metagRoot

F494546

General Info

Members	Datasets	Scaffolds	Average Seq Length
1522	758	1254	307

Family's Representative Sequence

Representative Sequence	3300050493\|nmdc:mga0k408_28398_c1\|nmdc:mga0k408_28398_c1_1480_2610
Length	376
Sequence	VILSTGKLASDGNGAFFRIKPNPVSVDSAFGLDRDLGPLYRDDQQAASRDDPRRAPPLGEDFMSRMSPTEMARQLGGGLLSFPVTHFDDQHQFLEAPYREHCGWMLERDLAGLFAAGGTGEFFSLRPQEVGQVVRAAVAETAGKIPVIAGCGYGTAIATDLARDAEAAGADGVLLLPPYLTNATQDGLAGHIEAVCRSTRLGVIVYNRDNAIINEDTLEQLCDRNPNLVGFKDGVGDLELMMRVYARMGDRLTYIGGLPTAETFALPYLEMGVTTYSSAIFNFLPEWALSFYQAVRARDRDTVMAGLRDFVLPYISLRNRGKGYAVSIVKAGMKAIGRDAGPVRLPLTELTSAELGELQALIARVQPGDQRRAAAG

Samples

	Sample ID	Description	Type	Environment
1	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
2	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
3	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
4	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
5	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
6	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
7	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
8	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
9	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
10	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
11	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
12	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
13	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
14	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
15	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
16	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
17	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
18	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
19	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
20	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
21	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
22	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
23	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
24	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
25	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
26	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
27	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
28	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
29	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
30	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
31	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
32	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
33	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
34	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
35	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
36	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
37	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
38	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
39	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
40	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
41	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
42	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
43	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
44	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
45	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
46	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
47	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
48	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
49	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
50	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
51	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
52	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
53	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
54	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
55	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
56	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
57	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
58	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
59	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
60	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
61	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
62	2643221622	Sphingomonas sp. Root241	Isolate	Unclassified
63	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
64	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
65	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
66	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
67	2643221733	Bosea sp. Root381	Isolate	Unclassified
68	2643221736	Bosea sp. Root483D1	Isolate	Unclassified
69	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
70	2718217882	Rhizobium sp. N741	Isolate	Nodule
71	2718217927	Rhizobium sp. N324	Isolate	Nodule
72	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
73	2718218009	Rhizobium sp. N561	Isolate	Nodule
74	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
75	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
76	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
77	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
78	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
79	2718218363	Rhizobium sp. N113	Isolate	Nodule
80	2718218365	Rhizobium sp. N731	Isolate	Nodule
81	2718218366	Rhizobium sp. N621	Isolate	Nodule
82	2718218423	Rhizobium sp. N941	Isolate	Nodule
83	2721755514	Rhizobium sp. N6212	Isolate	Nodule
84	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
85	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
86	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
87	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
88	2721755809	Rhizobium sp. N541	Isolate	Nodule
89	2721755810	Rhizobium sp. N871	Isolate	Nodule
90	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
91	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
92	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
93	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
94	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
95	2728369365	Rhizobium sp. N1341	Isolate	Nodule
96	2728369397	Rhizobium sp. N1314	Isolate	Nodule
97	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
98	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
99	2739367756	Asticcacaulis sp. CF398	Isolate	Unclassified
100	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
101	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
102	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
103	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
104	2791355199
105	2791355256	Rhizobium sp. M10	Isolate	Nodule
106	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
107	2791355260	Rhizobium sp. L9	Isolate	Nodule
108	2791355261	Rhizobium sp. J15	Isolate	Nodule
109	2791355262	Rhizobium sp. M1	Isolate	Nodule
110	2791355263	Rhizobium chutanense C5	Isolate	Nodule
111	2791355264	Rhizobium sp. S9	Isolate	Nodule
112	2791355265	Rhizobium sp. H4	Isolate	Nodule
113	2791355266	Rhizobium sp. L43	Isolate	Nodule
114	2791355267	Rhizobium sp. L18	Isolate	Nodule
115	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
116	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
117	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
118	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
119	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
120	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
121	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
122	2818991435	Caulobacter henricii 536	Isolate	Unclassified
123	2818991438	Novosphingobium barchaimii 1192	Isolate	Unclassified
124	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
125	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
126	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
127	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
128	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
129	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
130	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
131	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
132	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
133	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
134	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
135	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
136	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
137	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
138	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
139	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
140	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
141	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
142	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
143	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
144	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
145	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
146	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
147	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
148	2841911363	Bosea caraganae RCAM04685	Isolate	Nodule
149	2841917233	Bosea caraganae RCAM04680	Isolate	Nodule
150	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
151	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
152	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
153	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
154	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
155	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
156	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
157	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
158	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
159	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
160	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
161	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
162	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
163	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
164	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
165	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
166	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
167	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
168	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
169	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
170	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
171	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
172	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
173	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
174	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
175	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
176	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
177	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
178	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
179	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
180	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
181	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
182	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
183	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
184	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
185	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
186	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
187	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
188	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
189	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
190	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
191	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
192	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
193	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
194	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
195	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
196	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
197	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
198	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
199	2849560528	Caulobacter zeae 410	Isolate	Unclassified
200	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
201	2851153111	Caulobacter radicis 736	Isolate	Unclassified
202	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
203	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
204	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
205	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
206	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
207	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
208	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
209	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
210	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
211	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
212	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
213	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
214	2928972540	Brevundimonas sp. 1080	Isolate	Rhizosphere
215	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
216	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
217	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
218	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
219	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
220	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
221	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
222	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
223	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
224	2946033335	Microbacterium sp. W4I4	Isolate	Rhizosphere
225	2977240413	Brevundimonas vesicularis SORGH_AS 431	Isolate	Unclassified
226	2996893221	Rhizobium sp. R635	Isolate	Nodule
227	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
228	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
229	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
230	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
231	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
232	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
233	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
234	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
235	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
236	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
237	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
238	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
239	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
240	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
241	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
242	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
243	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
244	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
245	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
246	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
247	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
248	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
249	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
250	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
251	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
252	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
253	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
254	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
255	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
256	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
257	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
258	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
259	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
260	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
261	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
262	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
263	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
264	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
265	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
266	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
267	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
268	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
269	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
270	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
271	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
272	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
273	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
274	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
275	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
276	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
277	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
278	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
279	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
280	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
281	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
282	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
283	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
284	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
285	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
286	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
287	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
288	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
289	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
290	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
291	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
292	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
293	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
294	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
295	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
296	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
297	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
298	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
299	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
300	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
301	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
302	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
303	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
304	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
305	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
306	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
307	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
308	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
309	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
310	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
311	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
312	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
313	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
314	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
315	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
316	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
317	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
318	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
319	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
320	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
321	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
322	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
323	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
324	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
325	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
326	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
327	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
328	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
329	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
330	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
331	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
332	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
333	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
334	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
335	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
336	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
337	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
338	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
339	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
340	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
341	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
342	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
343	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
344	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
345	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
346	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
347	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
348	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
349	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
350	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
351	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
352	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
353	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
354	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
355	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
356	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
357	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
358	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
359	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
360	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
361	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
362	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
363	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
364	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
365	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
366	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
367	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
368	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
369	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
370	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
371	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
372	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
373	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
374	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
375	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
376	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
377	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
378	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
379	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
380	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
381	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
382	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
383	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
384	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
385	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
386	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
387	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
388	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
389	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
390	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
391	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
392	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
393	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
442	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
445	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
446	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
448	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
451	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
452	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
453	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
454	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
455	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
456	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
457	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
458	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
459	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
460	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
461	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
462	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
463	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
464	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
465	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
466	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
467	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
468	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
469	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
470	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
471	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
472	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
473	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
474	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
475	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
476	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
477	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
478	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
479	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
480	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
481	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
482	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
483	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
484	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
485	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
486	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
487	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
488	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
489	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
490	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
491	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
492	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
493	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
494	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
495	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
496	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
497	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
498	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
499	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
500	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
501	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
502	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
503	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
504	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
505	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
506	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
507	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
508	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
509	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
510	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
511	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
512	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
513	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
514	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
515	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
516	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
517	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
518	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
519	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
520	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
521	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
522	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
523	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
524	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
525	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
526	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
527	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
528	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
529	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
530	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
531	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
532	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
533	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
534	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
535	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
536	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
537	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
538	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
539	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
540	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
541	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
542	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
543	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
544	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
545	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
546	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
547	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
548	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
549	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
550	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
551	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
552	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
553	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
554	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
555	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
556	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
557	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
558	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
559	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
560	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
561	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
562	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
563	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
564	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
565	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
566	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
567	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
568	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
569	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
570	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
571	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
572	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
573	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
574	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
575	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
576	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
577	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
578	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
579	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
580	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
581	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
582	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
583	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
584	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
585	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
586	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
587	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
588	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
589	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
590	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
591	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
592	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
593	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
594	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
595	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
596	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
597	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
598	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
599	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
600	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
601	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
602	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
603	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
604	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
605	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
606	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
607	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
608	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
609	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
610	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
611	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
612	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
613	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
614	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
615	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
616	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
617	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
618	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
619	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
620	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
621	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
622	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
623	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
624	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
625	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
626	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
627	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
628	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
629	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
630	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
631	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
632	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
633	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
634	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
635	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
636	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
637	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
638	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
639	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
640	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
641	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
642	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
643	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
644	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
645	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
646	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
647	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
648	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
649	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
650	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
651	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
652	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
653	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
654	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
655	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
656	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
657	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
658	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
659	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
660	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
661	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
662	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
663	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
664	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
665	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
666	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
667	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
668	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
669	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
670	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
671	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
672	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
673	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
674	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
675	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
676	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
677	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
678	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
679	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
680	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
681	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
682	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
683	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
684	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
685	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
686	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
687	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
688	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
689	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
690	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
691	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
692	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
693	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
694	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
695	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
696	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
697	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
698	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
699	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
700	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
701	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
702	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
703	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
704	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
705	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
706	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
707	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
708	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
709	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
710	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
711	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
712	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
713	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
714	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
715	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
716	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
717	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
718	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
719	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
720	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
721	8005258706	Rhizobium sp. R693	Isolate	Nodule
722	8005275841	Rhizobium sp. N4311	Isolate	Nodule
723	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
724	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
725	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
726	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
727	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
728	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
729	8005382845	Rhizobium sp. R634	Isolate	Nodule
730	8005395548	Rhizobium sp. R339	Isolate	Nodule
731	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
732	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
733	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
734	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
735	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
736	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
737	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
738	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
739	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
740	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
741	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
742	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
743	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
744	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
745	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
746	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
747	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
748	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
749	8018176218	Rhizobium sp. N122	Isolate	Nodule
750	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
751	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
752	8024501048	Rhizobium sp. H4	Isolate	Nodule
753	8056054917	Glycomyces luteolus NEAU-A15	Isolate	Rhizosphere
754	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
755	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
756	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
757	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule
758	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	82.12
Metatranscriptomes	0.33
Isolates	17.55

