F494484

General Info

Members Datasets Scaffolds Average Seq Length
1513 557 1504 131

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_1269221|Ga0466957_1269221_27_482
Length 151
Sequence VSGFACGLTPTYGIRDLAIIARMRILHTMLRVGDLQRSIDFYTKVLGMKLLRTTDRPEQKYSLAFVGYGTNPEHAELELTYNYGVERYEMGTAYGHIAIGVEDAYAACDRIRAAGGNITREPGPVKGGTTVIAFVTDPDGYKIELIQRDAN

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
5 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
6 2857564685 Duganella sp. R-74599 Isolate Unclassified
7 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
126 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
147 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
163 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
247 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
266 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
267 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
308 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
309 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
310 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
311 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
312 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
313 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
314 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
315 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
318 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
319 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
320 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
321 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
322 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
323 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
324 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
325 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
326 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
327 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
328 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
329 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
330 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
331 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
332 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
333 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
334 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
337 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
338 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
339 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
340 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
341 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
342 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
343 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
344 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
345 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
346 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
347 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
348 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
349 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
350 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
353 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
354 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
357 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
358 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
359 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
360 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
363 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
364 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
365 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
366 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
367 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
368 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
369 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
370 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
371 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
372 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
373 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
374 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
375 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
376 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
381 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
385 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
386 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
387 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
388 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
391 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
392 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
393 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
400 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
401 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
402 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
403 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
404 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
407 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
408 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
409 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
410 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
411 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
412 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
413 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
414 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
415 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
416 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
417 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
418 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
419 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
420 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
421 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
422 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
423 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
424 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
425 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
426 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
427 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
428 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
429 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
430 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
431 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
432 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
433 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
434 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
435 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
436 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
437 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
438 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
439 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
440 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
441 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
444 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
445 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
446 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
447 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
448 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
449 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
452 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
453 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
454 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
455 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
456 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
457 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
458 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
459 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
460 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
461 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
462 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
463 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
464 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
465 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
466 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
467 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
468 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
469 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
470 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
473 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
474 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
475 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
476 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
486 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
487 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
491 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
492 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
493 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
494 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
498 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
499 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
500 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
501 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
502 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
503 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
506 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
507 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
508 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
509 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
510 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
511 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
512 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
513 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
514 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
515 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
516 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
517 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
518 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
521 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
524 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
525 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
556 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
557 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 4.03
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 4.3
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001186 3300002705 Bacteria 11587
2 JGI25154J39366_1001057 3300002738 Bacteria 10924
3 JGI25151J46595_10005067 3300003187 Bacteria 6853
4 JGI25151J46595_10067132 3300003187 Bacteria 1107
5 JGI25406J46586_10104663 3300003203 Bacteria 841
6 rootL2_10001292 3300003322 Bacteria 4012
7 rootL2_10016479 3300003322 Bacteria 4719
8 Ga0007410J51695_1074680 3300003574 Bacteria 676
9 Ga0007409J51694_1010148 3300003575 Bacteria 1329
10 Ga0007416J51690_1030046 3300003577 Bacteria 1798
11 Ga0055526_1000063 3300003771 Bacteria 103612
12 Ga0055526_1006081 3300003771 Bacteria 6668
13 Ga0055526_1006214 3300003771 Bacteria 6557
14 Ga0055524_1027986 3300003775 Bacteria 1698
15 Ga0055536_1000150 3300003781 Bacteria 59586
16 Ga0055534_1002354 3300003784 Bacteria 6597
17 Ga0055540_1006946 3300003792 Bacteria 4377
18 Ga0055531_10000992 3300003794 Bacteria 22548
19 Ga0055543_1058690 3300004625 Bacteria 620
20 Ga0058862_12693219 3300004803 Bacteria 504
21 Ga0065165_1001336 3300005262 Bacteria 27356
22 Ga0065165_1030399 3300005262 Bacteria 1719
23 Ga0065715_10761580 3300005293 Bacteria 625
24 Ga0065715_11035556 3300005293 Bacteria 536
25 Ga0070658_10083823 3300005327 Bacteria 2621
26 Ga0070658_10102909 3300005327 Bacteria 2362
27 Ga0070658_10202820 3300005327 Bacteria 1674
28 Ga0070658_10590896 3300005327 Bacteria 962
29 Ga0070658_10649225 3300005327 Bacteria 915
30 Ga0070658_10875855 3300005327 Bacteria 781
31 Ga0070658_11690645 3300005327 Bacteria 548
32 Ga0070676_10009290 3300005328 Bacteria 5317
33 Ga0070676_10095408 3300005328 Bacteria 1829
34 Ga0070676_10605056 3300005328 Bacteria 791
35 Ga0070683_100005352 3300005329 Bacteria 10701
36 Ga0070683_100713129 3300005329 Bacteria 961
37 Ga0070670_100003584 3300005331 Bacteria 12922
38 Ga0070670_100009851 3300005331 Bacteria 8160
39 Ga0070670_100631372 3300005331 Bacteria 960
40 Ga0070677_10164781 3300005333 Bacteria 1043
41 Ga0068869_100069759 3300005334 Bacteria 2599
42 Ga0068869_100628228 3300005334 Bacteria 910
43 Ga0068869_101294863 3300005334 Bacteria 643
44 Ga0070666_10113018 3300005335 Bacteria 1879
45 Ga0070680_100157683 3300005336 Bacteria 1907
46 Ga0070682_100013740 3300005337 Bacteria 4667
47 Ga0068868_100001157 3300005338 Bacteria 18078
48 Ga0068868_100761222 3300005338 Bacteria 871
49 Ga0070660_100002145 3300005339 Bacteria 13621
50 Ga0070660_100073236 3300005339 Bacteria 2678
51 Ga0070660_100182808 3300005339 Bacteria 1697
52 Ga0070660_100601408 3300005339 Bacteria 919
53 Ga0070689_100954472 3300005340 Bacteria 761
54 Ga0070691_10164712 3300005341 Bacteria 1145
55 Ga0070661_100003784 3300005344 Bacteria 10428
56 Ga0070661_100033962 3300005344 Bacteria 3698
57 Ga0070661_100037349 3300005344 Bacteria 3533
58 Ga0070661_101388409 3300005344 Bacteria 591
59 Ga0070668_100069229 3300005347 Bacteria 2745
60 Ga0070668_101073529 3300005347 Bacteria 726
61 Ga0070669_100118703 3300005353 Bacteria 2015
62 Ga0070669_101456430 3300005353 Bacteria 595
63 Ga0070675_100001801 3300005354 Bacteria 15832
64 Ga0070675_100022306 3300005354 Bacteria 5058
65 Ga0070671_100010623 3300005355 Bacteria 7389
66 Ga0070671_100020902 3300005355 Bacteria 5340
67 Ga0070671_100208905 3300005355 Bacteria 1656
68 Ga0070671_100299367 3300005355 Bacteria 1369
69 Ga0070673_100865695 3300005364 Bacteria 837
70 Ga0070659_100014894 3300005366 Bacteria 5816
71 Ga0070659_100101143 3300005366 Bacteria 2320
72 Ga0070659_100125477 3300005366 Bacteria 2082
73 Ga0070667_100088937 3300005367 Bacteria 2652
74 Ga0070703_10124524 3300005406 Bacteria 939
75 Ga0070714_100370316 3300005435 Bacteria 1349
76 Ga0070714_102296400 3300005435 Bacteria 525
77 Ga0070713_100042585 3300005436 Bacteria 3707
78 Ga0070713_100193456 3300005436 Bacteria 1834
79 Ga0070713_100354967 3300005436 Bacteria 1361
80 Ga0070713_102466974 3300005436 Bacteria 502
81 Ga0070701_10242541 3300005438 Bacteria 1085
82 Ga0070711_100634673 3300005439 Bacteria 894
83 Ga0070705_100016436 3300005440 Bacteria 3845
84 Ga0070705_100367620 3300005440 Bacteria 1054
85 Ga0070700_100529171 3300005441 Bacteria 912
86 Ga0070694_100384794 3300005444 Bacteria 1095
87 Ga0070694_100562711 3300005444 Bacteria 914
88 Ga0070708_100156079 3300005445 Bacteria 2125
89 Ga0070708_100249276 3300005445 Bacteria 1668
90 Ga0070663_100040127 3300005455 Bacteria 3275
91 Ga0070663_100572541 3300005455 Bacteria 947
92 Ga0070663_100940293 3300005455 Bacteria 749
93 Ga0070663_100968974 3300005455 Bacteria 738
94 Ga0070678_100005974 3300005456 Bacteria 7092
95 Ga0070678_100046649 3300005456 Bacteria 3109
96 Ga0070678_100278890 3300005456 Bacteria 1413
97 Ga0070678_100279362 3300005456 Bacteria 1411
98 Ga0070678_100409481 3300005456 Bacteria 1180
99 Ga0070662_100000867 3300005457 Bacteria 18517
100 Ga0070662_100024603 3300005457 Bacteria 4150
101 Ga0070662_100110025 3300005457 Bacteria 2097
102 Ga0070662_100254611 3300005457 Bacteria 1413
103 Ga0070681_10493180 3300005458 Bacteria 1138
104 Ga0068867_100099511 3300005459 Bacteria 2218
105 Ga0068867_100691765 3300005459 Bacteria 899
106 Ga0070707_100536809 3300005468 Bacteria 1132
107 Ga0070707_101522555 3300005468 Bacteria 636
108 Ga0070679_100059905 3300005530 Bacteria 3794
109 Ga0070679_100410893 3300005530 Bacteria 1299
110 Ga0070684_100027307 3300005535 Bacteria 4815
111 Ga0070684_100409742 3300005535 Bacteria 1250
112 Ga0070684_101134418 3300005535 Bacteria 735
113 Ga0068853_100002880 3300005539 Bacteria 13055
114 Ga0068853_100369445 3300005539 Bacteria 1338
115 Ga0068853_100860240 3300005539 Bacteria 870
116 Ga0070672_100000535 3300005543 Bacteria 22337
117 Ga0070686_100969540 3300005544 Bacteria 696
118 Ga0070695_100000692 3300005545 Bacteria 18036
119 Ga0070695_100150230 3300005545 Bacteria 1625
120 Ga0070696_100008854 3300005546 Bacteria 6731
121 Ga0070696_100311941 3300005546 Bacteria 1208
122 Ga0070696_100475830 3300005546 Bacteria 990
123 Ga0070693_100029302 3300005547 Bacteria 3001
124 Ga0070693_101101446 3300005547 Bacteria 605
125 Ga0070665_100694432 3300005548 Bacteria 1031
126 Ga0070704_100476839 3300005549 Bacteria 1079
127 Ga0070704_101842160 3300005549 Bacteria 560
128 Ga0068855_100005319 3300005563 Bacteria 15724
129 Ga0068855_100042921 3300005563 Bacteria 5358
130 Ga0068855_100051204 3300005563 Bacteria 4864
131 Ga0068855_100155710 3300005563 Bacteria 2596
132 Ga0068855_100654019 3300005563 Bacteria 1128
133 Ga0068855_101218898 3300005563 Bacteria 782
134 Ga0068855_101614744 3300005563 Bacteria 663
135 Ga0070664_100016501 3300005564 Bacteria 6054
136 Ga0070664_100055141 3300005564 Bacteria 3373
137 Ga0070664_100478778 3300005564 Bacteria 1145
138 Ga0068857_100270774 3300005577 Bacteria 1561
139 Ga0068857_101165040 3300005577 Bacteria 746