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.13
Nodule	12.29
Rhizoplane	1.45
Rhizosphere	62.22
Stem	0
Stem Tuber	0
Unclassified	9.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000002	3300001979	Bacteria	158865
2	JGI24739J22299_10014392	3300001989	Bacteria	2879
3	JGI24737J22298_10004506	3300001990	Bacteria	4850
4	JGI24735J21928_10000165	3300002067	Bacteria	23603
5	JGI24735J21928_10013507	3300002067	Bacteria	2566
6	JGI24738J21930_10000011	3300002075	Bacteria	37603
7	JGI25155J39150_1000021	3300002704	Bacteria	150730
8	JGI25156J39149_1000022	3300002705	Bacteria	150730
9	JGI25162J39368_1000144	3300002737	Bacteria	77232
10	JGI25162J39368_1000847	3300002737	Bacteria	20195
11	JGI25154J39366_1000048	3300002738	Bacteria	126252
12	JGI25157J39369_1000025	3300002741	Bacteria	150726
13	JGI25152J39213_1005348	3300002773	Bacteria	3772
14	JGI25150J39212_1000415	3300002774	Bacteria	19646
15	JGI25159J45721_1001463	3300002987	Bacteria	9739
16	JGI25151J46595_10000143	3300003187	Bacteria	95160
17	JGI25151J46595_10000238	3300003187	Bacteria	64884
18	JGI25165J46597_1000066	3300003214	Bacteria	199459
19	JGI25165J46597_1000075	3300003214	Bacteria	181212
20	JGI25165J46597_1001464	3300003214	Bacteria	12322
21	JGI25153J46596_10000158	3300003215	Bacteria	68367
22	JGI25153J46596_10000172	3300003215	Bacteria	64551
23	JGI25153J46596_10000679	3300003215	Bacteria	20744
24	JGI25153J46596_10003267	3300003215	Bacteria	9113
25	JGI25153J46596_10004883	3300003215	Bacteria	7129
26	JGI25153J46596_10017836	3300003215	Bacteria	2779
27	rootH1_10037045	3300003316	Bacteria	8068
28	rootH1_10072506	3300003316	Bacteria	4291
29	rootH2_10066627	3300003320	Bacteria	19117
30	rootL2_10004132	3300003322	Bacteria	41354
31	rootL2_10089696	3300003322	Bacteria	7437
32	JGI25160J50197_1001510	3300003354	Bacteria	11568
33	JGI25407J50210_10035012	3300003373	Bacteria	1294
34	JGI25161J50226_1000119	3300003374	Bacteria	58009
35	Ga0055539_1007632	3300003752	Bacteria	1366
36	Ga0055526_1000483	3300003771	Bacteria	31566
37	Ga0055526_1001371	3300003771	Bacteria	17456
38	Ga0055524_1009194	3300003775	Bacteria	4041
39	Ga0055524_1023151	3300003775	Bacteria	2007
40	Ga0055536_1001755	3300003781	Bacteria	12782
41	Ga0055536_1004635	3300003781	Bacteria	6958
42	Ga0055536_1041595	3300003781	Bacteria	1083
43	Ga0055528_1000106	3300003790	Bacteria	67208
44	Ga0055528_1010218	3300003790	Bacteria	3839
45	Ga0055528_1029019	3300003790	Bacteria	1510
46	Ga0055530_10000093	3300003791	Bacteria	77624
47	Ga0055530_10000104	3300003791	Bacteria	72163
48	Ga0055530_10005872	3300003791	Bacteria	5674
49	Ga0055530_10015292	3300003791	Bacteria	2513
50	Ga0055530_10043481	3300003791	Bacteria	1083
51	Ga0055540_1000103	3300003792	Bacteria	94710
52	Ga0055540_1005697	3300003792	Bacteria	5148
53	Ga0055531_10000016	3300003794	Bacteria	181898
54	Ga0055531_10000854	3300003794	Bacteria	25073
55	Ga0055531_10002106	3300003794	Bacteria	13680
56	Ga0055543_1001443	3300004625	Bacteria	9431
57	Ga0065165_1052495	3300005262	Bacteria	1151
58	Ga0070658_10000003	3300005327	Bacteria	465963
59	Ga0070658_10000081	3300005327	Bacteria	90275
60	Ga0070658_10002075	3300005327	Bacteria	16818
61	Ga0070658_10018096	3300005327	Bacteria	5636
62	Ga0070658_10025882	3300005327	Bacteria	4706
63	Ga0070658_10036254	3300005327	Bacteria	3975
64	Ga0070658_10110255	3300005327	Bacteria	2279
65	Ga0070658_10346301	3300005327	Bacteria	1271
66	Ga0070676_10002279	3300005328	Bacteria	9797
67	Ga0070683_100019909	3300005329	Bacteria	5965
68	Ga0070683_100073275	3300005329	Bacteria	3198
69	Ga0070690_100125256	3300005330	Bacteria	1729
70	Ga0068869_100007096	3300005334	Bacteria	7136
71	Ga0068869_100162525	3300005334	Bacteria	1739
72	Ga0068869_100213401	3300005334	Bacteria	1527
73	Ga0070666_10015392	3300005335	Bacteria	4878
74	Ga0070666_10019567	3300005335	Bacteria	4371
75	Ga0070666_10140757	3300005335	Bacteria	1680
76	Ga0070666_10180666	3300005335	Unclassified	1480
77	Ga0068868_100013220	3300005338	Bacteria	6047
78	Ga0068868_100051972	3300005338	Bacteria	3225
79	Ga0070660_100000449	3300005339	Bacteria	27407
80	Ga0070660_100002185	3300005339	Bacteria	13477
81	Ga0070660_100007420	3300005339	Bacteria	7640
82	Ga0070660_100038671	3300005339	Bacteria	3623
83	Ga0070660_100052759	3300005339	Bacteria	3135
84	Ga0070660_100168217	3300005339	Bacteria	1769
85	Ga0070689_100018669	3300005340	Bacteria	5114
86	Ga0070661_100017899	3300005344	Bacteria	5031
87	Ga0070661_100037519	3300005344	Bacteria	3525
88	Ga0070661_100133249	3300005344	Bacteria	1868
89	Ga0070668_100117307	3300005347	Bacteria	2124
90	Ga0070668_100197846	3300005347	Bacteria	1649
91	Ga0070669_100377769	3300005353	Bacteria	1155
92	Ga0070675_100033923	3300005354	Bacteria	4139
93	Ga0070674_100002676	3300005356	Bacteria	9865
94	Ga0070674_100019420	3300005356	Bacteria	4316
95	Ga0070674_100027739	3300005356	Bacteria	3713
96	Ga0070674_100356774	3300005356	Bacteria	1182
97	Ga0070673_100031892	3300005364	Bacteria	3960
98	Ga0070673_100042276	3300005364	Bacteria	3513
99	Ga0070688_100092352	3300005365	Bacteria	1980
100	Ga0070659_100000196	3300005366	Bacteria	46609
101	Ga0070659_100014093	3300005366	Bacteria	5967
102	Ga0070659_100018741	3300005366	Bacteria	5224
103	Ga0070659_100038782	3300005366	Bacteria	3717
104	Ga0070659_100071639	3300005366	Bacteria	2756
105	Ga0070659_100178504	3300005366	Bacteria	1742
106	Ga0070667_100012949	3300005367	Bacteria	6896
107	Ga0070667_100065561	3300005367	Bacteria	3084
108	Ga0070667_100169211	3300005367	Bacteria	1928
109	Ga0070667_100201647	3300005367	Bacteria	1765
110	Ga0070714_100118700	3300005435	Unclassified	2350
111	Ga0070713_100007701	3300005436	Bacteria	7580
112	Ga0070701_10169210	3300005438	Bacteria	1271
113	Ga0070700_100004967	3300005441	Bacteria	7001
114	Ga0070663_100246887	3300005455	Bacteria	1411
115	Ga0070663_100368885	3300005455	Bacteria	1166
116	Ga0070678_100128043	3300005456	Bacteria	2013
117	Ga0070678_100146253	3300005456	Bacteria	1898
118	Ga0070678_100330057	3300005456	Bacteria	1305
119	Ga0070678_100442527	3300005456	Bacteria	1137
120	Ga0070662_100029021	3300005457	Bacteria	3857
121	Ga0070662_100055602	3300005457	Bacteria	2872
122	Ga0070662_100073063	3300005457	Bacteria	2534
123	Ga0070662_100155934	3300005457	Bacteria	1782
124	Ga0070681_10021886	3300005458	Bacteria	6412
125	Ga0070681_10262927	3300005458	Bacteria	1637
126	Ga0070681_10390666	3300005458	Bacteria	1302
127	Ga0068867_100006410	3300005459	Bacteria	8311
128	Ga0070685_10012932	3300005466	Bacteria	4394
129	Ga0070685_10089343	3300005466	Bacteria	1862
130	Ga0070707_100021157	3300005468	Bacteria	6146
131	Ga0070679_100001140	3300005530	Bacteria	23233
132	Ga0070679_100025175	3300005530	Bacteria	5837
133	Ga0070679_100034911	3300005530	Bacteria	4987
134	Ga0070679_100043528	3300005530	Bacteria	4471
135	Ga0070679_100074442	3300005530	Bacteria	3387
136	Ga0070679_100238563	3300005530	Bacteria	1776
137	Ga0070679_100260812	3300005530	Bacteria	1688
138	Ga0070679_100427549	3300005530	Bacteria	1270
139	Ga0070684_100127378	3300005535	Bacteria	2294
140	Ga0068853_100004071	3300005539	Bacteria	11257
141	Ga0068853_100018983	3300005539	Bacteria	5696
142	Ga0068853_100019888	3300005539	Bacteria	5576
143	Ga0068853_100068650	3300005539	Bacteria	3082
144	Ga0068853_100206453	3300005539	Bacteria	1789
145	Ga0068853_100366071	3300005539	Bacteria	1344
146	Ga0070672_100003865	3300005543	Bacteria	9751
147	Ga0070686_100000912	3300005544	Bacteria	17117
148	Ga0070695_100012314	3300005545	Bacteria	5129
149	Ga0070693_100087647	3300005547	Bacteria	1870
150	Ga0070665_100000366	3300005548	Bacteria	67633
151	Ga0070665_100003453	3300005548	Bacteria	16839
152	Ga0070665_100010636	3300005548	Bacteria	9313
153	Ga0070665_100054006	3300005548	Bacteria	4030
154	Ga0070665_100212557	3300005548	Bacteria	1935
155	Ga0070665_100217400	3300005548	Bacteria	1912
156	Ga0070665_100370414	3300005548	Bacteria	1439
157	Ga0068855_100001505	3300005563	Bacteria	29183
158	Ga0068855_100001607	3300005563	Bacteria	28372
159	Ga0068855_100001891	3300005563	Bacteria	25987
160	Ga0068855_100020901	3300005563	Bacteria	7849
161	Ga0068855_100036087	3300005563	Bacteria	5885
162	Ga0068855_100053629	3300005563	Bacteria	4743
163	Ga0068855_100068282	3300005563	Bacteria	4139
164	Ga0068855_100129708	3300005563	Bacteria	2880
165	Ga0068855_100370385	3300005563	Bacteria	1575
166	Ga0068857_100148572	3300005577	Bacteria	2122
167	Ga0068854_100000003	3300005578	Bacteria	330045
168	Ga0068854_100000332	3300005578	Bacteria	30937
169	Ga0068854_100004451	3300005578	Bacteria	8836
170	Ga0068854_100481847	3300005578	Bacteria	1042
171	Ga0068856_100009012	3300005614	Bacteria	9708
172	Ga0068856_100091377	3300005614	Bacteria	3028
173	Ga0068856_100098423	3300005614	Bacteria	2915
174	Ga0068856_100116364	3300005614	Bacteria	2674
175	Ga0068856_100193529	3300005614	Bacteria	2047
176	Ga0068856_100335682	3300005614	Bacteria	1529
177	Ga0068856_100413849	3300005614	Bacteria	1368
178	Ga0068852_100000112	3300005616	Bacteria	54817
179	Ga0068852_100004184	3300005616	Bacteria	10169
180	Ga0068852_100024450	3300005616	Bacteria	4882
181	Ga0068852_100264703	3300005616	Bacteria	1652
182	Ga0068852_100293895	3300005616	Bacteria	1570
183	Ga0068859_100000181	3300005617	Bacteria	61904
184	Ga0068859_100002609	3300005617	Bacteria	18330
185	Ga0068859_100105871	3300005617	Bacteria	2872
186	Ga0068859_100316957	3300005617	Bacteria	1653
187	Ga0068859_100487501	3300005617	Bacteria	1328
188	Ga0068864_100210631	3300005618	Bacteria	1789
189	Ga0068864_100296140	3300005618	Bacteria	1514
190	Ga0068866_10113415	3300005718	Bacteria	1516
191	Ga0068861_100000001	3300005719	Bacteria	116118
192	Ga0068861_100013657	3300005719	Bacteria	5686
193	Ga0068851_10042156	3300005834	Bacteria	2297
194	Ga0068851_10051249	3300005834	Bacteria	2097
195	Ga0068851_10091425	3300005834	Bacteria	1602
196	Ga0068851_10140175	3300005834	Bacteria	1314
197	Ga0068870_10012019	3300005840	Bacteria	4032
198	Ga0068870_10022210	3300005840	Bacteria	3116
199	Ga0068863_100005995	3300005841	Bacteria	11915
200	Ga0068863_100010675	3300005841	Bacteria	8918
201	Ga0068863_100015163	3300005841	Bacteria	7403
202	Ga0068858_100001503	3300005842	Bacteria	23984
203	Ga0068858_100010168	3300005842	Bacteria	8931
204	Ga0068858_100214145	3300005842	Bacteria	1823
205	Ga0068860_100000626	3300005843	Bacteria	41822
206	Ga0068860_100002486	3300005843	Bacteria	19339
207	Ga0068860_100033163	3300005843	Bacteria	4957
208	Ga0068862_100044476	3300005844	Bacteria	3788
209	Ga0068862_100369111	3300005844	Bacteria	1335
210	Ga0081538_10001432	3300005981	Bacteria	24526
211	Ga0081539_10002538	3300005985	Bacteria	25414
212	Ga0081539_10026488	3300005985	Bacteria	3699
213	Ga0070717_10235152	3300006028	Bacteria	1614
214	Ga0075365_10021689	3300006038	Bacteria	4011
215	Ga0075365_10051173	3300006038	Bacteria	2727
216	Ga0075368_10000293	3300006042	Bacteria	14382
217	Ga0075363_100022916	3300006048	Bacteria	3161
218	Ga0070715_10017367	3300006163	Bacteria	2723
219	Ga0070712_100027643	3300006175	Bacteria	3789
220	Ga0075362_10002938	3300006177	Bacteria	5848
221	Ga0075362_10020189	3300006177	Bacteria	2781
222	Ga0075362_10034538	3300006177	Bacteria	2205
223	Ga0075367_10009892	3300006178	Bacteria	4995
224	Ga0075367_10029801	3300006178	Bacteria	3124
225	Ga0075369_10035431	3300006186	Bacteria	2121
226	Ga0075369_10050772	3300006186	Bacteria	1794
227	Ga0075369_10055125	3300006186	Bacteria	1727
228	Ga0075366_10003686	3300006195	Bacteria	8128
229	Ga0075366_10126625	3300006195	Bacteria	1540
230	Ga0097621_100000026	3300006237	Bacteria	73891
231	Ga0097621_100011038	3300006237	Bacteria	6639
232	Ga0097621_100078531	3300006237	Bacteria	2742
233	Ga0075370_10002779	3300006353	Bacteria	8201
234	Ga0075370_10033845	3300006353	Bacteria	2863
235	Ga0075370_10110655	3300006353	Bacteria	1595
236	Ga0068871_100000173	3300006358	Bacteria	43382
237	Ga0068871_100033725	3300006358	Bacteria	4056
238	Ga0068871_100040431	3300006358	Bacteria	3735
239	Ga0068871_100058229	3300006358	Bacteria	3145
240	Ga0075428_100069649	3300006844	Bacteria	3845
241	Ga0075430_100072583	3300006846	Bacteria	2887
242	Ga0075433_10013215	3300006852	Bacteria	6703
243	Ga0075434_100076105	3300006871	Bacteria	3351
244	Ga0075434_100274336	3300006871	Bacteria	1706
245	Ga0068865_100039104	3300006881	Bacteria	3216
246	Ga0068865_100137170	3300006881	Bacteria	1840
247	Ga0097620_100000181	3300006931	Bacteria	61904
248	Ga0097620_100002609	3300006931	Bacteria	18330
249	Ga0097620_100105871	3300006931	Bacteria	2872
250	Ga0097620_100316966	3300006931	Bacteria	1653
251	Ga0097620_100487558	3300006931	Bacteria	1328
252	Ga0075435_100038427	3300007076	Bacteria	3816
253	Ga0105240_10000156	3300009093	Bacteria	139950
254	Ga0105240_10000214	3300009093	Bacteria	117038
255	Ga0105240_10000818	3300009093	Bacteria	56550
256	Ga0105240_10000989	3300009093	Bacteria	50717
257	Ga0105240_10002361	3300009093	Bacteria	30432
258	Ga0105240_10037153	3300009093	Bacteria	6260
259	Ga0105240_10091182	3300009093	Bacteria	3724
260	Ga0105240_10098553	3300009093	Bacteria	3559
261	Ga0105240_10115371	3300009093	Bacteria	3242
262	Ga0105240_10170653	3300009093	Bacteria	2577
263	Ga0105240_10227780	3300009093	Bacteria	2168
264	Ga0105247_10004305	3300009101	Bacteria	9104
265	Ga0114129_10042066	3300009147	Bacteria	6434
266	Ga0114129_10298267	3300009147	Bacteria	2149
267	Ga0105241_10009827	3300009174	Bacteria	7031
268	Ga0105241_10046535	3300009174	Bacteria	3295
269	Ga0105241_10186601	3300009174	Bacteria	1724
270	Ga0105241_10212064	3300009174	Bacteria	1623
271	Ga0105241_10305543	3300009174	Bacteria	1366
272	Ga0105241_10358361	3300009174	Bacteria	1268
273	Ga0105242_10015493	3300009176	Bacteria	5920
274	Ga0105242_10036511	3300009176	Bacteria	3943
275	Ga0105242_10042761	3300009176	Bacteria	3661
276	Ga0105248_10011870	3300009177	Bacteria	9611
277	Ga0105248_10059953	3300009177	Bacteria	4274
278	Ga0105237_10000325	3300009545	Bacteria	67280
279	Ga0105237_10002620	3300009545	Bacteria	22150
280	Ga0105237_10007004	3300009545	Bacteria	12423
281	Ga0105237_10095817	3300009545	Bacteria	2957
282	Ga0105238_10015423	3300009551	Bacteria	7731
283	Ga0105238_10019896	3300009551	Bacteria	6832
284	Ga0105238_10022017	3300009551	Bacteria	6495
285	Ga0105238_10058822	3300009551	Bacteria	3852
286	Ga0105238_10082438	3300009551	Bacteria	3206
287	Ga0105238_10085871	3300009551	Bacteria	3134
288	Ga0105238_10093547	3300009551	Bacteria	2994
289	Ga0105238_10103013	3300009551	Bacteria	2836
290	Ga0105238_10118064	3300009551	Bacteria	2633
291	Ga0105238_10223844	3300009551	Bacteria	1858
292	Ga0105238_10295240	3300009551	Bacteria	1604
293	Ga0105238_10549761	3300009551	Bacteria	1159
294	Ga0105249_10005328	3300009553	Bacteria	11099
295	Ga0105249_10188572	3300009553	Bacteria	2011
296	Ga0123341_1000095	3300009765	Bacteria	37499
297	Ga0123342_1016923	3300009766	Bacteria	6209
298	Ga0123342_1022764	3300009766	Bacteria	4188
299	Ga0105239_10000031	3300010375	Bacteria	226947
300	Ga0105239_10000118	3300010375	Bacteria	112168
301	Ga0105239_10034191	3300010375	Bacteria	5581
302	Ga0105239_10352708	3300010375	Bacteria	1661
303	Ga0105239_10353886	3300010375	Bacteria	1658
304	Ga0105239_10734918	3300010375	Bacteria	1129
305	Ga0105246_10011976	3300011119	Bacteria	5400
306	Ga0105246_10060056	3300011119	Bacteria	2640
307	Ga0157373_10035964	3300013100	Bacteria	3555
308	Ga0157373_10114737	3300013100	Bacteria	1894
309	Ga0157373_10127447	3300013100	Bacteria	1790
310	Ga0157371_10101145	3300013102	Bacteria	2045
311	Ga0157370_10001189	3300013104	Bacteria	32466
312	Ga0157370_10005411	3300013104	Bacteria	14324
313	Ga0157370_10011933	3300013104	Bacteria	9059
314	Ga0157370_10028916	3300013104	Bacteria	5446
315	Ga0157370_10040227	3300013104	Unclassified	4514
316	Ga0157370_10047187	3300013104	Bacteria	4129
317	Ga0157370_10070950	3300013104	Bacteria	3287
318	Ga0157370_10141578	3300013104	Bacteria	2241
319	Ga0157370_10230352	3300013104	Bacteria	1715
320	Ga0157370_10246827	3300013104	Bacteria	1651
321	Ga0157370_10397112	3300013104	Bacteria	1269
322	Ga0157369_10000394	3300013105	Bacteria	58143
323	Ga0157369_10000559	3300013105	Bacteria	48965
324	Ga0157369_10002287	3300013105	Bacteria	23050
325	Ga0157369_10008095	3300013105	Bacteria	12053
326	Ga0157369_10009564	3300013105	Bacteria	11089
327	Ga0157369_10040827	3300013105	Bacteria	5065
328	Ga0157369_10064441	3300013105	Bacteria	3947
329	Ga0157369_10240330	3300013105	Bacteria	1892
330	Ga0157369_10244295	3300013105	Bacteria	1874
331	Ga0157369_10291574	3300013105	Bacteria	1698
332	Ga0157369_10698775	3300013105	Bacteria	1044
333	Ga0157374_10000126	3300013296	Bacteria	69928
334	Ga0157374_10022682	3300013296	Bacteria	5602
335	Ga0157374_10028793	3300013296	Bacteria	5021
336	Ga0157374_10138923	3300013296	Bacteria	2357
337	Ga0157374_10185768	3300013296	Bacteria	2032
338	Ga0157378_10113601	3300013297	Bacteria	2487
339	Ga0157378_10181558	3300013297	Bacteria	1980
340	Ga0157378_10198529	3300013297	Bacteria	1896
341	Ga0163162_10010939	3300013306	Bacteria	8834
342	Ga0163162_10018105	3300013306	Bacteria	6895
343	Ga0163162_10026191	3300013306	Bacteria	5764
344	Ga0163162_10053567	3300013306	Bacteria	4055
345	Ga0163162_10054544	3300013306	Bacteria	4021
346	Ga0163162_10106422	3300013306	Bacteria	2900
347	Ga0163162_10221972	3300013306	Bacteria	2020
348	Ga0157372_10000580	3300013307	Bacteria	39970
349	Ga0157372_10004795	3300013307	Bacteria	14367
350	Ga0157372_10009510	3300013307	Bacteria	10336
351	Ga0157372_10009728	3300013307	Bacteria	10225
352	Ga0157372_10017389	3300013307	Bacteria	7718
353	Ga0157372_10063722	3300013307	Bacteria	4134
354	Ga0157372_10098781	3300013307	Bacteria	3330
355	Ga0157372_10115057	3300013307	Bacteria	3083
356	Ga0157372_10136731	3300013307	Bacteria	2823
357	Ga0157375_10262734	3300013308	Bacteria	1888
358	Ga0157375_10624214	3300013308	Bacteria	1236
359	Ga0163163_10000090	3300014325	Bacteria	97441
360	Ga0163163_10006727	3300014325	Bacteria	10077
361	Ga0163163_10012221	3300014325	Bacteria	7815
362	Ga0163163_10100649	3300014325	Bacteria	2912
363	Ga0157380_10017472	3300014326	Bacteria	5308
364	Ga0157379_10012446	3300014968	Bacteria	7429
365	Ga0157379_10017685	3300014968	Bacteria	6280
366	Ga0157376_10032060	3300014969	Bacteria	4215
367	Ga0157376_10108550	3300014969	Bacteria	2438
368	Ga0182007_10008968	3300015262	Bacteria	4073
369	Ga0206356_10029665	3300020070	Bacteria	1505
370	Ga0206351_10046886	3300020077	Bacteria	1432
371	Ga0206350_10090852	3300020080	Bacteria	1507
372	Ga0154015_1656200	3300020610	Bacteria	5282
373	Ga0213872_10001965	3300021361	Bacteria	12537
374	Ga0213876_10000873	3300021384	Bacteria	20190
375	Ga0213876_10141786	3300021384	Bacteria	1278
376	Ga0224712_10008964	3300022467	Bacteria	2992
377	Ga0209435_100033	3300025206	Bacteria	150395
378	Ga0209436_100017	3300025208	Bacteria	116238
379	Ga0209147_100302	3300025229	Bacteria	40451
380	Ga0209437_100131	3300025233	Bacteria	181264
381	Ga0209437_100239	3300025233	Bacteria	89942
382	Ga0207425_1000019	3300025245	Bacteria	399942
383	Ga0207425_1000475	3300025245	Bacteria	25473
384	Ga0207425_1007921	3300025245	Bacteria	2761
385	Ga0209646_1000116	3300025246	Bacteria	150395
386	Ga0209646_1004631	3300025246	Bacteria	2484
387	Ga0209026_1000103	3300025250	Bacteria	152843
388	Ga0209677_100457	3300025253	Bacteria	23626
389	Ga0209677_103558	3300025253	Bacteria	4965
390	Ga0209759_1000105	3300025256	Bacteria	150395
391	Ga0209129_1000474	3300025258	Bacteria	29449
392	Ga0209129_1001388	3300025258	Bacteria	13539
393	Ga0209129_1002155	3300025258	Bacteria	9969
394	Ga0209129_1002928	3300025258	Bacteria	7823
395	Ga0209233_1000045	3300025261	Bacteria	473379
396	Ga0209233_1000132	3300025261	Bacteria	203971
397	Ga0209233_1000214	3300025261	Bacteria	108975
398	Ga0209233_1000245	3300025261	Bacteria	89961
399	Ga0209233_1001685	3300025261	Bacteria	8583
400	Ga0209455_1003956	3300025272	Bacteria	5031
401	Ga0209455_1005119	3300025272	Bacteria	4123
402	Ga0209455_1009546	3300025272	Bacteria	2539
403	Ga0209455_1009665	3300025272	Bacteria	2513
404	Ga0209673_1000139	3300025273	Bacteria	157765
405	Ga0209673_1005362	3300025273	Bacteria	6477
406	Ga0209673_1005469	3300025273	Bacteria	6370
407	Ga0209673_1008944	3300025273	Bacteria	4400
408	Ga0209673_1012134	3300025273	Bacteria	3494
409	Ga0209673_1012136	3300025273	Bacteria	3494
410	Ga0209130_1000001	3300025284	Bacteria	831557
411	Ga0209130_1000160	3300025284	Bacteria	100965
412	Ga0209675_1000188	3300025291	Bacteria	68178
413	Ga0209676_1000593	3300025292	Bacteria	54046
414	Ga0209676_1000908	3300025292	Bacteria	37192
415	Ga0209676_1002103	3300025292	Bacteria	15342
416	Ga0209025_1000237	3300025294	Bacteria	128553
417	Ga0209025_1000299	3300025294	Bacteria	110988
418	Ga0209025_1000559	3300025294	Bacteria	68241
419	Ga0209025_1007609	3300025294	Bacteria	8022
420	Ga0209025_1053061	3300025294	Bacteria	1595
421	Ga0209564_1000331	3300025295	Bacteria	91919
422	Ga0209564_1003107	3300025295	Bacteria	11742
423	Ga0209564_1010270	3300025295	Bacteria	4335
424	Ga0209758_1000007	3300025297	Bacteria	1270410
425	Ga0209758_1000008	3300025297	Bacteria	1215263
426	Ga0209758_1000019	3300025297	Bacteria	743682
427	Ga0209758_1000931	3300025297	Bacteria	39600
428	Ga0209758_1001313	3300025297	Bacteria	30267
429	Ga0209758_1001568	3300025297	Bacteria	26208
430	Ga0209758_1005602	3300025297	Bacteria	9551
431	Ga0209758_1012937	3300025297	Bacteria	4609
432	Ga0209758_1022587	3300025297	Bacteria	2876
433	Ga0209758_1026398	3300025297	Bacteria	2514
434	Ga0209758_1051704	3300025297	Bacteria	1428
435	Ga0209050_1000026	3300025298	Bacteria	499134
436	Ga0209050_1000115	3300025298	Bacteria	204622
437	Ga0209050_1000853	3300025298	Bacteria	41533
438	Ga0209050_1000935	3300025298	Bacteria	38200
439	Ga0209050_1002019	3300025298	Bacteria	18917
440	Ga0209050_1005189	3300025298	Bacteria	8331
441	Ga0209050_1033503	3300025298	Bacteria	1556
442	Ga0209050_1049174	3300025298	Bacteria	1083
443	Ga0209256_1000299	3300025299	Bacteria	86909
444	Ga0209256_1003540	3300025299	Bacteria	10849
445	Ga0209256_1009365	3300025299	Bacteria	4312
446	Ga0209256_1011492	3300025299	Bacteria	3531
447	Ga0209256_1048129	3300025299	Bacteria	1045
448	Ga0207426_1000005	3300025302	Bacteria	1037188
449	Ga0207426_1000098	3300025302	Bacteria	264264
450	Ga0207426_1000290	3300025302	Bacteria	99519
451	Ga0209051_1000095	3300025303	Bacteria	167840
452	Ga0209051_1000950	3300025303	Bacteria	28418
453	Ga0209051_1004295	3300025303	Bacteria	8861
454	Ga0209051_1050232	3300025303	Bacteria	1398
455	Ga0209257_1000009	3300025304	Bacteria	1205047
456	Ga0209257_1000160	3300025304	Bacteria	177175
457	Ga0209257_1000259	3300025304	Bacteria	122101
458	Ga0209257_1000395	3300025304	Bacteria	86373
459	Ga0209257_1000532	3300025304	Bacteria	66089
460	Ga0209257_1003744	3300025304	Bacteria	12591
461	Ga0209257_1015710	3300025304	Bacteria	3126
462	Ga0207710_10000380	3300025900	Bacteria	30562
463	Ga0207710_10015491	3300025900	Bacteria	3223
464	Ga0207680_10014304	3300025903	Bacteria	4101
465	Ga0207680_10119367	3300025903	Bacteria	1722
466	Ga0207647_10000956	3300025904	Bacteria	22344
467	Ga0207647_10003136	3300025904	Bacteria	12416
468	Ga0207647_10020577	3300025904	Bacteria	4421
469	Ga0207647_10076573	3300025904	Bacteria	2012
470	Ga0207685_10010120	3300025905	Bacteria	2769
471	Ga0207685_10062204	3300025905	Bacteria	1482
472	Ga0207645_10009089	3300025907	Bacteria	6893
473	Ga0207645_10073887	3300025907	Bacteria	2183
474	Ga0207643_10002770	3300025908	Bacteria	9466
475	Ga0207705_10000005	3300025909	Bacteria	673478
476	Ga0207705_10000157	3300025909	Bacteria	73563
477	Ga0207705_10002775	3300025909	Bacteria	13385
478	Ga0207705_10002880	3300025909	Bacteria	13167
479	Ga0207705_10004616	3300025909	Bacteria	10398
480	Ga0207705_10006803	3300025909	Bacteria	8447
481	Ga0207705_10017552	3300025909	Bacteria	5124
482	Ga0207705_10024490	3300025909	Bacteria	4307
483	Ga0207705_10031181	3300025909	Bacteria	3803
484	Ga0207705_10102573	3300025909	Bacteria	2106
485	Ga0207654_10037805	3300025911	Bacteria	2704
486	Ga0207707_10039109	3300025912	Bacteria	4146
487	Ga0207707_10150589	3300025912	Bacteria	2034
488	Ga0207695_10000250	3300025913	Bacteria	139984
489	Ga0207695_10000373	3300025913	Bacteria	101687
490	Ga0207695_10001582	3300025913	Bacteria	37107
491	Ga0207695_10002708	3300025913	Bacteria	25849
492	Ga0207695_10021901	3300025913	Bacteria	7275
493	Ga0207695_10056921	3300025913	Bacteria	4065
494	Ga0207695_10061675	3300025913	Bacteria	3875
495	Ga0207695_10141395	3300025913	Bacteria	2355
496	Ga0207695_10334345	3300025913	Bacteria	1403
497	Ga0207671_10000100	3300025914	Bacteria	131821
498	Ga0207671_10000448	3300025914	Bacteria	56985
499	Ga0207671_10003757	3300025914	Bacteria	14948
500	Ga0207671_10054011	3300025914	Bacteria	2977
501	Ga0207671_10159144	3300025914	Bacteria	1748
502	Ga0207671_10197078	3300025914	Bacteria	1572
503	Ga0207693_10118491	3300025915	Unclassified	2079
504	Ga0207657_10000820	3300025919	Bacteria	32824
505	Ga0207657_10006940	3300025919	Bacteria	11670
506	Ga0207657_10008113	3300025919	Bacteria	10708
507	Ga0207657_10013818	3300025919	Bacteria	7901
508	Ga0207657_10064850	3300025919	Bacteria	3116
509	Ga0207657_10244309	3300025919	Bacteria	1432
510	Ga0207649_10222902	3300025920	Bacteria	1344
511	Ga0207649_10280376	3300025920	Bacteria	1211
512	Ga0207652_10009611	3300025921	Bacteria	7780
513	Ga0207652_10042018	3300025921	Bacteria	3889
514	Ga0207652_10110653	3300025921	Bacteria	2436
515	Ga0207652_10312600	3300025921	Bacteria	1418
516	Ga0207681_10019150	3300025923	Bacteria	4322
517	Ga0207694_10012226	3300025924	Bacteria	6470
518	Ga0207694_10020711	3300025924	Bacteria	4979
519	Ga0207694_10090012	3300025924	Bacteria	2421
520	Ga0207694_10099691	3300025924	Bacteria	2301
521	Ga0207694_10285624	3300025924	Bacteria	1356
522	Ga0207694_10286376	3300025924	Bacteria	1354
523	Ga0207650_10074024	3300025925	Bacteria	2567
524	Ga0207650_10140882	3300025925	Bacteria	1896
525	Ga0207687_10036136	3300025927	Bacteria	3364
526	Ga0207700_10005505	3300025928	Bacteria	7592
527	Ga0207664_10229336	3300025929	Bacteria	1614
528	Ga0207644_10028048	3300025931	Bacteria	3893
529	Ga0207644_10138988	3300025931	Bacteria	1869
530	Ga0207690_10001287	3300025932	Bacteria	15850
531	Ga0207690_10001721	3300025932	Bacteria	13452
532	Ga0207690_10027423	3300025932	Bacteria	3599
533	Ga0207690_10034877	3300025932	Bacteria	3245
534	Ga0207690_10174744	3300025932	Bacteria	1612
535	Ga0207690_10374316	3300025932	Bacteria	1130
536	Ga0207706_10005670	3300025933	Bacteria	11636
537	Ga0207706_10006568	3300025933	Bacteria	10770
538	Ga0207706_10055351	3300025933	Bacteria	3499
539	Ga0207686_10026723	3300025934	Bacteria	3371
540	Ga0207686_10030086	3300025934	Bacteria	3211
541	Ga0207709_10062862	3300025935	Bacteria	2325
542	Ga0207709_10165883	3300025935	Bacteria	1545
543	Ga0207670_10317454	3300025936	Bacteria	1225
544	Ga0207669_10011411	3300025937	Bacteria	4322
545	Ga0207669_10026421	3300025937	Bacteria	3157
546	Ga0207669_10081171	3300025937	Bacteria	2076
547	Ga0207669_10108327	3300025937	Bacteria	1855
548	Ga0207704_10029315	3300025938	Bacteria	3067
549	Ga0207704_10057550	3300025938	Bacteria	2389
550	Ga0207691_10009476	3300025940	Bacteria	9351
551	Ga0207711_10006109	3300025941	Bacteria	10172
552	Ga0207711_10036911	3300025941	Bacteria	4147
553	Ga0207711_10308037	3300025941	Bacteria	1462
554	Ga0207711_10345719	3300025941	Bacteria	1377
555	Ga0207689_10014341	3300025942	Bacteria	6744
556	Ga0207689_10169024	3300025942	Bacteria	1802
557	Ga0207689_10226459	3300025942	Bacteria	1545
558	Ga0207661_10017470	3300025944	Bacteria	5311
559	Ga0207661_10069537	3300025944	Bacteria	2871
560	Ga0207661_10220784	3300025944	Bacteria	1675
561	Ga0207679_10335959	3300025945	Bacteria	1313
562	Ga0207667_10000006	3300025949	Bacteria	679876
563	Ga0207667_10000091	3300025949	Bacteria	148651
564	Ga0207667_10004871	3300025949	Bacteria	16395
565	Ga0207667_10017016	3300025949	Bacteria	8201
566	Ga0207667_10020411	3300025949	Bacteria	7368
567	Ga0207667_10027741	3300025949	Bacteria	6159
568	Ga0207667_10051186	3300025949	Bacteria	4355
569	Ga0207667_10067313	3300025949	Bacteria	3731
570	Ga0207667_10097137	3300025949	Bacteria	3041
571	Ga0207667_10181563	3300025949	Bacteria	2161
572	Ga0207667_10220498	3300025949	Bacteria	1943
573	Ga0207667_10308486	3300025949	Bacteria	1617
574	Ga0207651_10009459	3300025960	Bacteria	5339
575	Ga0207712_10411281	3300025961	Bacteria	1139
576	Ga0207712_10518683	3300025961	Bacteria	1021
577	Ga0207668_10026065	3300025972	Bacteria	3792
578	Ga0207668_10182882	3300025972	Bacteria	1655
579	Ga0207668_10219523	3300025972	Bacteria	1526
580	Ga0207640_10000002	3300025981	Bacteria	524211
581	Ga0207640_10000056	3300025981	Bacteria	94316
582	Ga0207640_10000527	3300025981	Bacteria	23072
583	Ga0207640_10000712	3300025981	Bacteria	19287
584	Ga0207640_10026103	3300025981	Bacteria	3543
585	Ga0207658_10002068	3300025986	Bacteria	14934
586	Ga0207658_10010673	3300025986	Bacteria	6244
587	Ga0207658_10012288	3300025986	Bacteria	5845
588	Ga0207658_10046905	3300025986	Bacteria	3159
589	Ga0207658_10176121	3300025986	Bacteria	1766
590	Ga0207658_10282378	3300025986	Bacteria	1424
591	Ga0207677_10029967	3300026023	Bacteria	3466
592	Ga0207677_10122092	3300026023	Bacteria	1962
593	Ga0207703_10000459	3300026035	Bacteria	42871
594	Ga0207703_10000655	3300026035	Bacteria	34701
595	Ga0207703_10015608	3300026035	Bacteria	5925
596	Ga0207703_10331448	3300026035	Bacteria	1396
597	Ga0207639_10000011	3300026041	Bacteria	381897
598	Ga0207639_10000038	3300026041	Bacteria	145316
599	Ga0207639_10002623	3300026041	Bacteria	12067
600	Ga0207639_10021443	3300026041	Bacteria	4641
601	Ga0207639_10144572	3300026041	Bacteria	1985
602	Ga0207639_10195085	3300026041	Bacteria	1732
603	Ga0207639_10296981	3300026041	Bacteria	1427
604	Ga0207639_10299362	3300026041	Bacteria	1421
605	Ga0207678_10001224	3300026067	Bacteria	23607
606	Ga0207678_10013803	3300026067	Bacteria	7098
607	Ga0207678_10031464	3300026067	Bacteria	4629
608	Ga0207678_10035279	3300026067	Bacteria	4355
609	Ga0207678_10134544	3300026067	Bacteria	2109
610	Ga0207678_10170711	3300026067	Bacteria	1857
611	Ga0207678_10420767	3300026067	Bacteria	1158
612	Ga0207708_10043109	3300026075	Bacteria	3439
613	Ga0207702_10020262	3300026078	Bacteria	5509
614	Ga0207702_10172757	3300026078	Bacteria	1983
615	Ga0207702_10254496	3300026078	Bacteria	1650
616	Ga0207702_10264454	3300026078	Bacteria	1621
617	Ga0207702_10406996	3300026078	Bacteria	1313
618	Ga0207641_10000211	3300026088	Bacteria	75479
619	Ga0207641_10084247	3300026088	Bacteria	2767
620	Ga0207641_10448762	3300026088	Bacteria	1246
621	Ga0207648_10022687	3300026089	Bacteria	5633
622	Ga0207648_10032454	3300026089	Bacteria	4610
623	Ga0207648_10075535	3300026089	Bacteria	2937
624	Ga0207676_10147984	3300026095	Bacteria	2019
625	Ga0207676_10281214	3300026095	Bacteria	1511
626	Ga0207674_10009067	3300026116	Bacteria	11425
627	Ga0207674_10021140	3300026116	Bacteria	7015
628	Ga0207674_10030367	3300026116	Bacteria	5682
629	Ga0207674_10046645	3300026116	Bacteria	4448
630	Ga0207674_10370453	3300026116	Bacteria	1384
631	Ga0207675_100000196	3300026118	Bacteria	55631
632	Ga0207675_100068192	3300026118	Bacteria	3325
633	Ga0207675_100073559	3300026118	Bacteria	3198
634	Ga0207675_100084529	3300026118	Bacteria	2978
635	Ga0207675_100292118	3300026118	Bacteria	1586
636	Ga0207683_10026272	3300026121	Bacteria	5025
637	Ga0207683_10489412	3300026121	Bacteria	1135
638	Ga0207698_10000507	3300026142	Bacteria	22643
639	Ga0207698_10064810	3300026142	Bacteria	2866
640	Ga0207698_10127374	3300026142	Bacteria	2168
641	Ga0207698_10438730	3300026142	Bacteria	1257
642	Ga0207698_10441813	3300026142	Bacteria	1253
643	Ga0209371_1004198	3300027312	Bacteria	6424
644	Ga0207428_10030117	3300027907	Bacteria	4489
645	Ga0268266_10000591	3300028379	Bacteria	50003
646	Ga0268266_10000848	3300028379	Bacteria	39835
647	Ga0268266_10000861	3300028379	Bacteria	39497
648	Ga0268266_10001728	3300028379	Bacteria	25005
649	Ga0268266_10024365	3300028379	Bacteria	5147
650	Ga0268266_10025874	3300028379	Bacteria	4992
651	Ga0268266_10030757	3300028379	Bacteria	4560
652	Ga0268266_10157600	3300028379	Bacteria	2052
653	Ga0268266_10225680	3300028379	Bacteria	1723
654	Ga0268266_10617054	3300028379	Bacteria	1042
655	Ga0268265_10061537	3300028380	Bacteria	2881
656	Ga0268264_10000047	3300028381	Bacteria	349944
657	Ga0268264_10000633	3300028381	Bacteria	41830
658	Ga0268264_10039463	3300028381	Bacteria	3901
659	Ga0307515_10000027	3300028794	Bacteria	371624
660	Ga0307515_10029370	3300028794	Bacteria	9295
661	Ga0307515_10031775	3300028794	Bacteria	8778
662	Ga0307515_10054677	3300028794	Bacteria	5854
663	Ga0307515_10085225	3300028794	Bacteria	4046
664	Ga0307515_10174586	3300028794	Bacteria	2125
665	Ga0265338_10003550	3300028800	Bacteria	21798
666	Ga0265338_10043006	3300028800	Bacteria	4198
667	Ga0268256_1003835	3300030500	Bacteria	6551
668	Ga0307511_10000659	3300030521	Bacteria	36822
669	Ga0307511_10102105	3300030521	Bacteria	1875
670	Ga0307512_10017605	3300030522	Bacteria	6548
671	Ga0265330_10048851	3300031235	Bacteria	1860
672	Ga0265332_10038097	3300031238	Bacteria	2084
673	Ga0265325_10003100	3300031241	Bacteria	10972
674	Ga0265340_10043104	3300031247	Bacteria	2213
675	Ga0265339_10037276	3300031249	Bacteria	2718
676	Ga0265339_10051037	3300031249	Bacteria	2259
677	Ga0265331_10063856	3300031250	Bacteria	1734
678	Ga0307513_10015966	3300031456	Bacteria	9083
679	Ga0307513_10021053	3300031456	Bacteria	7708
680	Ga0307513_10051320	3300031456	Bacteria	4451
681	Ga0307513_10073911	3300031456	Bacteria	3547
682	Ga0307513_10091048	3300031456	Bacteria	3109
683	Ga0307513_10166717	3300031456	Bacteria	2086
684	Ga0307509_10024617	3300031507	Bacteria	6738
685	Ga0307509_10055465	3300031507	Bacteria	4211
686	Ga0307509_10276906	3300031507	Bacteria	1442
687	Ga0307509_10303254	3300031507	Bacteria	1344
688	Ga0307408_100000063	3300031548	Bacteria	125218
689	Ga0265313_10023426	3300031595	Bacteria	3325
690	Ga0307508_10003032	3300031616	Bacteria	17301
691	Ga0307508_10044261	3300031616	Bacteria	3983
692	Ga0307508_10083836	3300031616	Bacteria	2770
693	Ga0307514_10095242	3300031649	Bacteria	2155
694	Ga0265342_10042817	3300031712	Bacteria	2734
695	Ga0307516_10002388	3300031730	Bacteria	25152
696	Ga0307413_10188647	3300031824	Bacteria	1478
697	Ga0307406_10001042	3300031901	Bacteria	15471
698	Ga0307406_10281810	3300031901	Bacteria	1268
699	Ga0307412_10058093	3300031911	Bacteria	2586
700	Ga0307412_10114387	3300031911	Bacteria	1932
701	Ga0307409_100186044	3300031995	Bacteria	1844
702	Ga0307409_100195865	3300031995	Bacteria	1803
703	Ga0307416_100184264	3300032002	Bacteria	1960
704	Ga0307416_100295741	3300032002	Bacteria	1606
705	Ga0307416_100422793	3300032002	Bacteria	1377
706	Ga0307414_10012559	3300032004	Bacteria	5013
707	Ga0307414_10023322	3300032004	Bacteria	3923
708	Ga0307411_10021523	3300032005	Bacteria	3776
709	Ga0307510_10002764	3300033180	Bacteria	20097
710	Ga0307510_10005984	3300033180	Bacteria	14518
711	Ga0307510_10148749	3300033180	Bacteria	1967
712	Ga0373940_0018966	3300035088	Bacteria	1732
713	Ga0373940_0027094	3300035088	Bacteria	1504
714	Ga0373923_0023947	3300035111	Bacteria	2406
715	Ga0373932_0011294	3300035112	Bacteria	2179
716	Ga0373936_0013453	3300035113	Bacteria	3122
717	Ga0373939_0043670	3300035114	Bacteria	1361
718	Ga0373941_0023481	3300035115	Bacteria	1761
719	Ga0373954_0004686	3300035118	Bacteria	5898
720	Ga0373943_0008551	3300035170	Bacteria	4589
721	Ga0373955_0020086	3300035172	Bacteria	3353
722	Ga0373942_0038116	3300035207	Bacteria	1302
723	Ga0373931_0006163	3300035691	Bacteria	5591
724	Ga0373931_0014893	3300035691	Bacteria	3809
725	Ga0373935_0046605	3300035692	Bacteria	2738
726	Ga0373927_0058523	3300035695	Bacteria	2492
727	Ga0373933_0012489	3300035724	Bacteria	4691
728	Ga0373947_0050569	3300035725	Bacteria	2499
729	Ga0373947_0176268	3300035725	Bacteria	1389
730	Ga0373937_0004553	3300036401	Bacteria	11768
731	Ga0373937_0023937	3300036401	Bacteria	5506
732	Ga0373925_0225311	3300037068	Bacteria	1497
733	Ga0395900_0000986	3300037418	Bacteria	37037
734	Ga0395900_0010267	3300037418	Bacteria	9577
735	Ga0395900_0019983	3300037418	Bacteria	6828
736	Ga0395900_0171078	3300037418	Bacteria	2212
737	Ga0395900_0242866	3300037418	Bacteria	1806
738	Ga0395898_0002142	3300037466	Bacteria	24324
739	Ga0395898_0021982	3300037466	Bacteria	6461
740	Ga0395898_0036761	3300037466	Bacteria	4861
741	Ga0395898_0139510	3300037466	Bacteria	2321
742	Ga0395898_0479753	3300037466	Bacteria	1183
743	Ga0395905_0040930	3300037471	Bacteria	4347
744	Ga0395905_0296125	3300037471	Bacteria	1505
745	Ga0395905_0392330	3300037471	Bacteria	1283
746	Ga0436364_0605911	3300037853	Bacteria	1315
747	Ga0436364_1271811	3300037853	Bacteria	2254
748	Ga0395901_0001736	3300038443	Bacteria	22521
749	Ga0395901_0017480	3300038443	Bacteria	7319
750	Ga0395901_0290251	3300038443	Bacteria	1698
751	Ga0400483_167880	3300039062	Unclassified	1585
752	Ga0436365_0713907	3300039437	Bacteria	1702
753	Ga0436365_1205090	3300039437	Bacteria	128002
754	Ga0436360_1352855	3300039438	Bacteria	3767
755	Ga0436361_0166862	3300039447	Bacteria	32287
756	Ga0436363_1013389	3300039450	Bacteria	5630
757	Ga0436362_0639050	3300039453	Bacteria	1700
758	Ga0439436_0017156	3300041404	Bacteria	2167
759	Ga0439436_0020452	3300041404	Bacteria	1971
760	Ga0439439_0009681	3300041406	Bacteria	2297
761	Ga0439461_0000072	3300041410	Bacteria	13093
762	Ga0439465_0001099	3300041413	Bacteria	8679
763	Ga0451789_1367961	3300041443	Bacteria	1892
764	Ga0451791_1757177	3300041451	Bacteria	2132
765	Ga0451839_0517051	3300041496	Bacteria	3796
766	Ga0451839_0801882	3300041496	Bacteria	1145
767	Ga0451847_0252322	3300041503	Bacteria	1645
768	Ga0451849_1091202	3300041505	Bacteria	2227
769	Ga0451843_0500975	3300041509	Bacteria	1554
770	Ga0451853_2470466	3300041512	Bacteria	1229
771	Ga0439442_000646	3300042002	Bacteria	7395
772	Ga0439445_0000422	3300042004	Bacteria	8521
773	Ga0439448_0062402	3300042005	Bacteria	1233
774	Ga0439432_000093	3300042006	Bacteria	28351
775	Ga0439449_0000524	3300042007	Bacteria	14275
776	Ga0439449_0001386	3300042007	Bacteria	9481
777	Ga0439457_007480	3300042014	Bacteria	2619
778	Ga0439462_0039796	3300042015	Bacteria	1253
779	Ga0450907_004110	3300042146	Bacteria	2521
780	Ga0450907_021205	3300042146	Bacteria	1092
781	Ga0439446_0027661	3300042156	Bacteria	1628
782	Ga0439434_0000066	3300042435	Bacteria	25506
783	Ga0439435_0006941	3300042436	Bacteria	2569
784	Ga0466969_0004825	3300044656	Bacteria	7179
785	Ga0466966_0019905	3300044684	Bacteria	4413
786	Ga0466966_0033735	3300044684	Bacteria	3313
787	Ga0466966_0074823	3300044684	Bacteria	2116
788	Ga0466966_0093224	3300044684	Bacteria	1868
789	Ga0466961_0143890	3300044693	Bacteria	1491
790	Ga0466963_0006781	3300044694	Bacteria	6809
791	Ga0466963_0010433	3300044694	Bacteria	5624
792	Ga0466971_0000786	3300044719	Bacteria	12795
793	Ga0466971_0152590	3300044719	Bacteria	1079
794	Ga0466970_0000338	3300044765	Bacteria	22956
795	Ga0466970_0197812	3300044765	Bacteria	1118
796	Ga0466957_0001165	3300044842	Bacteria	13627
797	Ga0466957_0180142	3300044842	Bacteria	1380
798	Ga0466959_0000837	3300045049	Bacteria	18178
799	Ga0466959_0186050	3300045049	Bacteria	1451
800	Ga0466959_0193343	3300045049	Bacteria	1419
801	Ga0466958_0028155	3300045836	Bacteria	3330
802	Ga0466958_0031042	3300045836	Bacteria	3176
803	Ga0495617_042928	3300046452	Bacteria	1510
804	Ga0495617_046329	3300046452	Bacteria	1449
805	Ga0495627_000105	3300046453	Bacteria	103413
806	Ga0495627_003575	3300046453	Bacteria	6786
807	Ga0495603_0093293	3300046455	Bacteria	1759
808	Ga0495590_0000506	3300046457	Bacteria	19115
809	Ga0495629_0001532	3300046459	Bacteria	18176
810	Ga0495629_0017412	3300046459	Bacteria	5150
811	Ga0495638_0000016	3300046460	Bacteria	396505
812	Ga0495638_0000151	3300046460	Bacteria	109795
813	Ga0495638_0001404	3300046460	Bacteria	21911
814	Ga0495638_0001574	3300046460	Bacteria	20441
815	Ga0495638_0012809	3300046460	Bacteria	5730
816	Ga0495638_0021181	3300046460	Bacteria	4287
817	Ga0495638_0070429	3300046460	Bacteria	2141
818	Ga0495638_0094939	3300046460	Bacteria	1792
819	Ga0495641_0090872	3300046461	Bacteria	1364
820	Ga0495651_0021819	3300046462	Bacteria	4979
821	Ga0495651_0054199	3300046462	Bacteria	3085
822	Ga0495650_0000007	3300046471	Bacteria	718072
823	Ga0495650_0040207	3300046471	Bacteria	2011
824	Ga0495580_0049688	3300046472	Bacteria	2967
825	Ga0495580_0136485	3300046472	Bacteria	1701
826	Ga0495582_0001945	3300046473	Bacteria	11601
827	Ga0495582_0038920	3300046473	Bacteria	2617
828	Ga0495605_0015398	3300046474	Bacteria	4163
829	Ga0495639_0003398	3300046475	Bacteria	6898
830	Ga0495662_0022971	3300046476	Bacteria	3011
831	Ga0495664_0016129	3300046477	Bacteria	4254
832	Ga0495584_0031460	3300046491	Bacteria	2686
833	Ga0495585_0002584	3300046492	Bacteria	12805
834	Ga0495585_0024026	3300046492	Bacteria	3496
835	Ga0495585_0058726	3300046492	Bacteria	2122
836	Ga0495594_0000216	3300046499	Bacteria	28040
837	Ga0495594_0000830	3300046499	Bacteria	15930
838	Ga0495596_0004358	3300046500	Bacteria	6918
839	Ga0495607_0053238	3300046501	Bacteria	2340
840	Ga0495583_0000029	3300046506	Bacteria	255536
841	Ga0495583_0000059	3300046506	Bacteria	199575
842	Ga0495583_0000094	3300046506	Bacteria	153549
843	Ga0495583_0018972	3300046506	Bacteria	3603
844	Ga0495583_0030713	3300046506	Bacteria	2613
845	Ga0495583_0031516	3300046506	Bacteria	2569
846	Ga0495583_0105879	3300046506	Bacteria	1196
847	Ga0495606_0000279	3300046507	Bacteria	88805
848	Ga0495606_0035650	3300046507	Bacteria	3398
849	Ga0495606_0063747	3300046507	Bacteria	2348
850	Ga0495606_0066224	3300046507	Bacteria	2292
851	Ga0495606_0105719	3300046507	Bacteria	1706
852	Ga0495608_0116737	3300046511	Bacteria	1713
853	Ga0495610_0000040	3300046512	Bacteria	165165
854	Ga0495610_0000262	3300046512	Bacteria	55293
855	Ga0495610_0000882	3300046512	Bacteria	27913
856	Ga0495610_0009325	3300046512	Bacteria	6217
857	Ga0495610_0015896	3300046512	Bacteria	4352
858	Ga0495610_0028413	3300046512	Bacteria	2958
859	Ga0495616_0000031	3300046513	Bacteria	130957
860	Ga0495616_0045407	3300046513	Bacteria	2224
861	Ga0495616_0069961	3300046513	Bacteria	1700
862	Ga0495618_0026199	3300046514	Bacteria	3623
863	Ga0495618_0061709	3300046514	Bacteria	2378
864	Ga0495618_0176160	3300046514	Bacteria	1360
865	Ga0495620_0036345	3300046515	Bacteria	2205
866	Ga0495620_0085931	3300046515	Bacteria	1267
867	Ga0495628_0063407	3300046516	Bacteria	2896
868	Ga0495628_0113714	3300046516	Bacteria	2080
869	Ga0495631_0003509	3300046518	Bacteria	8573
870	Ga0495631_0009183	3300046518	Bacteria	4952
871	Ga0495631_0085980	3300046518	Bacteria	1355
872	Ga0495631_0129401	3300046518	Bacteria	1085
873	Ga0495632_0000132	3300046519	Bacteria	75720
874	Ga0495632_0000607	3300046519	Bacteria	33188
875	Ga0495632_0034134	3300046519	Bacteria	2606
876	Ga0495637_0002737	3300046520	Bacteria	9598
877	Ga0495637_0014779	3300046520	Bacteria	3678
878	Ga0495637_0026695	3300046520	Bacteria	2589
879	Ga0495637_0043885	3300046520	Bacteria	1906
880	Ga0495643_0021510	3300046522	Bacteria	3699
881	Ga0495648_0000013	3300046524	Bacteria	289090
882	Ga0495648_0000069	3300046524	Bacteria	136934
883	Ga0495648_0000435	3300046524	Bacteria	45337
884	Ga0495648_0028659	3300046524	Bacteria	3705
885	Ga0495663_0001851	3300046525	Bacteria	6522
886	Ga0495642_0003102	3300046528	Bacteria	6595
887	Ga0495652_0003656	3300046529	Bacteria	15060
888	Ga0495652_0026592	3300046529	Bacteria	5108
889	Ga0495654_0000095	3300046530	Bacteria	100179
890	Ga0495654_0063376	3300046530	Bacteria	1770
891	Ga0495665_0000653	3300046531	Bacteria	17783
892	Ga0495640_0013089	3300046533	Bacteria	6316
893	Ga0495640_0021056	3300046533	Bacteria	4793
894	Ga0495587_0014225	3300046536	Bacteria	4994
895	Ga0495597_0062665	3300046542	Bacteria	1617
896	Ga0495645_0001418	3300046543	Bacteria	16143
897	Ga0495645_0028243	3300046543	Bacteria	4076
898	Ga0495645_0180424	3300046543	Bacteria	1447
899	Ga0495622_0006235	3300046557	Bacteria	5537
900	Ga0495622_0013727	3300046557	Bacteria	3755
901	Ga0495622_0018865	3300046557	Bacteria	3214
902	Ga0495633_0002481	3300046558	Bacteria	13007
903	Ga0495633_0011455	3300046558	Bacteria	4781
904	Ga0495633_0011706	3300046558	Bacteria	4711
905	Ga0495633_0039414	3300046558	Bacteria	2255
906	Ga0495633_0045062	3300046558	Bacteria	2089
907	Ga0495633_0093163	3300046558	Bacteria	1400
908	Ga0495667_0075122	3300046559	Bacteria	2200
909	Ga0495667_0150727	3300046559	Bacteria	1497
910	Ga0495668_0000014	3300046616	Bacteria	442055
911	Ga0495668_0000109	3300046616	Bacteria	132453
912	Ga0495668_0006051	3300046616	Bacteria	8017
913	Ga0495668_0021759	3300046616	Bacteria	3671
914	Ga0495668_0035498	3300046616	Bacteria	2794
915	Ga0495668_0043196	3300046616	Bacteria	2508
916	Ga0495668_0046417	3300046616	Bacteria	2413
917	Ga0495634_0054133	3300046642	Bacteria	2686
918	Ga0495634_0082113	3300046642	Bacteria	2107
919	Ga0495634_0100417	3300046642	Bacteria	1870
920	Ga0495611_0009662	3300046648	Bacteria	4076
921	Ga0495611_0058389	3300046648	Bacteria	1749
922	Ga0495611_0074984	3300046648	Bacteria	1550
923	Ga0495625_0000341	3300046660	Bacteria	71410
924	Ga0495625_0000710	3300046660	Bacteria	47064
925	Ga0495625_0001382	3300046660	Bacteria	29819
926	Ga0495625_0004297	3300046660	Bacteria	13552
927	Ga0495625_0005647	3300046660	Bacteria	11334
928	Ga0495625_0008824	3300046660	Bacteria	8533
929	Ga0495625_0008842	3300046660	Bacteria	8524
930	Ga0495625_0060492	3300046660	Bacteria	2683
931	Ga0495625_0061510	3300046660	Bacteria	2657
932	Ga0495625_0155162	3300046660	Bacteria	1537
933	Ga0495635_0012973	3300046663	Bacteria	5833
934	Ga0495635_0014689	3300046663	Bacteria	5478
935	Ga0495635_0066753	3300046663	Bacteria	2467
936	Ga0495661_0137713	3300046665	Bacteria	1331
937	Ga0495588_0053243	3300046674	Bacteria	2087
938	Ga0495599_0001842	3300046678	Bacteria	12288
939	Ga0495599_0148675	3300046678	Bacteria	1452
940	Ga0495623_0123849	3300046679	Bacteria	1553
941	Ga0495669_0000038	3300046684	Bacteria	93166
942	Ga0495613_0015379	3300046689	Bacteria	5689
943	Ga0495613_0102050	3300046689	Bacteria	2071
944	Ga0495613_0152386	3300046689	Bacteria	1648
945	Ga0495624_0004269	3300046690	Bacteria	10499
946	Ga0495670_0014845	3300046691	Bacteria	3834
947	Ga0495671_0000018	3300046692	Bacteria	291470
948	Ga0495649_0001239	3300046694	Bacteria	19642
949	Ga0495649_0010883	3300046694	Bacteria	5357
950	Ga0495649_0023443	3300046694	Bacteria	3449
951	Ga0495649_0073936	3300046694	Bacteria	1826
952	Ga0495589_0002752	3300046794	Bacteria	9726
953	Ga0495589_0069900	3300046794	Bacteria	1717
954	Ga0495660_0123246	3300046810	Bacteria	1309
955	Ga0495660_0142001	3300046810	Bacteria	1194
956	Ga0495581_0155950	3300047315	Bacteria	1334
957	Ga0495581_0179605	3300047315	Bacteria	1237
958	Ga0495604_0028598	3300047317	Bacteria	4435
959	Ga0495604_0032372	3300047317	Bacteria	4144
960	Ga0495672_0004104	3300047320	Bacteria	12142
961	Ga0495672_0127831	3300047320	Bacteria	1341
962	Ga0495676_0002006	3300047321	Bacteria	17919
963	Ga0495676_0069138	3300047321	Bacteria	2726
964	Ga0495683_0005623	3300047323	Bacteria	6942
965	Ga0495683_0009242	3300047323	Bacteria	5253
966	Ga0495683_0092545	3300047323	Bacteria	1463
967	Ga0495687_000089	3300047443	Bacteria	141448
968	Ga0495687_098384	3300047443	Bacteria	1104
969	Ga0495675_0006178	3300047444	Bacteria	7328
970	Ga0495677_0000671	3300047445	Bacteria	13854
971	Ga0495677_0001833	3300047445	Bacteria	8490
972	Ga0495677_0033020	3300047445	Bacteria	1886
973	Ga0495679_004241	3300047446	Bacteria	6662
974	Ga0495673_0000029	3300047469	Bacteria	471019
975	Ga0495673_0000163	3300047469	Bacteria	114230
976	Ga0495673_0000527	3300047469	Bacteria	39848
977	Ga0495681_0000047	3300047470	Bacteria	110934
978	Ga0495681_0009120	3300047470	Bacteria	6144
979	Ga0495681_0009858	3300047470	Bacteria	5842
980	Ga0495684_0031387	3300047471	Bacteria	4079
981	Ga0495684_0048578	3300047471	Bacteria	3244
982	Ga0495686_0000330	3300047472	Bacteria	77908
983	Ga0495686_0000557	3300047472	Bacteria	53288
984	Ga0495686_0001264	3300047472	Bacteria	28673
985	Ga0495686_0005184	3300047472	Bacteria	10377
986	Ga0495686_0006435	3300047472	Bacteria	8992
987	Ga0495686_0007803	3300047472	Bacteria	7963
988	Ga0495686_0027568	3300047472	Bacteria	3707
989	Ga0495686_0035761	3300047472	Bacteria	3191
990	Ga0495686_0088029	3300047472	Bacteria	1888
991	Ga0495593_0052968	3300047673	Bacteria	2142
992	Ga0495602_0073224	3300048088	Bacteria	2917
993	Ga0495614_0001767	3300048089	Bacteria	9446
994	Ga0495614_0012116	3300048089	Bacteria	3786
995	Ga0496100_0138145	3300048903	Bacteria	1724
996	Ga0496101_0146148	3300048904	Bacteria	1806
997	Ga0496102_0040557	3300048905	Bacteria	4211
998	Ga0496102_0090934	3300048905	Bacteria	2825
999	Ga0496103_0165637	3300048906	Bacteria	1418
1000	Ga0496104_0000068	3300048907	Bacteria	107801
1001	Ga0496104_0000237	3300048907	Bacteria	48566
1002	Ga0496105_0006861	3300048908	Bacteria	8762
1003	Ga0496106_0001515	3300048909	Bacteria	17471
1004	Ga0496106_0002647	3300048909	Bacteria	13321
1005	Ga0496108_0000679	3300048911	Bacteria	26334
1006	Ga0496109_0080839	3300048912	Bacteria	2995
1007	Ga0496110_0001662	3300048913	Bacteria	16312
1008	Ga0496111_0002343	3300048914	Bacteria	11415
1009	Ga0496112_0035776	3300048915	Bacteria	4840
1010	Ga0496113_0031695	3300048916	Bacteria	3838
1011	Ga0496115_0392885	3300048918	Bacteria	1126
1012	Ga0496116_0061844	3300048919	Bacteria	2421
1013	Ga0496117_0008200	3300048920	Bacteria	9962
1014	Ga0496117_0013911	3300048920	Bacteria	6975
1015	Ga0496117_0118037	3300048920	Bacteria	1636
1016	Ga0496118_0006775	3300048921	Bacteria	12457
1017	Ga0496118_0011735	3300048921	Bacteria	8516
1018	Ga0496118_0018936	3300048921	Bacteria	6172
1019	Ga0496118_0057940	3300048921	Bacteria	2899
1020	Ga0496118_0063420	3300048921	Bacteria	2719
1021	Ga0496119_0044466	3300048922	Bacteria	2795
1022	Ga0496119_0057114	3300048922	Bacteria	2360
1023	Ga0496119_0074801	3300048922	Bacteria	1971
1024	Ga0496119_0085705	3300048922	Bacteria	1803
1025	Ga0496121_0000069	3300048924	Bacteria	253087
1026	Ga0496121_0000146	3300048924	Bacteria	154459
1027	Ga0496121_0000357	3300048924	Bacteria	94003
1028	Ga0496121_0000496	3300048924	Bacteria	75156
1029	Ga0496121_0002068	3300048924	Bacteria	31782
1030	Ga0496121_0002995	3300048924	Bacteria	24532
1031	Ga0496121_0008291	3300048924	Bacteria	12289
1032	Ga0496121_0009041	3300048924	Bacteria	11541
1033	Ga0496121_0013320	3300048924	Bacteria	8852
1034	Ga0496121_0063189	3300048924	Bacteria	3027
1035	Ga0496121_0074895	3300048924	Bacteria	2706
1036	Ga0496121_0249748	3300048924	Bacteria	1231
1037	Ga0496122_0016094	3300048925	Bacteria	7106
1038	Ga0496122_0059219	3300048925	Bacteria	2828