140 Ga0068854_100027581 3300005578 Bacteria 3915
141 Ga0068854_100032147 3300005578 Bacteria 3650
142 Ga0068854_100034288 3300005578 Bacteria 3545
143 Ga0068856_100004035 3300005614 Bacteria 14702
144 Ga0068856_100154981 3300005614 Bacteria 2301
145 Ga0068856_100539159 3300005614 Bacteria 1188
146 Ga0068856_100625174 3300005614 Bacteria 1098
147 Ga0070702_100014791 3300005615 Bacteria 3968
148 Ga0068852_100018568 3300005616 Bacteria 5481
149 Ga0068852_100054887 3300005616 Bacteria 3436
150 Ga0068852_100072682 3300005616 Bacteria 3023
151 Ga0068852_100094552 3300005616 Bacteria 2681
152 Ga0068852_100447083 3300005616 Bacteria 1279
153 Ga0068852_101228262 3300005616 Bacteria 771
154 Ga0068852_101390769 3300005616 Bacteria 724
155 Ga0068859_101072680 3300005617 Bacteria 886
156 Ga0068859_101236815 3300005617 Bacteria 822
157 Ga0068864_100011769 3300005618 Bacteria 7227
158 Ga0068864_100024340 3300005618 Bacteria 5093
159 Ga0068864_100194010 3300005618 Bacteria 1863
160 Ga0068861_100003855 3300005719 Bacteria 10017
161 Ga0068861_102265949 3300005719 Bacteria 545
162 Ga0068851_10009705 3300005834 Bacteria 4482
163 Ga0068851_10020198 3300005834 Bacteria 3222
164 Ga0068851_10042872 3300005834 Bacteria 2279
165 Ga0068851_10044956 3300005834 Bacteria 2231
166 Ga0068851_10525089 3300005834 Bacteria 712
167 Ga0068863_100183411 3300005841 Bacteria 2009
168 Ga0068858_100160326 3300005842 Bacteria 2118
169 Ga0068858_100257075 3300005842 Bacteria 1659
170 Ga0068858_100977808 3300005842 Bacteria 829
171 Ga0068858_102136059 3300005842 Bacteria 554
172 Ga0068860_100247347 3300005843 Bacteria 1736
173 Ga0068860_100503270 3300005843 Bacteria 1210
174 Ga0068860_100616457 3300005843 Bacteria 1091
175 Ga0068860_101683473 3300005843 Bacteria 656
176 Ga0068862_100887250 3300005844 Bacteria 876
177 Ga0081539_10000226 3300005985 Bacteria 132618
178 Ga0070717_10057081 3300006028 Bacteria 3227
179 Ga0070717_10123117 3300006028 Bacteria 2224
180 Ga0070717_10301328 3300006028 Bacteria 1425
181 Ga0075365_10085227 3300006038 Bacteria 2146
182 Ga0075365_10238977 3300006038 Bacteria 1276
183 Ga0075365_10430610 3300006038 Bacteria 931
184 Ga0075368_10306824 3300006042 Bacteria 686
185 Ga0075368_10561871 3300006042 Bacteria 514
186 Ga0075363_100011747 3300006048 Bacteria 4203
187 Ga0075363_100193098 3300006048 Bacteria 1161
188 Ga0075364_10051591 3300006051 Bacteria 2687
189 Ga0075364_10690641 3300006051 Bacteria 697
190 Ga0070716_100259837 3300006173 Bacteria 1188
191 Ga0070712_100247407 3300006175 Bacteria 1423
192 Ga0075362_10008211 3300006177 Bacteria 3985
193 Ga0075362_10289212 3300006177 Bacteria 812
194 Ga0075367_10023342 3300006178 Bacteria 3479
195 Ga0075367_10433559 3300006178 Bacteria 832
196 Ga0075367_10731337 3300006178 Bacteria 630
197 Ga0075369_10169756 3300006186 Bacteria 1001
198 Ga0075366_10000574 3300006195 Bacteria 17235
199 Ga0075366_10009384 3300006195 Bacteria 5460
200 Ga0075366_10024978 3300006195 Bacteria 3487
201 Ga0075366_10096764 3300006195 Bacteria 1770
202 Ga0075366_10364572 3300006195 Bacteria 887
203 Ga0075366_10481328 3300006195 Bacteria 767
204 Ga0075366_10692919 3300006195 Bacteria 632
205 Ga0097621_100037998 3300006237 Bacteria 3862
206 Ga0097621_100786463 3300006237 Bacteria 881
207 Ga0075370_10000101 3300006353 Bacteria 27175
208 Ga0075370_10003489 3300006353 Bacteria 7492
209 Ga0075370_10013018 3300006353 Bacteria 4413
210 Ga0075370_10412510 3300006353 Bacteria 811
211 Ga0068871_100012983 3300006358 Bacteria 6169
212 Ga0068871_100168797 3300006358 Bacteria 1874
213 Ga0068871_101127584 3300006358 Bacteria 734
214 Ga0075428_100011487 3300006844 Bacteria 9851
215 Ga0075433_10028132 3300006852 Bacteria 4777
216 Ga0075433_10570812 3300006852 Bacteria 994
217 Ga0075433_10713891 3300006852 Bacteria 878
218 Ga0075434_100000306 3300006871 Bacteria 34874
219 Ga0075434_100211503 3300006871 Bacteria 1959
220 Ga0075434_100403542 3300006871 Bacteria 1388
221 Ga0075434_100715280 3300006871 Bacteria 1019
222 Ga0075429_100333108 3300006880 Bacteria 1328
223 Ga0068865_100503981 3300006881 Bacteria 1010
224 Ga0075436_100000087 3300006914 Bacteria 53435
225 Ga0075436_100044693 3300006914 Bacteria 3055
226 Ga0075436_100796252 3300006914 Bacteria 704
227 Ga0097620_101072672 3300006931 Bacteria 886
228 Ga0097620_101236828 3300006931 Bacteria 822
229 Ga0075435_100049500 3300007076 Bacteria 3380
230 Ga0075435_100476717 3300007076 Bacteria 1077
231 Ga0075435_101437372 3300007076 Bacteria 604
232 Ga0099794_10050309 3300007265 Bacteria 2004
233 Ga0099794_10114266 3300007265 Bacteria 1355
234 Ga0099794_10355707 3300007265 Bacteria 762
235 Ga0099794_10795900 3300007265 Bacteria 506
236 Ga0105240_10032391 3300009093 Bacteria 6768
237 Ga0105240_10215520 3300009093 Bacteria 2240
238 Ga0105240_10775247 3300009093 Bacteria 1041
239 Ga0111539_10542659 3300009094 Bacteria 1354
240 Ga0111539_11826380 3300009094 Bacteria 705
241 Ga0105245_10045639 3300009098 Bacteria 3914
242 Ga0105245_10520117 3300009098 Bacteria 1208
243 Ga0105245_10578523 3300009098 Bacteria 1147
244 Ga0105247_10582324 3300009101 Bacteria 827
245 Ga0105247_11383283 3300009101 Bacteria 569
246 Ga0114129_10829948 3300009147 Bacteria 1177
247 Ga0105243_10004726 3300009148 Bacteria 10716
248 Ga0105243_10102716 3300009148 Bacteria 2376
249 Ga0105243_12196051 3300009148 Bacteria 589
250 Ga0105241_10010400 3300009174 Bacteria 6827
251 Ga0105241_10398868 3300009174 Bacteria 1206
252 Ga0105241_11711613 3300009174 Unclassified 611
253 Ga0105241_11737655 3300009174 Bacteria 607
254 Ga0105242_10088648 3300009176 Bacteria 2599
255 Ga0105242_10577028 3300009176 Bacteria 1082
256 Ga0105248_10016659 3300009177 Bacteria 8090
257 Ga0105248_10032211 3300009177 Bacteria 5860
258 Ga0105248_10205361 3300009177 Bacteria 2220
259 Ga0105248_11062085 3300009177 Bacteria 915
260 Ga0105237_10018505 3300009545 Bacteria 7209
261 Ga0105237_10226287 3300009545 Bacteria 1871
262 Ga0105237_10514705 3300009545 Bacteria 1203
263 Ga0105237_10948551 3300009545 Bacteria 867
264 Ga0105237_12087580 3300009545 Bacteria 576
265 Ga0105237_12645292 3300009545 Bacteria 513
266 Ga0105238_10045282 3300009551 Bacteria 4445
267 Ga0105238_10065910 3300009551 Bacteria 3623
268 Ga0105238_10358793 3300009551 Unclassified 1447
269 Ga0105238_11617213 3300009551 Bacteria 678
270 Ga0105238_12606685 3300009551 Bacteria 542
271 Ga0105249_10957232 3300009553 Bacteria 924
272 Ga0105249_11130627 3300009553 Bacteria 854
273 Ga0105249_11285878 3300009553 Bacteria 803
274 Ga0105239_10050731 3300010375 Bacteria 4549
275 Ga0105239_10057462 3300010375 Bacteria 4268
276 Ga0105246_10225508 3300011119 Bacteria 1472
277 Ga0157328_1016793 3300012478 Bacteria 579
278 Ga0157318_1009564 3300012482 Bacteria 702
279 Ga0157373_10038808 3300013100 Bacteria 3411
280 Ga0157373_10056085 3300013100 Bacteria 2798
281 Ga0157371_10000064 3300013102 Bacteria 169056
282 Ga0157371_10044279 3300013102 Bacteria 3169
283 Ga0157370_10126001 3300013104 Bacteria 2390
284 Ga0157370_10292270 3300013104 Bacteria 1505
285 Ga0157370_10923974 3300013104 Bacteria 791
286 Ga0157369_10381445 3300013105 Bacteria 1463
287 Ga0157374_10009658 3300013296 Bacteria 8284
288 Ga0157374_10353469 3300013296 Bacteria 1460
289 Ga0157374_11470716 3300013296 Bacteria 704
290 Ga0157374_11846605 3300013296 Bacteria 630
291 Ga0157378_10706173 3300013297 Bacteria 1028
292 Ga0157378_11504214 3300013297 Bacteria 718
293 Ga0157378_12518481 3300013297 Bacteria 567
294 Ga0163162_10016188 3300013306 Bacteria 7293
295 Ga0163162_11337283 3300013306 Bacteria 814
296 Ga0163162_12939054 3300013306 Bacteria 548
297 Ga0157372_10156872 3300013307 Bacteria 2629
298 Ga0157372_10428020 3300013307 Bacteria 1543
299 Ga0157375_10375005 3300013308 Bacteria 1589
300 Ga0157375_10485292 3300013308 Bacteria 1401
301 Ga0157375_11259186 3300013308 Bacteria 869
302 Ga0157375_13194834 3300013308 Bacteria 546
303 Ga0163163_10191753 3300014325 Bacteria 2092
304 Ga0163163_11422140 3300014325 Bacteria 755
305 Ga0163163_12741624 3300014325 Bacteria 550
306 Ga0157380_10028623 3300014326 Bacteria 4251
307 Ga0157380_10045978 3300014326 Bacteria 3427
308 Ga0157380_10502146 3300014326 Bacteria 1178
309 Ga0157380_11027379 3300014326 Bacteria 859
310 Ga0182008_10036875 3300014497 Bacteria 2446
311 Ga0182008_10061920 3300014497 Bacteria 1845
312 Ga0157379_10010369 3300014968 Bacteria 8119
313 Ga0157379_10054527 3300014968 Bacteria 3572
314 Ga0157379_10072587 3300014968 Bacteria 3079
315 Ga0157379_10872353 3300014968 Bacteria 852
316 Ga0157376_10005027 3300014969 Bacteria 9221
317 Ga0157376_12490579 3300014969 Bacteria 557
318 Ga0157376_12959438 3300014969 Bacteria 514
319 Ga0182007_10017984 3300015262 Bacteria 2571
320 Ga0163161_10003912 3300017792 Bacteria 10448
321 Ga0197907_10339444 3300020069 Bacteria 806
322 Ga0206356_11187003 3300020070 Bacteria 1200
323 Ga0206356_11700594 3300020070 Bacteria 584
324 Ga0206349_1530087 3300020075 Bacteria 845
325 Ga0206355_1211932 3300020076 Bacteria 566
326 Ga0206351_10140964 3300020077 Bacteria 543
327 Ga0206352_10593072 3300020078 Bacteria 919
328 Ga0206350_11130271 3300020080 Bacteria 856
329 Ga0206350_11406840 3300020080 Bacteria 668
330 Ga0206354_11246408 3300020081 Bacteria 943
331 Ga0154015_1086285 3300020610 Bacteria 861
332 Ga0213872_10002261 3300021361 Bacteria 11488
333 Ga0213876_10108926 3300021384 Bacteria 1470
334 Ga0213875_10528058 3300021388 Bacteria 568
335 Ga0213871_10314223 3300021441 Bacteria 508
336 Ga0224712_10124612 3300022467 Bacteria 1119
337 Ga0224712_10393493 3300022467 Bacteria 660
338 Ga0247551_105375 3300023552 Bacteria 532
339 Ga0209435_100323 3300025206 Bacteria 11442
340 Ga0209646_1000283 3300025246 Bacteria 44163
341 Ga0209026_1001836 3300025250 Bacteria 8710
342 Ga0209148_1001569 3300025254 Bacteria 10901
343 Ga0209759_1000548 3300025256 Bacteria 38674
344 Ga0209565_1016465 3300025263 Bacteria 1643
345 Ga0209565_1017675 3300025263 Bacteria 1559
346 Ga0207666_1010509 3300025271 Bacteria 1267
347 Ga0209673_1014580 3300025273 Bacteria 3034
348 Ga0209673_1046816 3300025273 Bacteria 1177
349 Ga0209130_1010299 3300025284 Bacteria 2587
350 Ga0209675_1000449 3300025291 Bacteria 31892
351 Ga0209676_1000064 3300025292 Bacteria 321700
352 Ga0209025_1000690 3300025294 Bacteria 57778
353 Ga0209025_1000746 3300025294 Bacteria 54767
354 Ga0209564_1000891 3300025295 Bacteria 39249
355 Ga0209564_1001109 3300025295 Bacteria 31794
356 Ga0209256_1000193 3300025299 Bacteria 117486
357 Ga0209051_1000281 3300025303 Bacteria 83196
358 Ga0209051_1000980 3300025303 Bacteria 27699
359 Ga0209051_1012476 3300025303 Bacteria 4108
360 Ga0209257_1000039 3300025304 Bacteria 591694
361 Ga0207697_10129333 3300025315 Bacteria 1090
362 Ga0207656_10120352 3300025321 Bacteria 1222
363 Ga0207682_10245409 3300025893 Bacteria 833
364 Ga0207688_10236596 3300025901 Bacteria 1103
365 Ga0207680_10182205 3300025903 Bacteria 1421
366 Ga0207685_10457549 3300025905 Bacteria 665
367 Ga0207699_10032668 3300025906 Bacteria 2934
368 Ga0207645_10005684 3300025907 Bacteria 9010
369 Ga0207645_10239960 3300025907 Bacteria 1197
370 Ga0207645_10323101 3300025907 Bacteria 1029
371 Ga0207643_10421149 3300025908 Bacteria 846
372 Ga0207643_10706685 3300025908 Bacteria 652
373 Ga0207705_10006851 3300025909 Bacteria 8421
374 Ga0207705_10181070 3300025909 Bacteria 1590
375 Ga0207705_10276060 3300025909 Bacteria 1286
376 Ga0207705_10398586 3300025909 Bacteria 1064
377 Ga0207705_10561058 3300025909 Bacteria 888
378 Ga0207684_10037357 3300025910 Bacteria 4121
379 Ga0207654_10005360 3300025911 Bacteria 6480
380 Ga0207654_11180043 3300025911 Bacteria 558
381 Ga0207707_10885989 3300025912 Bacteria 739
382 Ga0207695_10414780 3300025913 Bacteria 1231
383 Ga0207671_10080363 3300025914 Bacteria 2444
384 Ga0207671_10137847 3300025914 Bacteria 1877
385 Ga0207693_10076579 3300025915 Bacteria 2619
386 Ga0207693_10469920 3300025915 Bacteria 982
387 Ga0207663_10054098 3300025916 Bacteria 2512
388 Ga0207663_10173167 3300025916 Bacteria 1535
389 Ga0207663_11181642 3300025916 Bacteria 616
390 Ga0207660_10709516 3300025917 Bacteria 820
391 Ga0207660_11171119 3300025917 Bacteria 626
392 Ga0207662_10124229 3300025918 Bacteria 1621
393 Ga0207657_10001356 3300025919 Bacteria 26083
394 Ga0207657_10037493 3300025919 Bacteria 4327
395 Ga0207657_10037997 3300025919 Bacteria 4292
396 Ga0207657_10435813 3300025919 Bacteria 1029
397 Ga0207657_10765997 3300025919 Bacteria 747
398 Ga0207649_10008692 3300025920 Bacteria 5546
399 Ga0207649_10213913 3300025920 Bacteria 1369
400 Ga0207652_10299460 3300025921 Bacteria 1451
401 Ga0207652_10696569 3300025921 Bacteria 907
402 Ga0207652_10914042 3300025921 Bacteria 775
403 Ga0207652_11174352 3300025921 Bacteria 669
404 Ga0207646_10958276 3300025922 Bacteria 757
405 Ga0207681_10041950 3300025923 Bacteria 3053
406 Ga0207681_10091869 3300025923 Bacteria 2169
407 Ga0207681_10568204 3300025923 Bacteria 935
408 Ga0207694_10038457 3300025924 Bacteria 3679
409 Ga0207694_10125141 3300025924 Bacteria 2056
410 Ga0207694_10169738 3300025924 Bacteria 1766
411 Ga0207694_10283236 3300025924 Unclassified 1362
412 Ga0207650_10749426 3300025925 Bacteria 826
413 Ga0207659_10005215 3300025926 Bacteria 7866
414 Ga0207659_10048380 3300025926 Bacteria 3012
415 Ga0207659_11436307 3300025926 Bacteria 591
416 Ga0207687_10059961 3300025927 Bacteria 2682
417 Ga0207687_10135575 3300025927 Bacteria 1861
418 Ga0207687_10513131 3300025927 Bacteria 1002
419 Ga0207700_10100054 3300025928 Bacteria 2310
420 Ga0207700_10118043 3300025928 Bacteria 2146
421 Ga0207700_10174177 3300025928 Bacteria 1797
422 Ga0207700_10481255 3300025928 Bacteria 1097
423 Ga0207700_11522786 3300025928 Bacteria 593
424 Ga0207664_10039415 3300025929 Bacteria 3668
425 Ga0207664_11014766 3300025929 Bacteria 743
426 Ga0207644_10079813 3300025931 Bacteria 2415
427 Ga0207644_10088455 3300025931 Bacteria 2304
428 Ga0207644_10289327 3300025931 Bacteria 1317
429 Ga0207644_11081445 3300025931 Bacteria 674
430 Ga0207690_10008492 3300025932 Bacteria 6092
431 Ga0207690_10032989 3300025932 Bacteria 3326
432 Ga0207690_10294649 3300025932 Bacteria 1267
433 Ga0207690_10305092 3300025932 Bacteria 1247
434 Ga0207690_11669074 3300025932 Bacteria 532
435 Ga0207706_10000933 3300025933 Bacteria 29885
436 Ga0207706_10020371 3300025933 Bacteria 5962
437 Ga0207706_10091464 3300025933 Bacteria 2675
438 Ga0207706_10137030 3300025933 Bacteria 2153
439 Ga0207706_10203567 3300025933 Bacteria 1736
440 Ga0207706_10976996 3300025933 Bacteria 712
441 Ga0207686_10023141 3300025934 Bacteria 3585
442 Ga0207686_10910490 3300025934 Bacteria 710
443 Ga0207709_10813999 3300025935 Bacteria 755
444 Ga0207709_11750571 3300025935 Bacteria 517
445 Ga0207670_10122033 3300025936 Bacteria 1896
446 Ga0207670_10797064 3300025936 Bacteria 787
447 Ga0207670_10993567 3300025936 Bacteria 706
448 Ga0207669_11606463 3300025937 Bacteria 555
449 Ga0207704_10293317 3300025938 Bacteria 1242
450 Ga0207704_11224007 3300025938 Bacteria 641
451 Ga0207665_10119669 3300025939 Bacteria 1859
452 Ga0207665_10363817 3300025939 Bacteria 1094
453 Ga0207691_10008515 3300025940 Bacteria 9852
454 Ga0207691_10083769 3300025940 Bacteria 2863
455 Ga0207691_10341381 3300025940 Bacteria 1282
456 Ga0207691_11130370 3300025940 Bacteria 651
457 Ga0207711_10046230 3300025941 Bacteria 3719
458 Ga0207711_10118967 3300025941 Bacteria 2357
459 Ga0207711_11271343 3300025941 Bacteria 678
460 Ga0207689_10000150 3300025942 Bacteria 60037
461 Ga0207689_10729710 3300025942 Bacteria 836
462 Ga0207661_10784722 3300025944 Bacteria 877
463 Ga0207679_10012145 3300025945 Bacteria 5607
464 Ga0207679_10020511 3300025945 Bacteria 4461
465 Ga0207679_10083942 3300025945 Bacteria 2443
466 Ga0207679_10087149 3300025945 Bacteria 2403
467 Ga0207679_10277740 3300025945 Bacteria 1435
468 Ga0207679_11498423 3300025945 Bacteria 619
469 Ga0207667_10016294 3300025949 Bacteria 8399
470 Ga0207667_10163526 3300025949 Bacteria 2288
471 Ga0207667_10223884 3300025949 Bacteria 1927
472 Ga0207667_10307577 3300025949 Bacteria 1619
473 Ga0207667_10821888 3300025949 Bacteria 925
474 Ga0207651_10036335 3300025960 Bacteria 3214
475 Ga0207651_10182804 3300025960 Bacteria 1665
476 Ga0207651_10550739 3300025960 Bacteria 1003
477 Ga0207668_10171906 3300025972 Bacteria 1700
478 Ga0207668_11098077 3300025972 Bacteria 713
479 Ga0207640_10017371 3300025981 Bacteria 4209
480 Ga0207640_10061385 3300025981 Bacteria 2490
481 Ga0207640_10159840 3300025981 Bacteria 1666
482 Ga0207640_11002290 3300025981 Bacteria 735
483 Ga0207658_10275815 3300025986 Bacteria 1439
484 Ga0207658_10365469 3300025986 Bacteria 1260
485 Ga0207658_11133683 3300025986 Bacteria 715
486 Ga0207677_10012436 3300026023 Bacteria 4893
487 Ga0207677_10902991 3300026023 Bacteria 796
488 Ga0207677_11004334 3300026023 Bacteria 757
489 Ga0207703_10030559 3300026035 Bacteria 4258
490 Ga0207703_10047106 3300026035 Bacteria 3475
491 Ga0207703_10875308 3300026035 Bacteria 860
492 Ga0207639_10053565 3300026041 Bacteria 3079
493 Ga0207639_10140530 3300026041 Bacteria 2011
494 Ga0207639_11485460 3300026041 Bacteria 636
495 Ga0207639_11580365 3300026041 Bacteria 615
496 Ga0207678_10002944 3300026067 Bacteria 15425
497 Ga0207708_10547373 3300026075 Bacteria 975
498 Ga0207708_10680046 3300026075 Bacteria 878
499 Ga0207702_10046560 3300026078 Bacteria 3652
500 Ga0207702_10401949 3300026078 Bacteria 1321
501 Ga0207702_10815597 3300026078 Bacteria 923
502 Ga0207641_10576045 3300026088 Bacteria 1100
503 Ga0207641_10919223 3300026088 Bacteria 869
504 Ga0207641_11041584 3300026088 Bacteria 816
505 Ga0207648_10067687 3300026089 Bacteria 3113
506 Ga0207648_10561469 3300026089 Bacteria 1049
507 Ga0207648_10746705 3300026089 Bacteria 909
508 Ga0207648_10765479 3300026089 Bacteria 897
509 Ga0207676_10063161 3300026095 Bacteria 2940
510 Ga0207676_10063624 3300026095 Bacteria 2931
511 Ga0207676_10184572 3300026095 Bacteria 1829
512 Ga0207674_10020946 3300026116 Bacteria 7053
513 Ga0207674_10023098 3300026116 Bacteria 6669
514 Ga0207674_10878405 3300026116 Bacteria 864
515 Ga0207675_100001131 3300026118 Bacteria 26465
516 Ga0207675_102018693 3300026118 Bacteria 594
517 Ga0207683_10034729 3300026121 Bacteria 4383
518 Ga0207683_10064766 3300026121 Bacteria 3222
519 Ga0207683_10145903 3300026121 Bacteria 2134
520 Ga0207698_10016066 3300026142 Bacteria 5035
521 Ga0207698_10054479 3300026142 Bacteria 3077
522 Ga0207698_10129121 3300026142 Bacteria 2156
523 Ga0207698_10289791 3300026142 Bacteria 1519
524 Ga0209981_1058634 3300027378 Bacteria 588
525 Ga0209588_1052034 3300027671 Bacteria 1324
526 Ga0209966_1001722 3300027695 Bacteria 3714
527 Ga0209813_10092905 3300027866 Bacteria 1016
528 Ga0209813_10463238 3300027866 Bacteria 520
529 Ga0207428_10076303 3300027907 Bacteria 2625
530 Ga0268266_10042112 3300028379 Bacteria 3899
531 Ga0268264_10080643 3300028381 Bacteria 2779
532 Ga0268264_11569700 3300028381 Bacteria 669
533 Ga0307517_10142655 3300028786 Bacteria 1675
534 Ga0265338_11112225 3300028800 Bacteria 532
535 Ga0265332_10024451 3300031238 Bacteria 2658
536 Ga0265328_10052951 3300031239 Bacteria 1489
537 Ga0265328_10082897 3300031239 Bacteria 1182
538 Ga0265329_10013217 3300031242 Bacteria 2950
539 Ga0265331_10069940 3300031250 Bacteria 1643
540 Ga0265327_10000235 3300031251 Bacteria 111362
541 Ga0265316_10273699 3300031344 Bacteria 1235
542 Ga0307408_100168832 3300031548 Bacteria 1745
543 Ga0265314_10069835 3300031711 Bacteria 2356
544 Ga0265342_10375356 3300031712 Bacteria 737
545 Ga0307516_10784276 3300031730 Bacteria 614
546 Ga0307405_10100216 3300031731 Bacteria 1941
547 Ga0307413_10281625 3300031824 Bacteria 1251
548 Ga0307410_10198657 3300031852 Bacteria 1530
549 Ga0307406_10647142 3300031901 Bacteria 877
550 Ga0307406_10872865 3300031901 Bacteria 764
551 Ga0307406_11098634 3300031901 Bacteria 687
552 Ga0307407_10333253 3300031903 Bacteria 1069
553 Ga0307407_11169890 3300031903 Bacteria 600
554 Ga0307412_10012955 3300031911 Bacteria 4876
555 Ga0307409_100325083 3300031995 Bacteria 1441
556 Ga0307409_100393451 3300031995 Bacteria 1321
557 Ga0307416_100002702 3300032002 Bacteria 10275
558 Ga0307416_100180331 3300032002 Bacteria 1978
559 Ga0307416_100333748 3300032002 Bacteria 1525
560 Ga0307416_100460126 3300032002 Bacteria 1327
561 Ga0307416_103638900 3300032002 Bacteria 516
562 Ga0307414_10483247 3300032004 Bacteria 1093
563 Ga0307411_10325565 3300032005 Bacteria 1243
564 Ga0307411_10382218 3300032005 Bacteria 1158
565 Ga0307411_11783030 3300032005 Bacteria 571
566 Ga0373930_0094068 3300034816 Bacteria 706
567 Ga0373948_0029739 3300034817 Bacteria 1094
568 Ga0373958_0209027 3300034819 Bacteria 514
569 Ga0373938_0177643 3300034957 Bacteria 580
570 Ga0373926_0000087 3300035083 Bacteria 17710
571 Ga0373926_0297034 3300035083 Bacteria 630
572 Ga0373928_0008445 3300035084 Bacteria 2000
573 Ga0373934_0156273 3300035086 Bacteria 935
574 Ga0373934_0168803 3300035086 Unclassified 898
575 Ga0373944_0026731 3300035089 Bacteria 1706
576 Ga0373944_0093003 3300035089 Bacteria 1010
577 Ga0373951_0182670 3300035091 Bacteria 603
578 Ga0373923_0103358 3300035111 Bacteria 1259
579 Ga0373923_0586749 3300035111 Unclassified 548
580 Ga0373932_0042968 3300035112 Bacteria 1313
581 Ga0373936_0003309 3300035113 Bacteria 6045
582 Ga0373939_0010456 3300035114 Bacteria 2321
583 Ga0373941_0428948 3300035115 Bacteria 551
584 Ga0373945_0010919 3300035116 Bacteria 2995
585 Ga0373953_0068564 3300035117 Bacteria 1460
586 Ga0373956_0056907 3300035119 Unclassified 1766
587 Ga0373956_0157436 3300035119 Bacteria 1070
588 Ga0373957_0098280 3300035120 Bacteria 1170
589 Ga0373943_0007648 3300035170 Bacteria 4855
590 Ga0373943_0023074 3300035170 Bacteria 2890
591 Ga0373943_0196052 3300035170 Bacteria 1116
592 Ga0373943_0322287 3300035170 Bacteria 881
593 Ga0373943_0680074 3300035170 Bacteria 609
594 Ga0373946_0007723 3300035171 Bacteria 3941
595 Ga0373946_0101427 3300035171 Bacteria 1291
596 Ga0373955_0063053 3300035172 Bacteria 2052
597 Ga0373955_0080380 3300035172 Unclassified 1841
598 Ga0373942_0063074 3300035207 Bacteria 1066
599 Ga0373961_0024198 3300035241 Bacteria 1641
600 Ga0373962_0053205 3300035242 Bacteria 1171
601 Ga0373962_0071634 3300035242 Bacteria 1037
602 Ga0373931_0004895 3300035691 Bacteria 6157
603 Ga0373931_0020515 3300035691 Bacteria 3307
604 Ga0373931_0557768 3300035691 Bacteria 745
605 Ga0373931_0669130 3300035691 Bacteria 683
606 Ga0373935_0145650 3300035692 Bacteria 1603
607 Ga0373935_0317902 3300035692 Bacteria 1104
608 Ga0373935_1293747 3300035692 Bacteria 544
609 Ga0373927_0027669 3300035695 Bacteria 3701
610 Ga0373933_0178501 3300035724 Bacteria 1354
611 Ga0373933_0494155 3300035724 Unclassified 801
612 Ga0373947_0002298 3300035725 Bacteria 11557
613 Ga0373947_0066867 3300035725 Unclassified 2194
614 Ga0373947_0076151 3300035725 Bacteria 2067
615 Ga0373947_0347720 3300035725 Bacteria 994
616 Ga0373947_0847437 3300035725 Bacteria 624
617 Ga0373937_0010585 3300036401 Bacteria 8060
618 Ga0373937_0013598 3300036401 Bacteria 7171
619 Ga0373937_0024912 3300036401 Bacteria 5400
620 Ga0373937_1062308 3300036401 Bacteria 758
621 Ga0373925_0031082 3300037068 Bacteria 3921
622 Ga0373925_0043519 3300037068 Bacteria 3333
623 Ga0373925_0766317 3300037068 Bacteria 795
624 Ga0373925_1234211 3300037068 Bacteria 614
625 Ga0395899_0007451 3300037312 Bacteria 8454
626 Ga0395899_0035375 3300037312 Bacteria 3750
627 Ga0395899_0240357 3300037312 Bacteria 1246
628 Ga0395900_0000846 3300037418 Bacteria 40292
629 Ga0395900_0016251 3300037418 Bacteria 7583
630 Ga0395900_0032975 3300037418 Bacteria 5330
631 Ga0395900_0037359 3300037418 Bacteria 5008
632 Ga0395900_0068359 3300037418 Bacteria 3650
633 Ga0395900_0076227 3300037418 Bacteria 3447
634 Ga0395900_0192550 3300037418 Bacteria 2067
635 Ga0395900_0451656 3300037418 Bacteria 1241
636 Ga0395900_0489864 3300037418 Bacteria 1181
637 Ga0395900_0702634 3300037418 Bacteria 944
638 Ga0395898_0063565 3300037466 Bacteria 3581
639 Ga0395898_0535860 3300037466 Bacteria 1112
640 Ga0395898_0807538 3300037466 Bacteria 878
641 Ga0395905_0000589 3300037471 Bacteria 48792
642 Ga0395905_0001323 3300037471 Bacteria 30288
643 Ga0395905_0010865 3300037471 Bacteria 8818
644 Ga0395905_0011469 3300037471 Bacteria 8565
645 Ga0395905_0047866 3300037471 Bacteria 4007
646 Ga0395905_0054452 3300037471 Bacteria 3744
647 Ga0395905_0148918 3300037471 Bacteria 2202
648 Ga0395905_0304019 3300037471 Bacteria 1483
649 Ga0395905_0612190 3300037471 Bacteria 991
650 Ga0395905_0981921 3300037471 Bacteria 747
651 Ga0395905_1110335 3300037471 Bacteria 694
652 Ga0395905_1358427 3300037471 Bacteria 614
653 Ga0436364_0111886 3300037853 Bacteria 3128
654 Ga0395901_0000730 3300038443 Bacteria 37345
655 Ga0395901_0203522 3300038443 Bacteria 2074
656 Ga0395901_0280083 3300038443 Bacteria 1732
657 Ga0395901_0387167 3300038443 Bacteria 1438
658 Ga0395901_0407129 3300038443 Bacteria 1397
659 Ga0395901_0456038 3300038443 Bacteria 1307
660 Ga0400483_078643 3300039062 Bacteria 13677
661 Ga0400483_260254 3300039062 Bacteria 8241
662 Ga0436365_0322561 3300039437 Bacteria 902
663 Ga0436365_1519697 3300039437 Bacteria 1791
664 Ga0436360_0707490 3300039438 Bacteria 1646
665 Ga0436361_0239425 3300039447 Bacteria 40455
666 Ga0436363_1012411 3300039450 Bacteria 918
667 Ga0436363_1219339 3300039450 Bacteria 4090
668 Ga0439436_0082677 3300041404 Bacteria 894
669 Ga0439436_0175784 3300041404 Bacteria 608
670 Ga0439438_085533 3300041405 Bacteria 771
671 Ga0439439_0187321 3300041406 Bacteria 598
672 Ga0439453_0006038 3300041408 Bacteria 1870
673 Ga0439461_0133137 3300041410 Bacteria 630
674 Ga0451791_0640864 3300041451 Bacteria 627
675 Ga0451802_0100909 3300041460 Bacteria 1391
676 Ga0451839_0242961 3300041496 Bacteria 509
677 Ga0451841_0820842 3300041498 Bacteria 552
678 Ga0451853_1927380 3300041512 Bacteria 638
679 Ga0439433_0064245 3300041999 Bacteria 878
680 Ga0439433_0093801 3300041999 Bacteria 740
681 Ga0439441_024765 3300042001 Bacteria 1129
682 Ga0439443_124526 3300042003 Bacteria 508
683 Ga0439448_0005764 3300042005 Bacteria 3538
684 Ga0439449_0007009 3300042007 Bacteria 4293
685 Ga0439449_0113627 3300042007 Bacteria 1004
686 Ga0439449_0113655 3300042007 Bacteria 1003
687 Ga0439450_093737 3300042008 Bacteria 756
688 Ga0439455_0232008 3300042012 Bacteria 538
689 Ga0439457_038319 3300042014 Bacteria 1067
690 Ga0439462_0031644 3300042015 Bacteria 1401
691 Ga0450896_017071 3300042133 Bacteria 1046
692 Ga0450904_000433 3300042139 Bacteria 8384
693 Ga0450906_065311 3300042145 Bacteria 649
694 Ga0439446_0015332 3300042156 Bacteria 2125
695 Ga0439446_0044458 3300042156 Bacteria 1314
696 Ga0439458_0049411 3300042157 Bacteria 1035
697 Ga0439458_0170571 3300042157 Bacteria 588
698 Ga0450908_019422 3300042184 Bacteria 1196
699 Ga0450909_030549 3300042185 Bacteria 817
700 Ga0439464_0028302 3300042439 Bacteria 1561
701 Ga0439460_0006452 3300042461 Bacteria 2911
702 Ga0451577_0002065 3300042876 Bacteria 24794
703 Ga0451577_0028662 3300042876 Bacteria 5033
704 Ga0451577_0074388 3300042876 Bacteria 3030
705 Ga0451577_0103577 3300042876 Bacteria 2543
706 Ga0451577_0641176 3300042876 Bacteria 963
707 Ga0451577_0796240 3300042876 Bacteria 854
708 Ga0439440_0280101 3300042993 Bacteria 515
709 Ga0466969_0000349 3300044656 Bacteria 25360
710 Ga0466969_0073557 3300044656 Bacteria 1640
711 Ga0466969_0276076 3300044656 Bacteria 761
712 Ga0466969_0547412 3300044656 Bacteria 529
713 Ga0466972_0003323 3300044658 Bacteria 7976
714 Ga0466972_0010708 3300044658 Bacteria 4601
715 Ga0466972_0285913 3300044658 Bacteria 770
716 Ga0466965_0000489 3300044683 Bacteria 14080
717 Ga0466965_0003742 3300044683 Bacteria 6715
718 Ga0466965_0022215 3300044683 Bacteria 3058
719 Ga0466965_0056211 3300044683 Bacteria 1959
720 Ga0466965_0174393 3300044683 Bacteria 1132
721 Ga0466965_0228009 3300044683 Bacteria 994
722 Ga0466965_0357395 3300044683 Bacteria 801
723 Ga0466966_0009286 3300044684 Bacteria 6510
724 Ga0466966_0015545 3300044684 Bacteria 5030
725 Ga0466966_0058816 3300044684 Bacteria 2428
726 Ga0466966_0124631 3300044684 Bacteria 1580
727 Ga0466966_0659804 3300044684 Bacteria 630
728 Ga0466966_0800219 3300044684 Bacteria 568
729 Ga0466961_0304783 3300044693 Bacteria 972
730 Ga0466961_0314475 3300044693 Bacteria 955
731 Ga0466961_0502743 3300044693 Bacteria 732
732 Ga0466963_0217135 3300044694 Bacteria 1339
733 Ga0466963_0303647 3300044694 Bacteria 1123
734 Ga0466963_0455532 3300044694 Bacteria 903
735 Ga0466964_0002101 3300044706 Bacteria 7014
736 Ga0466964_0020999 3300044706 Bacteria 2521
737 Ga0466964_0101537 3300044706 Bacteria 1269
738 Ga0466964_0124520 3300044706 Bacteria 1166
739 Ga0453684_0064524 3300044712 Bacteria 4677
740 Ga0453684_0231499 3300044712 Bacteria 2133
741 Ga0453684_0352917 3300044712 Bacteria 1658
742 Ga0453684_0636998 3300044712 Bacteria 1164
743 Ga0453684_0860025 3300044712 Bacteria 974
744 Ga0466971_0048746 3300044719 Bacteria 1904
745 Ga0466971_0699625 3300044719 Bacteria 509
746 Ga0466968_0012041 3300044735 Bacteria 3379
747 Ga0466968_0014107 3300044735 Bacteria 3153
748 Ga0466968_0043104 3300044735 Bacteria 1909
749 Ga0466970_0095225 3300044765 Bacteria 1618
750 Ga0466970_0183982 3300044765 Bacteria 1160
751 Ga0466957_0002989 3300044842 Bacteria 9180
752 Ga0466957_0096678 3300044842 Bacteria 1856
753 Ga0466957_1269221 3300044842 Bacteria 534
754 Ga0466960_0006510 3300044901 Bacteria 4688
755 Ga0466959_0080761 3300045049 Bacteria 2343
756 Ga0466959_0185276 3300045049 Bacteria 1454
757 Ga0466959_0321614 3300045049 Bacteria 1057
758 Ga0466959_0367182 3300045049 Bacteria 980
759 Ga0466959_0488701 3300045049 Bacteria 833
760 Ga0466959_0594114 3300045049 Bacteria 745
761 Ga0451576_0001787 3300045051 Bacteria 35253
762 Ga0451576_0004860 3300045051 Bacteria 17216
763 Ga0451576_0013709 3300045051 Bacteria 9056
764 Ga0451576_0032108 3300045051 Bacteria 5596
765 Ga0451576_0073133 3300045051 Bacteria 3567
766 Ga0451576_0125359 3300045051 Bacteria 2676
767 Ga0451576_0151188 3300045051 Bacteria 2421
768 Ga0451576_0442008 3300045051 Bacteria 1365
769 Ga0451576_0611557 3300045051 Bacteria 1145
770 Ga0466958_0007467 3300045836 Bacteria 6018
771 Ga0466958_0328258 3300045836 Bacteria 984
772 Ga0466958_0350471 3300045836 Bacteria 950
773 Ga0466958_0396849 3300045836 Bacteria 890
774 Ga0466958_0432877 3300045836 Bacteria 851
775 Ga0466958_0692050 3300045836 Bacteria 664
776 Ga0466967_0185836 3300045976 Bacteria 1962
777 Ga0466967_0555119 3300045976 Bacteria 1131
778 Ga0466967_1997079 3300045976 Bacteria 577
779 Ga0495617_000134 3300046452 Bacteria 49612
780 Ga0495617_000305 3300046452 Bacteria 27697
781 Ga0495627_000458 3300046453 Bacteria 35419
782 Ga0495627_007824 3300046453 Bacteria 4063
783 Ga0495592_0066694 3300046454 Bacteria 2633
784 Ga0495592_0273776 3300046454 Bacteria 1107
785 Ga0495592_0897617 3300046454 Bacteria 521
786 Ga0495603_0008086 3300046455 Bacteria 6356
787 Ga0495603_0038945 3300046455 Bacteria 2849
788 Ga0495603_0587554 3300046455 Bacteria 637
789 Ga0495603_0587564 3300046455 Bacteria 637
790 Ga0495590_0000186 3300046457 Bacteria 35464
791 Ga0495590_0000538 3300046457 Bacteria 18178
792 Ga0495590_0006291 3300046457 Bacteria 4646
793 Ga0495591_000149 3300046458 Bacteria 74051
794 Ga0495591_013030 3300046458 Bacteria 3064
795 Ga0495629_0019066 3300046459 Bacteria 4905
796 Ga0495629_0090904 3300046459 Bacteria 2130
797 Ga0495629_0373516 3300046459 Bacteria 971
798 Ga0495629_0377036 3300046459 Bacteria 965
799 Ga0495629_0409631 3300046459 Unclassified 921
800 Ga0495629_0767210 3300046459 Bacteria 637
801 Ga0495638_0009109 3300046460 Bacteria 6988
802 Ga0495638_0137305 3300046460 Bacteria 1430
803 Ga0495638_0309513 3300046460 Bacteria 848
804 Ga0495651_0048106 3300046462 Bacteria 3294
805 Ga0495651_0473713 3300046462 Bacteria 805
806 Ga0495653_0047322 3300046463 Bacteria 3327
807 Ga0495653_0121713 3300046463 Unclassified 1859
808 Ga0495653_0133827 3300046463 Bacteria 1751
809 Ga0495650_0000499 3300046471 Bacteria 59360
810 Ga0495650_0000666 3300046471 Bacteria 44724
811 Ga0495650_0005914 3300046471 Bacteria 7773
812 Ga0495650_0029067 3300046471 Bacteria 2525
813 Ga0495650_0195072 3300046471 Bacteria 706
814 Ga0495580_0010068 3300046472 Bacteria 7388
815 Ga0495580_0212768 3300046472 Bacteria 1330
816 Ga0495580_0238257 3300046472 Bacteria 1248
817 Ga0495580_0259921 3300046472 Bacteria 1187
818 Ga0495580_0364301 3300046472 Bacteria 978
819 Ga0495580_0371736 3300046472 Bacteria 966
820 Ga0495582_0017109 3300046473 Bacteria 3968
821 Ga0495582_0035632 3300046473 Bacteria 2737
822 Ga0495582_0112802 3300046473 Bacteria 1527
823 Ga0495605_0000317 3300046474 Bacteria 50604
824 Ga0495605_0000351 3300046474 Bacteria 44529
825 Ga0495605_0003626 3300046474 Bacteria 9160
826 Ga0495605_0008785 3300046474 Bacteria 5701
827 Ga0495605_0017514 3300046474 Bacteria 3853
828 Ga0495605_0033194 3300046474 Bacteria 2622
829 Ga0495605_0040894 3300046474 Bacteria 2311
830 Ga0495605_0054808 3300046474 Bacteria 1929
831 Ga0495605_0055543 3300046474 Bacteria 1913
832 Ga0495605_0114338 3300046474 Bacteria 1228
833 Ga0495639_0039448 3300046475 Bacteria 2123
834 Ga0495639_0264113 3300046475 Bacteria 853
835 Ga0495662_0678381 3300046476 Bacteria 503
836 Ga0495664_0001723 3300046477 Bacteria 11632
837 Ga0495664_0444856 3300046477 Bacteria 776
838 Ga0495664_0606109 3300046477 Bacteria 651
839 Ga0495584_0000413 3300046491 Bacteria 29405
840 Ga0495584_0000642 3300046491 Bacteria 23292
841 Ga0495584_0000875 3300046491 Bacteria 19432
842 Ga0495584_0002667 3300046491 Bacteria 10048
843 Ga0495584_0010340 3300046491 Bacteria 4797
844 Ga0495584_0012542 3300046491 Bacteria 4326
845 Ga0495584_0013009 3300046491 Bacteria 4246
846 Ga0495584_0027897 3300046491 Bacteria 2860
847 Ga0495584_0029248 3300046491 Bacteria 2792
848 Ga0495584_0029393 3300046491 Bacteria 2784
849 Ga0495584_0046724 3300046491 Bacteria 2184
850 Ga0495584_0076889 3300046491 Bacteria 1678
851 Ga0495584_0087146 3300046491 Bacteria 1573
852 Ga0495584_0088426 3300046491 Bacteria 1562
853 Ga0495584_0093697 3300046491 Bacteria 1515
854 Ga0495584_0119517 3300046491 Bacteria 1334
855 Ga0495584_0151355 3300046491 Bacteria 1179
856 Ga0495584_0192953 3300046491 Bacteria 1035
857 Ga0495584_0389238 3300046491 Bacteria 708
858 Ga0495585_0000148 3300046492 Bacteria 76376
859 Ga0495585_0000500 3300046492 Bacteria 37095
860 Ga0495585_0003434 3300046492 Bacteria 10705
861 Ga0495585_0003975 3300046492 Bacteria 9757
862 Ga0495585_0004965 3300046492 Bacteria 8506
863 Ga0495585_0010663 3300046492 Bacteria 5460
864 Ga0495585_0015683 3300046492 Bacteria 4400
865 Ga0495585_0021337 3300046492 Bacteria 3719
866 Ga0495585_0051903 3300046492 Bacteria 2271
867 Ga0495585_0158739 3300046492 Bacteria 1174
868 Ga0495594_0005043 3300046499 Bacteria 6796