1039	Ga0496123_0003037	3300048926	Bacteria	19347
1040	Ga0496124_0001405	3300048927	Bacteria	35949
1041	Ga0496124_0003847	3300048927	Bacteria	17970
1042	Ga0496124_0011727	3300048927	Bacteria	8743
1043	Ga0496124_0017694	3300048927	Bacteria	6708
1044	Ga0496124_0127266	3300048927	Bacteria	2028
1045	Ga0496124_0134624	3300048927	Bacteria	1958
1046	Ga0496124_0273587	3300048927	Bacteria	1235
1047	Ga0496125_0001035	3300048928	Bacteria	43113
1048	Ga0496125_0002040	3300048928	Bacteria	27332
1049	Ga0496125_0012462	3300048928	Bacteria	8439
1050	Ga0496125_0020178	3300048928	Bacteria	6263
1051	Ga0496125_0020632	3300048928	Bacteria	6180
1052	Ga0496125_0067818	3300048928	Bacteria	2809
1053	Ga0496125_0151986	3300048928	Bacteria	1588
1054	Ga0496126_0000560	3300048929	Bacteria	71370
1055	Ga0496126_0001842	3300048929	Bacteria	30940
1056	Ga0496126_0002265	3300048929	Bacteria	26538
1057	Ga0496126_0003087	3300048929	Bacteria	21537
1058	Ga0496126_0006295	3300048929	Bacteria	13255
1059	Ga0496126_0045971	3300048929	Bacteria	4008
1060	Ga0496126_0162674	3300048929	Bacteria	1906
1061	Ga0496126_0363078	3300048929	Bacteria	1182
1062	Ga0495678_000973	3300049459	Bacteria	24654
1063	Ga0495682_0072995	3300049460	Bacteria	1235
1064	Ga0495682_0088431	3300049460	Bacteria	1113
1065	Ga0501031_0000112	3300049568	Bacteria	43234
1066	Ga0501031_0042403	3300049568	Bacteria	2970
1067	Ga0501032_0001051	3300049569	Bacteria	22113
1068	Ga0501032_0001341	3300049569	Bacteria	19600
1069	Ga0501032_0003560	3300049569	Bacteria	11871
1070	Ga0501032_0028604	3300049569	Bacteria	3829
1071	Ga0501032_0156983	3300049569	Bacteria	1494
1072	Ga0501033_0001028	3300049570	Bacteria	25387
1073	Ga0501033_0008868	3300049570	Bacteria	7768
1074	Ga0501033_0010985	3300049570	Bacteria	6938
1075	Ga0501033_0021835	3300049570	Bacteria	4830
1076	Ga0501033_0079301	3300049570	Bacteria	2409
1077	Ga0501034_0003515	3300049571	Bacteria	17784
1078	Ga0501034_0012428	3300049571	Bacteria	8793
1079	Ga0501034_0019266	3300049571	Bacteria	6984
1080	Ga0501034_0069172	3300049571	Bacteria	3541
1081	Ga0501034_0159026	3300049571	Bacteria	2232
1082	Ga0501034_0207669	3300049571	Bacteria	1914
1083	Ga0501034_0290850	3300049571	Bacteria	1572
1084	Ga0501036_0001867	3300049572	Bacteria	16331
1085	Ga0501036_0008500	3300049572	Bacteria	8415
1086	Ga0501036_0053659	3300049572	Bacteria	3413
1087	Ga0501036_0080014	3300049572	Bacteria	2763
1088	Ga0501036_0132808	3300049572	Bacteria	2101
1089	Ga0501037_0000968	3300049573	Bacteria	21318
1090	Ga0501037_0004848	3300049573	Bacteria	9786
1091	Ga0501037_0010388	3300049573	Bacteria	6830
1092	Ga0501037_0013205	3300049573	Bacteria	6088
1093	Ga0501037_0119408	3300049573	Bacteria	1896
1094	Ga0501038_0000341	3300049574	Bacteria	40328
1095	Ga0501038_0007160	3300049574	Bacteria	10310
1096	Ga0501038_0008542	3300049574	Bacteria	9404
1097	Ga0501038_0052697	3300049574	Bacteria	3507
1098	Ga0501038_0274351	3300049574	Bacteria	1329
1099	Ga0501039_0004789	3300049575	Bacteria	10243
1100	Ga0501039_0067819	3300049575	Bacteria	2770
1101	Ga0501039_0459015	3300049575	Bacteria	1000
1102	Ga0501042_0043486	3300049578	Bacteria	3199
1103	Ga0501043_0000679	3300049579	Bacteria	29946
1104	Ga0501043_0001705	3300049579	Bacteria	19030
1105	Ga0501043_0050198	3300049579	Bacteria	3279
1106	Ga0501043_0066238	3300049579	Bacteria	2836
1107	Ga0501043_0075704	3300049579	Bacteria	2644
1108	Ga0501046_0000209	3300049580	Bacteria	60874
1109	Ga0501046_0000230	3300049580	Bacteria	57666
1110	Ga0501046_0010628	3300049580	Bacteria	7897
1111	Ga0501047_0001733	3300049581	Bacteria	21193
1112	Ga0501047_0002896	3300049581	Bacteria	16274
1113	Ga0501047_0002902	3300049581	Bacteria	16263
1114	Ga0501047_0013182	3300049581	Bacteria	7829
1115	Ga0501047_0031460	3300049581	Bacteria	5118
1116	Ga0501047_0042764	3300049581	Bacteria	4377
1117	Ga0501047_0120503	3300049581	Bacteria	2506
1118	Ga0501047_0124713	3300049581	Bacteria	2456
1119	Ga0501047_0174335	3300049581	Bacteria	2019
1120	Ga0501047_0260811	3300049581	Bacteria	1581
1121	Ga0501048_0000713	3300049582	Bacteria	24290
1122	Ga0501048_0004873	3300049582	Bacteria	10237
1123	Ga0501067_0125292	3300049583	Bacteria	1430
1124	Ga0501068_0049712	3300049584	Bacteria	2533
1125	Ga0501068_0186794	3300049584	Bacteria	1312
1126	Ga0501069_0099716	3300049585	Bacteria	1648
1127	Ga0501070_0000838	3300049586	Bacteria	27930
1128	Ga0501070_0040278	3300049586	Bacteria	3896
1129	Ga0501070_0071445	3300049586	Bacteria	2873
1130	Ga0501072_0220964	3300049588	Bacteria	1510
1131	Ga0501073_0001733	3300049589	Bacteria	16214
1132	Ga0501073_0004500	3300049589	Bacteria	10472
1133	Ga0501073_0008267	3300049589	Bacteria	7719
1134	Ga0501073_0008578	3300049589	Bacteria	7577
1135	Ga0501073_0021908	3300049589	Bacteria	4603
1136	Ga0501074_0006531	3300049590	Bacteria	8421
1137	Ga0501074_0011410	3300049590	Bacteria	6461
1138	Ga0501077_0059322	3300049593	Bacteria	2429
1139	Ga0501223_018924	3300049663	Bacteria	1353
1140	Ga0501080_0000870	3300049742	Bacteria	24737
1141	Ga0501080_0004950	3300049742	Bacteria	11865
1142	Ga0501080_0090921	3300049742	Bacteria	2835
1143	Ga0501080_0177554	3300049742	Bacteria	1961
1144	Ga0501080_0400827	3300049742	Bacteria	1234
1145	Ga0501083_0000105	3300049744	Bacteria	56997
1146	Ga0501083_0021405	3300049744	Bacteria	4494
1147	Ga0501083_0051170	3300049744	Bacteria	2778
1148	Ga0501083_0199701	3300049744	Bacteria	1304
1149	Ga0501268_005228	3300049765	Bacteria	1860
1150	Ga0501035_0005839	3300049822	Bacteria	11608
1151	Ga0501035_0013098	3300049822	Bacteria	7653
1152	Ga0501035_0018580	3300049822	Bacteria	6402
1153	Ga0501035_0024463	3300049822	Bacteria	5537
1154	Ga0501035_0055107	3300049822	Bacteria	3550
1155	Ga0501035_0114110	3300049822	Bacteria	2366
1156	Ga0501044_0003941	3300049823	Bacteria	16633
1157	Ga0501044_0026675	3300049823	Bacteria	6114
1158	Ga0501044_0048381	3300049823	Bacteria	4393
1159	Ga0501044_0092861	3300049823	Bacteria	3043
1160	Ga0501044_0096713	3300049823	Bacteria	2974
1161	Ga0501044_0186287	3300049823	Bacteria	2040
1162	nmdc:mga0yw44_238403_c1	3300050492	Bacteria	1208
1163	nmdc:mga0k408_106523_c1	3300050493	Bacteria	1656
1164	nmdc:mga0k408_28398_c1	3300050493	Bacteria	3181
1165	nmdc:mga06z11_123015_c1	3300050494	Bacteria	1449
1166	nmdc:mga06z11_5541_c1	3300050494	Bacteria	5075
1167	nmdc:mga04h51_4762_c1	3300050495	Bacteria	3405
1168	nmdc:mga07m45_25907_c1	3300050496	Bacteria	3220
1169	nmdc:mga07m45_3768_c1	3300050496	Bacteria	7334
1170	nmdc:mga05p37_241997_c1	3300050507	Bacteria	2169
1171	nmdc:mga05p37_272611_c1	3300050507	Bacteria	2021
1172	nmdc:mga0qj67_67597_c1	3300050509	Bacteria	2847
1173	nmdc:mga06r32_64119_c1	3300050510	Bacteria	3542
1174	nmdc:mga08y16_194036_c1	3300050511	Bacteria	2106
1175	nmdc:mga0n895_45809_c1	3300050512	Bacteria	4270
1176	nmdc:mga0rr50_37280_c1	3300050513	Bacteria	3508
1177	nmdc:mga0a205_80122_c1	3300050515	Bacteria	3156
1178	Ga0495612_0030747	3300053078	Bacteria	2163
1179	Ga0500610_0000060	3300053079	Bacteria	34270
1180	Ga0500578_0000354	3300053086	Bacteria	56309
1181	Ga0500578_0015201	3300053086	Bacteria	4946
1182	Ga0500643_000006	3300053087	Bacteria	479605
1183	Ga0500643_002025	3300053087	Bacteria	10892
1184	Ga0500643_003474	3300053087	Bacteria	7579
1185	Ga0500643_047642	3300053087	Bacteria	1234
1186	Ga0500644_0000362	3300053088	Bacteria	22238
1187	Ga0500583_0014052	3300053092	Bacteria	3122
1188	Ga0500583_0033860	3300053092	Bacteria	2266
1189	Ga0500651_0000002	3300053093	Bacteria	476609
1190	Ga0500566_0061699	3300053094	Bacteria	2121
1191	Ga0500641_0095754	3300053096	Bacteria	1270
1192	Ga0500555_000222	3300053103	Bacteria	25909
1193	Ga0500556_0000179	3300053104	Bacteria	52362
1194	Ga0500556_0001920	3300053104	Bacteria	7423
1195	Ga0500594_0000963	3300053118	Bacteria	6188
1196	Ga0500594_0003333	3300053118	Bacteria	3519
1197	Ga0500595_000014	3300053119	Bacteria	247996
1198	Ga0500595_002690	3300053119	Bacteria	8617
1199	Ga0500595_003572	3300053119	Bacteria	7225
1200	Ga0500597_023877	3300053120	Bacteria	2449
1201	Ga0500608_000006	3300053122	Bacteria	102722
1202	Ga0500608_008921	3300053122	Bacteria	4241
1203	Ga0500618_000053	3300053125	Bacteria	101079
1204	Ga0500618_000622	3300053125	Bacteria	21518
1205	Ga0500642_0000001	3300053130	Bacteria	1468402
1206	Ga0500642_0001824	3300053130	Bacteria	6149
1207	Ga0500652_006882	3300053131	Bacteria	3688
1208	Ga0500658_0000086	3300053134	Bacteria	43329
1209	Ga0500658_0001905	3300053134	Bacteria	8185
1210	Ga0500658_0014457	3300053134	Bacteria	2922
1211	Ga0500658_0018719	3300053134	Bacteria	2600
1212	Ga0500658_0025981	3300053134	Bacteria	2254
1213	Ga0500658_0083104	3300053134	Bacteria	1373
1214	Ga0500658_0126091	3300053134	Bacteria	1138
1215	Ga0500559_0002313	3300053136	Bacteria	9996
1216	Ga0500559_0017445	3300053136	Bacteria	3032
1217	Ga0500559_0022114	3300053136	Bacteria	2697
1218	Ga0500564_000056	3300053138	Bacteria	29802
1219	Ga0500568_0001721	3300053139	Bacteria	13596
1220	Ga0500568_0045594	3300053139	Bacteria	1744
1221	Ga0500568_0053459	3300053139	Bacteria	1583
1222	Ga0500573_0000009	3300053140	Bacteria	230823
1223	Ga0500577_0000103	3300053142	Bacteria	20439
1224	Ga0500577_0129510	3300053142	Bacteria	1056
1225	Ga0500588_0021715	3300053146	Bacteria	1737
1226	Ga0500603_029227	3300053150	Bacteria	1412
1227	Ga0500604_0046930	3300053151	Bacteria	1322
1228	Ga0500616_0000203	3300053153	Bacteria	97028
1229	Ga0500616_0007625	3300053153	Bacteria	6840
1230	Ga0500616_0010939	3300053153	Bacteria	5399
1231	Ga0500616_0014522	3300053153	Bacteria	4524
1232	Ga0500622_0000452	3300053156	Bacteria	39067
1233	Ga0500622_0000836	3300053156	Bacteria	26294
1234	Ga0500622_0018069	3300053156	Bacteria	3749
1235	Ga0500622_0023659	3300053156	Bacteria	3253
1236	Ga0500624_000015	3300053157	Bacteria	161928
1237	Ga0500627_0050824	3300053158	Bacteria	1806
1238	Ga0500636_0004016	3300053177	Bacteria	8298
1239	Ga0500636_0021404	3300053177	Bacteria	3827
1240	Ga0500637_0066224	3300053178	Bacteria	2073
1241	Ga0500645_000008	3300053730	Bacteria	212254
1242	Ga0500645_001213	3300053730	Bacteria	13632
1243	Ga0500645_002974	3300053730	Bacteria	7188
1244	Ga0500645_057873	3300053730	Bacteria	1124
1245	Ga0500609_000311	3300053731	Bacteria	7212
1246	Ga0500596_001697	3300053735	Bacteria	4463
1247	Ga0501084_0001717	3300054114	Bacteria	17403
1248	Ga0501084_0005104	3300054114	Bacteria	10745
1249	Ga0501084_0056938	3300054114	Bacteria	3271
1250	Ga0500661_000991	3300055283	Bacteria	5323
1251	Ga0501082_0001282	3300060353	Bacteria	22071
1252	Ga0501082_0076691	3300060353	Bacteria	2881
1253	Ga0501082_0082067	3300060353	Bacteria	2781
1254	Ga0466962_0000531	3300061719	Bacteria	16705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003790	Ga0055528_1010218	Ga0055528_10102182	262
2	3300041496	Ga0451839_0801882	Ga0451839_0801882_35_904	284
3	iso_pu_bacteria	8018163183	8018168170	285
4	3300035111	Ga0373923_0023947	Ga0373923_0023947_293_1237	289
5	3300035118	Ga0373954_0004686	Ga0373954_0004686_1895_2839	289
6	3300035170	Ga0373943_0008551	Ga0373943_0008551_864_1808	289
7	3300035692	Ga0373935_0046605	Ga0373935_0046605_1648_2592	289
8	3300035695	Ga0373927_0058523	Ga0373927_0058523_1104_2048	289
9	3300035724	Ga0373933_0012489	Ga0373933_0012489_1465_2409	289
10	3300035725	Ga0373947_0050569	Ga0373947_0050569_354_1298	289
11	3300036401	Ga0373937_0004553	Ga0373937_0004553_1669_2613	289
12	3300037068	Ga0373925_0225311	Ga0373925_0225311_90_1034	289
13	3300046472	Ga0495580_0049688	Ga0495580_0049688_26_970	289
14	3300046473	Ga0495582_0038920	Ga0495582_0038920_1197_2141	289
15	3300046476	Ga0495662_0022971	Ga0495662_0022971_1416_2360	289
16	3300046514	Ga0495618_0176160	Ga0495618_0176160_175_1119	289
17	3300046516	Ga0495628_0063407	Ga0495628_0063407_1648_2592	289
18	3300046533	Ga0495640_0021056	Ga0495640_0021056_19_963	289
19	3300046543	Ga0495645_0180424	Ga0495645_0180424_142_1086	289
20	3300046559	Ga0495667_0075122	Ga0495667_0075122_1062_2006	289
21	3300046642	Ga0495634_0100417	Ga0495634_0100417_26_970	289
22	3300046663	Ga0495635_0014689	Ga0495635_0014689_1745_2689	289
23	3300046678	Ga0495599_0148675	Ga0495599_0148675_263_1207	289
24	3300047315	Ga0495581_0155950	Ga0495581_0155950_44_988	289
25	3300047471	Ga0495684_0048578	Ga0495684_0048578_63_1007	289
26	3300048924	Ga0496121_0063189	Ga0496121_0063189_1102_2070	289
27	3300053078	Ga0495612_0030747	Ga0495612_0030747_774_1718	289
28	3300048921	Ga0496118_0063420	Ga0496118_0063420_688_1656	290
29	3300053177	Ga0500636_0021404	Ga0500636_0021404_1904_2848	292
30	iso_pu_bacteria	8057529695	8057530648	293
31	3300013100	Ga0157373_10114737	Ga0157373_101147372	296
32	3300013105	Ga0157369_10291574	Ga0157369_102915742	296
33	3300013307	Ga0157372_10136731	Ga0157372_101367313	296
34	3300046460	Ga0495638_0070429	Ga0495638_0070429_229_1146	296
35	3300047472	Ga0495686_0027568	Ga0495686_0027568_1493_2410	296
36	3300049574	Ga0501038_0274351	Ga0501038_0274351_145_1065	296
37	3300053136	Ga0500559_0017445	Ga0500559_0017445_1327_2244	296
38	3300053153	Ga0500616_0010939	Ga0500616_0010939_4410_5333	296
39	iso_pu_bacteria	2582581308	2585282412	296
40	iso_pu_bacteria	2582581315	2585327739	296
41	iso_pu_bacteria	2582581316	2585335703	296
42	iso_pu_bacteria	2585427527	2585537053	296
43	iso_pu_bacteria	2585427530	2585556429	296
44	iso_pu_bacteria	2615840626	2616310135	296
45	iso_pu_bacteria	2617270742	2617384014	296
46	iso_pu_bacteria	2765235802	2765468950	296
47	iso_pu_bacteria	2775507266	2778178066	296
48	iso_pu_bacteria	2818991448	2819607479	296
49	iso_pu_bacteria	2818991453	2819643846	296
50	iso_pu_bacteria	2842482326	2842486415	296
51	iso_pu_bacteria	3005416602	3005419136	296
52	iso_pu_bacteria	8005314921	8005318099	296
53	iso_pu_bacteria	8005484373	8005486184	296
54	iso_pu_bacteria	8005645114	8005650956	296
55	3300005327	Ga0070658_10000003	Ga0070658_1000000379	297
56	3300005366	Ga0070659_100014093	Ga0070659_1000140932	297
57	3300005366	Ga0070659_100038782	Ga0070659_1000387822	297
58	3300005456	Ga0070678_100146253	Ga0070678_1001462532	297
59	3300013105	Ga0157369_10064441	Ga0157369_100644411	297
60	3300025298	Ga0209050_1002019	Ga0209050_10020195	297
61	3300025909	Ga0207705_10000005	Ga0207705_1000000582	297
62	3300025932	Ga0207690_10001721	Ga0207690_100017217	297
63	3300025932	Ga0207690_10034877	Ga0207690_100348771	297
64	3300035113	Ga0373936_0013453	Ga0373936_0013453_381_1292	297
65	3300035115	Ga0373941_0023481	Ga0373941_0023481_14_919	297
66	3300039437	Ga0436365_1205090	Ga0436365_1205090_16237_17151	297
67	3300046452	Ga0495617_042928	Ga0495617_042928_149_1063	297
68	3300046452	Ga0495617_046329	Ga0495617_046329_361_1275	297
69	3300046453	Ga0495627_003575	Ga0495627_003575_706_1620	297
70	3300046506	Ga0495583_0031516	Ga0495583_0031516_510_1424	297
71	3300046511	Ga0495608_0116737	Ga0495608_0116737_43_969	297
72	3300046512	Ga0495610_0000882	Ga0495610_0000882_4573_5487	297
73	3300046519	Ga0495632_0000132	Ga0495632_0000132_23960_24874	297
74	3300046520	Ga0495637_0002737	Ga0495637_0002737_1796_2710	297
75	3300046558	Ga0495633_0039414	Ga0495633_0039414_154_1068	297
76	3300046616	Ga0495668_0046417	Ga0495668_0046417_242_1156	297
77	3300046660	Ga0495625_0008824	Ga0495625_0008824_5634_6548	297
78	3300046665	Ga0495661_0137713	Ga0495661_0137713_406_1320	297
79	3300047445	Ga0495677_0000671	Ga0495677_0000671_3118_4032	297
80	3300047470	Ga0495681_0000047	Ga0495681_0000047_69035_69949	297
81	3300047472	Ga0495686_0001264	Ga0495686_0001264_18932_19846	297
82	3300047472	Ga0495686_0088029	Ga0495686_0088029_936_1856	297
83	3300048924	Ga0496121_0009041	Ga0496121_0009041_5544_6470	297
84	3300048927	Ga0496124_0011727	Ga0496124_0011727_4351_5277	297
85	3300049663	Ga0501223_018924	Ga0501223_018924_252_1178	297
86	3300053087	Ga0500643_002025	Ga0500643_002025_5895_6809	297
87	3300053131	Ga0500652_006882	Ga0500652_006882_1258_2172	297
88	3300053136	Ga0500559_0022114	Ga0500559_0022114_829_1743	297
89	3300053157	Ga0500624_000015	Ga0500624_000015_138874_139788	297
90	3300053730	Ga0500645_001213	Ga0500645_001213_931_1851	297
91	iso_pu_bacteria	2844533157	2844536378	297
92	3300005530	Ga0070679_100427549	Ga0070679_1004275492	298
93	iso_pu_bacteria	2508501114	2509076258	298
94	iso_pu_bacteria	2510065019	2510132971	298
95	iso_pu_bacteria	2510461076	2510894350	298
96	iso_pu_bacteria	2510461076	2510899375	298
97	iso_pu_bacteria	2510917022	2511136961	298
98	iso_pu_bacteria	2510917028	2511184314	298
99	iso_pu_bacteria	2510917030	2511195760	298
100	iso_pu_bacteria	2513237084	2513569933	298
101	iso_pu_bacteria	2513237085	2513575206	298
102	iso_pu_bacteria	2513237093	2513633115	298
103	iso_pu_bacteria	2513237103	2513710147	298
104	iso_pu_bacteria	2513237138	2513866158	298
105	iso_pu_bacteria	2513237144	2513910782	298
106	iso_pu_bacteria	2513237146	2513927249	298
107	iso_pu_bacteria	2513237162	2514021794	298
108	iso_pu_bacteria	2515075009	2515111922	298
109	iso_pu_bacteria	2515154113	2515633726	298
110	iso_pu_bacteria	2515154114	2515645100	298
111	iso_pu_bacteria	2515154116	2515660244	298
112	iso_pu_bacteria	2515154134	2515738902	298
113	iso_pu_bacteria	2516653077	2517035663	298
114	iso_pu_bacteria	2516653085	2517076090	298
115	iso_pu_bacteria	2517093000	2517094844	298
116	iso_pu_bacteria	2517287029	2517406468	298
117	iso_pu_bacteria	2582581294	2585200908	298
118	iso_pu_bacteria	2582581307	2585272232	298
119	iso_pu_bacteria	2582581867	2585405230	298
120	iso_pu_bacteria	2585427526	2585528244	298
121	iso_pu_bacteria	2585427528	2585540442	298
122	iso_pu_bacteria	2585427531	2585561704	298
123	iso_pu_bacteria	2585427590	2585823436	298
124	iso_pu_bacteria	2585427593	2585838653	298
125	iso_pu_bacteria	2585427608	2585899548	298
126	iso_pu_bacteria	2585427609	2585906932	298
127	iso_pu_bacteria	2585428125	2587982353	298
128	iso_pu_bacteria	2599185170	2599415310	298
129	iso_pu_bacteria	2615840698	2616555679	298
130	iso_pu_bacteria	2643221563	2643832472	298
131	iso_pu_bacteria	2643221608	2644053733	298
132	iso_pu_bacteria	2643221634	2644194463	298
133	iso_pu_bacteria	2667528174	2671115510	298
134	iso_pu_bacteria	2718217997	2719665320	298
135	iso_pu_bacteria	2718218199	2720491740	298
136	iso_pu_bacteria	2721755823	2724109908	298
137	iso_pu_bacteria	2724679232	2725949853	298
138	iso_pu_bacteria	2738541333	2739037934	298
139	iso_pu_bacteria	2765235942	2766062351	298
140	iso_pu_bacteria	2791355263	2793341242	298
141	iso_pu_bacteria	2791355266	2793361479	298
142	iso_pu_bacteria	2802429606	2805935588	298
143	iso_pu_bacteria	2802429633	2806045457	298
144	iso_pu_bacteria	2802429634	2806051740	298
145	iso_pu_bacteria	2802429635	2806061784	298
146	iso_pu_bacteria	2802429636	2806067965	298
147	iso_pu_bacteria	2802429637	2806072686	298
148	iso_pu_bacteria	2821443989	2821449730	298
149	iso_pu_bacteria	2838029111	2838031784	298
150	iso_pu_bacteria	2838035591	2838038965	298
151	iso_pu_bacteria	2838661181	2838664443	298
152	iso_pu_bacteria	2838686498	2838689161	298
153	iso_pu_bacteria	2838707686	2838709654	298
154	iso_pu_bacteria	2838729681	2838730509	298
155	iso_pu_bacteria	2838742623	2838743450	298
156	iso_pu_bacteria	2841851746	2841854874	298
157	iso_pu_bacteria	2842110456	2842110844	298
158	iso_pu_bacteria	2842118031	2842119664	298
159	iso_pu_bacteria	2842156927	2842157737	298
160	iso_pu_bacteria	2842163707	2842164948	298
161	iso_pu_bacteria	2842180545	2842180678	298
162	iso_pu_bacteria	2842229732	2842231270	298
163	iso_pu_bacteria	2842257432	2842258442	298
164	iso_pu_bacteria	2842264693	2842267469	298
165	iso_pu_bacteria	2842271015	2842273181	298
166	iso_pu_bacteria	2842291075	2842291490	298
167	iso_pu_bacteria	2842304105	2842309336	298
168	iso_pu_bacteria	2842311132	2842315465	298
169	iso_pu_bacteria	2842363717	2842366600	298
170	iso_pu_bacteria	2842370503	2842373101	298
171	iso_pu_bacteria	2842384541	2842386173	298
172	iso_pu_bacteria	2842428310	2842431953	298
173	iso_pu_bacteria	2842434925	2842438066	298
174	iso_pu_bacteria	2842441272	2842444879	298
175	iso_pu_bacteria	2842462802	2842465743	298
176	iso_pu_bacteria	2842469257	2842472683	298
177	iso_pu_bacteria	2842475841	2842478516	298
178	iso_pu_bacteria	2842502639	2842505539	298
179	iso_pu_bacteria	2844454524	2844459484	298
180	iso_pu_bacteria	2857516855	2857523758	298
181	iso_pu_bacteria	2899803654	2899807094	298
182	iso_pu_bacteria	2919100787	2919103254	298
183	iso_pu_bacteria	2919408235	2919412166	298
184	iso_pu_bacteria	2923556063	2923561648	298
185	iso_pu_bacteria	2933016740	2933023122	298
186	iso_pu_bacteria	2933570622	2933575891	298
187	iso_pu_bacteria	2933586486	2933586869	298
188	iso_pu_bacteria	2935894831	2935899029	298
189	iso_pu_bacteria	2935901341	2935904405	298
190	iso_pu_bacteria	2936367885	2936373068	298
191	iso_pu_bacteria	2936375103	2936381213	298
192	iso_pu_bacteria	2936381700	2936385994	298
193	iso_pu_bacteria	3002141150	3002145370	298
194	iso_pu_bacteria	8005258706	8005260643	298
195	iso_pu_bacteria	8005307578	8005314193	298
196	iso_pu_bacteria	8005376324	8005378864	298
197	iso_pu_bacteria	8005460587	8005462582	298
198	iso_pu_bacteria	8005556819	8005558047	298
199	iso_pu_bacteria	8005563573	8005569221	298
200	iso_pu_bacteria	8005570704	8005575489	298
201	iso_pu_bacteria	8005682033	8005685960	298
202	iso_pu_bacteria	8023680758	8023681025	298
203	iso_pu_bacteria	8057874678	8057875417	298
204	3300003316	rootH1_10072506	rootH1_100725062	299
205	3300003322	rootL2_10089696	rootL2_100896966	299
206	3300005327	Ga0070658_10002075	Ga0070658_100020752	299
207	3300005327	Ga0070658_10025882	Ga0070658_100258826	299
208	3300005327	Ga0070658_10346301	Ga0070658_103463011	299
209	3300005329	Ga0070683_100073275	Ga0070683_1000732752	299
210	3300005339	Ga0070660_100038671	Ga0070660_1000386712	299
211	3300005339	Ga0070660_100052759	Ga0070660_1000527593	299
212	3300005344	Ga0070661_100017899	Ga0070661_1000178993	299
213	3300005366	Ga0070659_100000196	Ga0070659_1000001969	299
214	3300005366	Ga0070659_100018741	Ga0070659_1000187413	299
215	3300005366	Ga0070659_100071639	Ga0070659_1000716392	299
216	3300005435	Ga0070714_100118700	Ga0070714_1001187002	299
217	3300005436	Ga0070713_100007701	Ga0070713_1000077015	299
218	3300005458	Ga0070681_10021886	Ga0070681_100218862	299
219	3300005458	Ga0070681_10390666	Ga0070681_103906662	299
220	3300005530	Ga0070679_100001140	Ga0070679_10000114023	299
221	3300005530	Ga0070679_100025175	Ga0070679_1000251752	299
222	3300005530	Ga0070679_100034911	Ga0070679_1000349113	299
223	3300005530	Ga0070679_100260812	Ga0070679_1002608122	299
224	3300005535	Ga0070684_100127378	Ga0070684_1001273781	299
225	3300005539	Ga0068853_100019888	Ga0068853_1000198883	299
226	3300005539	Ga0068853_100206453	Ga0068853_1002064532	299
227	3300005563	Ga0068855_100020901	Ga0068855_1000209013	299
228	3300005563	Ga0068855_100036087	Ga0068855_1000360874	299
229	3300005563	Ga0068855_100053629	Ga0068855_1000536293	299
230	3300005563	Ga0068855_100129708	Ga0068855_1001297082	299
231	3300005578	Ga0068854_100000003	Ga0068854_100000003211	299
232	3300005578	Ga0068854_100004451	Ga0068854_1000044516	299
233	3300005614	Ga0068856_100098423	Ga0068856_1000984232	299
234	3300005614	Ga0068856_100335682	Ga0068856_1003356822	299
235	3300005616	Ga0068852_100024450	Ga0068852_1000244503	299
236	3300005834	Ga0068851_10042156	Ga0068851_100421562	299
237	3300006028	Ga0070717_10235152	Ga0070717_102351522	299
238	3300006175	Ga0070712_100027643	Ga0070712_1000276434	299
239	3300009093	Ga0105240_10002361	Ga0105240_1000236112	299
240	3300009545	Ga0105237_10095817	Ga0105237_100958172	299
241	3300009551	Ga0105238_10085871	Ga0105238_100858712	299
242	3300009551	Ga0105238_10093547	Ga0105238_100935473	299
243	3300009551	Ga0105238_10549761	Ga0105238_105497611	299
244	3300013104	Ga0157370_10001189	Ga0157370_100011894	299
245	3300013104	Ga0157370_10011933	Ga0157370_100119336	299
246	3300013104	Ga0157370_10028916	Ga0157370_100289162	299
247	3300013104	Ga0157370_10040227	Ga0157370_100402273	299
248	3300013104	Ga0157370_10141578	Ga0157370_101415781	299
249	3300013104	Ga0157370_10397112	Ga0157370_103971121	299
250	3300013105	Ga0157369_10009564	Ga0157369_1000956413	299
251	3300013105	Ga0157369_10040827	Ga0157369_100408273	299
252	3300013105	Ga0157369_10240330	Ga0157369_102403301	299
253	3300013105	Ga0157369_10698775	Ga0157369_106987751	299
254	3300013296	Ga0157374_10022682	Ga0157374_100226822	299
255	3300013296	Ga0157374_10138923	Ga0157374_101389232	299
256	3300013296	Ga0157374_10185768	Ga0157374_101857681	299
257	3300013306	Ga0163162_10010939	Ga0163162_100109395	299
258	3300013307	Ga0157372_10004795	Ga0157372_100047959	299
259	3300013307	Ga0157372_10009510	Ga0157372_100095105	299
260	3300013307	Ga0157372_10009728	Ga0157372_100097283	299
261	3300013307	Ga0157372_10017389	Ga0157372_100173899	299
262	3300013307	Ga0157372_10063722	Ga0157372_100637222	299
263	3300013307	Ga0157372_10115057	Ga0157372_101150572	299
264	3300014969	Ga0157376_10108550	Ga0157376_101085502	299
265	3300021361	Ga0213872_10001965	Ga0213872_100019654	299
266	3300025261	Ga0209233_1001685	Ga0209233_10016855	299
267	3300025904	Ga0207647_10003136	Ga0207647_100031369	299
268	3300025909	Ga0207705_10002775	Ga0207705_100027757	299
269	3300025909	Ga0207705_10004616	Ga0207705_100046163	299
270	3300025909	Ga0207705_10017552	Ga0207705_100175522	299
271	3300025909	Ga0207705_10031181	Ga0207705_100311812	299
272	3300025912	Ga0207707_10039109	Ga0207707_100391093	299
273	3300025913	Ga0207695_10021901	Ga0207695_100219014	299