869 Ga0495594_0009434 3300046499 Bacteria 5039
870 Ga0495594_0024113 3300046499 Bacteria 3265
871 Ga0495594_0029417 3300046499 Bacteria 2968
872 Ga0495594_0103591 3300046499 Bacteria 1601
873 Ga0495596_0001037 3300046500 Bacteria 16509
874 Ga0495596_0002079 3300046500 Bacteria 10979
875 Ga0495596_0002643 3300046500 Bacteria 9485
876 Ga0495596_0002945 3300046500 Bacteria 8834
877 Ga0495596_0006916 3300046500 Bacteria 5168
878 Ga0495596_0023774 3300046500 Bacteria 2485
879 Ga0495596_0035603 3300046500 Bacteria 1973
880 Ga0495596_0050451 3300046500 Bacteria 1630
881 Ga0495596_0288781 3300046500 Bacteria 637
882 Ga0495607_0000409 3300046501 Bacteria 43547
883 Ga0495607_0000558 3300046501 Bacteria 36357
884 Ga0495607_0000899 3300046501 Bacteria 27679
885 Ga0495607_0002604 3300046501 Bacteria 14508
886 Ga0495607_0006007 3300046501 Bacteria 8611
887 Ga0495607_0010344 3300046501 Bacteria 6276
888 Ga0495607_0010963 3300046501 Bacteria 6062
889 Ga0495607_0010968 3300046501 Bacteria 6060
890 Ga0495607_0019907 3300046501 Bacteria 4252
891 Ga0495607_0115168 3300046501 Bacteria 1419
892 Ga0495607_0367984 3300046501 Bacteria 660
893 Ga0495607_0508411 3300046501 Bacteria 533
894 Ga0495583_0000590 3300046506 Bacteria 49812
895 Ga0495583_0000856 3300046506 Bacteria 37034
896 Ga0495583_0001490 3300046506 Bacteria 23383
897 Ga0495583_0007409 3300046506 Bacteria 6902
898 Ga0495583_0013563 3300046506 Bacteria 4538
899 Ga0495583_0014742 3300046506 Bacteria 4293
900 Ga0495583_0022669 3300046506 Bacteria 3197
901 Ga0495583_0044197 3300046506 Bacteria 2069
902 Ga0495583_0079968 3300046506 Bacteria 1421
903 Ga0495606_0002227 3300046507 Bacteria 23133
904 Ga0495606_0004441 3300046507 Bacteria 14017
905 Ga0495606_0011116 3300046507 Bacteria 7380
906 Ga0495606_0012532 3300046507 Bacteria 6791
907 Ga0495606_0042722 3300046507 Bacteria 3029
908 Ga0495606_0170705 3300046507 Bacteria 1262
909 Ga0495608_0036509 3300046511 Bacteria 3308
910 Ga0495610_0000555 3300046512 Bacteria 37362
911 Ga0495616_0000052 3300046513 Bacteria 105258
912 Ga0495616_0001914 3300046513 Bacteria 14016
913 Ga0495616_0003379 3300046513 Bacteria 10233
914 Ga0495616_0006221 3300046513 Bacteria 7255
915 Ga0495616_0010286 3300046513 Bacteria 5422
916 Ga0495616_0011821 3300046513 Bacteria 4980
917 Ga0495616_0015289 3300046513 Bacteria 4268
918 Ga0495616_0042250 3300046513 Bacteria 2321
919 Ga0495616_0074785 3300046513 Bacteria 1631
920 Ga0495616_0075075 3300046513 Bacteria 1627
921 Ga0495616_0174567 3300046513 Bacteria 959
922 Ga0495616_0261990 3300046513 Bacteria 739
923 Ga0495616_0377891 3300046513 Bacteria 586
924 Ga0495618_0413609 3300046514 Bacteria 823
925 Ga0495628_0063065 3300046516 Bacteria 2904
926 Ga0495630_0046294 3300046517 Bacteria 3251
927 Ga0495630_0948879 3300046517 Bacteria 654
928 Ga0495631_0003928 3300046518 Bacteria 8030
929 Ga0495631_0004117 3300046518 Bacteria 7805
930 Ga0495631_0004219 3300046518 Bacteria 7686
931 Ga0495631_0007135 3300046518 Bacteria 5710
932 Ga0495631_0014570 3300046518 Bacteria 3789
933 Ga0495631_0016096 3300046518 Bacteria 3573
934 Ga0495631_0021100 3300046518 Bacteria 3035
935 Ga0495631_0049397 3300046518 Bacteria 1841
936 Ga0495631_0094953 3300046518 Bacteria 1284
937 Ga0495631_0260011 3300046518 Bacteria 739
938 Ga0495632_0001106 3300046519 Bacteria 23102
939 Ga0495632_0005873 3300046519 Bacteria 8016
940 Ga0495632_0007321 3300046519 Bacteria 6952
941 Ga0495632_0011776 3300046519 Bacteria 5090
942 Ga0495632_0024796 3300046519 Bacteria 3180
943 Ga0495637_0000014 3300046520 Bacteria 228956
944 Ga0495637_0008808 3300046520 Bacteria 4941
945 Ga0495637_0021157 3300046520 Bacteria 2984
946 Ga0495643_0000079 3300046522 Bacteria 162735
947 Ga0495643_0000569 3300046522 Bacteria 45560
948 Ga0495643_0000966 3300046522 Bacteria 29456
949 Ga0495643_0006666 3300046522 Bacteria 7568
950 Ga0495643_0009289 3300046522 Bacteria 6123
951 Ga0495643_0010544 3300046522 Bacteria 5682
952 Ga0495643_0037601 3300046522 Bacteria 2654
953 Ga0495643_0062438 3300046522 Bacteria 1972
954 Ga0495643_0138436 3300046522 Bacteria 1216
955 Ga0495643_0284444 3300046522 Bacteria 759
956 Ga0495643_0346991 3300046522 Bacteria 665
957 Ga0495644_0000343 3300046523 Bacteria 21147
958 Ga0495644_0003670 3300046523 Bacteria 6045
959 Ga0495644_0013674 3300046523 Bacteria 3112
960 Ga0495644_0022045 3300046523 Bacteria 2428
961 Ga0495644_0025467 3300046523 Bacteria 2245
962 Ga0495644_0056819 3300046523 Bacteria 1470
963 Ga0495644_0114482 3300046523 Bacteria 1024
964 Ga0495648_0000117 3300046524 Bacteria 97341
965 Ga0495648_0001357 3300046524 Bacteria 24183
966 Ga0495648_0004461 3300046524 Bacteria 11954
967 Ga0495648_0006377 3300046524 Bacteria 9642
968 Ga0495648_0037677 3300046524 Bacteria 3103
969 Ga0495663_0002287 3300046525 Bacteria 5804
970 Ga0495663_0004095 3300046525 Bacteria 4129
971 Ga0495663_0006624 3300046525 Bacteria 3196
972 Ga0495663_0018299 3300046525 Bacteria 1995
973 Ga0495666_0000105 3300046526 Bacteria 34314
974 Ga0495666_0028590 3300046526 Bacteria 2743
975 Ga0495666_0101215 3300046526 Bacteria 1357
976 Ga0495642_0000716 3300046528 Bacteria 16513
977 Ga0495642_0002469 3300046528 Bacteria 7518
978 Ga0495642_0005378 3300046528 Bacteria 4912
979 Ga0495642_0093700 3300046528 Bacteria 1273
980 Ga0495642_0098491 3300046528 Bacteria 1243
981 Ga0495642_0109076 3300046528 Bacteria 1182
982 Ga0495642_0131698 3300046528 Bacteria 1076
983 Ga0495652_0006184 3300046529 Bacteria 11170
984 Ga0495652_0147524 3300046529 Bacteria 1842
985 Ga0495654_0005316 3300046530 Bacteria 7507
986 Ga0495654_0013571 3300046530 Bacteria 4358
987 Ga0495654_0059332 3300046530 Bacteria 1843
988 Ga0495654_0078627 3300046530 Bacteria 1550
989 Ga0495665_0003288 3300046531 Bacteria 8756
990 Ga0495665_0004480 3300046531 Bacteria 7537
991 Ga0495665_0052457 3300046531 Bacteria 2159
992 Ga0495665_0093842 3300046531 Bacteria 1577
993 Ga0495665_0172907 3300046531 Bacteria 1124
994 Ga0495640_0009203 3300046533 Bacteria 7705
995 Ga0495640_0220259 3300046533 Bacteria 1197
996 Ga0495640_0323356 3300046533 Unclassified 955
997 Ga0495640_0906700 3300046533 Bacteria 522
998 Ga0495586_0005523 3300046535 Bacteria 6758
999 Ga0495586_0007775 3300046535 Bacteria 5716
1000 Ga0495586_0255862 3300046535 Bacteria 999
1001 Ga0495587_0009016 3300046536 Bacteria 6404
1002 Ga0495587_0054464 3300046536 Bacteria 2357
1003 Ga0495587_0468215 3300046536 Bacteria 697
1004 Ga0495598_0211522 3300046537 Bacteria 704
1005 Ga0495598_0239456 3300046537 Bacteria 668
1006 Ga0495609_0000028 3300046538 Bacteria 219908
1007 Ga0495609_0001458 3300046538 Bacteria 15690
1008 Ga0495609_0001649 3300046538 Bacteria 14549
1009 Ga0495609_0001938 3300046538 Bacteria 13171
1010 Ga0495609_0002982 3300046538 Bacteria 10002
1011 Ga0495609_0048464 3300046538 Bacteria 1898
1012 Ga0495609_0134826 3300046538 Bacteria 1056
1013 Ga0495609_0138102 3300046538 Bacteria 1041
1014 Ga0495609_0155752 3300046538 Bacteria 970
1015 Ga0495621_0047082 3300046539 Bacteria 1532
1016 Ga0495621_0153539 3300046539 Bacteria 907
1017 Ga0495621_0169521 3300046539 Bacteria 867
1018 Ga0495621_0525679 3300046539 Bacteria 512
1019 Ga0495597_0000315 3300046542 Bacteria 43611
1020 Ga0495597_0000369 3300046542 Bacteria 39539
1021 Ga0495597_0001487 3300046542 Bacteria 16767
1022 Ga0495597_0001633 3300046542 Bacteria 15702
1023 Ga0495597_0002233 3300046542 Bacteria 12649
1024 Ga0495597_0002969 3300046542 Bacteria 10278
1025 Ga0495597_0029514 3300046542 Bacteria 2503
1026 Ga0495597_0054524 3300046542 Bacteria 1755
1027 Ga0495597_0131597 3300046542 Bacteria 1037
1028 Ga0495597_0157791 3300046542 Bacteria 927
1029 Ga0495597_0205346 3300046542 Bacteria 788
1030 Ga0495597_0429416 3300046542 Bacteria 500
1031 Ga0495645_0039341 3300046543 Bacteria 3449
1032 Ga0495645_0041323 3300046543 Bacteria 3363
1033 Ga0495645_0422672 3300046543 Bacteria 845
1034 Ga0495622_0194110 3300046557 Bacteria 906
1035 Ga0495633_0001752 3300046558 Bacteria 16133
1036 Ga0495633_0003558 3300046558 Bacteria 10307
1037 Ga0495633_0005489 3300046558 Bacteria 7723
1038 Ga0495633_0011443 3300046558 Bacteria 4784
1039 Ga0495633_0042182 3300046558 Bacteria 2168
1040 Ga0495633_0100659 3300046558 Bacteria 1341
1041 Ga0495633_0128894 3300046558 Bacteria 1170
1042 Ga0495633_0577675 3300046558 Bacteria 506
1043 Ga0495667_0158011 3300046559 Bacteria 1458
1044 Ga0495667_0206325 3300046559 Bacteria 1257
1045 Ga0495667_0377060 3300046559 Bacteria 895
1046 Ga0495656_0001105 3300046615 Bacteria 8760
1047 Ga0495656_0004033 3300046615 Bacteria 4993
1048 Ga0495656_0011557 3300046615 Bacteria 3242
1049 Ga0495656_0037732 3300046615 Bacteria 1998
1050 Ga0495656_0170437 3300046615 Bacteria 1064
1051 Ga0495656_0303892 3300046615 Bacteria 818
1052 Ga0495656_0364352 3300046615 Bacteria 751
1053 Ga0495656_0388561 3300046615 Bacteria 728
1054 Ga0495656_0649248 3300046615 Bacteria 566
1055 Ga0495668_0001207 3300046616 Bacteria 26142
1056 Ga0495668_0005271 3300046616 Bacteria 8844
1057 Ga0495668_0018322 3300046616 Bacteria 4045
1058 Ga0495668_0067916 3300046616 Bacteria 1961
1059 Ga0495668_0086604 3300046616 Bacteria 1718
1060 Ga0495668_0164494 3300046616 Bacteria 1215
1061 Ga0495634_0007567 3300046642 Bacteria 8143
1062 Ga0495611_0003145 3300046648 Bacteria 7318
1063 Ga0495611_0005991 3300046648 Bacteria 5186
1064 Ga0495611_0012887 3300046648 Bacteria 3553
1065 Ga0495611_0024143 3300046648 Bacteria 2643
1066 Ga0495611_0038803 3300046648 Bacteria 2119
1067 Ga0495611_0352213 3300046648 Bacteria 675
1068 Ga0495625_0008448 3300046660 Bacteria 8788
1069 Ga0495625_0030164 3300046660 Bacteria 4049
1070 Ga0495625_0074545 3300046660 Bacteria 2377
1071 Ga0495625_0204564 3300046660 Bacteria 1301
1072 Ga0495625_0225021 3300046660 Bacteria 1227
1073 Ga0495635_0002078 3300046663 Bacteria 13585
1074 Ga0495635_0067519 3300046663 Bacteria 2453
1075 Ga0495635_0189678 3300046663 Bacteria 1396
1076 Ga0495635_0617384 3300046663 Bacteria 707
1077 Ga0495661_0000950 3300046665 Bacteria 26304
1078 Ga0495661_0001346 3300046665 Bacteria 20826
1079 Ga0495661_0002468 3300046665 Bacteria 14233
1080 Ga0495661_0003746 3300046665 Bacteria 11128
1081 Ga0495661_0004402 3300046665 Bacteria 10180
1082 Ga0495661_0006222 3300046665 Bacteria 8394
1083 Ga0495661_0008157 3300046665 Bacteria 7261
1084 Ga0495661_0010000 3300046665 Bacteria 6486
1085 Ga0495661_0012582 3300046665 Bacteria 5711
1086 Ga0495661_0021461 3300046665 Bacteria 4210
1087 Ga0495661_0037402 3300046665 Bacteria 3030
1088 Ga0495661_0058144 3300046665 Bacteria 2305
1089 Ga0495661_0100637 3300046665 Bacteria 1627
1090 Ga0495661_0117116 3300046665 Bacteria 1476
1091 Ga0495661_0118233 3300046665 Bacteria 1467
1092 Ga0495661_0149104 3300046665 Bacteria 1265
1093 Ga0495661_0178653 3300046665 Bacteria 1126
1094 Ga0495661_0326186 3300046665 Bacteria 762
1095 Ga0495661_0403427 3300046665 Bacteria 664
1096 Ga0495588_0000248 3300046674 Bacteria 45277
1097 Ga0495588_0003529 3300046674 Bacteria 6822
1098 Ga0495588_0009619 3300046674 Bacteria 4474
1099 Ga0495588_0058560 3300046674 Bacteria 1991
1100 Ga0495588_0067437 3300046674 Bacteria 1857
1101 Ga0495588_0121539 3300046674 Bacteria 1376
1102 Ga0495657_0639337 3300046675 Bacteria 614
1103 Ga0495599_0014270 3300046678 Bacteria 4919
1104 Ga0495599_0208901 3300046678 Bacteria 1198
1105 Ga0495623_0002488 3300046679 Bacteria 12217
1106 Ga0495623_0017205 3300046679 Bacteria 4670
1107 Ga0495623_0073006 3300046679 Bacteria 2133
1108 Ga0495623_0273312 3300046679 Bacteria 943
1109 Ga0495623_0654775 3300046679 Bacteria 541
1110 Ga0495646_0023334 3300046680 Bacteria 3896
1111 Ga0495647_0000233 3300046681 Bacteria 15143
1112 Ga0495658_0043733 3300046683 Bacteria 2507
1113 Ga0495658_0153852 3300046683 Bacteria 1414
1114 Ga0495669_0000228 3300046684 Bacteria 33234
1115 Ga0495669_0000859 3300046684 Bacteria 12862
1116 Ga0495669_0001640 3300046684 Bacteria 9200
1117 Ga0495669_0009038 3300046684 Bacteria 4199
1118 Ga0495669_0044475 3300046684 Bacteria 1978
1119 Ga0495669_0050355 3300046684 Bacteria 1867
1120 Ga0495669_0081242 3300046684 Bacteria 1488
1121 Ga0495613_0034223 3300046689 Bacteria 3775
1122 Ga0495613_0105051 3300046689 Bacteria 2039
1123 Ga0495613_0488989 3300046689 Bacteria 830
1124 Ga0495670_0000237 3300046691 Bacteria 25310
1125 Ga0495670_0002403 3300046691 Bacteria 9233
1126 Ga0495670_0005782 3300046691 Bacteria 6061
1127 Ga0495670_0017160 3300046691 Bacteria 3561
1128 Ga0495670_0019739 3300046691 Bacteria 3321
1129 Ga0495670_0381426 3300046691 Bacteria 760
1130 Ga0495670_0485398 3300046691 Bacteria 670
1131 Ga0495671_0002737 3300046692 Bacteria 11049
1132 Ga0495671_0004717 3300046692 Bacteria 8057
1133 Ga0495671_0005286 3300046692 Bacteria 7577
1134 Ga0495671_0157001 3300046692 Bacteria 1107
1135 Ga0495671_0644246 3300046692 Bacteria 503
1136 Ga0495649_0003105 3300046694 Bacteria 11370
1137 Ga0495649_0005628 3300046694 Bacteria 7919
1138 Ga0495649_0013683 3300046694 Bacteria 4676
1139 Ga0495649_0049656 3300046694 Bacteria 2278
1140 Ga0495649_0054436 3300046694 Bacteria 2164
1141 Ga0495649_0103965 3300046694 Bacteria 1508
1142 Ga0495649_0242534 3300046694 Bacteria 928
1143 Ga0495649_0330477 3300046694 Bacteria 772
1144 Ga0495649_0372416 3300046694 Bacteria 719
1145 Ga0495589_0000113 3300046794 Bacteria 76949
1146 Ga0495589_0000178 3300046794 Bacteria 56371
1147 Ga0495589_0000225 3300046794 Bacteria 48078
1148 Ga0495589_0001893 3300046794 Bacteria 11861
1149 Ga0495589_0014360 3300046794 Bacteria 4080
1150 Ga0495589_0034468 3300046794 Bacteria 2541
1151 Ga0495589_0117337 3300046794 Bacteria 1282
1152 Ga0495589_0138689 3300046794 Bacteria 1165
1153 Ga0495589_0268108 3300046794 Bacteria 795
1154 Ga0495589_0547608 3300046794 Bacteria 527
1155 Ga0495589_0598773 3300046794 Bacteria 502
1156 Ga0495600_0005904 3300046809 Bacteria 7406
1157 Ga0495600_0099892 3300046809 Bacteria 1891
1158 Ga0495600_0682745 3300046809 Bacteria 619
1159 Ga0495660_0000438 3300046810 Bacteria 34904
1160 Ga0495660_0005112 3300046810 Bacteria 7882
1161 Ga0495660_0034709 3300046810 Bacteria 2821
1162 Ga0495660_0038091 3300046810 Bacteria 2675
1163 Ga0495660_0061568 3300046810 Bacteria 2013
1164 Ga0495660_0071424 3300046810 Bacteria 1840
1165 Ga0495660_0072926 3300046810 Bacteria 1817
1166 Ga0495660_0177336 3300046810 Bacteria 1033
1167 Ga0495660_0374577 3300046810 Bacteria 628
1168 Ga0495604_0011002 3300047317 Bacteria 7184
1169 Ga0495604_0024580 3300047317 Bacteria 4806
1170 Ga0495604_0028211 3300047317 Bacteria 4465
1171 Ga0495604_0034503 3300047317 Bacteria 4002
1172 Ga0495604_0051039 3300047317 Bacteria 3209
1173 Ga0495604_0094873 3300047317 Bacteria 2205
1174 Ga0495636_0033788 3300047318 Bacteria 2103
1175 Ga0495636_0161378 3300047318 Bacteria 1010
1176 Ga0495636_0351316 3300047318 Bacteria 696
1177 Ga0495674_0137727 3300047319 Bacteria 2053
1178 Ga0495674_0146396 3300047319 Bacteria 1983
1179 Ga0495674_0305594 3300047319 Bacteria 1298
1180 Ga0495672_0000014 3300047320 Bacteria 505636
1181 Ga0495672_0000140 3300047320 Bacteria 106637
1182 Ga0495672_0000471 3300047320 Bacteria 47689
1183 Ga0495672_0000521 3300047320 Bacteria 43978
1184 Ga0495672_0000997 3300047320 Bacteria 29222
1185 Ga0495672_0033283 3300047320 Bacteria 3194
1186 Ga0495672_0040958 3300047320 Bacteria 2805
1187 Ga0495672_0130712 3300047320 Bacteria 1321
1188 Ga0495672_0140029 3300047320 Bacteria 1264
1189 Ga0495672_0186770 3300047320 Bacteria 1045
1190 Ga0495676_0000180 3300047321 Bacteria 49779
1191 Ga0495676_0072447 3300047321 Bacteria 2645
1192 Ga0495676_0303869 3300047321 Bacteria 1075
1193 Ga0495676_0831603 3300047321 Bacteria 593
1194 Ga0495680_0003335 3300047322 Bacteria 15874
1195 Ga0495680_0049898 3300047322 Bacteria 3275
1196 Ga0495680_0169825 3300047322 Bacteria 1579
1197 Ga0495680_0179794 3300047322 Bacteria 1527
1198 Ga0495683_0000242 3300047323 Bacteria 49547
1199 Ga0495683_0001445 3300047323 Bacteria 15590
1200 Ga0495683_0025695 3300047323 Bacteria 3017
1201 Ga0495683_0036376 3300047323 Bacteria 2499
1202 Ga0495683_0072086 3300047323 Bacteria 1694
1203 Ga0495683_0219826 3300047323 Bacteria 847
1204 Ga0495683_0259558 3300047323 Bacteria 759
1205 Ga0495683_0261753 3300047323 Bacteria 755
1206 Ga0495687_000054 3300047443 Bacteria 194607
1207 Ga0495687_001284 3300047443 Bacteria 23652
1208 Ga0495687_002185 3300047443 Bacteria 16281
1209 Ga0495687_002656 3300047443 Bacteria 13937
1210 Ga0495687_003943 3300047443 Bacteria 10379
1211 Ga0495687_014261 3300047443 Bacteria 4097
1212 Ga0495687_022632 3300047443 Bacteria 3013
1213 Ga0495687_030558 3300047443 Bacteria 2479
1214 Ga0495675_0003293 3300047444 Bacteria 9712
1215 Ga0495675_0025019 3300047444 Bacteria 3808
1216 Ga0495675_0045772 3300047444 Bacteria 2787
1217 Ga0495675_0062223 3300047444 Bacteria 2363
1218 Ga0495675_0129201 3300047444 Bacteria 1571
1219 Ga0495675_0168430 3300047444 Unclassified 1346
1220 Ga0495675_0439275 3300047444 Bacteria 756
1221 Ga0495677_0000084 3300047445 Bacteria 48271
1222 Ga0495677_0000723 3300047445 Bacteria 13329
1223 Ga0495677_0001366 3300047445 Bacteria 9760
1224 Ga0495677_0005230 3300047445 Bacteria 4936
1225 Ga0495677_0006688 3300047445 Bacteria 4341
1226 Ga0495677_0013840 3300047445 Bacteria 2937
1227 Ga0495677_0014184 3300047445 Bacteria 2902
1228 Ga0495677_0034073 3300047445 Bacteria 1857
1229 Ga0495677_0064659 3300047445 Bacteria 1359
1230 Ga0495677_0080774 3300047445 Bacteria 1218
1231 Ga0495677_0089770 3300047445 Bacteria 1157
1232 Ga0495677_0135459 3300047445 Bacteria 944
1233 Ga0495677_0266002 3300047445 Bacteria 672
1234 Ga0495679_001674 3300047446 Bacteria 12320
1235 Ga0495679_001847 3300047446 Bacteria 11452
1236 Ga0495679_027729 3300047446 Bacteria 1864
1237 Ga0495679_185390 3300047446 Bacteria 550
1238 Ga0495685_007440 3300047447 Bacteria 3615
1239 Ga0495685_038942 3300047447 Bacteria 1627
1240 Ga0495685_099939 3300047447 Bacteria 958
1241 Ga0495685_106286 3300047447 Bacteria 925
1242 Ga0495673_0018181 3300047469 Bacteria 3551
1243 Ga0495673_0117228 3300047469 Bacteria 1058
1244 Ga0495673_0182490 3300047469 Bacteria 794
1245 Ga0495681_0000840 3300047470 Bacteria 23654
1246 Ga0495681_0002247 3300047470 Bacteria 13893
1247 Ga0495681_0003545 3300047470 Bacteria 10858
1248 Ga0495681_0004805 3300047470 Bacteria 9155
1249 Ga0495681_0023127 3300047470 Bacteria 3308
1250 Ga0495681_0024760 3300047470 Bacteria 3152
1251 Ga0495681_0030058 3300047470 Bacteria 2772
1252 Ga0495681_0285687 3300047470 Bacteria 642
1253 Ga0495684_0592518 3300047471 Bacteria 749
1254 Ga0495684_0725708 3300047471 Bacteria 656
1255 Ga0495684_1065892 3300047471 Bacteria 509
1256 Ga0495686_0000285 3300047472 Bacteria 88880
1257 Ga0495686_0004901 3300047472 Bacteria 10786
1258 Ga0495686_0051766 3300047472 Bacteria 2576
1259 Ga0495686_0057530 3300047472 Bacteria 2426
1260 Ga0495686_0083086 3300047472 Bacteria 1954
1261 Ga0495593_0023218 3300047673 Bacteria 3449
1262 Ga0495593_0265975 3300047673 Bacteria 858
1263 Ga0495602_0015309 3300048088 Bacteria 7747
1264 Ga0495602_0107551 3300048088 Bacteria 2273
1265 Ga0495614_0003105 3300048089 Bacteria 7396
1266 Ga0495614_0406643 3300048089 Bacteria 640
1267 Ga0495615_0068646 3300048090 Bacteria 951
1268 Ga0495626_0000036 3300048091 Bacteria 180464
1269 Ga0495626_0000044 3300048091 Bacteria 165533
1270 Ga0495626_0000629 3300048091 Bacteria 34299
1271 Ga0495626_0001081 3300048091 Bacteria 23187
1272 Ga0495626_0002963 3300048091 Bacteria 11267
1273 Ga0495626_0006613 3300048091 Bacteria 6571
1274 Ga0495626_0017553 3300048091 Bacteria 3610
1275 Ga0495626_0028012 3300048091 Bacteria 2734
1276 Ga0495626_0038454 3300048091 Bacteria 2268
1277 Ga0495626_0042084 3300048091 Bacteria 2147
1278 Ga0495626_0060279 3300048091 Bacteria 1729
1279 Ga0495626_0112058 3300048091 Bacteria 1180
1280 Ga0495626_0112206 3300048091 Bacteria 1179
1281 Ga0495626_0129400 3300048091 Bacteria 1079
1282 Ga0495626_0138925 3300048091 Bacteria 1031
1283 Ga0495626_0301151 3300048091 Bacteria 633
1284 Ga0496100_0001165 3300048903 Bacteria 12784
1285 Ga0496100_0123007 3300048903 Bacteria 1818
1286 Ga0496100_0832291 3300048903 Bacteria 724
1287 Ga0496101_0064188 3300048904 Bacteria 2674
1288 Ga0496101_0122159 3300048904 Bacteria 1970
1289 Ga0496101_0456086 3300048904 Bacteria 1009
1290 Ga0496102_0000422 3300048905 Bacteria 48884
1291 Ga0496102_0004117 3300048905 Bacteria 12329
1292 Ga0496102_0010119 3300048905 Bacteria 8113
1293 Ga0496102_0074965 3300048905 Bacteria 3110
1294 Ga0496102_0128757 3300048905 Bacteria 2368
1295 Ga0496102_0190643 3300048905 Bacteria 1932
1296 Ga0496102_0333326 3300048905 Bacteria 1429
1297 Ga0496102_0881966 3300048905 Bacteria 816
1298 Ga0496102_1433809 3300048905 Bacteria 609
1299 Ga0496104_0022451 3300048907 Bacteria 5798
1300 Ga0496104_0090739 3300048907 Bacteria 2920
1301 Ga0496104_0559640 3300048907 Bacteria 1054
1302 Ga0496104_0927991 3300048907 Bacteria 775
1303 Ga0496105_0078861 3300048908 Bacteria 2719
1304 Ga0496105_0392841 3300048908 Bacteria 1102
1305 Ga0496105_0907311 3300048908 Bacteria 664
1306 Ga0496106_0001957 3300048909 Bacteria 15478
1307 Ga0496106_0072734 3300048909 Bacteria 2629
1308 Ga0496106_0973228 3300048909 Bacteria 668
1309 Ga0496107_0009370 3300048910 Bacteria 6788
1310 Ga0496107_0246498 3300048910 Bacteria 1329
1311 Ga0496107_0497102 3300048910 Bacteria 905
1312 Ga0496108_0012798 3300048911 Bacteria 6832
1313 Ga0496108_0243780 3300048911 Bacteria 1563
1314 Ga0496108_0620621 3300048911 Bacteria 941
1315 Ga0496108_0912411 3300048911 Bacteria 754
1316 Ga0496108_1747674 3300048911 Bacteria 511
1317 Ga0496109_0006063 3300048912 Bacteria 10156
1318 Ga0496109_0028870 3300048912 Bacteria 4966
1319 Ga0496109_0064236 3300048912 Bacteria 3359
1320 Ga0496109_0162874 3300048912 Bacteria 2090
1321 Ga0496109_0167622 3300048912 Bacteria 2060
1322 Ga0496109_0313007 3300048912 Bacteria 1481
1323 Ga0496109_0317221 3300048912 Bacteria 1471
1324 Ga0496110_0000233 3300048913 Bacteria 35865
1325 Ga0496110_0104317 3300048913 Bacteria 2543
1326 Ga0496110_0790936 3300048913 Bacteria 853
1327 Ga0496110_0910842 3300048913 Bacteria 785
1328 Ga0496111_0133604 3300048914 Bacteria 1837
1329 Ga0496111_0152684 3300048914 Bacteria 1713
1330 Ga0496111_0293917 3300048914 Bacteria 1205
1331 Ga0496111_0399718 3300048914 Bacteria 1015
1332 Ga0496111_0951895 3300048914 Bacteria 617
1333 Ga0496112_0187678 3300048915 Bacteria 2030
1334 Ga0496112_0541582 3300048915 Bacteria 1098
1335 Ga0496112_0611479 3300048915 Bacteria 1021
1336 Ga0496112_0770753 3300048915 Bacteria 887
1337 Ga0496112_0816915 3300048915 Bacteria 857
1338 Ga0496113_0008052 3300048916 Bacteria 6839
1339 Ga0496113_0080967 3300048916 Bacteria 2488
1340 Ga0496113_0204380 3300048916 Bacteria 1570
1341 Ga0496113_0387803 3300048916 Bacteria 1121
1342 Ga0496114_0062115 3300048917 Bacteria 3126
1343 Ga0496114_0072365 3300048917 Bacteria 2899
1344 Ga0496114_0115597 3300048917 Bacteria 2302
1345 Ga0496114_0828258 3300048917 Bacteria 805
1346 Ga0496115_0297697 3300048918 Bacteria 1322
1347 Ga0496121_0255560 3300048924 Bacteria 1213
1348 Ga0496122_0001269 3300048925 Bacteria 42288
1349 Ga0496122_0018535 3300048925 Bacteria 6422
1350 Ga0496123_0000780 3300048926 Bacteria 51494
1351 Ga0496123_0003906 3300048926 Bacteria 16199
1352 Ga0496124_0036489 3300048927 Bacteria 4287
1353 Ga0496124_0235880 3300048927 Bacteria 1364
1354 Ga0496124_0282901 3300048927 Bacteria 1208
1355 Ga0496125_0000870 3300048928 Bacteria 48206
1356 Ga0496125_0360110 3300048928 Bacteria 865
1357 Ga0501308_000453 3300049128 Bacteria 2669
1358 Ga0501304_008560 3300049160 Bacteria 864
1359 Ga0495678_000150 3300049459 Bacteria 84562
1360 Ga0495678_000327 3300049459 Bacteria 50475
1361 Ga0495678_000413 3300049459 Bacteria 43138
1362 Ga0495678_008087 3300049459 Bacteria 5357
1363 Ga0495682_0019126 3300049460 Bacteria 2577
1364 Ga0501297_074797 3300049520 Bacteria 540
1365 Ga0501298_119295 3300049521 Bacteria 620
1366 Ga0501031_0761371 3300049568 Bacteria 621
1367 Ga0501033_0259284 3300049570 Bacteria 1231
1368 Ga0501034_0511114 3300049571 Bacteria 1114
1369 Ga0501034_0552216 3300049571 Bacteria 1061
1370 Ga0501037_0165891 3300049573 Bacteria 1573
1371 Ga0501038_0204781 3300049574 Bacteria 1582
1372 Ga0501042_1158471 3300049578 Bacteria 564
1373 Ga0501046_0320910 3300049580 Bacteria 1129
1374 Ga0501047_0198473 3300049581 Bacteria 1868
1375 Ga0501047_0581272 3300049581 Bacteria 943
1376 Ga0501047_0689797 3300049581 Bacteria 839
1377 Ga0501048_0641277 3300049582 Bacteria 763
1378 Ga0501048_1093814 3300049582 Bacteria 573
1379 Ga0501067_0872232 3300049583 Bacteria 508
1380 Ga0501069_0927362 3300049585 Bacteria 530
1381 Ga0501073_1186734 3300049589 Bacteria 524
1382 Ga0501074_0813146 3300049590 Bacteria 658
1383 Ga0501076_0130391 3300049592 Bacteria 2039
1384 Ga0501076_1607252 3300049592 Bacteria 533
1385 Ga0501235_177894 3300049669 Bacteria 565
1386 Ga0501249_025427 3300049679 Bacteria 1307
1387 Ga0501249_113046 3300049679 Bacteria 658
1388 Ga0501079_0230779 3300049741 Bacteria 1446
1389 Ga0501080_0798529 3300049742 Bacteria 828
1390 Ga0501080_1203144 3300049742 Bacteria 651
1391 Ga0501232_030868 3300049757 Bacteria 744
1392 Ga0501035_0006628 3300049822 Bacteria 10837
1393 Ga0501035_0995495 3300049822 Bacteria 659
1394 Ga0501044_0037408 3300049823 Bacteria 5073
1395 Ga0501044_0191265 3300049823 Bacteria 2009
1396 Ga0501044_0283310 3300049823 Bacteria 1590
1397 nmdc:mga03683_76329_c1 3300050489 Bacteria 1440
1398 nmdc:mga03n38_5373_c1 3300050490 Bacteria 4354
1399 nmdc:mga00v17_292411_c1 3300050491 Bacteria 1058
1400 nmdc:mga00v17_676460_c1 3300050491 Bacteria 663
1401 nmdc:mga0yw44_1206841_c1 3300050492 Bacteria 510
1402 nmdc:mga0yw44_254161_c1 3300050492 Bacteria 1170
1403 nmdc:mga0yw44_89847_c1 3300050492 Bacteria 1939
1404 nmdc:mga0k408_100132_c1 3300050493 Bacteria 1708
1405 nmdc:mga0k408_158619_c1 3300050493 Bacteria 1348
1406 nmdc:mga0k408_15900_c1 3300050493 Bacteria 4167
1407 nmdc:mga0k408_1682_c1 3300050493 Bacteria 11938
1408 nmdc:mga0k408_16862_c1 3300050493 Bacteria 4061
1409 nmdc:mga0k408_201322_c1 3300050493 Bacteria 1189
1410 nmdc:mga0k408_45759_c1 3300050493 Bacteria 2526
1411 nmdc:mga0k408_463930_c1 3300050493 Bacteria 752
1412 nmdc:mga0k408_650255_c1 3300050493 Bacteria 620
1413 nmdc:mga06z11_206918_c1 3300050494 Bacteria 1142
1414 nmdc:mga06z11_293909_c1 3300050494 Bacteria 965
1415 nmdc:mga04h51_301457_c1 3300050495 Bacteria 653
1416 nmdc:mga04h51_386840_c1 3300050495 Bacteria 584
1417 nmdc:mga07m45_101201_c1 3300050496 Bacteria 1654
1418 nmdc:mga07m45_1045_c1 3300050496 Bacteria 12330
1419 nmdc:mga07m45_157133_c1 3300050496 Bacteria 1320
1420 nmdc:mga07m45_22889_c1 3300050496 Bacteria 3413
1421 nmdc:mga07m45_54386_c1 3300050496 Bacteria 2263
1422 nmdc:mga05p37_305446_c1 3300050507 Bacteria 1888
1423 nmdc:mga0qj67_388631_c1 3300050509 Bacteria 1126
1424 nmdc:mga08y16_211143_c1 3300050511 Bacteria 2010
1425 nmdc:mga08y16_57458_c1 3300050511 Bacteria 4066
1426 nmdc:mga0n895_103710_c1 3300050512 Bacteria 2855
1427 nmdc:mga0n895_1281284_c1 3300050512 Bacteria 704
1428 nmdc:mga0n895_151356_c1 3300050512 Bacteria 2351
1429 nmdc:mga0n895_432_c1 3300050512 Bacteria 28136
1430 nmdc:mga0rr50_173645_c1 3300050513 Bacteria 1758
1431 nmdc:mga0rr50_61261_c1 3300050513 Bacteria 2834
1432 nmdc:mga0rr50_67511_c1 3300050513 Bacteria 2716
1433 nmdc:mga08x19_142626_c1 3300050514 Bacteria 1619
1434 nmdc:mga08x19_2248_c1 3300050514 Bacteria 11784
1435 nmdc:mga08x19_430068_c1 3300050514 Bacteria 928
1436 nmdc:mga08x19_45268_c1 3300050514 Bacteria 2812
1437 nmdc:mga08x19_487_c1 3300050514 Bacteria 26435
1438 nmdc:mga0a205_27965_c1 3300050515 Bacteria 3937
1439 nmdc:mga0a205_612497_c1 3300050515 Bacteria 941
1440 nmdc:mga0a205_799884_c1 3300050515 Bacteria 791
1441 nmdc:mga0a205_829583_c1 3300050515 Bacteria 772
1442 nmdc:mga0sz30_160192_c1 3300050516 Bacteria 997
1443 nmdc:mga0sz30_261490_c1 3300050516 Bacteria 771
1444 nmdc:mga0sz30_385315_c1 3300050516 Bacteria 628
1445 Ga0495601_0110597 3300053077 Bacteria 1779
1446 Ga0495601_0127073 3300053077 Bacteria 1659
1447 Ga0495601_1079756 3300053077 Bacteria 503
1448 Ga0495612_0039584 3300053078 Bacteria 1918
1449 Ga0495612_0176323 3300053078 Bacteria 937
1450 Ga0495595_0052108 3300053084 Bacteria 1898
1451 Ga0495595_0334568 3300053084 Bacteria 763
1452 Ga0495619_0029087 3300053085 Bacteria 3568
1453 Ga0495619_0141124 3300053085 Unclassified 1659
1454 Ga0500578_0257492 3300053086 Bacteria 1049
1455 Ga0500628_178306 3300053129 Bacteria 606
1456 Ga0500658_0003329 3300053134 Bacteria 6093
1457 Ga0500568_0047444 3300053139 Bacteria 1701
1458 Ga0500633_0177078 3300053160 Bacteria 800
1459 Ga0501084_0493912 3300054114 Bacteria 1034
1460 Ga0590071_065942 3300059421 Bacteria 889
1461 Ga0590075_015049 3300059424 Bacteria 1896
1462 Ga0587084_128763 3300059477 Bacteria 539
1463 Ga0587066_059248 3300059490 Bacteria 777
1464 Ga0587070_013077 3300059491 Bacteria 1274
1465 Ga0587073_0011612 3300059492 Bacteria 1507
1466 Ga0587073_0057516 3300059492 Bacteria 901
1467 Ga0587077_083970 3300059493 Bacteria 736
1468 Ga0587080_007413 3300059503 Bacteria 1541
1469 Ga0587080_086770 3300059503 Bacteria 651
1470 Ga0587080_115170 3300059503 Bacteria 590
1471 Ga0587082_008167 3300059504 Bacteria 1451
1472 Ga0587083_0002695 3300059505 Bacteria 2250
1473 Ga0587083_0022683 3300059505 Bacteria 1178
1474 Ga0587086_055246 3300059507 Bacteria 649
1475 Ga0587088_027587 3300059508 Bacteria 993
1476 Ga0587088_177939 3300059508 Bacteria 531
1477 Ga0587089_050168 3300059509 Bacteria 668
1478 Ga0587090_097530 3300059510 Bacteria 611
1479 Ga0587091_010283 3300059511 Bacteria 1428
1480 Ga0587091_014194 3300059511 Bacteria 1293
1481 Ga0587098_011816 3300059604 Bacteria 989
1482 Ga0587098_043611 3300059604 Bacteria 660
1483 Ga0587098_097312 3300059604 Bacteria 509
1484 Ga0587106_051010 3300059605 Bacteria 733
1485 Ga0587099_009391 3300059622 Bacteria 960
1486 Ga0587101_009356 3300059623 Bacteria 1207
1487 Ga0587101_076736 3300059623 Bacteria 626
1488 Ga0587113_012529 3300059625 Bacteria 808
1489 Ga0587115_110139 3300059626 Bacteria 520
1490 Ga0587128_170952 3300059630 Bacteria 507
1491 Ga0587062_030309 3300059639 Bacteria 825
1492 Ga0587062_107422 3300059639 Bacteria 550
1493 Ga0587067_008287 3300059640 Bacteria 1515
1494 Ga0587068_012974 3300059641 Bacteria 1279
1495 Ga0587069_006057 3300059642 Bacteria 1438
1496 Ga0587076_143311 3300059645 Bacteria 573
1497 Ga0587078_073249 3300059646 Bacteria 538
1498 Ga0587078_081511 3300059646 Bacteria 519
1499 Ga0587079_010086 3300059647 Bacteria 1488
1500 Ga0587102_026987 3300059649 Bacteria 682
1501 Ga0587119_059417 3300059658 Bacteria 586
1502 Ga0587111_0031246 3300060346 Bacteria 1089
1503 Ga0466962_0044798 3300061719 Bacteria 2116
1504 Ga0466962_0669419 3300061719 Bacteria 531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0557768 Ga0373931_0557768_399_722 107
2 3300005843 Ga0068860_101683473 Ga0068860_1016834732 121
3 3300028381 Ga0268264_11569700 Ga0268264_115697001 121
4 3300035242 Ga0373962_0071634 Ga0373962_0071634_119_484 121
5 3300045051 Ga0451576_0611557 Ga0451576_0611557_346_711 121
6 3300046491 Ga0495584_0192953 Ga0495584_0192953_632_997 121
7 3300046525 Ga0495663_0018299 Ga0495663_0018299_443_808 121
8 3300046684 Ga0495669_0050355 Ga0495669_0050355_485_850 121
9 3300049574 Ga0501038_0204781 Ga0501038_0204781_88_453 121
10 3300050507 nmdc:mga05p37_305446_c1 nmdc:mga05p37_305446_c1_331_696 121
11 3300059658 Ga0587119_059417 Ga0587119_059417_97_465 121
12 3300006178 Ga0075367_10731337 Ga0075367_107313372 122
13 3300007265 Ga0099794_10050309 Ga0099794_100503093 122
14 3300007265 Ga0099794_10795900 Ga0099794_107959002 122
15 3300009093 Ga0105240_10775247 Ga0105240_107752472 122
16 3300009098 Ga0105245_10045639 Ga0105245_100456394 122
17 3300009148 Ga0105243_10102716 Ga0105243_101027163 122
18 3300009177 Ga0105248_10016659 Ga0105248_100166594 122
19 3300009177 Ga0105248_10032211 Ga0105248_100322117 122
20 3300009177 Ga0105248_10205361 Ga0105248_102053614 122
21 3300009545 Ga0105237_10948551 Ga0105237_109485511 122
22 3300009545 Ga0105237_12645292 Ga0105237_126452921 122
23 3300009551 Ga0105238_10045282 Ga0105238_100452826 122
24 3300009551 Ga0105238_11617213 Ga0105238_116172132 122
25 3300009553 Ga0105249_11130627 Ga0105249_111306272 122
26 3300010375 Ga0105239_10057462 Ga0105239_100574622 122
27 3300012478 Ga0157328_1016793 Ga0157328_10167932 122
28 3300012482 Ga0157318_1009564 Ga0157318_10095641 122
29 3300013100 Ga0157373_10056085 Ga0157373_100560853 122
30 3300013102 Ga0157371_10044279 Ga0157371_100442794 122
31 3300013104 Ga0157370_10292270 Ga0157370_102922702 122
32 3300013296 Ga0157374_10009658 Ga0157374_100096588 122
33 3300013296 Ga0157374_11846605 Ga0157374_118466051 122
34 3300013306 Ga0163162_10016188 Ga0163162_100161882 122
35 3300013307 Ga0157372_10156872 Ga0157372_101568724 122
36 3300013308 Ga0157375_10375005 Ga0157375_103750053 122
37 3300013308 Ga0157375_10485292 Ga0157375_104852924 122
38 3300014326 Ga0157380_10028623 Ga0157380_100286232 122
39 3300014326 Ga0157380_11027379 Ga0157380_110273792 122
40 3300014968 Ga0157379_10010369 Ga0157379_100103692 122
41 3300014968 Ga0157379_10054527 Ga0157379_100545274 122
42 3300014968 Ga0157379_10072587 Ga0157379_100725873 122
43 3300014969 Ga0157376_10005027 Ga0157376_100050273 122
44 3300014969 Ga0157376_12959438 Ga0157376_129594382 122
45 3300025273 Ga0209673_1014580 Ga0209673_10145802 122
46 3300034816 Ga0373930_0094068 Ga0373930_0094068_14_382 122
47 3300034817 Ga0373948_0029739 Ga0373948_0029739_272_640 122
48 3300034819 Ga0373958_0209027 Ga0373958_0209027_117_485 122
49 3300035084 Ga0373928_0008445 Ga0373928_0008445_456_824 122
50 3300035114 Ga0373939_0010456 Ga0373939_0010456_460_828 122
51 3300035242 Ga0373962_0053205 Ga0373962_0053205_440_808 122
52 3300035691 Ga0373931_0004895 Ga0373931_0004895_61_429 122
53 3300035691 Ga0373931_0020515 Ga0373931_0020515_2490_2858 122
54 3300035691 Ga0373931_0669130 Ga0373931_0669130_302_670 122
55 3300035692 Ga0373935_0317902 Ga0373935_0317902_195_563 122
56 3300037466 Ga0395898_0063565 Ga0395898_0063565_2964_3332 122
57 3300039437 Ga0436365_0322561 Ga0436365_0322561_109_477 122
58 3300039450 Ga0436363_1219339 Ga0436363_1219339_2439_2807 122
59 3300041451 Ga0451791_0640864 Ga0451791_0640864_116_484 122
60 3300041460 Ga0451802_0100909 Ga0451802_0100909_575_946 122
61 3300041498 Ga0451841_0820842 Ga0451841_0820842_140_508 122
62 3300041512 Ga0451853_1927380 Ga0451853_1927380_26_394 122
63 3300041999 Ga0439433_0064245 Ga0439433_0064245_212_580 122
64 3300042007 Ga0439449_0007009 Ga0439449_0007009_2825_3193 122
65 3300042015 Ga0439462_0031644 Ga0439462_0031644_956_1324 122
66 3300042157 Ga0439458_0170571 Ga0439458_0170571_27_395 122
67 3300042876 Ga0451577_0641176 Ga0451577_0641176_537_905 122
68 3300042993 Ga0439440_0280101 Ga0439440_0280101_85_453 122