274	3300025913	Ga0207695_10141395	Ga0207695_101413952	299
275	3300025914	Ga0207671_10159144	Ga0207671_101591441	299
276	3300025915	Ga0207693_10118491	Ga0207693_101184912	299
277	3300025919	Ga0207657_10008113	Ga0207657_100081133	299
278	3300025919	Ga0207657_10244309	Ga0207657_102443091	299
279	3300025921	Ga0207652_10042018	Ga0207652_100420182	299
280	3300025921	Ga0207652_10110653	Ga0207652_101106531	299
281	3300025928	Ga0207700_10005505	Ga0207700_100055055	299
282	3300025929	Ga0207664_10229336	Ga0207664_102293362	299
283	3300025932	Ga0207690_10001287	Ga0207690_100012877	299
284	3300025932	Ga0207690_10027423	Ga0207690_100274232	299
285	3300025941	Ga0207711_10308037	Ga0207711_103080371	299
286	3300025944	Ga0207661_10017470	Ga0207661_100174706	299
287	3300025949	Ga0207667_10020411	Ga0207667_100204113	299
288	3300025949	Ga0207667_10051186	Ga0207667_100511863	299
289	3300025949	Ga0207667_10067313	Ga0207667_100673132	299
290	3300025949	Ga0207667_10097137	Ga0207667_100971372	299
291	3300025949	Ga0207667_10308486	Ga0207667_103084861	299
292	3300025981	Ga0207640_10000002	Ga0207640_10000002368	299
293	3300025981	Ga0207640_10026103	Ga0207640_100261032	299
294	3300025986	Ga0207658_10046905	Ga0207658_100469052	299
295	3300026041	Ga0207639_10000011	Ga0207639_10000011243	299
296	3300026041	Ga0207639_10144572	Ga0207639_101445722	299
297	3300026067	Ga0207678_10001224	Ga0207678_100012245	299
298	3300026067	Ga0207678_10013803	Ga0207678_100138034	299
299	3300026067	Ga0207678_10031464	Ga0207678_100314643	299
300	3300026067	Ga0207678_10134544	Ga0207678_101345442	299
301	3300026116	Ga0207674_10021140	Ga0207674_100211403	299
302	3300026142	Ga0207698_10064810	Ga0207698_100648102	299
303	3300028379	Ga0268266_10000591	Ga0268266_1000059125	299
304	3300028379	Ga0268266_10000848	Ga0268266_1000084821	299
305	3300028379	Ga0268266_10617054	Ga0268266_106170541	299
306	3300028800	Ga0265338_10043006	Ga0265338_100430062	299
307	3300035172	Ga0373955_0020086	Ga0373955_0020086_1715_2620	299
308	3300036401	Ga0373937_0023937	Ga0373937_0023937_748_1653	299
309	3300037466	Ga0395898_0036761	Ga0395898_0036761_2554_3459	299
310	3300037466	Ga0395898_0139510	Ga0395898_0139510_93_998	299
311	3300039447	Ga0436361_0166862	Ga0436361_0166862_13676_14581	299
312	3300044684	Ga0466966_0074823	Ga0466966_0074823_405_1319	299
313	3300044765	Ga0466970_0197812	Ga0466970_0197812_148_1062	299
314	3300045049	Ga0466959_0186050	Ga0466959_0186050_58_972	299
315	3300046455	Ga0495603_0093293	Ga0495603_0093293_357_1271	299
316	3300046459	Ga0495629_0001532	Ga0495629_0001532_8677_9591	299
317	3300046459	Ga0495629_0017412	Ga0495629_0017412_1293_2207	299
318	3300046461	Ga0495641_0090872	Ga0495641_0090872_400_1314	299
319	3300046462	Ga0495651_0021819	Ga0495651_0021819_3499_4404	299
320	3300046462	Ga0495651_0054199	Ga0495651_0054199_152_1066	299
321	3300046472	Ga0495580_0136485	Ga0495580_0136485_632_1546	299
322	3300046473	Ga0495582_0001945	Ga0495582_0001945_2325_3239	299
323	3300046475	Ga0495639_0003398	Ga0495639_0003398_4884_5798	299
324	3300046477	Ga0495664_0016129	Ga0495664_0016129_1288_2202	299
325	3300046499	Ga0495594_0000216	Ga0495594_0000216_15024_15938	299
326	3300046499	Ga0495594_0000830	Ga0495594_0000830_10211_11125	299
327	3300046507	Ga0495606_0063747	Ga0495606_0063747_1077_1991	299
328	3300046514	Ga0495618_0026199	Ga0495618_0026199_372_1286	299
329	3300046516	Ga0495628_0113714	Ga0495628_0113714_1102_2016	299
330	3300046518	Ga0495631_0129401	Ga0495631_0129401_98_1012	299
331	3300046529	Ga0495652_0003656	Ga0495652_0003656_5261_6166	299
332	3300046529	Ga0495652_0026592	Ga0495652_0026592_867_1781	299
333	3300046531	Ga0495665_0000653	Ga0495665_0000653_11906_12820	299
334	3300046533	Ga0495640_0013089	Ga0495640_0013089_2075_2989	299
335	3300046536	Ga0495587_0014225	Ga0495587_0014225_1522_2427	299
336	3300046543	Ga0495645_0001418	Ga0495645_0001418_9668_10573	299
337	3300046543	Ga0495645_0028243	Ga0495645_0028243_1972_2886	299
338	3300046557	Ga0495622_0006235	Ga0495622_0006235_1093_2007	299
339	3300046559	Ga0495667_0150727	Ga0495667_0150727_103_1017	299
340	3300046642	Ga0495634_0054133	Ga0495634_0054133_481_1395	299
341	3300046660	Ga0495625_0001382	Ga0495625_0001382_6235_7149	299
342	3300046663	Ga0495635_0012973	Ga0495635_0012973_4720_5625	299
343	3300046663	Ga0495635_0066753	Ga0495635_0066753_1288_2202	299
344	3300046674	Ga0495588_0053243	Ga0495588_0053243_1151_2065	299
345	3300046678	Ga0495599_0001842	Ga0495599_0001842_10188_11102	299
346	3300046679	Ga0495623_0123849	Ga0495623_0123849_170_1075	299
347	3300046689	Ga0495613_0015379	Ga0495613_0015379_4637_5551	299
348	3300046689	Ga0495613_0102050	Ga0495613_0102050_931_1845	299
349	3300046689	Ga0495613_0152386	Ga0495613_0152386_204_1109	299
350	3300046690	Ga0495624_0004269	Ga0495624_0004269_9480_10394	299
351	3300046694	Ga0495649_0023443	Ga0495649_0023443_2112_3017	299
352	3300047315	Ga0495581_0179605	Ga0495581_0179605_259_1173	299
353	3300047317	Ga0495604_0028598	Ga0495604_0028598_2190_3095	299
354	3300047317	Ga0495604_0032372	Ga0495604_0032372_2191_3105	299
355	3300047320	Ga0495672_0127831	Ga0495672_0127831_255_1169	299
356	3300047321	Ga0495676_0002006	Ga0495676_0002006_13694_14608	299
357	3300047323	Ga0495683_0092545	Ga0495683_0092545_82_996	299
358	3300047444	Ga0495675_0006178	Ga0495675_0006178_285_1199	299
359	3300047471	Ga0495684_0031387	Ga0495684_0031387_2495_3400	299
360	3300047472	Ga0495686_0005184	Ga0495686_0005184_6536_7450	299
361	3300047472	Ga0495686_0006435	Ga0495686_0006435_2102_3046	299
362	3300047472	Ga0495686_0035761	Ga0495686_0035761_1990_2934	299
363	3300047673	Ga0495593_0052968	Ga0495593_0052968_819_1733	299
364	3300048088	Ga0495602_0073224	Ga0495602_0073224_1476_2381	299
365	3300048089	Ga0495614_0001767	Ga0495614_0001767_4654_5568	299
366	3300048089	Ga0495614_0012116	Ga0495614_0012116_41_955	299
367	3300048907	Ga0496104_0000068	Ga0496104_0000068_250_1155	299
368	3300048929	Ga0496126_0000560	Ga0496126_0000560_24650_25555	299
369	3300048929	Ga0496126_0003087	Ga0496126_0003087_15387_16301	299
370	3300049460	Ga0495682_0088431	Ga0495682_0088431_124_1029	299
371	3300049569	Ga0501032_0001051	Ga0501032_0001051_2474_3379	299
372	3300049570	Ga0501033_0001028	Ga0501033_0001028_17205_18110	299
373	3300049571	Ga0501034_0003515	Ga0501034_0003515_4981_5886	299
374	3300049572	Ga0501036_0008500	Ga0501036_0008500_6132_7037	299
375	3300049573	Ga0501037_0000968	Ga0501037_0000968_13961_14866	299
376	3300049573	Ga0501037_0119408	Ga0501037_0119408_934_1848	299
377	3300049574	Ga0501038_0000341	Ga0501038_0000341_18508_19413	299
378	3300049575	Ga0501039_0459015	Ga0501039_0459015_60_965	299
379	3300049579	Ga0501043_0001705	Ga0501043_0001705_4958_5863	299
380	3300049580	Ga0501046_0000209	Ga0501046_0000209_8649_9554	299
381	3300049581	Ga0501047_0001733	Ga0501047_0001733_18303_19208	299
382	3300049581	Ga0501047_0031460	Ga0501047_0031460_261_1175	299
383	3300049586	Ga0501070_0040278	Ga0501070_0040278_436_1350	299
384	3300049589	Ga0501073_0004500	Ga0501073_0004500_5380_6285	299
385	3300049742	Ga0501080_0004950	Ga0501080_0004950_7271_8176	299
386	3300049742	Ga0501080_0400827	Ga0501080_0400827_196_1110	299
387	3300049822	Ga0501035_0013098	Ga0501035_0013098_2080_2985	299
388	3300049823	Ga0501044_0003941	Ga0501044_0003941_9826_10731	299
389	3300053093	Ga0500651_0000002	Ga0500651_0000002_33909_34823	299
390	3300053119	Ga0500595_000014	Ga0500595_000014_24387_25292	299
391	3300055283	Ga0500661_000991	Ga0500661_000991_2246_3151	299
392	iso_pu_bacteria	2509276021	2509386980	299
393	iso_pu_bacteria	2509276033	2509442508	299
394	iso_pu_bacteria	2519899620	2520379450	299
395	iso_pu_bacteria	2529292951	2530645226	299
396	iso_pu_bacteria	2615840624	2616292743	299
397	iso_pu_bacteria	2718217882	2719180897	299
398	iso_pu_bacteria	2718217927	2719385501	299
399	iso_pu_bacteria	2718218009	2719731646	299
400	iso_pu_bacteria	2718218232	2720613009	299
401	iso_pu_bacteria	2718218233	2720619859	299
402	iso_pu_bacteria	2718218235	2720631287	299
403	iso_pu_bacteria	2718218269	2720775014	299
404	iso_pu_bacteria	2718218363	2721146991	299
405	iso_pu_bacteria	2718218365	2721158521	299
406	iso_pu_bacteria	2718218366	2721163909	299
407	iso_pu_bacteria	2718218423	2721399249	299
408	iso_pu_bacteria	2721755514	2722840079	299
409	iso_pu_bacteria	2721755556	2723026653	299
410	iso_pu_bacteria	2721755684	2723560267	299
411	iso_pu_bacteria	2721755685	2723566834	299
412	iso_pu_bacteria	2721755809	2724038062	299
413	iso_pu_bacteria	2721755810	2724044402	299
414	iso_pu_bacteria	2721755819	2724089621	299
415	iso_pu_bacteria	2721755822	2724104099	299
416	iso_pu_bacteria	2728369352	2730107589	299
417	iso_pu_bacteria	2728369365	2730164134	299
418	iso_pu_bacteria	2728369397	2730298153	299
419	iso_pu_bacteria	2738541276	2738713819	299
420	iso_pu_bacteria	2791355256	2793298326	299
421	iso_pu_bacteria	2791355259	2793313803	299
422	iso_pu_bacteria	2791355260	2793324389	299
423	iso_pu_bacteria	2791355261	2793326408	299
424	iso_pu_bacteria	2791355262	2793337806	299
425	iso_pu_bacteria	2791355264	2793347585	299
426	iso_pu_bacteria	2791355265	2793352344	299
427	iso_pu_bacteria	2791355267	2793366496	299
428	iso_pu_bacteria	2802429605	2805927680	299
429	iso_pu_bacteria	2818991438	2819555447	299
430	iso_pu_bacteria	2838016132	2838018855	299
431	iso_pu_bacteria	2838022645	2838025442	299
432	iso_pu_bacteria	2838042994	2838043143	299
433	iso_pu_bacteria	2838048938	2838052079	299
434	iso_pu_bacteria	2838061910	2838067304	299
435	iso_pu_bacteria	2838068647	2838071419	299
436	iso_pu_bacteria	2838668709	2838670126	299
437	iso_pu_bacteria	2838680041	2838682534	299
438	iso_pu_bacteria	2838694306	2838697105	299
439	iso_pu_bacteria	2838701080	2838702497	299
440	iso_pu_bacteria	2841864319	2841864857	299
441	iso_pu_bacteria	2842077413	2842077828	299
442	iso_pu_bacteria	2842146304	2842146958	299
443	iso_pu_bacteria	2842192696	2842196940	299
444	iso_pu_bacteria	2842198810	2842201010	299
445	iso_pu_bacteria	2842205361	2842206338	299
446	iso_pu_bacteria	2842217011	2842223058	299
447	iso_pu_bacteria	2842237096	2842239067	299
448	iso_pu_bacteria	2842243621	2842244629	299
449	iso_pu_bacteria	2842250916	2842252023	299
450	iso_pu_bacteria	2842278818	2842279795	299
451	iso_pu_bacteria	2842285085	2842287442	299
452	iso_pu_bacteria	2842317721	2842318205	299
453	iso_pu_bacteria	2842341865	2842347215	299
454	iso_pu_bacteria	2842377471	2842377886	299
455	iso_pu_bacteria	2842395702	2842397360	299
456	iso_pu_bacteria	2842402390	2842405029	299
457	iso_pu_bacteria	2842409023	2842411611	299
458	iso_pu_bacteria	2842415677	2842417938	299
459	iso_pu_bacteria	2842422224	2842424923	299
460	iso_pu_bacteria	2842447887	2842451794	299
461	iso_pu_bacteria	2842489311	2842492830	299
462	iso_pu_bacteria	2842495871	2842496475	299
463	iso_pu_bacteria	2933599457	2933602218	299
464	iso_pu_bacteria	2996893221	2996898421	299
465	iso_pu_bacteria	639633055	639648217	299
466	iso_pu_bacteria	8005275841	8005280272	299
467	iso_pu_bacteria	8005282627	8005288338	299
468	iso_pu_bacteria	8005289223	8005294850	299
469	iso_pu_bacteria	8005301065	8005306989	299
470	iso_pu_bacteria	8005382845	8005388056	299
471	iso_pu_bacteria	8005395548	8005396988	299
472	iso_pu_bacteria	8005430974	8005433175	299
473	iso_pu_bacteria	8005497431	8005499961	299
474	iso_pu_bacteria	8005619151	8005621328	299
475	iso_pu_bacteria	8005626139	8005631383	299
476	iso_pu_bacteria	8005668836	8005671377	299
477	iso_pu_bacteria	8005688590	8005694904	299
478	iso_pu_bacteria	8005695170	8005696079	299
479	iso_pu_bacteria	8018127388	8018129618	299
480	iso_pu_bacteria	8018176218	8018177950	299
481	iso_pu_bacteria	8024479707	8024485824	299
482	iso_pu_bacteria	8024501048	8024505291	299
483	iso_pu_bacteria	8056375014	8056380208	299
484	iso_pu_bacteria	8056382006	8056387498	299
485	3300002737	JGI25162J39368_1000847	JGI25162J39368_10008476	300
486	3300003214	JGI25165J46597_1001464	JGI25165J46597_10014647	300
487	3300003316	rootH1_10037045	rootH1_100370452	300
488	3300003320	rootH2_10066627	rootH2_1006662711	300
489	3300003322	rootL2_10004132	rootL2_1000413234	300
490	3300003373	JGI25407J50210_10035012	JGI25407J50210_100350122	300
491	3300003752	Ga0055539_1007632	Ga0055539_10076321	300
492	3300003794	Ga0055531_10000016	Ga0055531_10000016109	300
493	3300005344	Ga0070661_100037519	Ga0070661_1000375192	300
494	3300005455	Ga0070663_100368885	Ga0070663_1003688851	300
495	3300005563	Ga0068855_100001891	Ga0068855_1000018912	300
496	3300005614	Ga0068856_100413849	Ga0068856_1004138492	300
497	3300005616	Ga0068852_100264703	Ga0068852_1002647032	300
498	3300005834	Ga0068851_10091425	Ga0068851_100914252	300
499	3300005981	Ga0081538_10001432	Ga0081538_100014328	300
500	3300006163	Ga0070715_10017367	Ga0070715_100173673	300
501	3300006871	Ga0075434_100274336	Ga0075434_1002743361	300
502	3300009093	Ga0105240_10000214	Ga0105240_1000021461	300
503	3300009093	Ga0105240_10037153	Ga0105240_100371534	300
504	3300009174	Ga0105241_10358361	Ga0105241_103583611	300
505	3300009545	Ga0105237_10002620	Ga0105237_1000262015	300
506	3300010375	Ga0105239_10034191	Ga0105239_100341914	300
507	3300013102	Ga0157371_10101145	Ga0157371_101011452	300
508	3300013104	Ga0157370_10005411	Ga0157370_100054113	300
509	3300013104	Ga0157370_10047187	Ga0157370_100471873	300
510	3300013104	Ga0157370_10246827	Ga0157370_102468272	300
511	3300013105	Ga0157369_10000394	Ga0157369_1000039423	300
512	3300013105	Ga0157369_10000559	Ga0157369_1000055912	300
513	3300015262	Ga0182007_10008968	Ga0182007_100089684	300
514	3300020070	Ga0206356_10029665	Ga0206356_100296652	300
515	3300022467	Ga0224712_10008964	Ga0224712_100089642	300
516	3300025233	Ga0209437_100239	Ga0209437_10023968	300
517	3300025253	Ga0209677_100457	Ga0209677_10045726	300
518	3300025261	Ga0209233_1000214	Ga0209233_1000214106	300
519	3300025261	Ga0209233_1000245	Ga0209233_100024514	300
520	3300025298	Ga0209050_1000026	Ga0209050_1000026346	300
521	3300025304	Ga0209257_1000009	Ga0209257_1000009346	300
522	3300025905	Ga0207685_10010120	Ga0207685_100101202	300
523	3300025909	Ga0207705_10002880	Ga0207705_100028807	300
524	3300025913	Ga0207695_10000373	Ga0207695_1000037344	300
525	3300025914	Ga0207671_10000448	Ga0207671_1000044845	300
526	3300025924	Ga0207694_10285624	Ga0207694_102856241	300
527	3300025949	Ga0207667_10004871	Ga0207667_1000487115	300
528	3300026067	Ga0207678_10420767	Ga0207678_104207671	300
529	3300026142	Ga0207698_10438730	Ga0207698_104387302	300
530	3300028794	Ga0307515_10000027	Ga0307515_1000002739	300
531	3300031456	Ga0307513_10051320	Ga0307513_100513202	300
532	3300031548	Ga0307408_100000063	Ga0307408_10000006352	300
533	3300031730	Ga0307516_10002388	Ga0307516_1000238822	300
534	3300031901	Ga0307406_10001042	Ga0307406_100010427	300
535	3300037418	Ga0395900_0000986	Ga0395900_0000986_15828_16742	300
536	3300037418	Ga0395900_0010267	Ga0395900_0010267_8649_9563	300
537	3300037466	Ga0395898_0002142	Ga0395898_0002142_23264_24178	300
538	3300038443	Ga0395901_0001736	Ga0395901_0001736_21557_22471	300
539	3300038443	Ga0395901_0017480	Ga0395901_0017480_99_1013	300
540	3300039062	Ga0400483_167880	Ga0400483_167880_120_1055	300
541	3300041404	Ga0439436_0017156	Ga0439436_0017156_732_1670	300
542	3300041406	Ga0439439_0009681	Ga0439439_0009681_813_1751	300
543	3300041410	Ga0439461_0000072	Ga0439461_0000072_11719_12657	300
544	3300041413	Ga0439465_0001099	Ga0439465_0001099_4935_5873	300
545	3300042002	Ga0439442_000646	Ga0439442_000646_5454_6392	300
546	3300042004	Ga0439445_0000422	Ga0439445_0000422_657_1595	300
547	3300042006	Ga0439432_000093	Ga0439432_000093_7987_8925	300
548	3300042156	Ga0439446_0027661	Ga0439446_0027661_525_1463	300
549	3300042435	Ga0439434_0000066	Ga0439434_0000066_20124_21062	300
550	3300044684	Ga0466966_0093224	Ga0466966_0093224_789_1703	300
551	3300044694	Ga0466963_0010433	Ga0466963_0010433_1097_2011	300
552	3300044719	Ga0466971_0000786	Ga0466971_0000786_2206_3120	300
553	3300044842	Ga0466957_0001165	Ga0466957_0001165_8567_9481	300
554	3300045836	Ga0466958_0031042	Ga0466958_0031042_974_1888	300
555	3300046660	Ga0495625_0155162	Ga0495625_0155162_192_1118	300
556	3300048903	Ga0496100_0138145	Ga0496100_0138145_534_1436	300
557	3300048904	Ga0496101_0146148	Ga0496101_0146148_145_1047	300
558	3300048905	Ga0496102_0040557	Ga0496102_0040557_3291_4193	300
559	3300048906	Ga0496103_0165637	Ga0496103_0165637_315_1217	300
560	3300048919	Ga0496116_0061844	Ga0496116_0061844_761_1663	300
561	3300048920	Ga0496117_0008200	Ga0496117_0008200_2420_3322	300
562	3300048921	Ga0496118_0018936	Ga0496118_0018936_311_1213	300
563	3300048922	Ga0496119_0044466	Ga0496119_0044466_1700_2602	300
564	3300048924	Ga0496121_0000357	Ga0496121_0000357_20389_21303	300
565	3300048928	Ga0496125_0002040	Ga0496125_0002040_26241_27143	300
566	3300048929	Ga0496126_0002265	Ga0496126_0002265_20349_21263	300
567	3300048929	Ga0496126_0045971	Ga0496126_0045971_228_1130	300
568	3300049581	Ga0501047_0042764	Ga0501047_0042764_2109_3023	300
569	3300049583	Ga0501067_0125292	Ga0501067_0125292_332_1234	300
570	3300061719	Ga0466962_0000531	Ga0466962_0000531_6117_7031	300
571	iso_pu_bacteria	2791355048	2792461617	300
572	iso_pu_bacteria	2843744320	2843746324	300
573	iso_pu_bacteria	2849560528	2849562001	300
574	iso_pu_bacteria	2849573788	2849575807	300
575	iso_pu_bacteria	2851153111	2851156278	300
576	iso_pu_bacteria	2898329390	2898331803	300
577	iso_pu_bacteria	2946033335	2946036778	300
578	iso_pu_bacteria	8056054917	8056058453	300
579	3300001990	JGI24737J22298_10004506	JGI24737J22298_100045063	301
580	3300002067	JGI24735J21928_10000165	JGI24735J21928_100001655	301
581	3300002075	JGI24738J21930_10000011	JGI24738J21930_1000001115	301
582	3300003781	Ga0055536_1041595	Ga0055536_10415951	301
583	3300003791	Ga0055530_10043481	Ga0055530_100434811	301
584	3300005457	Ga0070662_100029021	Ga0070662_1000290213	301
585	3300013104	Ga0157370_10070950	Ga0157370_100709504	301
586	3300013306	Ga0163162_10106422	Ga0163162_101064222	301
587	3300025229	Ga0209147_100302	Ga0209147_10030217	301
588	3300025298	Ga0209050_1049174	Ga0209050_10491741	301
589	3300025299	Ga0209256_1048129	Ga0209256_10481291	301
590	3300025303	Ga0209051_1050232	Ga0209051_10502322	301
591	3300025304	Ga0209257_1000532	Ga0209257_10005321	301
592	3300025932	Ga0207690_10374316	Ga0207690_103743162	301
593	3300025933	Ga0207706_10005670	Ga0207706_100056704	301
594	3300025945	Ga0207679_10335959	Ga0207679_103359592	301
595	3300028794	Ga0307515_10085225	Ga0307515_100852251	301
596	3300031456	Ga0307513_10073911	Ga0307513_100739112	301
597	3300041404	Ga0439436_0020452	Ga0439436_0020452_93_1010	301
598	3300042007	Ga0439449_0001386	Ga0439449_0001386_726_1643	301
599	3300042014	Ga0439457_007480	Ga0439457_007480_457_1374	301
600	3300042146	Ga0450907_004110	Ga0450907_004110_1342_2259	301
601	3300042146	Ga0450907_021205	Ga0450907_021205_66_983	301
602	3300044693	Ga0466961_0143890	Ga0466961_0143890_146_1063	301
603	3300045836	Ga0466958_0028155	Ga0466958_0028155_2276_3193	301
604	3300047472	Ga0495686_0000557	Ga0495686_0000557_38433_39368	301
605	3300049568	Ga0501031_0000112	Ga0501031_0000112_2491_3408	301
606	3300049569	Ga0501032_0001341	Ga0501032_0001341_3514_4431	301
607	3300049570	Ga0501033_0010985	Ga0501033_0010985_4752_5669	301
608	3300049571	Ga0501034_0012428	Ga0501034_0012428_2753_3670	301
609	3300049572	Ga0501036_0001867	Ga0501036_0001867_8503_9420	301
610	3300049573	Ga0501037_0004848	Ga0501037_0004848_5112_6029	301
611	3300049574	Ga0501038_0007160	Ga0501038_0007160_438_1355	301
612	3300049575	Ga0501039_0004789	Ga0501039_0004789_4757_5674	301
613	3300049578	Ga0501042_0043486	Ga0501042_0043486_111_1028	301
614	3300049579	Ga0501043_0000679	Ga0501043_0000679_15285_16202	301
615	3300049580	Ga0501046_0000230	Ga0501046_0000230_47794_48711	301
616	3300049581	Ga0501047_0002902	Ga0501047_0002902_8625_9542	301
617	3300049582	Ga0501048_0000713	Ga0501048_0000713_15181_16098	301
618	3300049584	Ga0501068_0049712	Ga0501068_0049712_654_1571	301
619	3300049586	Ga0501070_0000838	Ga0501070_0000838_5915_6832	301
620	3300049589	Ga0501073_0008267	Ga0501073_0008267_3516_4433	301
621	3300049590	Ga0501074_0006531	Ga0501074_0006531_3747_4664	301
622	3300049742	Ga0501080_0000870	Ga0501080_0000870_6584_7501	301
623	3300049744	Ga0501083_0199701	Ga0501083_0199701_147_1064	301
624	3300049822	Ga0501035_0018580	Ga0501035_0018580_1844_2761	301
625	3300049823	Ga0501044_0026675	Ga0501044_0026675_2590_3507	301
626	3300053134	Ga0500658_0014457	Ga0500658_0014457_955_1872	301
627	3300053156	Ga0500622_0018069	Ga0500622_0018069_1288_2205	301
628	3300054114	Ga0501084_0005104	Ga0501084_0005104_2753_3670	301
629	iso_pu_bacteria	2513237101	2513695619	301
630	iso_pu_bacteria	2515154123	2515689034	301
631	iso_pu_bacteria	2582581279	2585146193	301
632	iso_pu_bacteria	2585428106	2587919558	301
633	iso_pu_bacteria	2596583598	2597030569	301
634	iso_pu_bacteria	2599185178	2599447914	301
635	iso_pu_bacteria	2643221545	2643750645	301
636	iso_pu_bacteria	2643221552	2643778321	301
637	iso_pu_bacteria	2643221584	2643927419	301
638	iso_pu_bacteria	2643221622	2644128998	301
639	iso_pu_bacteria	2643221640	2644226510	301
640	iso_pu_bacteria	2643221642	2644235998	301
641	iso_pu_bacteria	2643221691	2644509719	301
642	iso_pu_bacteria	2643221733	2644729556	301
643	iso_pu_bacteria	2643221736	2644744863	301
644	iso_pu_bacteria	2721755755	2723846867	301
645	iso_pu_bacteria	2739367756	2739792359	301
646	iso_pu_bacteria	2791355199	2793076373	301
647	iso_pu_bacteria	2818991435	2819535806	301
648	iso_pu_bacteria	2818991454	2819646038	301
649	iso_pu_bacteria	2818991467	2819718990	301
650	iso_pu_bacteria	2848297114	2848298938	301
651	iso_pu_bacteria	2857504554	2857506827	301
652	iso_pu_bacteria	2874604998	2874611173	301
653	iso_pu_bacteria	2900577576	2900582843	301
654	iso_pu_bacteria	2922386360	2922387638	301
655	iso_pu_bacteria	2928058823	2928058900	301
656	iso_pu_bacteria	2928531327	2928534026	301
657	iso_pu_bacteria	2928972540	2928973975	301
658	iso_pu_bacteria	2977240413	2977241092	301
659	iso_pu_bacteria	8006964411	8006969054	301
660	iso_pu_bacteria	8006994254	8006995000	301
661	iso_pu_bacteria	8056673599	8056679577	301
662	3300001979	JGI24740J21852_10000002	JGI24740J21852_10000002109	302
663	3300001989	JGI24739J22299_10014392	JGI24739J22299_100143923	302
664	3300002067	JGI24735J21928_10013507	JGI24735J21928_100135073	302
665	3300002704	JGI25155J39150_1000021	JGI25155J39150_1000021104	302
666	3300002705	JGI25156J39149_1000022	JGI25156J39149_1000022103	302
667	3300002737	JGI25162J39368_1000144	JGI25162J39368_100014445	302
668	3300002738	JGI25154J39366_1000048	JGI25154J39366_100004813	302
669	3300002741	JGI25157J39369_1000025	JGI25157J39369_100002538	302
670	3300002773	JGI25152J39213_1005348	JGI25152J39213_10053484	302
671	3300002774	JGI25150J39212_1000415	JGI25150J39212_10004154	302
672	3300002987	JGI25159J45721_1001463	JGI25159J45721_10014638	302
673	3300003187	JGI25151J46595_10000143	JGI25151J46595_1000014319	302
674	3300003187	JGI25151J46595_10000238	JGI25151J46595_1000023873	302
675	3300003214	JGI25165J46597_1000066	JGI25165J46597_100006643	302
676	3300003214	JGI25165J46597_1000075	JGI25165J46597_100007586	302
677	3300003215	JGI25153J46596_10000158	JGI25153J46596_1000015835	302
678	3300003215	JGI25153J46596_10000172	JGI25153J46596_1000017241	302
679	3300003215	JGI25153J46596_10000679	JGI25153J46596_1000067915	302
680	3300003215	JGI25153J46596_10003267	JGI25153J46596_100032678	302
681	3300003215	JGI25153J46596_10004883	JGI25153J46596_100048834	302
682	3300003215	JGI25153J46596_10017836	JGI25153J46596_100178363	302
683	3300003354	JGI25160J50197_1001510	JGI25160J50197_10015102	302
684	3300003374	JGI25161J50226_1000119	JGI25161J50226_100011921	302
685	3300003771	Ga0055526_1000483	Ga0055526_10004833	302
686	3300003771	Ga0055526_1001371	Ga0055526_100137115	302
687	3300003775	Ga0055524_1009194	Ga0055524_10091944	302
688	3300003775	Ga0055524_1023151	Ga0055524_10231512	302
689	3300003781	Ga0055536_1001755	Ga0055536_10017554	302
690	3300003781	Ga0055536_1004635	Ga0055536_10046355	302
691	3300003790	Ga0055528_1000106	Ga0055528_100010640	302
692	3300003790	Ga0055528_1029019	Ga0055528_10290191	302
693	3300003791	Ga0055530_10000093	Ga0055530_1000009341	302
694	3300003791	Ga0055530_10000104	Ga0055530_100001047	302
695	3300003791	Ga0055530_10005872	Ga0055530_100058721	302
696	3300003791	Ga0055530_10015292	Ga0055530_100152922	302
697	3300003792	Ga0055540_1000103	Ga0055540_100010324	302
698	3300003792	Ga0055540_1005697	Ga0055540_10056972	302
699	3300003794	Ga0055531_10000854	Ga0055531_100008548	302
700	3300003794	Ga0055531_10002106	Ga0055531_1000210612	302
701	3300004625	Ga0055543_1001443	Ga0055543_10014438	302
702	3300005262	Ga0065165_1052495	Ga0065165_10524951	302
703	3300005327	Ga0070658_10000081	Ga0070658_1000008163	302
704	3300005327	Ga0070658_10018096	Ga0070658_100180964	302
705	3300005327	Ga0070658_10036254	Ga0070658_100362544	302
706	3300005327	Ga0070658_10110255	Ga0070658_101102552	302
707	3300005328	Ga0070676_10002279	Ga0070676_100022794	302
708	3300005329	Ga0070683_100019909	Ga0070683_1000199094	302
709	3300005330	Ga0070690_100125256	Ga0070690_1001252561	302
710	3300005334	Ga0068869_100007096	Ga0068869_1000070966	302
711	3300005334	Ga0068869_100162525	Ga0068869_1001625252	302
712	3300005334	Ga0068869_100213401	Ga0068869_1002134012	302
713	3300005335	Ga0070666_10015392	Ga0070666_100153924	302
714	3300005335	Ga0070666_10019567	Ga0070666_100195673	302
715	3300005335	Ga0070666_10140757	Ga0070666_101407571	302
716	3300005335	Ga0070666_10180666	Ga0070666_101806661	302
717	3300005338	Ga0068868_100013220	Ga0068868_1000132203	302
718	3300005338	Ga0068868_100051972	Ga0068868_1000519722	302
719	3300005339	Ga0070660_100000449	Ga0070660_1000004498	302
720	3300005339	Ga0070660_100002185	Ga0070660_1000021854	302
721	3300005339	Ga0070660_100007420	Ga0070660_1000074202	302
722	3300005339	Ga0070660_100168217	Ga0070660_1001682172	302
723	3300005340	Ga0070689_100018669	Ga0070689_1000186694	302
724	3300005344	Ga0070661_100133249	Ga0070661_1001332492	302
725	3300005347	Ga0070668_100117307	Ga0070668_1001173072	302
726	3300005347	Ga0070668_100197846	Ga0070668_1001978461	302
727	3300005353	Ga0070669_100377769	Ga0070669_1003777691	302
728	3300005354	Ga0070675_100033923	Ga0070675_1000339233	302
729	3300005356	Ga0070674_100002676	Ga0070674_1000026761	302
730	3300005356	Ga0070674_100019420	Ga0070674_1000194203	302
731	3300005356	Ga0070674_100027739	Ga0070674_1000277395	302
732	3300005356	Ga0070674_100356774	Ga0070674_1003567742	302
733	3300005364	Ga0070673_100031892	Ga0070673_1000318923	302
734	3300005364	Ga0070673_100042276	Ga0070673_1000422761	302
735	3300005365	Ga0070688_100092352	Ga0070688_1000923522	302
736	3300005366	Ga0070659_100178504	Ga0070659_1001785042	302
737	3300005367	Ga0070667_100012949	Ga0070667_1000129495	302
738	3300005367	Ga0070667_100065561	Ga0070667_1000655612	302
739	3300005367	Ga0070667_100169211	Ga0070667_1001692112	302
740	3300005367	Ga0070667_100201647	Ga0070667_1002016472	302
741	3300005438	Ga0070701_10169210	Ga0070701_101692101	302
742	3300005441	Ga0070700_100004967	Ga0070700_1000049674	302
743	3300005455	Ga0070663_100246887	Ga0070663_1002468871	302
744	3300005456	Ga0070678_100128043	Ga0070678_1001280432	302
745	3300005456	Ga0070678_100330057	Ga0070678_1003300571	302
746	3300005456	Ga0070678_100442527	Ga0070678_1004425271	302
747	3300005457	Ga0070662_100055602	Ga0070662_1000556022	302
748	3300005457	Ga0070662_100073063	Ga0070662_1000730632	302
749	3300005457	Ga0070662_100155934	Ga0070662_1001559342	302
750	3300005458	Ga0070681_10262927	Ga0070681_102629272	302
751	3300005459	Ga0068867_100006410	Ga0068867_1000064106	302
752	3300005466	Ga0070685_10012932	Ga0070685_100129323	302
753	3300005466	Ga0070685_10089343	Ga0070685_100893431	302
754	3300005468	Ga0070707_100021157	Ga0070707_1000211573	302
755	3300005530	Ga0070679_100043528	Ga0070679_1000435283	302
756	3300005530	Ga0070679_100074442	Ga0070679_1000744422	302
757	3300005530	Ga0070679_100238563	Ga0070679_1002385632	302
758	3300005539	Ga0068853_100004071	Ga0068853_10000407112	302
759	3300005539	Ga0068853_100018983	Ga0068853_1000189833	302
760	3300005539	Ga0068853_100068650	Ga0068853_1000686503	302
761	3300005539	Ga0068853_100366071	Ga0068853_1003660711	302
762	3300005543	Ga0070672_100003865	Ga0070672_10000386511	302
763	3300005544	Ga0070686_100000912	Ga0070686_1000009127	302
764	3300005545	Ga0070695_100012314	Ga0070695_1000123143	302
765	3300005547	Ga0070693_100087647	Ga0070693_1000876472	302
766	3300005548	Ga0070665_100000366	Ga0070665_10000036615	302
767	3300005548	Ga0070665_100003453	Ga0070665_1000034538	302
768	3300005548	Ga0070665_100010636	Ga0070665_1000106362	302
769	3300005548	Ga0070665_100054006	Ga0070665_1000540063	302
770	3300005548	Ga0070665_100212557	Ga0070665_1002125572	302
771	3300005548	Ga0070665_100217400	Ga0070665_1002174002	302
772	3300005548	Ga0070665_100370414	Ga0070665_1003704142	302
773	3300005563	Ga0068855_100001505	Ga0068855_10000150512	302
774	3300005563	Ga0068855_100001607	Ga0068855_1000016072	302
775	3300005563	Ga0068855_100068282	Ga0068855_1000682824	302
776	3300005563	Ga0068855_100370385	Ga0068855_1003703852	302
777	3300005577	Ga0068857_100148572	Ga0068857_1001485722	302
778	3300005578	Ga0068854_100000332	Ga0068854_10000033215	302
779	3300005578	Ga0068854_100481847	Ga0068854_1004818471	302
780	3300005614	Ga0068856_100009012	Ga0068856_1000090127	302
781	3300005614	Ga0068856_100091377	Ga0068856_1000913773	302
782	3300005614	Ga0068856_100116364	Ga0068856_1001163642	302
783	3300005614	Ga0068856_100193529	Ga0068856_1001935292	302
784	3300005616	Ga0068852_100000112	Ga0068852_10000011224	302
785	3300005616	Ga0068852_100004184	Ga0068852_10000418411	302
786	3300005616	Ga0068852_100293895	Ga0068852_1002938951	302
787	3300005617	Ga0068859_100000181	Ga0068859_10000018133	302
788	3300005617	Ga0068859_100002609	Ga0068859_1000026092	302
789	3300005617	Ga0068859_100105871	Ga0068859_1001058712	302
790	3300005617	Ga0068859_100316957	Ga0068859_1003169572	302
791	3300005617	Ga0068859_100487501	Ga0068859_1004875012	302
792	3300005618	Ga0068864_100210631	Ga0068864_1002106312	302
793	3300005618	Ga0068864_100296140	Ga0068864_1002961402	302
794	3300005718	Ga0068866_10113415	Ga0068866_101134152	302
795	3300005719	Ga0068861_100000001	Ga0068861_10000000132	302
796	3300005719	Ga0068861_100013657	Ga0068861_1000136574	302
797	3300005834	Ga0068851_10051249	Ga0068851_100512492	302
798	3300005834	Ga0068851_10140175	Ga0068851_101401751	302
799	3300005840	Ga0068870_10012019	Ga0068870_100120192	302
800	3300005840	Ga0068870_10022210	Ga0068870_100222103	302
801	3300005841	Ga0068863_100005995	Ga0068863_1000059953	302
802	3300005841	Ga0068863_100010675	Ga0068863_1000106752	302
803	3300005841	Ga0068863_100015163	Ga0068863_1000151633	302
804	3300005842	Ga0068858_100001503	Ga0068858_1000015035	302
805	3300005842	Ga0068858_100010168	Ga0068858_1000101686	302
806	3300005842	Ga0068858_100214145	Ga0068858_1002141452	302
807	3300005843	Ga0068860_100000626	Ga0068860_10000062626	302
808	3300005843	Ga0068860_100002486	Ga0068860_10000248611	302
809	3300005843	Ga0068860_100033163	Ga0068860_1000331635	302
810	3300005844	Ga0068862_100044476	Ga0068862_1000444762	302
811	3300005844	Ga0068862_100369111	Ga0068862_1003691111	302
812	3300005985	Ga0081539_10002538	Ga0081539_1000253817	302
813	3300005985	Ga0081539_10026488	Ga0081539_100264882	302
814	3300006038	Ga0075365_10021689	Ga0075365_100216892	302
815	3300006038	Ga0075365_10051173	Ga0075365_100511733	302
816	3300006042	Ga0075368_10000293	Ga0075368_1000029317	302
817	3300006048	Ga0075363_100022916	Ga0075363_1000229162	302
818	3300006177	Ga0075362_10002938	Ga0075362_100029385	302
819	3300006177	Ga0075362_10020189	Ga0075362_100201893	302
820	3300006177	Ga0075362_10034538	Ga0075362_100345382	302
821	3300006178	Ga0075367_10009892	Ga0075367_100098925	302
822	3300006178	Ga0075367_10029801	Ga0075367_100298012	302
823	3300006186	Ga0075369_10035431	Ga0075369_100354312	302
824	3300006186	Ga0075369_10050772	Ga0075369_100507722	302
825	3300006186	Ga0075369_10055125	Ga0075369_100551252	302
826	3300006195	Ga0075366_10003686	Ga0075366_100036868	302
827	3300006195	Ga0075366_10126625	Ga0075366_101266252	302
828	3300006237	Ga0097621_100000026	Ga0097621_1000000263	302
829	3300006237	Ga0097621_100011038	Ga0097621_1000110384	302
830	3300006237	Ga0097621_100078531	Ga0097621_1000785313	302
831	3300006353	Ga0075370_10002779	Ga0075370_100027792	302
832	3300006353	Ga0075370_10033845	Ga0075370_100338455	302
833	3300006353	Ga0075370_10110655	Ga0075370_101106552	302
834	3300006358	Ga0068871_100000173	Ga0068871_10000017326	302
835	3300006358	Ga0068871_100033725	Ga0068871_1000337254	302
836	3300006358	Ga0068871_100040431	Ga0068871_1000404313	302
837	3300006358	Ga0068871_100058229	Ga0068871_1000582293	302
838	3300006844	Ga0075428_100069649	Ga0075428_1000696492	302
839	3300006846	Ga0075430_100072583	Ga0075430_1000725834	302
840	3300006852	Ga0075433_10013215	Ga0075433_100132156	302
841	3300006871	Ga0075434_100076105	Ga0075434_1000761051	302
842	3300006881	Ga0068865_100039104	Ga0068865_1000391043	302
843	3300006881	Ga0068865_100137170	Ga0068865_1001371702	302
844	3300006931	Ga0097620_100000181	Ga0097620_10000018133	302
845	3300006931	Ga0097620_100002609	Ga0097620_1000026092	302
846	3300006931	Ga0097620_100105871	Ga0097620_1001058714	302
847	3300006931	Ga0097620_100316966	Ga0097620_1003169662	302
848	3300006931	Ga0097620_100487558	Ga0097620_1004875582	302
849	3300007076	Ga0075435_100038427	Ga0075435_1000384272	302
850	3300009093	Ga0105240_10000156	Ga0105240_1000015674	302
851	3300009093	Ga0105240_10000818	Ga0105240_100008186	302
852	3300009093	Ga0105240_10000989	Ga0105240_1000098913	302
853	3300009093	Ga0105240_10091182	Ga0105240_100911823	302
854	3300009093	Ga0105240_10098553	Ga0105240_100985532	302
855	3300009093	Ga0105240_10115371	Ga0105240_101153712	302
856	3300009093	Ga0105240_10170653	Ga0105240_101706533	302
857	3300009093	Ga0105240_10227780	Ga0105240_102277802	302
858	3300009101	Ga0105247_10004305	Ga0105247_100043055	302
859	3300009147	Ga0114129_10042066	Ga0114129_100420667	302
860	3300009147	Ga0114129_10298267	Ga0114129_102982672	302
861	3300009174	Ga0105241_10009827	Ga0105241_100098276	302
862	3300009174	Ga0105241_10046535	Ga0105241_100465352	302
863	3300009174	Ga0105241_10186601	Ga0105241_101866012	302
864	3300009174	Ga0105241_10212064	Ga0105241_102120641	302
865	3300009174	Ga0105241_10305543	Ga0105241_103055431	302
866	3300009176	Ga0105242_10015493	Ga0105242_100154932	302
867	3300009176	Ga0105242_10036511	Ga0105242_100365113	302
868	3300009176	Ga0105242_10042761	Ga0105242_100427613	302
869	3300009177	Ga0105248_10011870	Ga0105248_100118704	302
870	3300009177	Ga0105248_10059953	Ga0105248_100599531	302
871	3300009545	Ga0105237_10000325	Ga0105237_1000032527	302
872	3300009545	Ga0105237_10007004	Ga0105237_100070043	302
873	3300009551	Ga0105238_10015423	Ga0105238_100154238	302
874	3300009551	Ga0105238_10019896	Ga0105238_100198964	302
875	3300009551	Ga0105238_10022017	Ga0105238_100220173	302
876	3300009551	Ga0105238_10058822	Ga0105238_100588223	302
877	3300009551	Ga0105238_10082438	Ga0105238_100824383	302
878	3300009551	Ga0105238_10103013	Ga0105238_101030131	302
879	3300009551	Ga0105238_10118064	Ga0105238_101180642	302
880	3300009551	Ga0105238_10223844	Ga0105238_102238442	302
881	3300009551	Ga0105238_10295240	Ga0105238_102952402	302
882	3300009553	Ga0105249_10005328	Ga0105249_100053282	302
883	3300009553	Ga0105249_10188572	Ga0105249_101885722	302
884	3300009765	Ga0123341_1000095	Ga0123341_100009512	302
885	3300009766	Ga0123342_1016923	Ga0123342_10169234	302
886	3300009766	Ga0123342_1022764	Ga0123342_10227643	302
887	3300010375	Ga0105239_10000031	Ga0105239_10000031101	302
888	3300010375	Ga0105239_10000118	Ga0105239_1000011894	302
889	3300010375	Ga0105239_10352708	Ga0105239_103527082	302
890	3300010375	Ga0105239_10353886	Ga0105239_103538862	302
891	3300010375	Ga0105239_10734918	Ga0105239_107349181	302
892	3300011119	Ga0105246_10011976	Ga0105246_100119762	302
893	3300011119	Ga0105246_10060056	Ga0105246_100600562	302
894	3300013100	Ga0157373_10035964	Ga0157373_100359643	302
895	3300013100	Ga0157373_10127447	Ga0157373_101274472	302
896	3300013104	Ga0157370_10230352	Ga0157370_102303522	302
897	3300013105	Ga0157369_10002287	Ga0157369_1000228723	302
898	3300013105	Ga0157369_10008095	Ga0157369_100080958	302
899	3300013105	Ga0157369_10244295	Ga0157369_102442952	302
900	3300013296	Ga0157374_10000126	Ga0157374_1000012643	302
901	3300013296	Ga0157374_10028793	Ga0157374_100287932	302
902	3300013297	Ga0157378_10113601	Ga0157378_101136012	302
903	3300013297	Ga0157378_10181558	Ga0157378_101815582	302
904	3300013297	Ga0157378_10198529	Ga0157378_101985292	302
905	3300013306	Ga0163162_10018105	Ga0163162_100181053	302
906	3300013306	Ga0163162_10026191	Ga0163162_100261912	302
907	3300013306	Ga0163162_10053567	Ga0163162_100535672	302
908	3300013306	Ga0163162_10054544	Ga0163162_100545442	302
909	3300013306	Ga0163162_10221972	Ga0163162_102219722	302
910	3300013307	Ga0157372_10000580	Ga0157372_1000058023	302
911	3300013307	Ga0157372_10098781	Ga0157372_100987812	302
912	3300013308	Ga0157375_10262734	Ga0157375_102627342	302
913	3300013308	Ga0157375_10624214	Ga0157375_106242142	302
914	3300014325	Ga0163163_10000090	Ga0163163_100000904	302
915	3300014325	Ga0163163_10006727	Ga0163163_100067276	302
916	3300014325	Ga0163163_10012221	Ga0163163_100122216	302
917	3300014325	Ga0163163_10100649	Ga0163163_101006492	302
918	3300014326	Ga0157380_10017472	Ga0157380_100174724	302
919	3300014968	Ga0157379_10012446	Ga0157379_100124468	302
920	3300014968	Ga0157379_10017685	Ga0157379_100176857	302
921	3300014969	Ga0157376_10032060	Ga0157376_100320604	302
922	3300020077	Ga0206351_10046886	Ga0206351_100468861	302
923	3300020080	Ga0206350_10090852	Ga0206350_100908521	302
924	3300020610	Ga0154015_1656200	Ga0154015_16562002	302
925	3300021384	Ga0213876_10000873	Ga0213876_100008733	302
926	3300021384	Ga0213876_10141786	Ga0213876_101417862	302
927	3300025206	Ga0209435_100033	Ga0209435_10003334	302
928	3300025208	Ga0209436_100017	Ga0209436_10001735	302
929	3300025233	Ga0209437_100131	Ga0209437_10013183	302
930	3300025245	Ga0207425_1000019	Ga0207425_1000019136	302
931	3300025245	Ga0207425_1000475	Ga0207425_100047516	302
932	3300025245	Ga0207425_1007921	Ga0207425_10079212	302
933	3300025246	Ga0209646_1000116	Ga0209646_100011697	302
934	3300025246	Ga0209646_1004631	Ga0209646_10046313	302
935	3300025250	Ga0209026_1000103	Ga0209026_100010334	302
936	3300025253	Ga0209677_103558	Ga0209677_1035583	302
937	3300025256	Ga0209759_1000105	Ga0209759_100010597	302
938	3300025258	Ga0209129_1000474	Ga0209129_100047411	302
939	3300025258	Ga0209129_1001388	Ga0209129_10013884	302
940	3300025258	Ga0209129_1002155	Ga0209129_10021553	302
941	3300025258	Ga0209129_1002928	Ga0209129_10029283	302
942	3300025261	Ga0209233_1000045	Ga0209233_1000045391	302
943	3300025261	Ga0209233_1000132	Ga0209233_1000132102	302
944	3300025272	Ga0209455_1003956	Ga0209455_10039564	302
945	3300025272	Ga0209455_1005119	Ga0209455_10051193	302
946	3300025272	Ga0209455_1009546	Ga0209455_10095462	302
947	3300025272	Ga0209455_1009665	Ga0209455_10096652	302
948	3300025273	Ga0209673_1000139	Ga0209673_100013979	302
949	3300025273	Ga0209673_1005362	Ga0209673_10053625	302
950	3300025273	Ga0209673_1005469	Ga0209673_10054693	302
951	3300025273	Ga0209673_1008944	Ga0209673_10089441	302
952	3300025273	Ga0209673_1012134	Ga0209673_10121343	302
953	3300025273	Ga0209673_1012136	Ga0209673_10121363	302
954	3300025284	Ga0209130_1000001	Ga0209130_100000153	302
955	3300025284	Ga0209130_1000160	Ga0209130_100016069	302
956	3300025291	Ga0209675_1000188	Ga0209675_100018810	302
957	3300025292	Ga0209676_1000593	Ga0209676_100059312	302
958	3300025292	Ga0209676_1000908	Ga0209676_100090825	302
959	3300025292	Ga0209676_1002103	Ga0209676_10021033	302
960	3300025294	Ga0209025_1000237	Ga0209025_100023797	302
961	3300025294	Ga0209025_1000299	Ga0209025_100029988	302
962	3300025294	Ga0209025_1000559	Ga0209025_100055934	302
963	3300025294	Ga0209025_1007609	Ga0209025_10076092	302
964	3300025294	Ga0209025_1053061	Ga0209025_10530612	302
965	3300025295	Ga0209564_1000331	Ga0209564_100033137	302
966	3300025295	Ga0209564_1003107	Ga0209564_10031073	302
967	3300025295	Ga0209564_1010270	Ga0209564_10102703	302
968	3300025297	Ga0209758_1000007	Ga0209758_100000723	302
969	3300025297	Ga0209758_1000008	Ga0209758_1000008875	302
970	3300025297	Ga0209758_1000019	Ga0209758_1000019451	302
971	3300025297	Ga0209758_1000931	Ga0209758_100093122	302
972	3300025297	Ga0209758_1001313	Ga0209758_10013139	302
973	3300025297	Ga0209758_1001568	Ga0209758_100156813	302
974	3300025297	Ga0209758_1005602	Ga0209758_10056023	302
975	3300025297	Ga0209758_1012937	Ga0209758_10129372	302
976	3300025297	Ga0209758_1022587	Ga0209758_10225873	302
977	3300025297	Ga0209758_1026398	Ga0209758_10263983	302
978	3300025297	Ga0209758_1051704	Ga0209758_10517042	302
979	3300025298	Ga0209050_1000115	Ga0209050_1000115132	302
980	3300025298	Ga0209050_1000853	Ga0209050_100085317	302
981	3300025298	Ga0209050_1000935	Ga0209050_100093526	302
982	3300025298	Ga0209050_1005189	Ga0209050_10051892	302
983	3300025298	Ga0209050_1033503	Ga0209050_10335032	302
984	3300025299	Ga0209256_1000299	Ga0209256_100029932	302
985	3300025299	Ga0209256_1003540	Ga0209256_10035403	302
986	3300025299	Ga0209256_1009365	Ga0209256_10093653	302
987	3300025299	Ga0209256_1011492	Ga0209256_10114923	302
988	3300025302	Ga0207426_1000005	Ga0207426_1000005658	302
989	3300025302	Ga0207426_1000098	Ga0207426_100009873	302
990	3300025302	Ga0207426_1000290	Ga0207426_100029068	302
991	3300025303	Ga0209051_1000095	Ga0209051_100009546	302
992	3300025303	Ga0209051_1000950	Ga0209051_100095010	302
993	3300025303	Ga0209051_1004295	Ga0209051_10042952	302
994	3300025304	Ga0209257_1000160	Ga0209257_1000160106	302
995	3300025304	Ga0209257_1000259	Ga0209257_10002593	302
996	3300025304	Ga0209257_1000395	Ga0209257_100039518	302
997	3300025304	Ga0209257_1003744	Ga0209257_100374410	302
998	3300025304	Ga0209257_1015710	Ga0209257_10157102	302
999	3300025900	Ga0207710_10000380	Ga0207710_1000038019	302
1000	3300025900	Ga0207710_10015491	Ga0207710_100154912	302
1001	3300025903	Ga0207680_10014304	Ga0207680_100143043	302
1002	3300025903	Ga0207680_10119367	Ga0207680_101193671	302
1003	3300025904	Ga0207647_10000956	Ga0207647_100009567	302
1004	3300025904	Ga0207647_10020577	Ga0207647_100205772	302
1005	3300025904	Ga0207647_10076573	Ga0207647_100765732	302
1006	3300025905	Ga0207685_10062204	Ga0207685_100622041	302
1007	3300025907	Ga0207645_10009089	Ga0207645_100090895	302
1008	3300025907	Ga0207645_10073887	Ga0207645_100738872	302
1009	3300025908	Ga0207643_10002770	Ga0207643_100027707	302
1010	3300025909	Ga0207705_10000157	Ga0207705_100001573	302
1011	3300025909	Ga0207705_10006803	Ga0207705_100068037	302
1012	3300025909	Ga0207705_10024490	Ga0207705_100244902	302
1013	3300025909	Ga0207705_10102573	Ga0207705_101025732	302
1014	3300025911	Ga0207654_10037805	Ga0207654_100378052	302
1015	3300025912	Ga0207707_10150589	Ga0207707_101505892	302
1016	3300025913	Ga0207695_10000250	Ga0207695_1000025072	302
1017	3300025913	Ga0207695_10001582	Ga0207695_1000158226	302
1018	3300025913	Ga0207695_10002708	Ga0207695_1000270812	302
1019	3300025913	Ga0207695_10056921	Ga0207695_100569214	302
1020	3300025913	Ga0207695_10061675	Ga0207695_100616752	302
1021	3300025913	Ga0207695_10334345	Ga0207695_103343452	302
1022	3300025914	Ga0207671_10000100	Ga0207671_1000010095	302
1023	3300025914	Ga0207671_10003757	Ga0207671_1000375712	302
1024	3300025914	Ga0207671_10054011	Ga0207671_100540112	302
1025	3300025914	Ga0207671_10197078	Ga0207671_101970781	302
1026	3300025919	Ga0207657_10000820	Ga0207657_1000082011	302
1027	3300025919	Ga0207657_10006940	Ga0207657_100069403	302
1028	3300025919	Ga0207657_10013818	Ga0207657_100138185	302
1029	3300025919	Ga0207657_10064850	Ga0207657_100648502	302
1030	3300025920	Ga0207649_10222902	Ga0207649_102229022	302
1031	3300025920	Ga0207649_10280376	Ga0207649_102803761	302
1032	3300025921	Ga0207652_10009611	Ga0207652_100096115	302
1033	3300025921	Ga0207652_10312600	Ga0207652_103126002	302
1034	3300025923	Ga0207681_10019150	Ga0207681_100191502	302
1035	3300025924	Ga0207694_10012226	Ga0207694_100122264	302
1036	3300025924	Ga0207694_10020711	Ga0207694_100207114	302
1037	3300025924	Ga0207694_10090012	Ga0207694_100900122	302
1038	3300025924	Ga0207694_10099691	Ga0207694_100996912	302
1039	3300025924	Ga0207694_10286376	Ga0207694_102863762	302
1040	3300025925	Ga0207650_10074024	Ga0207650_100740242	302
1041	3300025925	Ga0207650_10140882	Ga0207650_101408822	302
1042	3300025927	Ga0207687_10036136	Ga0207687_100361363	302
1043	3300025931	Ga0207644_10028048	Ga0207644_100280484	302
1044	3300025931	Ga0207644_10138988	Ga0207644_101389881	302
1045	3300025932	Ga0207690_10174744	Ga0207690_101747442	302
1046	3300025933	Ga0207706_10006568	Ga0207706_100065682	302
1047	3300025933	Ga0207706_10055351	Ga0207706_100553512	302
1048	3300025934	Ga0207686_10026723	Ga0207686_100267232	302
1049	3300025934	Ga0207686_10030086	Ga0207686_100300862	302
1050	3300025935	Ga0207709_10062862	Ga0207709_100628622	302
1051	3300025935	Ga0207709_10165883	Ga0207709_101658831	302
1052	3300025936	Ga0207670_10317454	Ga0207670_103174542	302
1053	3300025937	Ga0207669_10011411	Ga0207669_100114112	302
1054	3300025937	Ga0207669_10026421	Ga0207669_100264212	302
1055	3300025937	Ga0207669_10081171	Ga0207669_100811712	302
1056	3300025937	Ga0207669_10108327	Ga0207669_101083271	302
1057	3300025938	Ga0207704_10029315	Ga0207704_100293152	302
1058	3300025938	Ga0207704_10057550	Ga0207704_100575502	302
1059	3300025940	Ga0207691_10009476	Ga0207691_1000947611	302
1060	3300025941	Ga0207711_10006109	Ga0207711_100061098	302
1061	3300025941	Ga0207711_10036911	Ga0207711_100369112	302
1062	3300025941	Ga0207711_10345719	Ga0207711_103457191	302
1063	3300025942	Ga0207689_10014341	Ga0207689_100143413	302
1064	3300025942	Ga0207689_10169024	Ga0207689_101690242	302
1065	3300025942	Ga0207689_10226459	Ga0207689_102264592	302
1066	3300025944	Ga0207661_10069537	Ga0207661_100695372	302
1067	3300025944	Ga0207661_10220784	Ga0207661_102207841	302
1068	3300025949	Ga0207667_10000006	Ga0207667_10000006349	302
1069	3300025949	Ga0207667_10000091	Ga0207667_1000009142	302
1070	3300025949	Ga0207667_10017016	Ga0207667_100170161	302
1071	3300025949	Ga0207667_10027741	Ga0207667_100277414	302
1072	3300025949	Ga0207667_10181563	Ga0207667_101815631	302
1073	3300025949	Ga0207667_10220498	Ga0207667_102204982	302
1074	3300025960	Ga0207651_10009459	Ga0207651_100094593	302
1075	3300025961	Ga0207712_10411281	Ga0207712_104112811	302
1076	3300025961	Ga0207712_10518683	Ga0207712_105186831	302
1077	3300025972	Ga0207668_10026065	Ga0207668_100260653	302
1078	3300025972	Ga0207668_10182882	Ga0207668_101828822	302
1079	3300025972	Ga0207668_10219523	Ga0207668_102195231	302
1080	3300025981	Ga0207640_10000056	Ga0207640_1000005641	302
1081	3300025981	Ga0207640_10000527	Ga0207640_100005277	302
1082	3300025981	Ga0207640_10000712	Ga0207640_100007126	302
1083	3300025986	Ga0207658_10002068	Ga0207658_1000206814	302
1084	3300025986	Ga0207658_10010673	Ga0207658_100106732	302
1085	3300025986	Ga0207658_10012288	Ga0207658_100122886	302
1086	3300025986	Ga0207658_10176121	Ga0207658_101761212	302
1087	3300025986	Ga0207658_10282378	Ga0207658_102823782	302
1088	3300026023	Ga0207677_10029967	Ga0207677_100299673	302
1089	3300026023	Ga0207677_10122092	Ga0207677_101220921	302
1090	3300026035	Ga0207703_10000459	Ga0207703_1000045919	302
1091	3300026035	Ga0207703_10000655	Ga0207703_1000065513	302
1092	3300026035	Ga0207703_10015608	Ga0207703_100156082	302
1093	3300026035	Ga0207703_10331448	Ga0207703_103314482	302
1094	3300026041	Ga0207639_10000038	Ga0207639_10000038111	302
1095	3300026041	Ga0207639_10002623	Ga0207639_100026233	302
1096	3300026041	Ga0207639_10021443	Ga0207639_100214434	302
1097	3300026041	Ga0207639_10195085	Ga0207639_101950852	302
1098	3300026041	Ga0207639_10296981	Ga0207639_102969811	302
1099	3300026041	Ga0207639_10299362	Ga0207639_102993622	302
1100	3300026067	Ga0207678_10035279	Ga0207678_100352793	302
1101	3300026067	Ga0207678_10170711	Ga0207678_101707111	302
1102	3300026075	Ga0207708_10043109	Ga0207708_100431093	302
1103	3300026078	Ga0207702_10020262	Ga0207702_100202624	302
1104	3300026078	Ga0207702_10172757	Ga0207702_101727572	302
1105	3300026078	Ga0207702_10254496	Ga0207702_102544962	302
1106	3300026078	Ga0207702_10264454	Ga0207702_102644542	302
1107	3300026078	Ga0207702_10406996	Ga0207702_104069962	302
1108	3300026088	Ga0207641_10000211	Ga0207641_1000021114	302
1109	3300026088	Ga0207641_10084247	Ga0207641_100842472	302
1110	3300026088	Ga0207641_10448762	Ga0207641_104487621	302
1111	3300026089	Ga0207648_10022687	Ga0207648_100226872	302
1112	3300026089	Ga0207648_10032454	Ga0207648_100324541	302
1113	3300026089	Ga0207648_10075535	Ga0207648_100755353	302
1114	3300026095	Ga0207676_10147984	Ga0207676_101479842	302
1115	3300026095	Ga0207676_10281214	Ga0207676_102812141	302
1116	3300026116	Ga0207674_10009067	Ga0207674_100090678	302
1117	3300026116	Ga0207674_10030367	Ga0207674_100303672	302
1118	3300026116	Ga0207674_10046645	Ga0207674_100466454	302
1119	3300026116	Ga0207674_10370453	Ga0207674_103704532	302
1120	3300026118	Ga0207675_100000196	Ga0207675_10000019632	302
1121	3300026118	Ga0207675_100068192	Ga0207675_1000681922	302
1122	3300026118	Ga0207675_100073559	Ga0207675_1000735592	302
1123	3300026118	Ga0207675_100084529	Ga0207675_1000845294	302
1124	3300026118	Ga0207675_100292118	Ga0207675_1002921182	302
1125	3300026121	Ga0207683_10026272	Ga0207683_100262722	302
1126	3300026121	Ga0207683_10489412	Ga0207683_104894122	302
1127	3300026142	Ga0207698_10000507	Ga0207698_100005076	302
1128	3300026142	Ga0207698_10127374	Ga0207698_101273742	302
1129	3300026142	Ga0207698_10441813	Ga0207698_104418132	302
1130	3300027312	Ga0209371_1004198	Ga0209371_10041985	302
1131	3300027907	Ga0207428_10030117	Ga0207428_100301174	302
1132	3300028379	Ga0268266_10000861	Ga0268266_1000086120	302
1133	3300028379	Ga0268266_10001728	Ga0268266_100017285	302
1134	3300028379	Ga0268266_10024365	Ga0268266_100243652	302
1135	3300028379	Ga0268266_10025874	Ga0268266_100258743	302
1136	3300028379	Ga0268266_10030757	Ga0268266_100307572	302
1137	3300028379	Ga0268266_10157600	Ga0268266_101576002	302