69 3300044712 Ga0453684_0231499 Ga0453684_0231499_569_937 122
70 3300044712 Ga0453684_0352917 Ga0453684_0352917_1087_1455 122
71 3300044712 Ga0453684_0636998 Ga0453684_0636998_468_836 122
72 3300045051 Ga0451576_0032108 Ga0451576_0032108_1359_1727 122
73 3300045051 Ga0451576_0125359 Ga0451576_0125359_563_931 122
74 3300045051 Ga0451576_0151188 Ga0451576_0151188_1445_1813 122
75 3300046454 Ga0495592_0273776 Ga0495592_0273776_511_879 122
76 3300046459 Ga0495629_0373516 Ga0495629_0373516_578_946 122
77 3300046460 Ga0495638_0309513 Ga0495638_0309513_289_657 122
78 3300046471 Ga0495650_0005914 Ga0495650_0005914_6581_6961 122
79 3300046472 Ga0495580_0238257 Ga0495580_0238257_869_1237 122
80 3300046472 Ga0495580_0259921 Ga0495580_0259921_675_1043 122
81 3300046491 Ga0495584_0000875 Ga0495584_0000875_5865_6245 122
82 3300046533 Ga0495640_0906700 Ga0495640_0906700_115_483 122
83 3300046539 Ga0495621_0169521 Ga0495621_0169521_327_695 122
84 3300046543 Ga0495645_0041323 Ga0495645_0041323_2197_2565 122
85 3300046616 Ga0495668_0067916 Ga0495668_0067916_95_475 122
86 3300046663 Ga0495635_0189678 Ga0495635_0189678_430_798 122
87 3300046683 Ga0495658_0043733 Ga0495658_0043733_1512_1880 122
88 3300046809 Ga0495600_0682745 Ga0495600_0682745_113_481 122
89 3300047447 Ga0495685_007440 Ga0495685_007440_1377_1757 122
90 3300047470 Ga0495681_0285687 Ga0495681_0285687_136_504 122
91 3300047471 Ga0495684_1065892 Ga0495684_1065892_90_458 122
92 3300047472 Ga0495686_0004901 Ga0495686_0004901_7617_7985 122
93 3300048903 Ga0496100_0123007 Ga0496100_0123007_1411_1779 122
94 3300048904 Ga0496101_0122159 Ga0496101_0122159_511_879 122
95 3300048904 Ga0496101_0456086 Ga0496101_0456086_190_570 122
96 3300048905 Ga0496102_0010119 Ga0496102_0010119_507_875 122
97 3300048905 Ga0496102_0190643 Ga0496102_0190643_542_922 122
98 3300048907 Ga0496104_0022451 Ga0496104_0022451_4652_5032 122
99 3300048907 Ga0496104_0090739 Ga0496104_0090739_35_403 122
100 3300048908 Ga0496105_0392841 Ga0496105_0392841_641_1009 122
101 3300048909 Ga0496106_0072734 Ga0496106_0072734_2076_2444 122
102 3300048910 Ga0496107_0009370 Ga0496107_0009370_523_891 122
103 3300048911 Ga0496108_0012798 Ga0496108_0012798_2900_3280 122
104 3300048911 Ga0496108_0243780 Ga0496108_0243780_411_779 122
105 3300048912 Ga0496109_0028870 Ga0496109_0028870_3972_4340 122
106 3300048912 Ga0496109_0064236 Ga0496109_0064236_650_1030 122
107 3300048914 Ga0496111_0152684 Ga0496111_0152684_884_1252 122
108 3300048914 Ga0496111_0293917 Ga0496111_0293917_746_1126 122
109 3300048915 Ga0496112_0541582 Ga0496112_0541582_48_416 122
110 3300048915 Ga0496112_0770753 Ga0496112_0770753_44_424 122
111 3300048916 Ga0496113_0204380 Ga0496113_0204380_1087_1467 122
112 3300048917 Ga0496114_0062115 Ga0496114_0062115_666_1034 122
113 3300049573 Ga0501037_0165891 Ga0501037_0165891_734_1102 122
114 3300049581 Ga0501047_0581272 Ga0501047_0581272_117_485 122
115 3300049582 Ga0501048_0641277 Ga0501048_0641277_58_426 122
116 3300049679 Ga0501249_025427 Ga0501249_025427_115_483 122
117 3300049679 Ga0501249_113046 Ga0501249_113046_59_427 122
118 3300049741 Ga0501079_0230779 Ga0501079_0230779_442_822 122
119 3300049823 Ga0501044_0037408 Ga0501044_0037408_4127_4495 122
120 3300049823 Ga0501044_0283310 Ga0501044_0283310_976_1344 122
121 3300050489 nmdc:mga03683_76329_c1 nmdc:mga03683_76329_c1_968_1336 122
122 3300050493 nmdc:mga0k408_100132_c1 nmdc:mga0k408_100132_c1_983_1351 122
123 3300050493 nmdc:mga0k408_16862_c1 nmdc:mga0k408_16862_c1_808_1176 122
124 3300050493 nmdc:mga0k408_201322_c1 nmdc:mga0k408_201322_c1_759_1127 122
125 3300050493 nmdc:mga0k408_463930_c1 nmdc:mga0k408_463930_c1_86_454 122
126 3300050493 nmdc:mga0k408_650255_c1 nmdc:mga0k408_650255_c1_113_493 122
127 3300050494 nmdc:mga06z11_206918_c1 nmdc:mga06z11_206918_c1_396_764 122
128 3300050496 nmdc:mga07m45_22889_c1 nmdc:mga07m45_22889_c1_838_1206 122
129 3300050511 nmdc:mga08y16_57458_c1 nmdc:mga08y16_57458_c1_2492_2860 122
130 3300050512 nmdc:mga0n895_103710_c1 nmdc:mga0n895_103710_c1_251_619 122
131 3300050515 nmdc:mga0a205_612497_c1 nmdc:mga0a205_612497_c1_449_817 122
132 3300053077 Ga0495601_0127073 Ga0495601_0127073_44_412 122
133 3300053078 Ga0495612_0039584 Ga0495612_0039584_672_1040 122
134 3300053086 Ga0500578_0257492 Ga0500578_0257492_357_725 122
135 iso_pu_bacteria 2916178963 2916180032 122
136 3300005293 Ga0065715_10761580 Ga0065715_107615801 123
137 3300006038 Ga0075365_10085227 Ga0075365_100852271 123
138 3300006038 Ga0075365_10430610 Ga0075365_104306102 123
139 3300006042 Ga0075368_10561871 Ga0075368_105618711 123
140 3300006195 Ga0075366_10000574 Ga0075366_1000057410 123
141 3300006195 Ga0075366_10024978 Ga0075366_100249784 123
142 3300006353 Ga0075370_10000101 Ga0075370_1000010110 123
143 3300006881 Ga0068865_100503981 Ga0068865_1005039813 123
144 3300009093 Ga0105240_10032391 Ga0105240_100323915 123
145 3300009098 Ga0105245_10578523 Ga0105245_105785231 123
146 3300009148 Ga0105243_12196051 Ga0105243_121960511 123
147 3300009174 Ga0105241_10398868 Ga0105241_103988682 123
148 3300009176 Ga0105242_10577028 Ga0105242_105770282 123
149 3300009177 Ga0105248_11062085 Ga0105248_110620852 123
150 3300009545 Ga0105237_10018505 Ga0105237_100185059 123
151 3300010375 Ga0105239_10050731 Ga0105239_100507314 123
152 3300013297 Ga0157378_11504214 Ga0157378_115042142 123
153 3300013308 Ga0157375_11259186 Ga0157375_112591862 123
154 3300025931 Ga0207644_11081445 Ga0207644_110814452 123
155 3300025938 Ga0207704_11224007 Ga0207704_112240071 123
156 3300025981 Ga0207640_10017371 Ga0207640_100173711 123
157 3300026089 Ga0207648_10067687 Ga0207648_100676874 123
158 3300026142 Ga0207698_10054479 Ga0207698_100544794 123
159 3300027866 Ga0209813_10463238 Ga0209813_104632381 123
160 3300028786 Ga0307517_10142655 Ga0307517_101426552 123
161 3300034957 Ga0373938_0177643 Ga0373938_0177643_199_570 123
162 3300035083 Ga0373926_0000087 Ga0373926_0000087_15748_16119 123
163 3300035089 Ga0373944_0026731 Ga0373944_0026731_1076_1447 123
164 3300035113 Ga0373936_0003309 Ga0373936_0003309_5464_5835 123
165 3300035116 Ga0373945_0010919 Ga0373945_0010919_1004_1375 123
166 3300035170 Ga0373943_0007648 Ga0373943_0007648_212_583 123
167 3300035170 Ga0373943_0023074 Ga0373943_0023074_1609_1980 123
168 3300035171 Ga0373946_0007723 Ga0373946_0007723_214_585 123
169 3300035692 Ga0373935_0145650 Ga0373935_0145650_42_413 123
170 3300035695 Ga0373927_0027669 Ga0373927_0027669_1503_1874 123
171 3300035725 Ga0373947_0002298 Ga0373947_0002298_3464_3835 123
172 3300035725 Ga0373947_0347720 Ga0373947_0347720_179_550 123
173 3300035725 Ga0373947_0847437 Ga0373947_0847437_135_506 123
174 3300037068 Ga0373925_0031082 Ga0373925_0031082_1460_1831 123
175 3300037471 Ga0395905_0010865 Ga0395905_0010865_7192_7575 123
176 3300037471 Ga0395905_0148918 Ga0395905_0148918_748_1131 123
177 3300042001 Ga0439441_024765 Ga0439441_024765_290_661 123
178 3300042876 Ga0451577_0074388 Ga0451577_0074388_1914_2285 123
179 3300044706 Ga0466964_0020999 Ga0466964_0020999_129_500 123
180 3300044712 Ga0453684_0860025 Ga0453684_0860025_154_525 123
181 3300044735 Ga0466968_0012041 Ga0466968_0012041_1994_2365 123
182 3300045051 Ga0451576_0001787 Ga0451576_0001787_18131_18502 123
183 3300045051 Ga0451576_0013709 Ga0451576_0013709_4543_4914 123
184 3300045836 Ga0466958_0692050 Ga0466958_0692050_248_619 123
185 3300046455 Ga0495603_0008086 Ga0495603_0008086_614_985 123
186 3300046471 Ga0495650_0195072 Ga0495650_0195072_321_692 123
187 3300046472 Ga0495580_0010068 Ga0495580_0010068_1613_1984 123
188 3300046473 Ga0495582_0035632 Ga0495582_0035632_1328_1699 123
189 3300046475 Ga0495639_0039448 Ga0495639_0039448_553_924 123
190 3300046491 Ga0495584_0151355 Ga0495584_0151355_577_948 123
191 3300046517 Ga0495630_0948879 Ga0495630_0948879_224_595 123
192 3300046535 Ga0495586_0007775 Ga0495586_0007775_4668_5039 123
193 3300046542 Ga0495597_0429416 Ga0495597_0429416_113_484 123
194 3300046615 Ga0495656_0037732 Ga0495656_0037732_641_1012 123
195 3300046665 Ga0495661_0326186 Ga0495661_0326186_182_553 123
196 3300046674 Ga0495588_0009619 Ga0495588_0009619_2802_3173 123
197 3300046681 Ga0495647_0000233 Ga0495647_0000233_1038_1409 123
198 3300046683 Ga0495658_0153852 Ga0495658_0153852_128_499 123
199 3300047321 Ga0495676_0831603 Ga0495676_0831603_95_466 123
200 3300047445 Ga0495677_0135459 Ga0495677_0135459_528_899 123
201 3300048908 Ga0496105_0078861 Ga0496105_0078861_720_1091 123
202 3300048917 Ga0496114_0072365 Ga0496114_0072365_2116_2487 123
203 3300048917 Ga0496114_0115597 Ga0496114_0115597_1760_2131 123
204 3300049580 Ga0501046_0320910 Ga0501046_0320910_44_415 123
205 3300050491 nmdc:mga00v17_676460_c1 nmdc:mga00v17_676460_c1_106_477 123
206 3300050492 nmdc:mga0yw44_1206841_c1 nmdc:mga0yw44_1206841_c1_63_434 123
207 3300050493 nmdc:mga0k408_158619_c1 nmdc:mga0k408_158619_c1_862_1233 123
208 3300050493 nmdc:mga0k408_15900_c1 nmdc:mga0k408_15900_c1_1930_2301 123
209 3300050493 nmdc:mga0k408_45759_c1 nmdc:mga0k408_45759_c1_653_1024 123
210 3300050495 nmdc:mga04h51_301457_c1 nmdc:mga04h51_301457_c1_29_400 123
211 3300050496 nmdc:mga07m45_1045_c1 nmdc:mga07m45_1045_c1_412_783 123
212 3300050496 nmdc:mga07m45_54386_c1 nmdc:mga07m45_54386_c1_1162_1533 123
213 3300050512 nmdc:mga0n895_1281284_c1 nmdc:mga0n895_1281284_c1_164_535 123
214 3300050513 nmdc:mga0rr50_67511_c1 nmdc:mga0rr50_67511_c1_1984_2355 123
215 3300050516 nmdc:mga0sz30_160192_c1 nmdc:mga0sz30_160192_c1_166_537 123
216 3300050516 nmdc:mga0sz30_385315_c1 nmdc:mga0sz30_385315_c1_69_440 123
217 3300053129 Ga0500628_178306 Ga0500628_178306_169_540 123
218 3300003792 Ga0055540_1006946 Ga0055540_10069463 124
219 3300025303 Ga0209051_1000281 Ga0209051_100028165 124
220 3300025304 Ga0209257_1000039 Ga0209257_1000039117 124
221 3300035091 Ga0373951_0182670 Ga0373951_0182670_206_592 124
222 3300037471 Ga0395905_0054452 Ga0395905_0054452_2394_2780 124
223 3300044683 Ga0466965_0228009 Ga0466965_0228009_405_791 124
224 3300044684 Ga0466966_0015545 Ga0466966_0015545_1657_2043 124
225 3300044765 Ga0466970_0183982 Ga0466970_0183982_146_532 124
226 3300045049 Ga0466959_0185276 Ga0466959_0185276_894_1280 124
227 3300048912 Ga0496109_0162874 Ga0496109_0162874_1514_1900 124
228 3300048913 Ga0496110_0910842 Ga0496110_0910842_41_427 124
229 3300050496 nmdc:mga07m45_101201_c1 nmdc:mga07m45_101201_c1_841_1215 124
230 3300005339 Ga0070660_100182808 Ga0070660_1001828082 125
231 3300005341 Ga0070691_10164712 Ga0070691_101647122 125
232 3300005458 Ga0070681_10493180 Ga0070681_104931802 125
233 3300005563 Ga0068855_100005319 Ga0068855_1000053193 125
234 3300009093 Ga0105240_10215520 Ga0105240_102155203 125
235 3300025912 Ga0207707_10885989 Ga0207707_108859892 125
236 3300025919 Ga0207657_10037493 Ga0207657_100374934 125
237 3300025921 Ga0207652_10299460 Ga0207652_102994602 125
238 3300025924 Ga0207694_10169738 Ga0207694_101697382 125
239 3300025949 Ga0207667_10163526 Ga0207667_101635263 125
240 3300026089 Ga0207648_10746705 Ga0207648_107467052 125
241 3300031711 Ga0265314_10069835 Ga0265314_100698353 125
242 3300031712 Ga0265342_10375356 Ga0265342_103753562 125
243 3300041404 Ga0439436_0082677 Ga0439436_0082677_10_387 125
244 3300041406 Ga0439439_0187321 Ga0439439_0187321_151_528 125
245 3300042007 Ga0439449_0113627 Ga0439449_0113627_522_917 125
246 3300049571 Ga0501034_0552216 Ga0501034_0552216_400_777 125
247 3300049578 Ga0501042_1158471 Ga0501042_1158471_80_457 125
248 3300050492 nmdc:mga0yw44_89847_c1 nmdc:mga0yw44_89847_c1_1031_1408 125
249 3300050514 nmdc:mga08x19_487_c1 nmdc:mga08x19_487_c1_21570_21947 125
250 3300059424 Ga0590075_015049 Ga0590075_015049_58_435 125
251 3300005293 Ga0065715_11035556 Ga0065715_110355561 126
252 3300005329 Ga0070683_100713129 Ga0070683_1007131292 126
253 3300005338 Ga0068868_100761222 Ga0068868_1007612222 126
254 3300005347 Ga0070668_100069229 Ga0070668_1000692292 126
255 3300005353 Ga0070669_100118703 Ga0070669_1001187034 126
256 3300005435 Ga0070714_102296400 Ga0070714_1022964001 126
257 3300005456 Ga0070678_100279362 Ga0070678_1002793622 126
258 3300005614 Ga0068856_100625174 Ga0068856_1006251742 126
259 3300005719 Ga0068861_102265949 Ga0068861_1022659491 126
260 3300009094 Ga0111539_10542659 Ga0111539_105426592 126
261 3300009545 Ga0105237_10514705 Ga0105237_105147051 126
262 3300009553 Ga0105249_10957232 Ga0105249_109572321 126
263 3300011119 Ga0105246_10225508 Ga0105246_102255082 126
264 3300013296 Ga0157374_11470716 Ga0157374_114707162 126
265 3300013297 Ga0157378_12518481 Ga0157378_125184811 126
266 3300014325 Ga0163163_10191753 Ga0163163_101917533 126
267 3300014326 Ga0157380_10045978 Ga0157380_100459785 126
268 3300020080 Ga0206350_11406840 Ga0206350_114068402 126
269 3300025303 Ga0209051_1000980 Ga0209051_10009805 126
270 3300025923 Ga0207681_10091869 Ga0207681_100918692 126
271 3300025936 Ga0207670_10122033 Ga0207670_101220334 126
272 3300025944 Ga0207661_10784722 Ga0207661_107847222 126
273 3300026023 Ga0207677_11004334 Ga0207677_110043341 126
274 3300026078 Ga0207702_10815597 Ga0207702_108155971 126
275 3300026118 Ga0207675_102018693 Ga0207675_1020186931 126
276 3300026121 Ga0207683_10145903 Ga0207683_101459034 126
277 3300028379 Ga0268266_10042112 Ga0268266_100421121 126
278 3300037068 Ga0373925_1234211 Ga0373925_1234211_10_390 126
279 3300039450 Ga0436363_1012411 Ga0436363_1012411_373_756 126
280 3300041496 Ga0451839_0242961 Ga0451839_0242961_50_430 126
281 3300046454 Ga0495592_0897617 Ga0495592_0897617_29_412 126
282 3300046472 Ga0495580_0212768 Ga0495580_0212768_537_920 126
283 3300047319 Ga0495674_0137727 Ga0495674_0137727_1535_1918 126
284 3300047471 Ga0495684_0725708 Ga0495684_0725708_194_577 126
285 3300048912 Ga0496109_0313007 Ga0496109_0313007_11_394 126
286 3300049568 Ga0501031_0761371 Ga0501031_0761371_115_495 126
287 3300049592 Ga0501076_1607252 Ga0501076_1607252_35_415 126
288 3300050511 nmdc:mga08y16_211143_c1 nmdc:mga08y16_211143_c1_508_888 126
289 3300003203 JGI25406J46586_10104663 JGI25406J46586_101046632 127
290 3300004803 Ga0058862_12693219 Ga0058862_126932191 127
291 3300005327 Ga0070658_10590896 Ga0070658_105908962 127
292 3300005327 Ga0070658_11690645 Ga0070658_116906451 127
293 3300005435 Ga0070714_100370316 Ga0070714_1003703163 127
294 3300005436 Ga0070713_100042585 Ga0070713_1000425853 127
295 3300005436 Ga0070713_100354967 Ga0070713_1003549672 127
296 3300005436 Ga0070713_102466974 Ga0070713_1024669741 127
297 3300005439 Ga0070711_100634673 Ga0070711_1006346732 127
298 3300005440 Ga0070705_100016436 Ga0070705_1000164363 127
299 3300005441 Ga0070700_100529171 Ga0070700_1005291712 127
300 3300005444 Ga0070694_100384794 Ga0070694_1003847942 127
301 3300005445 Ga0070708_100249276 Ga0070708_1002492762 127
302 3300005468 Ga0070707_100536809 Ga0070707_1005368092 127
303 3300005468 Ga0070707_101522555 Ga0070707_1015225551 127
304 3300005530 Ga0070679_100059905 Ga0070679_1000599054 127
305 3300005535 Ga0070684_101134418 Ga0070684_1011344181 127
306 3300005545 Ga0070695_100000692 Ga0070695_1000006927 127
307 3300005545 Ga0070695_100150230 Ga0070695_1001502302 127
308 3300005546 Ga0070696_100008854 Ga0070696_1000088545 127
309 3300005546 Ga0070696_100311941 Ga0070696_1003119412 127
310 3300005549 Ga0070704_101842160 Ga0070704_1018421601 127
311 3300005614 Ga0068856_100539159 Ga0068856_1005391591 127
312 3300005985 Ga0081539_10000226 Ga0081539_10000226143 127
313 3300006028 Ga0070717_10123117 Ga0070717_101231173 127
314 3300006028 Ga0070717_10301328 Ga0070717_103013281 127
315 3300006173 Ga0070716_100259837 Ga0070716_1002598372 127
316 3300006175 Ga0070712_100247407 Ga0070712_1002474072 127
317 3300006358 Ga0068871_101127584 Ga0068871_1011275842 127
318 3300006844 Ga0075428_100011487 Ga0075428_1000114876 127
319 3300006852 Ga0075433_10028132 Ga0075433_100281325 127
320 3300006852 Ga0075433_10713891 Ga0075433_107138912 127
321 3300006871 Ga0075434_100211503 Ga0075434_1002115034 127
322 3300006871 Ga0075434_100403542 Ga0075434_1004035422 127
323 3300006914 Ga0075436_100000087 Ga0075436_10000008733 127
324 3300006914 Ga0075436_100044693 Ga0075436_1000446932 127
325 3300006914 Ga0075436_100796252 Ga0075436_1007962522 127
326 3300007076 Ga0075435_100476717 Ga0075435_1004767172 127
327 3300007076 Ga0075435_101437372 Ga0075435_1014373721 127
328 3300009101 Ga0105247_11383283 Ga0105247_113832832 127
329 3300009174 Ga0105241_11711613 Ga0105241_117116132 127
330 3300009551 Ga0105238_10358793 Ga0105238_103587932 127
331 3300009551 Ga0105238_12606685 Ga0105238_126066851 127
332 3300009553 Ga0105249_11285878 Ga0105249_112858781 127
333 3300013104 Ga0157370_10126001 Ga0157370_101260013 127
334 3300013297 Ga0157378_10706173 Ga0157378_107061732 127
335 3300013306 Ga0163162_11337283 Ga0163162_113372832 127
336 3300013308 Ga0157375_13194834 Ga0157375_131948341 127
337 3300014497 Ga0182008_10036875 Ga0182008_100368753 127
338 3300020069 Ga0197907_10339444 Ga0197907_103394442 127
339 3300020070 Ga0206356_11187003 Ga0206356_111870032 127
340 3300020070 Ga0206356_11700594 Ga0206356_117005942 127
341 3300020075 Ga0206349_1530087 Ga0206349_15300872 127
342 3300020076 Ga0206355_1211932 Ga0206355_12119321 127
343 3300020077 Ga0206351_10140964 Ga0206351_101409642 127
344 3300020078 Ga0206352_10593072 Ga0206352_105930722 127
345 3300020080 Ga0206350_11130271 Ga0206350_111302712 127
346 3300020081 Ga0206354_11246408 Ga0206354_112464082 127
347 3300020610 Ga0154015_1086285 Ga0154015_10862852 127
348 3300021388 Ga0213875_10528058 Ga0213875_105280581 127
349 3300021441 Ga0213871_10314223 Ga0213871_103142231 127
350 3300022467 Ga0224712_10124612 Ga0224712_101246122 127
351 3300022467 Ga0224712_10393493 Ga0224712_103934932 127
352 3300023552 Ga0247551_105375 Ga0247551_1053751 127
353 3300025905 Ga0207685_10457549 Ga0207685_104575492 127
354 3300025906 Ga0207699_10032668 Ga0207699_100326682 127
355 3300025909 Ga0207705_10181070 Ga0207705_101810703 127
356 3300025910 Ga0207684_10037357 Ga0207684_100373574 127
357 3300025915 Ga0207693_10076579 Ga0207693_100765792 127
358 3300025915 Ga0207693_10469920 Ga0207693_104699202 127
359 3300025916 Ga0207663_10054098 Ga0207663_100540981 127
360 3300025916 Ga0207663_11181642 Ga0207663_111816421 127
361 3300025922 Ga0207646_10958276 Ga0207646_109582762 127
362 3300025924 Ga0207694_10283236 Ga0207694_102832362 127
363 3300025926 Ga0207659_11436307 Ga0207659_114363071 127
364 3300025928 Ga0207700_10100054 Ga0207700_101000542 127
365 3300025928 Ga0207700_10118043 Ga0207700_101180433 127
366 3300025928 Ga0207700_10174177 Ga0207700_101741772 127
367 3300025928 Ga0207700_10481255 Ga0207700_104812552 127
368 3300025928 Ga0207700_11522786 Ga0207700_115227861 127
369 3300025929 Ga0207664_10039415 Ga0207664_100394152 127
370 3300025929 Ga0207664_11014766 Ga0207664_110147662 127
371 3300025937 Ga0207669_11606463 Ga0207669_116064631 127
372 3300025939 Ga0207665_10363817 Ga0207665_103638172 127
373 3300025986 Ga0207658_10365469 Ga0207658_103654692 127
374 3300026075 Ga0207708_10547373 Ga0207708_105473732 127
375 3300026078 Ga0207702_10401949 Ga0207702_104019492 127
376 3300027378 Ga0209981_1058634 Ga0209981_10586342 127
377 3300028800 Ga0265338_11112225 Ga0265338_111122251 127
378 3300035083 Ga0373926_0297034 Ga0373926_0297034_207_593 127
379 3300035086 Ga0373934_0156273 Ga0373934_0156273_509_895 127
380 3300035086 Ga0373934_0168803 Ga0373934_0168803_34_420 127
381 3300035089 Ga0373944_0093003 Ga0373944_0093003_505_891 127
382 3300035111 Ga0373923_0586749 Ga0373923_0586749_114_500 127
383 3300035115 Ga0373941_0428948 Ga0373941_0428948_110_493 127
384 3300035117 Ga0373953_0068564 Ga0373953_0068564_1019_1405 127
385 3300035119 Ga0373956_0056907 Ga0373956_0056907_1342_1728 127
386 3300035119 Ga0373956_0157436 Ga0373956_0157436_581_967 127
387 3300035120 Ga0373957_0098280 Ga0373957_0098280_663_1049 127
388 3300035170 Ga0373943_0196052 Ga0373943_0196052_281_667 127
389 3300035170 Ga0373943_0680074 Ga0373943_0680074_71_457 127
390 3300035171 Ga0373946_0101427 Ga0373946_0101427_119_505 127
391 3300035172 Ga0373955_0063053 Ga0373955_0063053_1173_1559 127
392 3300035172 Ga0373955_0080380 Ga0373955_0080380_814_1200 127
393 3300035692 Ga0373935_1293747 Ga0373935_1293747_147_533 127
394 3300035724 Ga0373933_0178501 Ga0373933_0178501_128_514 127
395 3300035724 Ga0373933_0494155 Ga0373933_0494155_235_621 127
396 3300035725 Ga0373947_0066867 Ga0373947_0066867_1544_1930 127
397 3300035725 Ga0373947_0076151 Ga0373947_0076151_1546_1932 127
398 3300036401 Ga0373937_0010585 Ga0373937_0010585_4748_5134 127
399 3300036401 Ga0373937_0013598 Ga0373937_0013598_812_1198 127
400 3300036401 Ga0373937_0024912 Ga0373937_0024912_4990_5376 127
401 3300036401 Ga0373937_1062308 Ga0373937_1062308_341_727 127
402 3300037068 Ga0373925_0043519 Ga0373925_0043519_633_1019 127
403 3300037471 Ga0395905_0000589 Ga0395905_0000589_14427_14810 127
404 3300037471 Ga0395905_0011469 Ga0395905_0011469_3011_3394 127
405 3300037853 Ga0436364_0111886 Ga0436364_0111886_1741_2127 127
406 3300039438 Ga0436360_0707490 Ga0436360_0707490_1158_1541 127
407 3300042133 Ga0450896_017071 Ga0450896_017071_75_458 127
408 3300044706 Ga0466964_0101537 Ga0466964_0101537_469_852 127
409 3300045051 Ga0451576_0073133 Ga0451576_0073133_1068_1460 127
410 3300045976 Ga0466967_0555119 Ga0466967_0555119_566_952 127
411 3300045976 Ga0466967_1997079 Ga0466967_1997079_82_468 127
412 3300046454 Ga0495592_0066694 Ga0495592_0066694_2151_2537 127
413 3300046459 Ga0495629_0090904 Ga0495629_0090904_102_488 127
414 3300046459 Ga0495629_0409631 Ga0495629_0409631_490_876 127
415 3300046462 Ga0495651_0048106 Ga0495651_0048106_568_954 127
416 3300046462 Ga0495651_0473713 Ga0495651_0473713_103_489 127
417 3300046463 Ga0495653_0121713 Ga0495653_0121713_835_1221 127
418 3300046463 Ga0495653_0133827 Ga0495653_0133827_211_597 127
419 3300046477 Ga0495664_0001723 Ga0495664_0001723_5166_5552 127
420 3300046511 Ga0495608_0036509 Ga0495608_0036509_127_513 127
421 3300046514 Ga0495618_0413609 Ga0495618_0413609_33_419 127
422 3300046516 Ga0495628_0063065 Ga0495628_0063065_776_1162 127
423 3300046529 Ga0495652_0147524 Ga0495652_0147524_1072_1458 127
424 3300046533 Ga0495640_0220259 Ga0495640_0220259_49_435 127
425 3300046533 Ga0495640_0323356 Ga0495640_0323356_292_678 127
426 3300046536 Ga0495587_0009016 Ga0495587_0009016_385_771 127
427 3300046537 Ga0495598_0211522 Ga0495598_0211522_47_430 127
428 3300046539 Ga0495621_0047082 Ga0495621_0047082_630_1013 127
429 3300046543 Ga0495645_0039341 Ga0495645_0039341_1576_1962 127
430 3300046559 Ga0495667_0158011 Ga0495667_0158011_812_1198 127
431 3300046559 Ga0495667_0377060 Ga0495667_0377060_18_404 127
432 3300046663 Ga0495635_0067519 Ga0495635_0067519_1507_1893 127
433 3300046675 Ga0495657_0639337 Ga0495657_0639337_56_442 127
434 3300046678 Ga0495599_0014270 Ga0495599_0014270_2202_2588 127
435 3300046680 Ga0495646_0023334 Ga0495646_0023334_1981_2367 127
436 3300046689 Ga0495613_0488989 Ga0495613_0488989_431_817 127
437 3300046809 Ga0495600_0099892 Ga0495600_0099892_311_697 127
438 3300047317 Ga0495604_0011002 Ga0495604_0011002_3934_4320 127
439 3300047318 Ga0495636_0351316 Ga0495636_0351316_283_666 127
440 3300047319 Ga0495674_0146396 Ga0495674_0146396_1556_1942 127
441 3300047319 Ga0495674_0305594 Ga0495674_0305594_127_513 127
442 3300047322 Ga0495680_0049898 Ga0495680_0049898_2183_2569 127
443 3300047322 Ga0495680_0169825 Ga0495680_0169825_636_1022 127
444 3300047444 Ga0495675_0062223 Ga0495675_0062223_1808_2194 127
445 3300047444 Ga0495675_0129201 Ga0495675_0129201_36_422 127
446 3300047444 Ga0495675_0168430 Ga0495675_0168430_571_957 127
447 3300047471 Ga0495684_0592518 Ga0495684_0592518_36_422 127
448 3300048088 Ga0495602_0015309 Ga0495602_0015309_1192_1578 127
449 3300048903 Ga0496100_0832291 Ga0496100_0832291_24_410 127
450 3300048915 Ga0496112_0611479 Ga0496112_0611479_604_990 127
451 3300049581 Ga0501047_0689797 Ga0501047_0689797_435_821 127
452 3300049582 Ga0501048_1093814 Ga0501048_1093814_51_434 127
453 3300049585 Ga0501069_0927362 Ga0501069_0927362_96_479 127
454 3300050512 nmdc:mga0n895_151356_c1 nmdc:mga0n895_151356_c1_344_727 127
455 3300050513 nmdc:mga0rr50_61261_c1 nmdc:mga0rr50_61261_c1_37_420 127
456 3300050514 nmdc:mga08x19_142626_c1 nmdc:mga08x19_142626_c1_699_1082 127
457 3300050514 nmdc:mga08x19_2248_c1 nmdc:mga08x19_2248_c1_6886_7269 127
458 3300050514 nmdc:mga08x19_430068_c1 nmdc:mga08x19_430068_c1_455_838 127
459 3300050515 nmdc:mga0a205_27965_c1 nmdc:mga0a205_27965_c1_221_604 127
460 3300050515 nmdc:mga0a205_829583_c1 nmdc:mga0a205_829583_c1_248_631 127
461 3300053077 Ga0495601_0110597 Ga0495601_0110597_579_965 127
462 3300053077 Ga0495601_1079756 Ga0495601_1079756_84_470 127
463 3300053078 Ga0495612_0176323 Ga0495612_0176323_183_569 127
464 3300053084 Ga0495595_0052108 Ga0495595_0052108_211_597 127
465 3300053085 Ga0495619_0029087 Ga0495619_0029087_629_1015 127
466 3300053085 Ga0495619_0141124 Ga0495619_0141124_50_436 127
467 3300059507 Ga0587086_055246 Ga0587086_055246_194_580 127
468 3300059508 Ga0587088_177939 Ga0587088_177939_69_455 127
469 3300059509 Ga0587089_050168 Ga0587089_050168_66_452 127
470 3300059604 Ga0587098_097312 Ga0587098_097312_66_452 127
471 3300059623 Ga0587101_076736 Ga0587101_076736_69_455 127
472 3300059626 Ga0587115_110139 Ga0587115_110139_68_454 127
473 3300059630 Ga0587128_170952 Ga0587128_170952_85_471 127
474 3300059646 Ga0587078_073249 Ga0587078_073249_69_455 127
475 3300059646 Ga0587078_081511 Ga0587078_081511_77_463 127
476 3300003322 rootL2_10016479 rootL2_100164791 128
477 3300005327 Ga0070658_10083823 Ga0070658_100838234 128
478 3300005327 Ga0070658_10102909 Ga0070658_101029091 128
479 3300005327 Ga0070658_10202820 Ga0070658_102028201 128
480 3300005328 Ga0070676_10009290 Ga0070676_100092905 128
481 3300005328 Ga0070676_10095408 Ga0070676_100954082 128
482 3300005328 Ga0070676_10605056 Ga0070676_106050562 128
483 3300005329 Ga0070683_100005352 Ga0070683_1000053526 128
484 3300005331 Ga0070670_100003584 Ga0070670_10000358411 128
485 3300005331 Ga0070670_100009851 Ga0070670_1000098518 128
486 3300005333 Ga0070677_10164781 Ga0070677_101647812 128
487 3300005334 Ga0068869_100069759 Ga0068869_1000697594 128
488 3300005334 Ga0068869_101294863 Ga0068869_1012948632 128
489 3300005335 Ga0070666_10113018 Ga0070666_101130183 128
490 3300005336 Ga0070680_100157683 Ga0070680_1001576833 128
491 3300005338 Ga0068868_100001157 Ga0068868_1000011578 128
492 3300005339 Ga0070660_100073236 Ga0070660_1000732365 128
493 3300005344 Ga0070661_100033962 Ga0070661_1000339625 128
494 3300005344 Ga0070661_100037349 Ga0070661_1000373494 128
495 3300005344 Ga0070661_101388409 Ga0070661_1013884091 128
496 3300005353 Ga0070669_101456430 Ga0070669_1014564301 128
497 3300005354 Ga0070675_100001801 Ga0070675_1000018017 128
498 3300005354 Ga0070675_100022306 Ga0070675_1000223066 128
499 3300005355 Ga0070671_100010623 Ga0070671_1000106236 128
500 3300005355 Ga0070671_100020902 Ga0070671_1000209027 128
501 3300005355 Ga0070671_100208905 Ga0070671_1002089053 128
502 3300005355 Ga0070671_100299367 Ga0070671_1002993673 128
503 3300005364 Ga0070673_100865695 Ga0070673_1008656952 128
504 3300005366 Ga0070659_100125477 Ga0070659_1001254773 128
505 3300005367 Ga0070667_100088937 Ga0070667_1000889372 128
506 3300005438 Ga0070701_10242541 Ga0070701_102425412 128
507 3300005440 Ga0070705_100367620 Ga0070705_1003676202 128
508 3300005444 Ga0070694_100562711 Ga0070694_1005627111 128
509 3300005455 Ga0070663_100040127 Ga0070663_1000401272 128
510 3300005455 Ga0070663_100572541 Ga0070663_1005725412 128
511 3300005456 Ga0070678_100005974 Ga0070678_1000059749 128
512 3300005456 Ga0070678_100046649 Ga0070678_1000466494 128
513 3300005456 Ga0070678_100278890 Ga0070678_1002788901 128
514 3300005457 Ga0070662_100000867 Ga0070662_1000008678 128
515 3300005457 Ga0070662_100110025 Ga0070662_1001100251 128
516 3300005535 Ga0070684_100027307 Ga0070684_1000273075 128
517 3300005535 Ga0070684_100409742 Ga0070684_1004097423 128
518 3300005539 Ga0068853_100002880 Ga0068853_1000028808 128
519 3300005543 Ga0070672_100000535 Ga0070672_1000005358 128
520 3300005544 Ga0070686_100969540 Ga0070686_1009695401 128
521 3300005546 Ga0070696_100475830 Ga0070696_1004758302 128
522 3300005547 Ga0070693_100029302 Ga0070693_1000293022 128
523 3300005547 Ga0070693_101101446 Ga0070693_1011014462 128
524 3300005548 Ga0070665_100694432 Ga0070665_1006944322 128
525 3300005563 Ga0068855_100051204 Ga0068855_1000512045 128
526 3300005563 Ga0068855_100155710 Ga0068855_1001557101 128
527 3300005563 Ga0068855_101218898 Ga0068855_1012188982 128
528 3300005564 Ga0070664_100055141 Ga0070664_1000551413 128
529 3300005577 Ga0068857_101165040 Ga0068857_1011650402 128
530 3300005578 Ga0068854_100027581 Ga0068854_1000275815 128
531 3300005578 Ga0068854_100032147 Ga0068854_1000321471 128
532 3300005614 Ga0068856_100004035 Ga0068856_1000040358 128
533 3300005615 Ga0070702_100014791 Ga0070702_1000147913 128
534 3300005616 Ga0068852_100018568 Ga0068852_1000185687 128
535 3300005616 Ga0068852_100054887 Ga0068852_1000548872 128
536 3300005616 Ga0068852_100072682 Ga0068852_1000726824 128
537 3300005616 Ga0068852_100447083 Ga0068852_1004470833 128
538 3300005616 Ga0068852_101228262 Ga0068852_1012282622 128
539 3300005616 Ga0068852_101390769 Ga0068852_1013907692 128
540 3300005617 Ga0068859_101072680 Ga0068859_1010726802 128
541 3300005617 Ga0068859_101236815 Ga0068859_1012368152 128
542 3300005618 Ga0068864_100011769 Ga0068864_10001176910 128
543 3300005618 Ga0068864_100024340 Ga0068864_1000243404 128
544 3300005618 Ga0068864_100194010 Ga0068864_1001940104 128
545 3300005719 Ga0068861_100003855 Ga0068861_10000385510 128
546 3300005834 Ga0068851_10009705 Ga0068851_100097055 128
547 3300005834 Ga0068851_10020198 Ga0068851_100201985 128
548 3300005834 Ga0068851_10042872 Ga0068851_100428724 128
549 3300005834 Ga0068851_10044956 Ga0068851_100449561 128
550 3300005841 Ga0068863_100183411 Ga0068863_1001834113 128
551 3300005842 Ga0068858_100160326 Ga0068858_1001603263 128
552 3300005842 Ga0068858_100257075 Ga0068858_1002570753 128
553 3300005842 Ga0068858_102136059 Ga0068858_1021360592 128
554 3300005843 Ga0068860_100247347 Ga0068860_1002473474 128
555 3300005843 Ga0068860_100616457 Ga0068860_1006164572 128
556 3300005844 Ga0068862_100887250 Ga0068862_1008872502 128
557 3300006038 Ga0075365_10238977 Ga0075365_102389771 128
558 3300006042 Ga0075368_10306824 Ga0075368_103068242 128
559 3300006048 Ga0075363_100011747 Ga0075363_1000117473 128
560 3300006051 Ga0075364_10051591 Ga0075364_100515911 128
561 3300006177 Ga0075362_10008211 Ga0075362_100082113 128
562 3300006177 Ga0075362_10289212 Ga0075362_102892121 128
563 3300006178 Ga0075367_10023342 Ga0075367_100233422 128
564 3300006186 Ga0075369_10169756 Ga0075369_101697562 128
565 3300006195 Ga0075366_10009384 Ga0075366_100093841 128
566 3300006195 Ga0075366_10096764 Ga0075366_100967642 128
567 3300006195 Ga0075366_10364572 Ga0075366_103645722 128
568 3300006195 Ga0075366_10481328 Ga0075366_104813282 128
569 3300006195 Ga0075366_10692919 Ga0075366_106929191 128
570 3300006237 Ga0097621_100037998 Ga0097621_1000379983 128
571 3300006237 Ga0097621_100786463 Ga0097621_1007864632 128
572 3300006353 Ga0075370_10003489 Ga0075370_100034898 128
573 3300006353 Ga0075370_10013018 Ga0075370_100130184 128
574 3300006358 Ga0068871_100012983 Ga0068871_1000129834 128
575 3300006358 Ga0068871_100168797 Ga0068871_1001687973 128
576 3300006852 Ga0075433_10570812 Ga0075433_105708122 128
577 3300006871 Ga0075434_100000306 Ga0075434_10000030631 128
578 3300006871 Ga0075434_100715280 Ga0075434_1007152802 128
579 3300006880 Ga0075429_100333108 Ga0075429_1003331082 128
580 3300006931 Ga0097620_101072672 Ga0097620_1010726722 128
581 3300006931 Ga0097620_101236828 Ga0097620_1012368282 128
582 3300007076 Ga0075435_100049500 Ga0075435_1000495003 128
583 3300007265 Ga0099794_10114266 Ga0099794_101142661 128
584 3300007265 Ga0099794_10355707 Ga0099794_103557072 128
585 3300009101 Ga0105247_10582324 Ga0105247_105823241 128
586 3300009147 Ga0114129_10829948 Ga0114129_108299481 128
587 3300009545 Ga0105237_12087580 Ga0105237_120875802 128
588 3300013306 Ga0163162_12939054 Ga0163162_129390541 128
589 3300014325 Ga0163163_11422140 Ga0163163_114221402 128
590 3300014325 Ga0163163_12741624 Ga0163163_127416241 128
591 3300014326 Ga0157380_10502146 Ga0157380_105021462 128
592 3300014968 Ga0157379_10872353 Ga0157379_108723532 128
593 3300017792 Ga0163161_10003912 Ga0163161_100039128 128
594 3300021361 Ga0213872_10002261 Ga0213872_1000226110 128
595 3300021384 Ga0213876_10108926 Ga0213876_101089263 128
596 3300025271 Ga0207666_1010509 Ga0207666_10105092 128
597 3300025315 Ga0207697_10129333 Ga0207697_101293332 128
598 3300025321 Ga0207656_10120352 Ga0207656_101203523 128
599 3300025893 Ga0207682_10245409 Ga0207682_102454092 128
600 3300025901 Ga0207688_10236596 Ga0207688_102365962 128
601 3300025903 Ga0207680_10182205 Ga0207680_101822052 128
602 3300025907 Ga0207645_10005684 Ga0207645_100056845 128
603 3300025907 Ga0207645_10239960 Ga0207645_102399602 128
604 3300025908 Ga0207643_10421149 Ga0207643_104211492 128
605 3300025909 Ga0207705_10276060 Ga0207705_102760601 128
606 3300025909 Ga0207705_10398586 Ga0207705_103985862 128
607 3300025916 Ga0207663_10173167 Ga0207663_101731673 128
608 3300025917 Ga0207660_10709516 Ga0207660_107095162 128
609 3300025918 Ga0207662_10124229 Ga0207662_101242293 128
610 3300025919 Ga0207657_10435813 Ga0207657_104358132 128
611 3300025919 Ga0207657_10765997 Ga0207657_107659972 128
612 3300025921 Ga0207652_10914042 Ga0207652_109140422 128
613 3300025921 Ga0207652_11174352 Ga0207652_111743522 128
614 3300025923 Ga0207681_10041950 Ga0207681_100419503 128
615 3300025923 Ga0207681_10568204 Ga0207681_105682041 128
616 3300025924 Ga0207694_10038457 Ga0207694_100384574 128
617 3300025926 Ga0207659_10005215 Ga0207659_100052158 128
618 3300025926 Ga0207659_10048380 Ga0207659_100483804 128
619 3300025927 Ga0207687_10059961 Ga0207687_100599612 128
620 3300025931 Ga0207644_10079813 Ga0207644_100798134 128
621 3300025931 Ga0207644_10088455 Ga0207644_100884554 128
622 3300025931 Ga0207644_10289327 Ga0207644_102893273 128
623 3300025932 Ga0207690_10294649 Ga0207690_102946492 128
624 3300025933 Ga0207706_10000933 Ga0207706_1000093325 128
625 3300025933 Ga0207706_10137030 Ga0207706_101370304 128
626 3300025933 Ga0207706_10203567 Ga0207706_102035674 128
627 3300025933 Ga0207706_10976996 Ga0207706_109769961 128
628 3300025936 Ga0207670_10993567 Ga0207670_109935672 128
629 3300025938 Ga0207704_10293317 Ga0207704_102933171 128
630 3300025940 Ga0207691_10008515 Ga0207691_100085158 128
631 3300025940 Ga0207691_10083769 Ga0207691_100837693 128