1138	3300028379	Ga0268266_10225680	Ga0268266_102256802	302
1139	3300028380	Ga0268265_10061537	Ga0268265_100615372	302
1140	3300028381	Ga0268264_10000047	Ga0268264_10000047147	302
1141	3300028381	Ga0268264_10000633	Ga0268264_1000063323	302
1142	3300028381	Ga0268264_10039463	Ga0268264_100394632	302
1143	3300028794	Ga0307515_10029370	Ga0307515_100293709	302
1144	3300028794	Ga0307515_10031775	Ga0307515_100317753	302
1145	3300028794	Ga0307515_10054677	Ga0307515_100546772	302
1146	3300028794	Ga0307515_10174586	Ga0307515_101745862	302
1147	3300028800	Ga0265338_10003550	Ga0265338_1000355012	302
1148	3300030500	Ga0268256_1003835	Ga0268256_10038355	302
1149	3300030521	Ga0307511_10000659	Ga0307511_1000065923	302
1150	3300030521	Ga0307511_10102105	Ga0307511_101021052	302
1151	3300030522	Ga0307512_10017605	Ga0307512_100176054	302
1152	3300031235	Ga0265330_10048851	Ga0265330_100488512	302
1153	3300031238	Ga0265332_10038097	Ga0265332_100380972	302
1154	3300031241	Ga0265325_10003100	Ga0265325_100031008	302
1155	3300031247	Ga0265340_10043104	Ga0265340_100431043	302
1156	3300031249	Ga0265339_10037276	Ga0265339_100372762	302
1157	3300031249	Ga0265339_10051037	Ga0265339_100510371	302
1158	3300031250	Ga0265331_10063856	Ga0265331_100638562	302
1159	3300031456	Ga0307513_10015966	Ga0307513_100159662	302
1160	3300031456	Ga0307513_10021053	Ga0307513_100210537	302
1161	3300031456	Ga0307513_10091048	Ga0307513_100910482	302
1162	3300031456	Ga0307513_10166717	Ga0307513_101667171	302
1163	3300031507	Ga0307509_10024617	Ga0307509_100246174	302
1164	3300031507	Ga0307509_10055465	Ga0307509_100554652	302
1165	3300031507	Ga0307509_10276906	Ga0307509_102769062	302
1166	3300031507	Ga0307509_10303254	Ga0307509_103032541	302
1167	3300031595	Ga0265313_10023426	Ga0265313_100234263	302
1168	3300031616	Ga0307508_10003032	Ga0307508_100030325	302
1169	3300031616	Ga0307508_10044261	Ga0307508_100442612	302
1170	3300031616	Ga0307508_10083836	Ga0307508_100838362	302
1171	3300031649	Ga0307514_10095242	Ga0307514_100952421	302
1172	3300031712	Ga0265342_10042817	Ga0265342_100428172	302
1173	3300031824	Ga0307413_10188647	Ga0307413_101886472	302
1174	3300031901	Ga0307406_10281810	Ga0307406_102818102	302
1175	3300031911	Ga0307412_10058093	Ga0307412_100580933	302
1176	3300031911	Ga0307412_10114387	Ga0307412_101143872	302
1177	3300031995	Ga0307409_100186044	Ga0307409_1001860443	302
1178	3300031995	Ga0307409_100195865	Ga0307409_1001958652	302
1179	3300032002	Ga0307416_100184264	Ga0307416_1001842642	302
1180	3300032002	Ga0307416_100295741	Ga0307416_1002957411	302
1181	3300032002	Ga0307416_100422793	Ga0307416_1004227931	302
1182	3300032004	Ga0307414_10012559	Ga0307414_100125593	302
1183	3300032004	Ga0307414_10023322	Ga0307414_100233223	302
1184	3300032005	Ga0307411_10021523	Ga0307411_100215232	302
1185	3300033180	Ga0307510_10002764	Ga0307510_1000276411	302
1186	3300033180	Ga0307510_10005984	Ga0307510_100059847	302
1187	3300033180	Ga0307510_10148749	Ga0307510_101487492	302
1188	3300035088	Ga0373940_0018966	Ga0373940_0018966_625_1551	302
1189	3300035088	Ga0373940_0027094	Ga0373940_0027094_500_1426	302
1190	3300035112	Ga0373932_0011294	Ga0373932_0011294_90_1016	302
1191	3300035114	Ga0373939_0043670	Ga0373939_0043670_165_1091	302
1192	3300035207	Ga0373942_0038116	Ga0373942_0038116_305_1231	302
1193	3300035691	Ga0373931_0006163	Ga0373931_0006163_4585_5511	302
1194	3300035691	Ga0373931_0014893	Ga0373931_0014893_1530_2456	302
1195	3300035725	Ga0373947_0176268	Ga0373947_0176268_14_982	302
1196	3300037418	Ga0395900_0019983	Ga0395900_0019983_359_1282	302
1197	3300037418	Ga0395900_0171078	Ga0395900_0171078_182_1129	302
1198	3300037418	Ga0395900_0242866	Ga0395900_0242866_20_964	302
1199	3300037466	Ga0395898_0021982	Ga0395898_0021982_4725_5648	302
1200	3300037466	Ga0395898_0479753	Ga0395898_0479753_12_956	302
1201	3300037471	Ga0395905_0040930	Ga0395905_0040930_926_1870	302
1202	3300037471	Ga0395905_0296125	Ga0395905_0296125_446_1372	302
1203	3300037471	Ga0395905_0392330	Ga0395905_0392330_329_1258	302
1204	3300037853	Ga0436364_0605911	Ga0436364_0605911_309_1244	302
1205	3300037853	Ga0436364_1271811	Ga0436364_1271811_89_1033	302
1206	3300038443	Ga0395901_0290251	Ga0395901_0290251_661_1575	302
1207	3300039437	Ga0436365_0713907	Ga0436365_0713907_613_1527	302
1208	3300039438	Ga0436360_1352855	Ga0436360_1352855_849_1811	302
1209	3300039450	Ga0436363_1013389	Ga0436363_1013389_1410_2420	302
1210	3300039453	Ga0436362_0639050	Ga0436362_0639050_620_1534	302
1211	3300041443	Ga0451789_1367961	Ga0451789_1367961_189_1115	302
1212	3300041451	Ga0451791_1757177	Ga0451791_1757177_621_1547	302
1213	3300041496	Ga0451839_0517051	Ga0451839_0517051_272_1198	302
1214	3300041503	Ga0451847_0252322	Ga0451847_0252322_478_1404	302
1215	3300041505	Ga0451849_1091202	Ga0451849_1091202_217_1143	302
1216	3300041509	Ga0451843_0500975	Ga0451843_0500975_193_1119	302
1217	3300041512	Ga0451853_2470466	Ga0451853_2470466_55_969	302
1218	3300042005	Ga0439448_0062402	Ga0439448_0062402_202_1152	302
1219	3300042007	Ga0439449_0000524	Ga0439449_0000524_12311_13222	302
1220	3300042015	Ga0439462_0039796	Ga0439462_0039796_201_1130	302
1221	3300042436	Ga0439435_0006941	Ga0439435_0006941_1261_2175	302
1222	3300044656	Ga0466969_0004825	Ga0466969_0004825_1208_2134	302
1223	3300044684	Ga0466966_0019905	Ga0466966_0019905_1395_2321	302
1224	3300044684	Ga0466966_0033735	Ga0466966_0033735_1464_2372	302
1225	3300044694	Ga0466963_0006781	Ga0466963_0006781_252_1160	302
1226	3300044719	Ga0466971_0152590	Ga0466971_0152590_29_973	302
1227	3300044765	Ga0466970_0000338	Ga0466970_0000338_201_1109	302
1228	3300044842	Ga0466957_0180142	Ga0466957_0180142_400_1350	302
1229	3300045049	Ga0466959_0000837	Ga0466959_0000837_1063_1989	302
1230	3300045049	Ga0466959_0193343	Ga0466959_0193343_280_1188	302
1231	3300046453	Ga0495627_000105	Ga0495627_000105_75773_76696	302
1232	3300046457	Ga0495590_0000506	Ga0495590_0000506_301_1236	302
1233	3300046460	Ga0495638_0000016	Ga0495638_0000016_329455_330393	302
1234	3300046460	Ga0495638_0000151	Ga0495638_0000151_7314_8237	302
1235	3300046460	Ga0495638_0001404	Ga0495638_0001404_12493_13428	302
1236	3300046460	Ga0495638_0001574	Ga0495638_0001574_2896_3810	302
1237	3300046460	Ga0495638_0012809	Ga0495638_0012809_1757_2677	302
1238	3300046460	Ga0495638_0021181	Ga0495638_0021181_615_1550	302
1239	3300046460	Ga0495638_0094939	Ga0495638_0094939_292_1227	302
1240	3300046471	Ga0495650_0000007	Ga0495650_0000007_29151_30086	302
1241	3300046471	Ga0495650_0040207	Ga0495650_0040207_972_1892	302
1242	3300046474	Ga0495605_0015398	Ga0495605_0015398_1612_2535	302
1243	3300046491	Ga0495584_0031460	Ga0495584_0031460_718_1662	302
1244	3300046492	Ga0495585_0002584	Ga0495585_0002584_4871_5815	302
1245	3300046492	Ga0495585_0024026	Ga0495585_0024026_1120_2043	302
1246	3300046492	Ga0495585_0058726	Ga0495585_0058726_1162_2085	302
1247	3300046500	Ga0495596_0004358	Ga0495596_0004358_2587_3531	302
1248	3300046501	Ga0495607_0053238	Ga0495607_0053238_449_1363	302
1249	3300046506	Ga0495583_0000029	Ga0495583_0000029_142302_143225	302
1250	3300046506	Ga0495583_0000059	Ga0495583_0000059_150379_151314	302
1251	3300046506	Ga0495583_0000094	Ga0495583_0000094_84099_85037	302
1252	3300046506	Ga0495583_0018972	Ga0495583_0018972_751_1695	302
1253	3300046506	Ga0495583_0030713	Ga0495583_0030713_1288_2214	302
1254	3300046506	Ga0495583_0105879	Ga0495583_0105879_38_961	302
1255	3300046507	Ga0495606_0000279	Ga0495606_0000279_75527_76471	302
1256	3300046507	Ga0495606_0035650	Ga0495606_0035650_206_1132	302
1257	3300046507	Ga0495606_0066224	Ga0495606_0066224_1020_1964	302
1258	3300046507	Ga0495606_0105719	Ga0495606_0105719_437_1360	302
1259	3300046512	Ga0495610_0000040	Ga0495610_0000040_42971_43906	302
1260	3300046512	Ga0495610_0000262	Ga0495610_0000262_31312_32232	302
1261	3300046512	Ga0495610_0009325	Ga0495610_0009325_1276_2247	302
1262	3300046512	Ga0495610_0015896	Ga0495610_0015896_2987_3907	302
1263	3300046512	Ga0495610_0028413	Ga0495610_0028413_1065_2000	302
1264	3300046513	Ga0495616_0000031	Ga0495616_0000031_41754_42668	302
1265	3300046513	Ga0495616_0045407	Ga0495616_0045407_1169_2092	302
1266	3300046513	Ga0495616_0069961	Ga0495616_0069961_438_1364	302
1267	3300046514	Ga0495618_0061709	Ga0495618_0061709_1318_2241	302
1268	3300046515	Ga0495620_0036345	Ga0495620_0036345_629_1552	302
1269	3300046515	Ga0495620_0085931	Ga0495620_0085931_90_1010	302
1270	3300046518	Ga0495631_0003509	Ga0495631_0003509_6228_7151	302
1271	3300046518	Ga0495631_0009183	Ga0495631_0009183_3418_4353	302
1272	3300046518	Ga0495631_0085980	Ga0495631_0085980_90_1034	302
1273	3300046519	Ga0495632_0000607	Ga0495632_0000607_9192_10106	302
1274	3300046519	Ga0495632_0034134	Ga0495632_0034134_893_1816	302
1275	3300046520	Ga0495637_0014779	Ga0495637_0014779_2072_3004	302
1276	3300046520	Ga0495637_0026695	Ga0495637_0026695_499_1434	302
1277	3300046520	Ga0495637_0043885	Ga0495637_0043885_638_1573	302
1278	3300046522	Ga0495643_0021510	Ga0495643_0021510_229_1200	302
1279	3300046524	Ga0495648_0000013	Ga0495648_0000013_66113_67051	302
1280	3300046524	Ga0495648_0000069	Ga0495648_0000069_30297_31241	302
1281	3300046524	Ga0495648_0000435	Ga0495648_0000435_30341_31276	302
1282	3300046524	Ga0495648_0028659	Ga0495648_0028659_1559_2506	302
1283	3300046525	Ga0495663_0001851	Ga0495663_0001851_3417_4361	302
1284	3300046528	Ga0495642_0003102	Ga0495642_0003102_1671_2615	302
1285	3300046530	Ga0495654_0000095	Ga0495654_0000095_2710_3645	302
1286	3300046530	Ga0495654_0063376	Ga0495654_0063376_16_951	302
1287	3300046542	Ga0495597_0062665	Ga0495597_0062665_310_1239	302
1288	3300046557	Ga0495622_0013727	Ga0495622_0013727_124_1047	302
1289	3300046557	Ga0495622_0018865	Ga0495622_0018865_1812_2780	302
1290	3300046558	Ga0495633_0002481	Ga0495633_0002481_2262_3206	302
1291	3300046558	Ga0495633_0011455	Ga0495633_0011455_2034_2972	302
1292	3300046558	Ga0495633_0011706	Ga0495633_0011706_2479_3414	302
1293	3300046558	Ga0495633_0045062	Ga0495633_0045062_354_1280	302
1294	3300046558	Ga0495633_0093163	Ga0495633_0093163_31_954	302
1295	3300046616	Ga0495668_0000014	Ga0495668_0000014_150568_151503	302
1296	3300046616	Ga0495668_0000109	Ga0495668_0000109_43493_44437	302
1297	3300046616	Ga0495668_0006051	Ga0495668_0006051_4278_5213	302
1298	3300046616	Ga0495668_0021759	Ga0495668_0021759_677_1612	302
1299	3300046616	Ga0495668_0035498	Ga0495668_0035498_1857_2771	302
1300	3300046616	Ga0495668_0043196	Ga0495668_0043196_1075_1998	302
1301	3300046642	Ga0495634_0082113	Ga0495634_0082113_550_1497	302
1302	3300046648	Ga0495611_0009662	Ga0495611_0009662_1399_2343	302
1303	3300046648	Ga0495611_0058389	Ga0495611_0058389_393_1316	302
1304	3300046648	Ga0495611_0074984	Ga0495611_0074984_415_1338	302
1305	3300046660	Ga0495625_0000341	Ga0495625_0000341_29822_30766	302
1306	3300046660	Ga0495625_0000710	Ga0495625_0000710_30401_31336	302
1307	3300046660	Ga0495625_0004297	Ga0495625_0004297_7889_8818	302
1308	3300046660	Ga0495625_0005647	Ga0495625_0005647_4746_5669	302
1309	3300046660	Ga0495625_0008842	Ga0495625_0008842_3108_4043	302
1310	3300046660	Ga0495625_0060492	Ga0495625_0060492_121_1056	302
1311	3300046660	Ga0495625_0061510	Ga0495625_0061510_1033_1947	302
1312	3300046684	Ga0495669_0000038	Ga0495669_0000038_34453_35397	302
1313	3300046691	Ga0495670_0014845	Ga0495670_0014845_880_1815	302
1314	3300046692	Ga0495671_0000018	Ga0495671_0000018_68509_69447	302
1315	3300046694	Ga0495649_0001239	Ga0495649_0001239_6731_7666	302
1316	3300046694	Ga0495649_0010883	Ga0495649_0010883_1015_1935	302
1317	3300046694	Ga0495649_0073936	Ga0495649_0073936_514_1440	302
1318	3300046794	Ga0495589_0002752	Ga0495589_0002752_7137_8066	302
1319	3300046794	Ga0495589_0069900	Ga0495589_0069900_549_1463	302
1320	3300046810	Ga0495660_0123246	Ga0495660_0123246_302_1237	302
1321	3300046810	Ga0495660_0142001	Ga0495660_0142001_20_955	302
1322	3300047320	Ga0495672_0004104	Ga0495672_0004104_10043_10978	302
1323	3300047321	Ga0495676_0069138	Ga0495676_0069138_561_1505	302
1324	3300047323	Ga0495683_0005623	Ga0495683_0005623_5604_6548	302
1325	3300047323	Ga0495683_0009242	Ga0495683_0009242_1602_2516	302
1326	3300047443	Ga0495687_000089	Ga0495687_000089_94258_95202	302
1327	3300047443	Ga0495687_098384	Ga0495687_098384_80_1003	302
1328	3300047445	Ga0495677_0001833	Ga0495677_0001833_1978_2922	302
1329	3300047445	Ga0495677_0033020	Ga0495677_0033020_114_1058	302
1330	3300047446	Ga0495679_004241	Ga0495679_004241_106_1029	302
1331	3300047469	Ga0495673_0000029	Ga0495673_0000029_432789_433727	302
1332	3300047469	Ga0495673_0000163	Ga0495673_0000163_113166_114098	302
1333	3300047469	Ga0495673_0000527	Ga0495673_0000527_16848_17783	302
1334	3300047470	Ga0495681_0009120	Ga0495681_0009120_1555_2484	302
1335	3300047470	Ga0495681_0009858	Ga0495681_0009858_4735_5679	302
1336	3300047472	Ga0495686_0000330	Ga0495686_0000330_59323_60258	302
1337	3300047472	Ga0495686_0007803	Ga0495686_0007803_5553_6473	302
1338	3300048905	Ga0496102_0090934	Ga0496102_0090934_1348_2265	302
1339	3300048907	Ga0496104_0000237	Ga0496104_0000237_30057_30983	302
1340	3300048908	Ga0496105_0006861	Ga0496105_0006861_2068_2994	302
1341	3300048909	Ga0496106_0001515	Ga0496106_0001515_9135_10073	302
1342	3300048909	Ga0496106_0002647	Ga0496106_0002647_2366_3337	302
1343	3300048911	Ga0496108_0000679	Ga0496108_0000679_204_1130	302
1344	3300048912	Ga0496109_0080839	Ga0496109_0080839_634_1560	302
1345	3300048913	Ga0496110_0001662	Ga0496110_0001662_1462_2388	302
1346	3300048914	Ga0496111_0002343	Ga0496111_0002343_1025_1951	302
1347	3300048915	Ga0496112_0035776	Ga0496112_0035776_2518_3444	302
1348	3300048916	Ga0496113_0031695	Ga0496113_0031695_2662_3588	302
1349	3300048918	Ga0496115_0392885	Ga0496115_0392885_128_1063	302
1350	3300048920	Ga0496117_0013911	Ga0496117_0013911_1135_2073	302
1351	3300048920	Ga0496117_0118037	Ga0496117_0118037_342_1313	302
1352	3300048921	Ga0496118_0006775	Ga0496118_0006775_9483_10454	302
1353	3300048921	Ga0496118_0011735	Ga0496118_0011735_7262_8188	302
1354	3300048921	Ga0496118_0057940	Ga0496118_0057940_128_1066	302
1355	3300048922	Ga0496119_0057114	Ga0496119_0057114_1304_2212	302
1356	3300048922	Ga0496119_0074801	Ga0496119_0074801_906_1844	302
1357	3300048922	Ga0496119_0085705	Ga0496119_0085705_649_1569	302
1358	3300048924	Ga0496121_0000069	Ga0496121_0000069_76782_77729	302
1359	3300048924	Ga0496121_0000146	Ga0496121_0000146_101217_102155	302
1360	3300048924	Ga0496121_0000496	Ga0496121_0000496_14847_15800	302
1361	3300048924	Ga0496121_0002068	Ga0496121_0002068_16928_17851	302
1362	3300048924	Ga0496121_0002995	Ga0496121_0002995_20582_21499	302
1363	3300048924	Ga0496121_0008291	Ga0496121_0008291_11176_12105	302
1364	3300048924	Ga0496121_0013320	Ga0496121_0013320_7791_8762	302
1365	3300048924	Ga0496121_0074895	Ga0496121_0074895_183_1127	302
1366	3300048924	Ga0496121_0249748	Ga0496121_0249748_234_1169	302
1367	3300048925	Ga0496122_0016094	Ga0496122_0016094_6003_6911	302
1368	3300048925	Ga0496122_0059219	Ga0496122_0059219_1269_2240	302
1369	3300048926	Ga0496123_0003037	Ga0496123_0003037_4394_5344	302
1370	3300048927	Ga0496124_0001405	Ga0496124_0001405_22902_23831	302
1371	3300048927	Ga0496124_0003847	Ga0496124_0003847_6742_7680	302
1372	3300048927	Ga0496124_0017694	Ga0496124_0017694_3271_4206	302
1373	3300048927	Ga0496124_0127266	Ga0496124_0127266_916_1833	302
1374	3300048927	Ga0496124_0134624	Ga0496124_0134624_912_1820	302
1375	3300048927	Ga0496124_0273587	Ga0496124_0273587_237_1181	302
1376	3300048928	Ga0496125_0001035	Ga0496125_0001035_5677_6621	302
1377	3300048928	Ga0496125_0012462	Ga0496125_0012462_857_1774	302
1378	3300048928	Ga0496125_0020178	Ga0496125_0020178_3286_4257	302
1379	3300048928	Ga0496125_0020632	Ga0496125_0020632_4980_5918	302
1380	3300048928	Ga0496125_0067818	Ga0496125_0067818_1319_2254	302
1381	3300048928	Ga0496125_0151986	Ga0496125_0151986_316_1239	302
1382	3300048929	Ga0496126_0001842	Ga0496126_0001842_12345_13292	302
1383	3300048929	Ga0496126_0006295	Ga0496126_0006295_3384_4322	302
1384	3300048929	Ga0496126_0162674	Ga0496126_0162674_413_1336	302
1385	3300048929	Ga0496126_0363078	Ga0496126_0363078_197_1141	302
1386	3300049459	Ga0495678_000973	Ga0495678_000973_17759_18694	302
1387	3300049460	Ga0495682_0072995	Ga0495682_0072995_249_1193	302
1388	3300049568	Ga0501031_0042403	Ga0501031_0042403_1212_2135	302
1389	3300049569	Ga0501032_0003560	Ga0501032_0003560_4531_5454	302
1390	3300049569	Ga0501032_0028604	Ga0501032_0028604_485_1408	302
1391	3300049569	Ga0501032_0156983	Ga0501032_0156983_22_945	302
1392	3300049570	Ga0501033_0008868	Ga0501033_0008868_5526_6449	302
1393	3300049570	Ga0501033_0021835	Ga0501033_0021835_2123_3073	302
1394	3300049570	Ga0501033_0079301	Ga0501033_0079301_1034_1957	302
1395	3300049571	Ga0501034_0019266	Ga0501034_0019266_5123_6064	302
1396	3300049571	Ga0501034_0069172	Ga0501034_0069172_44_982	302
1397	3300049571	Ga0501034_0159026	Ga0501034_0159026_1272_2222	302
1398	3300049571	Ga0501034_0207669	Ga0501034_0207669_861_1784	302
1399	3300049571	Ga0501034_0290850	Ga0501034_0290850_434_1357	302
1400	3300049572	Ga0501036_0053659	Ga0501036_0053659_941_1864	302
1401	3300049572	Ga0501036_0080014	Ga0501036_0080014_67_990	302
1402	3300049572	Ga0501036_0132808	Ga0501036_0132808_128_1078	302
1403	3300049573	Ga0501037_0010388	Ga0501037_0010388_17_940	302
1404	3300049573	Ga0501037_0013205	Ga0501037_0013205_1717_2640	302
1405	3300049574	Ga0501038_0008542	Ga0501038_0008542_3482_4405	302
1406	3300049574	Ga0501038_0052697	Ga0501038_0052697_1544_2467	302
1407	3300049575	Ga0501039_0067819	Ga0501039_0067819_204_1127	302
1408	3300049579	Ga0501043_0050198	Ga0501043_0050198_1921_2844	302
1409	3300049579	Ga0501043_0066238	Ga0501043_0066238_365_1288	302
1410	3300049579	Ga0501043_0075704	Ga0501043_0075704_1711_2634	302
1411	3300049580	Ga0501046_0010628	Ga0501046_0010628_849_1772	302
1412	3300049581	Ga0501047_0002896	Ga0501047_0002896_7781_8737	302
1413	3300049581	Ga0501047_0013182	Ga0501047_0013182_6691_7614	302
1414	3300049581	Ga0501047_0120503	Ga0501047_0120503_199_1152	302
1415	3300049581	Ga0501047_0124713	Ga0501047_0124713_1387_2337	302
1416	3300049581	Ga0501047_0174335	Ga0501047_0174335_774_1697	302
1417	3300049581	Ga0501047_0260811	Ga0501047_0260811_637_1560	302
1418	3300049582	Ga0501048_0004873	Ga0501048_0004873_7375_8298	302
1419	3300049584	Ga0501068_0186794	Ga0501068_0186794_182_1108	302
1420	3300049585	Ga0501069_0099716	Ga0501069_0099716_408_1331	302
1421	3300049586	Ga0501070_0071445	Ga0501070_0071445_401_1324	302
1422	3300049588	Ga0501072_0220964	Ga0501072_0220964_90_1013	302
1423	3300049589	Ga0501073_0001733	Ga0501073_0001733_13585_14544	302
1424	3300049589	Ga0501073_0008578	Ga0501073_0008578_576_1499	302
1425	3300049589	Ga0501073_0021908	Ga0501073_0021908_3628_4551	302
1426	3300049590	Ga0501074_0011410	Ga0501074_0011410_269_1192	302
1427	3300049593	Ga0501077_0059322	Ga0501077_0059322_647_1606	302
1428	3300049742	Ga0501080_0090921	Ga0501080_0090921_473_1396	302
1429	3300049742	Ga0501080_0177554	Ga0501080_0177554_141_1064	302
1430	3300049744	Ga0501083_0000105	Ga0501083_0000105_41115_42074	302
1431	3300049744	Ga0501083_0021405	Ga0501083_0021405_1456_2370	302
1432	3300049744	Ga0501083_0051170	Ga0501083_0051170_1007_1930	302
1433	3300049765	Ga0501268_005228	Ga0501268_005228_416_1366	302
1434	3300049822	Ga0501035_0005839	Ga0501035_0005839_5518_6474	302
1435	3300049822	Ga0501035_0024463	Ga0501035_0024463_147_1070	302
1436	3300049822	Ga0501035_0055107	Ga0501035_0055107_2426_3349	302
1437	3300049822	Ga0501035_0114110	Ga0501035_0114110_881_1804	302
1438	3300049823	Ga0501044_0048381	Ga0501044_0048381_427_1380	302
1439	3300049823	Ga0501044_0092861	Ga0501044_0092861_19_942	302
1440	3300049823	Ga0501044_0096713	Ga0501044_0096713_1242_2267	302
1441	3300049823	Ga0501044_0186287	Ga0501044_0186287_1092_2015	302
1442	3300050492	nmdc:mga0yw44_238403_c1	nmdc:mga0yw44_238403_c1_13_942	302
1443	3300050493	nmdc:mga0k408_106523_c1	nmdc:mga0k408_106523_c1_581_1507	302
1444	3300050493	nmdc:mga0k408_28398_c1	nmdc:mga0k408_28398_c1_1480_2610	302
1445	3300050494	nmdc:mga06z11_123015_c1	nmdc:mga06z11_123015_c1_232_1158	302
1446	3300050494	nmdc:mga06z11_5541_c1	nmdc:mga06z11_5541_c1_2368_3294	302
1447	3300050495	nmdc:mga04h51_4762_c1	nmdc:mga04h51_4762_c1_112_1038	302
1448	3300050496	nmdc:mga07m45_25907_c1	nmdc:mga07m45_25907_c1_648_1577	302
1449	3300050496	nmdc:mga07m45_3768_c1	nmdc:mga07m45_3768_c1_6210_7133	302
1450	3300050507	nmdc:mga05p37_241997_c1	nmdc:mga05p37_241997_c1_948_1874	302
1451	3300050507	nmdc:mga05p37_272611_c1	nmdc:mga05p37_272611_c1_217_1143	302
1452	3300050509	nmdc:mga0qj67_67597_c1	nmdc:mga0qj67_67597_c1_1797_2723	302
1453	3300050510	nmdc:mga06r32_64119_c1	nmdc:mga06r32_64119_c1_1945_2871	302
1454	3300050511	nmdc:mga08y16_194036_c1	nmdc:mga08y16_194036_c1_474_1400	302
1455	3300050512	nmdc:mga0n895_45809_c1	nmdc:mga0n895_45809_c1_2113_3039	302
1456	3300050513	nmdc:mga0rr50_37280_c1	nmdc:mga0rr50_37280_c1_71_997	302
1457	3300050515	nmdc:mga0a205_80122_c1	nmdc:mga0a205_80122_c1_248_1174	302
1458	3300053079	Ga0500610_0000060	Ga0500610_0000060_10246_11190	302
1459	3300053086	Ga0500578_0000354	Ga0500578_0000354_34948_35883	302
1460	3300053086	Ga0500578_0015201	Ga0500578_0015201_3037_3963	302
1461	3300053087	Ga0500643_000006	Ga0500643_000006_125276_126199	302
1462	3300053087	Ga0500643_003474	Ga0500643_003474_5640_6569	302
1463	3300053087	Ga0500643_047642	Ga0500643_047642_155_1084	302
1464	3300053088	Ga0500644_0000362	Ga0500644_0000362_4287_5222	302
1465	3300053092	Ga0500583_0014052	Ga0500583_0014052_1536_2492	302
1466	3300053092	Ga0500583_0033860	Ga0500583_0033860_32_979	302
1467	3300053094	Ga0500566_0061699	Ga0500566_0061699_1123_2091	302
1468	3300053096	Ga0500641_0095754	Ga0500641_0095754_95_1030	302
1469	3300053103	Ga0500555_000222	Ga0500555_000222_3479_4414	302
1470	3300053104	Ga0500556_0000179	Ga0500556_0000179_37165_38094	302
1471	3300053104	Ga0500556_0001920	Ga0500556_0001920_3706_4641	302
1472	3300053118	Ga0500594_0000963	Ga0500594_0000963_2691_3626	302
1473	3300053118	Ga0500594_0003333	Ga0500594_0003333_2321_3244	302
1474	3300053119	Ga0500595_002690	Ga0500595_002690_3592_4515	302
1475	3300053119	Ga0500595_003572	Ga0500595_003572_3437_4360	302
1476	3300053120	Ga0500597_023877	Ga0500597_023877_1083_2030	302
1477	3300053122	Ga0500608_000006	Ga0500608_000006_47975_48910	302
1478	3300053122	Ga0500608_008921	Ga0500608_008921_1513_2442	302
1479	3300053125	Ga0500618_000053	Ga0500618_000053_12286_13209	302
1480	3300053125	Ga0500618_000622	Ga0500618_000622_7774_8691	302
1481	3300053130	Ga0500642_0000001	Ga0500642_0000001_1087398_1088327	302
1482	3300053130	Ga0500642_0001824	Ga0500642_0001824_3994_4938	302
1483	3300053134	Ga0500658_0000086	Ga0500658_0000086_14996_15922	302
1484	3300053134	Ga0500658_0001905	Ga0500658_0001905_5164_6093	302
1485	3300053134	Ga0500658_0018719	Ga0500658_0018719_809_1738	302
1486	3300053134	Ga0500658_0025981	Ga0500658_0025981_1168_2091	302
1487	3300053134	Ga0500658_0083104	Ga0500658_0083104_191_1111	302
1488	3300053134	Ga0500658_0126091	Ga0500658_0126091_121_1092	302
1489	3300053136	Ga0500559_0002313	Ga0500559_0002313_1498_2433	302
1490	3300053138	Ga0500564_000056	Ga0500564_000056_4376_5311	302
1491	3300053139	Ga0500568_0001721	Ga0500568_0001721_2548_3519	302
1492	3300053139	Ga0500568_0045594	Ga0500568_0045594_397_1326	302
1493	3300053139	Ga0500568_0053459	Ga0500568_0053459_239_1162	302
1494	3300053140	Ga0500573_0000009	Ga0500573_0000009_105507_106430	302
1495	3300053142	Ga0500577_0000103	Ga0500577_0000103_862_1797	302
1496	3300053142	Ga0500577_0129510	Ga0500577_0129510_102_1034	302
1497	3300053146	Ga0500588_0021715	Ga0500588_0021715_767_1717	302
1498	3300053150	Ga0500603_029227	Ga0500603_029227_213_1160	302
1499	3300053151	Ga0500604_0046930	Ga0500604_0046930_46_1017	302
1500	3300053153	Ga0500616_0000203	Ga0500616_0000203_5174_6097	302
1501	3300053153	Ga0500616_0007625	Ga0500616_0007625_1894_2820	302
1502	3300053153	Ga0500616_0014522	Ga0500616_0014522_2878_3834	302
1503	3300053156	Ga0500622_0000452	Ga0500622_0000452_1110_2045	302
1504	3300053156	Ga0500622_0000836	Ga0500622_0000836_21426_22397	302
1505	3300053156	Ga0500622_0023659	Ga0500622_0023659_117_1040	302
1506	3300053158	Ga0500627_0050824	Ga0500627_0050824_658_1593	302
1507	3300053177	Ga0500636_0004016	Ga0500636_0004016_657_1670	302
1508	3300053178	Ga0500637_0066224	Ga0500637_0066224_701_1669	302
1509	3300053730	Ga0500645_000008	Ga0500645_000008_87259_88203	302
1510	3300053730	Ga0500645_002974	Ga0500645_002974_3029_3964	302
1511	3300053730	Ga0500645_057873	Ga0500645_057873_187_1110	302
1512	3300053731	Ga0500609_000311	Ga0500609_000311_3492_4406	302
1513	3300053735	Ga0500596_001697	Ga0500596_001697_3123_4070	302
1514	3300054114	Ga0501084_0001717	Ga0501084_0001717_173_1132	302
1515	3300054114	Ga0501084_0056938	Ga0501084_0056938_227_1141	302
1516	3300060353	Ga0501082_0001282	Ga0501082_0001282_4189_5148	302
1517	3300060353	Ga0501082_0076691	Ga0501082_0076691_1544_2458	302
1518	3300060353	Ga0501082_0082067	Ga0501082_0082067_832_1755	302
1519	iso_pu_bacteria	2582581298	2585221790	302
1520	iso_pu_bacteria	2585427529	2585544040	302
1521	iso_pu_bacteria	2841911363	2841914602	302
1522	iso_pu_bacteria	2841917233	2841920233	302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

76

365

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ur7-assembly1.cif.gz_D	crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate	0.9859	1	296
5hwm-assembly1.cif.gz_A	crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid	0.9778	1	302
5hwm-assembly1.cif.gz_A	crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid	0.9746	1	302
4ur7-assembly1.cif.gz_D	crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate	0.9664	1	296
3e96-assembly1.cif.gz_A	crystal structure of dihydrodipicolinate synthase from bacillus clausii	0.9149	6	300

ID	Description	Score	Start	End	Superfamily
5hwjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9866	1	296	3.20.20.70
5hwjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.964	1	296	3.20.20.70
3e96A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9149	6	300	3.20.20.70
1xl9D00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9145	13	297	3.20.20.70
3eb2C00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9085	13	298	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A528V5R6-F1-model_v4	5-dehydro-4-deoxyglucarate dehydratase	0.9914	93	186	GO:0008840
AF-A0A5C7Z860-F1-model_v4	5-dehydro-4-deoxyglucarate dehydratase	0.9886	93	299	GO:0008840
AF-A0A4R3E3B6-F1-model_v4	Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH)	0.9876	1	302	GO:0008840 GO:0042838 GO:0047448
AF-A0A358B2K8-F1-model_v4	Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH)	0.9873	1	297	GO:0008840 GO:0042838 GO:0047448
AF-A0A561QVP7-F1-model_v4	Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH)	0.9871	1	296	GO:0008840 GO:0042838 GO:0047448

Feature Viewer

pLDDT	pTM	Quality
94.42	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494546

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00701

DHDPS

Dihydrodipicolinate synthetase family

76

365

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map