632 3300025941 Ga0207711_10046230 Ga0207711_100462303 128
633 3300025941 Ga0207711_10118967 Ga0207711_101189674 128
634 3300025942 Ga0207689_10000150 Ga0207689_1000015052 128
635 3300025945 Ga0207679_10083942 Ga0207679_100839423 128
636 3300025945 Ga0207679_10277740 Ga0207679_102777402 128
637 3300025945 Ga0207679_11498423 Ga0207679_114984232 128
638 3300025949 Ga0207667_10223884 Ga0207667_102238842 128
639 3300025949 Ga0207667_10307577 Ga0207667_103075771 128
640 3300025949 Ga0207667_10821888 Ga0207667_108218882 128
641 3300025960 Ga0207651_10036335 Ga0207651_100363352 128
642 3300025960 Ga0207651_10182804 Ga0207651_101828042 128
643 3300025972 Ga0207668_10171906 Ga0207668_101719062 128
644 3300025981 Ga0207640_10061385 Ga0207640_100613854 128
645 3300025981 Ga0207640_10159840 Ga0207640_101598402 128
646 3300025981 Ga0207640_11002290 Ga0207640_110022901 128
647 3300025986 Ga0207658_10275815 Ga0207658_102758152 128
648 3300025986 Ga0207658_11133683 Ga0207658_111336832 128
649 3300026023 Ga0207677_10012436 Ga0207677_100124366 128
650 3300026035 Ga0207703_10030559 Ga0207703_100305596 128
651 3300026035 Ga0207703_10047106 Ga0207703_100471063 128
652 3300026035 Ga0207703_10875308 Ga0207703_108753082 128
653 3300026041 Ga0207639_10053565 Ga0207639_100535652 128
654 3300026041 Ga0207639_11580365 Ga0207639_115803652 128
655 3300026067 Ga0207678_10002944 Ga0207678_100029449 128
656 3300026075 Ga0207708_10680046 Ga0207708_106800462 128
657 3300026078 Ga0207702_10046560 Ga0207702_100465606 128
658 3300026088 Ga0207641_10576045 Ga0207641_105760452 128
659 3300026088 Ga0207641_10919223 Ga0207641_109192232 128
660 3300026088 Ga0207641_11041584 Ga0207641_110415842 128
661 3300026089 Ga0207648_10561469 Ga0207648_105614691 128
662 3300026089 Ga0207648_10765479 Ga0207648_107654791 128
663 3300026095 Ga0207676_10063161 Ga0207676_100631614 128
664 3300026095 Ga0207676_10063624 Ga0207676_100636244 128
665 3300026095 Ga0207676_10184572 Ga0207676_101845722 128
666 3300026116 Ga0207674_10020946 Ga0207674_100209466 128
667 3300026116 Ga0207674_10878405 Ga0207674_108784052 128
668 3300026118 Ga0207675_100001131 Ga0207675_10000113129 128
669 3300026121 Ga0207683_10034729 Ga0207683_100347293 128
670 3300026121 Ga0207683_10064766 Ga0207683_100647664 128
671 3300026142 Ga0207698_10016066 Ga0207698_100160666 128
672 3300026142 Ga0207698_10289791 Ga0207698_102897913 128
673 3300027671 Ga0209588_1052034 Ga0209588_10520341 128
674 3300027866 Ga0209813_10092905 Ga0209813_100929051 128
675 3300027907 Ga0207428_10076303 Ga0207428_100763033 128
676 3300028381 Ga0268264_10080643 Ga0268264_100806434 128
677 3300031238 Ga0265332_10024451 Ga0265332_100244512 128
678 3300031239 Ga0265328_10052951 Ga0265328_100529513 128
679 3300031242 Ga0265329_10013217 Ga0265329_100132173 128
680 3300031250 Ga0265331_10069940 Ga0265331_100699402 128
681 3300031344 Ga0265316_10273699 Ga0265316_102736992 128
682 3300031548 Ga0307408_100168832 Ga0307408_1001688323 128
683 3300031731 Ga0307405_10100216 Ga0307405_101002162 128
684 3300031824 Ga0307413_10281625 Ga0307413_102816252 128
685 3300031852 Ga0307410_10198657 Ga0307410_101986573 128
686 3300031901 Ga0307406_10647142 Ga0307406_106471421 128
687 3300031901 Ga0307406_10872865 Ga0307406_108728652 128
688 3300031901 Ga0307406_11098634 Ga0307406_110986342 128
689 3300031903 Ga0307407_10333253 Ga0307407_103332531 128
690 3300031903 Ga0307407_11169890 Ga0307407_111698902 128
691 3300031911 Ga0307412_10012955 Ga0307412_100129552 128
692 3300031995 Ga0307409_100325083 Ga0307409_1003250832 128
693 3300031995 Ga0307409_100393451 Ga0307409_1003934512 128
694 3300032002 Ga0307416_100002702 Ga0307416_10000270214 128
695 3300032002 Ga0307416_103638900 Ga0307416_1036389001 128
696 3300032005 Ga0307411_10325565 Ga0307411_103255652 128
697 3300032005 Ga0307411_10382218 Ga0307411_103822182 128
698 3300032005 Ga0307411_11783030 Ga0307411_117830301 128
699 3300035207 Ga0373942_0063074 Ga0373942_0063074_587_973 128
700 3300035241 Ga0373961_0024198 Ga0373961_0024198_186_572 128
701 3300037418 Ga0395900_0068359 Ga0395900_0068359_1604_1990 128
702 3300037471 Ga0395905_0612190 Ga0395905_0612190_182_568 128
703 3300038443 Ga0395901_0407129 Ga0395901_0407129_20_415 128
704 3300039062 Ga0400483_078643 Ga0400483_078643_3077_3466 128
705 3300039062 Ga0400483_260254 Ga0400483_260254_4348_4737 128
706 3300039437 Ga0436365_1519697 Ga0436365_1519697_431_817 128
707 3300039447 Ga0436361_0239425 Ga0436361_0239425_3983_4378 128
708 3300041999 Ga0439433_0093801 Ga0439433_0093801_189_575 128
709 3300042008 Ga0439450_093737 Ga0439450_093737_146_532 128
710 3300042012 Ga0439455_0232008 Ga0439455_0232008_43_429 128
711 3300042014 Ga0439457_038319 Ga0439457_038319_499_885 128
712 3300042145 Ga0450906_065311 Ga0450906_065311_30_416 128
713 3300042156 Ga0439446_0044458 Ga0439446_0044458_434_820 128
714 3300042439 Ga0439464_0028302 Ga0439464_0028302_127_513 128
715 3300042461 Ga0439460_0006452 Ga0439460_0006452_94_480 128
716 3300042876 Ga0451577_0796240 Ga0451577_0796240_172_558 128
717 3300044684 Ga0466966_0800219 Ga0466966_0800219_74_460 128
718 3300044694 Ga0466963_0303647 Ga0466963_0303647_54_443 128
719 3300045836 Ga0466958_0328258 Ga0466958_0328258_444_833 128
720 3300046477 Ga0495664_0606109 Ga0495664_0606109_65_451 128
721 3300046513 Ga0495616_0174567 Ga0495616_0174567_553_939 128
722 3300046518 Ga0495631_0094953 Ga0495631_0094953_629_1015 128
723 3300046519 Ga0495632_0011776 Ga0495632_0011776_1081_1467 128
724 3300046531 Ga0495665_0093842 Ga0495665_0093842_108_494 128
725 3300046539 Ga0495621_0153539 Ga0495621_0153539_487_882 128
726 3300046558 Ga0495633_0577675 Ga0495633_0577675_40_426 128
727 3300046660 Ga0495625_0225021 Ga0495625_0225021_162_548 128
728 3300046684 Ga0495669_0081242 Ga0495669_0081242_573_959 128
729 3300046694 Ga0495649_0013683 Ga0495649_0013683_268_654 128
730 3300046810 Ga0495660_0034709 Ga0495660_0034709_433_819 128
731 3300048907 Ga0496104_0559640 Ga0496104_0559640_106_492 128
732 3300048911 Ga0496108_1747674 Ga0496108_1747674_44_433 128
733 3300048912 Ga0496109_0317221 Ga0496109_0317221_74_463 128
734 3300049570 Ga0501033_0259284 Ga0501033_0259284_468_854 128
735 3300049583 Ga0501067_0872232 Ga0501067_0872232_82_468 128
736 3300049590 Ga0501074_0813146 Ga0501074_0813146_183_569 128
737 3300049592 Ga0501076_0130391 Ga0501076_0130391_1047_1433 128
738 3300049742 Ga0501080_1203144 Ga0501080_1203144_59_445 128
739 3300049822 Ga0501035_0995495 Ga0501035_0995495_27_413 128
740 3300050490 nmdc:mga03n38_5373_c1 nmdc:mga03n38_5373_c1_3801_4187 128
741 3300050491 nmdc:mga00v17_292411_c1 nmdc:mga00v17_292411_c1_384_770 128
742 3300050492 nmdc:mga0yw44_254161_c1 nmdc:mga0yw44_254161_c1_734_1120 128
743 3300050493 nmdc:mga0k408_1682_c1 nmdc:mga0k408_1682_c1_9099_9485 128
744 3300050494 nmdc:mga06z11_293909_c1 nmdc:mga06z11_293909_c1_267_653 128
745 3300050495 nmdc:mga04h51_386840_c1 nmdc:mga04h51_386840_c1_130_516 128
746 3300050496 nmdc:mga07m45_157133_c1 nmdc:mga07m45_157133_c1_490_876 128
747 3300050509 nmdc:mga0qj67_388631_c1 nmdc:mga0qj67_388631_c1_634_1020 128
748 3300050512 nmdc:mga0n895_432_c1 nmdc:mga0n895_432_c1_2873_3259 128
749 3300050513 nmdc:mga0rr50_173645_c1 nmdc:mga0rr50_173645_c1_1345_1731 128
750 3300050514 nmdc:mga08x19_45268_c1 nmdc:mga08x19_45268_c1_1577_1963 128
751 3300050515 nmdc:mga0a205_799884_c1 nmdc:mga0a205_799884_c1_171_557 128
752 3300050516 nmdc:mga0sz30_261490_c1 nmdc:mga0sz30_261490_c1_169_555 128
753 3300053160 Ga0500633_0177078 Ga0500633_0177078_132_518 128
754 3300054114 Ga0501084_0493912 Ga0501084_0493912_510_896 128
755 3300059421 Ga0590071_065942 Ga0590071_065942_484_870 128
756 3300003771 Ga0055526_1000063 Ga0055526_100006312 129
757 3300005334 Ga0068869_100628228 Ga0068869_1006282282 129
758 3300005337 Ga0070682_100013740 Ga0070682_1000137403 129
759 3300005339 Ga0070660_100002145 Ga0070660_1000021453 129
760 3300005340 Ga0070689_100954472 Ga0070689_1009544722 129
761 3300005344 Ga0070661_100003784 Ga0070661_1000037842 129
762 3300005347 Ga0070668_101073529 Ga0070668_1010735291 129
763 3300005366 Ga0070659_100014894 Ga0070659_1000148945 129
764 3300005406 Ga0070703_10124524 Ga0070703_101245242 129
765 3300005445 Ga0070708_100156079 Ga0070708_1001560794 129
766 3300005455 Ga0070663_100968974 Ga0070663_1009689742 129
767 3300005456 Ga0070678_100409481 Ga0070678_1004094812 129
768 3300005457 Ga0070662_100024603 Ga0070662_1000246034 129
769 3300005459 Ga0068867_100099511 Ga0068867_1000995114 129
770 3300005539 Ga0068853_100369445 Ga0068853_1003694453 129
771 3300005563 Ga0068855_101614744 Ga0068855_1016147441 129
772 3300005564 Ga0070664_100016501 Ga0070664_1000165015 129
773 3300005577 Ga0068857_100270774 Ga0068857_1002707742 129
774 3300005578 Ga0068854_100034288 Ga0068854_1000342881 129
775 3300005616 Ga0068852_100094552 Ga0068852_1000945522 129
776 3300005842 Ga0068858_100977808 Ga0068858_1009778081 129
777 3300005843 Ga0068860_100503270 Ga0068860_1005032702 129
778 3300006048 Ga0075363_100193098 Ga0075363_1001930982 129
779 3300006051 Ga0075364_10690641 Ga0075364_106906412 129
780 3300006178 Ga0075367_10433559 Ga0075367_104335592 129
781 3300009094 Ga0111539_11826380 Ga0111539_118263802 129
782 3300025250 Ga0209026_1001836 Ga0209026_10018363 129
783 3300025907 Ga0207645_10323101 Ga0207645_103231011 129
784 3300025908 Ga0207643_10706685 Ga0207643_107066851 129
785 3300025911 Ga0207654_11180043 Ga0207654_111800431 129
786 3300025914 Ga0207671_10080363 Ga0207671_100803632 129
787 3300025919 Ga0207657_10001356 Ga0207657_100013568 129
788 3300025920 Ga0207649_10008692 Ga0207649_100086923 129
789 3300025920 Ga0207649_10213913 Ga0207649_102139131 129
790 3300025927 Ga0207687_10135575 Ga0207687_101355752 129
791 3300025932 Ga0207690_10008492 Ga0207690_100084925 129
792 3300025933 Ga0207706_10020371 Ga0207706_100203713 129
793 3300025934 Ga0207686_10910490 Ga0207686_109104901 129
794 3300025935 Ga0207709_10813999 Ga0207709_108139992 129
795 3300025935 Ga0207709_11750571 Ga0207709_117505711 129
796 3300025936 Ga0207670_10797064 Ga0207670_107970642 129
797 3300025940 Ga0207691_11130370 Ga0207691_111303702 129
798 3300025941 Ga0207711_11271343 Ga0207711_112713431 129
799 3300025942 Ga0207689_10729710 Ga0207689_107297102 129
800 3300025945 Ga0207679_10012145 Ga0207679_100121455 129
801 3300025945 Ga0207679_10020511 Ga0207679_100205113 129
802 3300025960 Ga0207651_10550739 Ga0207651_105507392 129
803 3300025972 Ga0207668_11098077 Ga0207668_110980771 129
804 3300026023 Ga0207677_10902991 Ga0207677_109029911 129
805 3300026041 Ga0207639_10140530 Ga0207639_101405302 129
806 3300026116 Ga0207674_10023098 Ga0207674_100230986 129
807 3300027695 Ga0209966_1001722 Ga0209966_10017224 129
808 3300031730 Ga0307516_10784276 Ga0307516_107842762 129
809 3300032002 Ga0307416_100180331 Ga0307416_1001803312 129
810 3300032002 Ga0307416_100460126 Ga0307416_1004601263 129
811 3300035111 Ga0373923_0103358 Ga0373923_0103358_394_783 129
812 3300035112 Ga0373932_0042968 Ga0373932_0042968_767_1159 129
813 3300035170 Ga0373943_0322287 Ga0373943_0322287_435_824 129
814 3300037068 Ga0373925_0766317 Ga0373925_0766317_391_780 129
815 3300038443 Ga0395901_0387167 Ga0395901_0387167_664_1053 129
816 3300042876 Ga0451577_0103577 Ga0451577_0103577_339_728 129
817 3300044656 Ga0466969_0276076 Ga0466969_0276076_269_658 129
818 3300044658 Ga0466972_0003323 Ga0466972_0003323_5330_5719 129
819 3300044658 Ga0466972_0285913 Ga0466972_0285913_185_574 129
820 3300044683 Ga0466965_0000489 Ga0466965_0000489_10921_11310 129
821 3300044683 Ga0466965_0174393 Ga0466965_0174393_145_534 129
822 3300044684 Ga0466966_0659804 Ga0466966_0659804_198_587 129
823 3300044706 Ga0466964_0002101 Ga0466964_0002101_3679_4068 129
824 3300044712 Ga0453684_0064524 Ga0453684_0064524_2517_2906 129
825 3300044735 Ga0466968_0014107 Ga0466968_0014107_2291_2680 129
826 3300044842 Ga0466957_1269221 Ga0466957_1269221_27_482 129
827 3300044901 Ga0466960_0006510 Ga0466960_0006510_2812_3204 129
828 3300045049 Ga0466959_0367182 Ga0466959_0367182_371_760 129
829 3300045049 Ga0466959_0594114 Ga0466959_0594114_101_490 129
830 3300045051 Ga0451576_0442008 Ga0451576_0442008_444_845 129
831 3300046501 Ga0495607_0010963 Ga0495607_0010963_1948_2337 129
832 3300046506 Ga0495583_0044197 Ga0495583_0044197_1667_2056 129
833 3300046507 Ga0495606_0002227 Ga0495606_0002227_9869_10297 129
834 3300046507 Ga0495606_0004441 Ga0495606_0004441_1718_2107 129
835 3300046528 Ga0495642_0098491 Ga0495642_0098491_579_968 129
836 3300046530 Ga0495654_0059332 Ga0495654_0059332_1441_1830 129
837 3300046538 Ga0495609_0134826 Ga0495609_0134826_544_933 129
838 3300046539 Ga0495621_0525679 Ga0495621_0525679_28_417 129
839 3300046543 Ga0495645_0422672 Ga0495645_0422672_68_460 129
840 3300046615 Ga0495656_0170437 Ga0495656_0170437_234_626 129
841 3300046665 Ga0495661_0403427 Ga0495661_0403427_257_652 129
842 3300046674 Ga0495588_0000248 Ga0495588_0000248_9302_9697 129
843 3300047317 Ga0495604_0094873 Ga0495604_0094873_983_1372 129
844 3300047320 Ga0495672_0000014 Ga0495672_0000014_203929_204324 129
845 3300047443 Ga0495687_022632 Ga0495687_022632_2163_2552 129
846 3300047445 Ga0495677_0006688 Ga0495677_0006688_15_410 129
847 3300047469 Ga0495673_0182490 Ga0495673_0182490_17_406 129
848 3300048091 Ga0495626_0129400 Ga0495626_0129400_278_667 129
849 3300048905 Ga0496102_0128757 Ga0496102_0128757_1118_1513 129
850 3300048914 Ga0496111_0951895 Ga0496111_0951895_212_607 129
851 3300048917 Ga0496114_0828258 Ga0496114_0828258_392_781 129
852 3300048918 Ga0496115_0297697 Ga0496115_0297697_159_548 129
853 3300048927 Ga0496124_0282901 Ga0496124_0282901_572_970 129
854 3300049520 Ga0501297_074797 Ga0501297_074797_124_513 129
855 3300049521 Ga0501298_119295 Ga0501298_119295_99_488 129
856 3300049571 Ga0501034_0511114 Ga0501034_0511114_180_569 129
857 3300049589 Ga0501073_1186734 Ga0501073_1186734_99_488 129
858 3300049742 Ga0501080_0798529 Ga0501080_0798529_246_758 129
859 3300049757 Ga0501232_030868 Ga0501232_030868_256_657 129
860 3300053134 Ga0500658_0003329 Ga0500658_0003329_4587_4976 129
861 3300053139 Ga0500568_0047444 Ga0500568_0047444_353_742 129
862 3300061719 Ga0466962_0044798 Ga0466962_0044798_680_1069 129
863 3300003794 Ga0055531_10000992 Ga0055531_100009922 130
864 3300005436 Ga0070713_100193456 Ga0070713_1001934563 130
865 3300006353 Ga0075370_10412510 Ga0075370_104125102 130
866 3300025273 Ga0209673_1046816 Ga0209673_10468162 130
867 3300025932 Ga0207690_10305092 Ga0207690_103050922 130
868 3300025939 Ga0207665_10119669 Ga0207665_101196693 130
869 3300031239 Ga0265328_10082897 Ga0265328_100828972 130
870 3300032002 Ga0307416_100333748 Ga0307416_1003337483 130
871 3300037418 Ga0395900_0037359 Ga0395900_0037359_1480_1872 130
872 3300042876 Ga0451577_0002065 Ga0451577_0002065_7418_7822 130
873 3300044656 Ga0466969_0000349 Ga0466969_0000349_12684_13088 130
874 3300044658 Ga0466972_0010708 Ga0466972_0010708_2767_3159 130
875 3300044683 Ga0466965_0003742 Ga0466965_0003742_3513_3905 130
876 3300044693 Ga0466961_0502743 Ga0466961_0502743_316_708 130
877 3300044735 Ga0466968_0043104 Ga0466968_0043104_369_761 130
878 3300044765 Ga0466970_0095225 Ga0466970_0095225_873_1265 130
879 3300053084 Ga0495595_0334568 Ga0495595_0334568_349_744 130
880 3300061719 Ga0466962_0669419 Ga0466962_0669419_81_473 130
881 3300005459 Ga0068867_100691765 Ga0068867_1006917652 131
882 3300005549 Ga0070704_100476839 Ga0070704_1004768392 131
883 3300013307 Ga0157372_10428020 Ga0157372_104280203 131
884 3300037471 Ga0395905_1110335 Ga0395905_1110335_197_616 131
885 3300041404 Ga0439436_0175784 Ga0439436_0175784_36_431 131
886 3300041405 Ga0439438_085533 Ga0439438_085533_296_691 131
887 3300041408 Ga0439453_0006038 Ga0439453_0006038_1188_1583 131
888 3300041410 Ga0439461_0133137 Ga0439461_0133137_26_421 131
889 3300042003 Ga0439443_124526 Ga0439443_124526_77_472 131
890 3300042156 Ga0439446_0015332 Ga0439446_0015332_59_454 131
891 3300042184 Ga0450908_019422 Ga0450908_019422_456_851 131
892 3300042185 Ga0450909_030549 Ga0450909_030549_275_670 131
893 3300045051 Ga0451576_0004860 Ga0451576_0004860_5677_6072 131
894 3300046537 Ga0495598_0239456 Ga0495598_0239456_10_405 131
895 iso_pu_bacteria 2511231003 2511248102 131
896 iso_pu_bacteria 2643221556 2643800509 131
897 iso_pu_bacteria 2643221684 2644470418 131
898 iso_pu_bacteria 2808606418 2809144018 131
899 iso_pu_bacteria 2834641062 2834645437 131
900 iso_pu_bacteria 2857564685 2857566205 131
901 iso_pu_bacteria 8003400568 8003400645 131
902 iso_pu_bacteria 8047673197 8047678814 131
903 3300032004 Ga0307414_10483247 Ga0307414_104832472 132
904 3300042876 Ga0451577_0028662 Ga0451577_0028662_240_638 132
905 3300005331 Ga0070670_100631372 Ga0070670_1006313721 133
906 3300013104 Ga0157370_10923974 Ga0157370_109239742 133
907 3300014969 Ga0157376_12490579 Ga0157376_124905791 133
908 3300025925 Ga0207650_10749426 Ga0207650_107494261 133
909 3300037418 Ga0395900_0489864 Ga0395900_0489864_176_589 133
910 3300037471 Ga0395905_0304019 Ga0395905_0304019_265_678 133
911 3300044683 Ga0466965_0357395 Ga0466965_0357395_122_523 133
912 3300046522 Ga0495643_0006666 Ga0495643_0006666_4783_5202 133
913 3300046542 Ga0495597_0029514 Ga0495597_0029514_185_604 133
914 3300046616 Ga0495668_0164494 Ga0495668_0164494_54_473 133
915 3300046665 Ga0495661_0002468 Ga0495661_0002468_6254_6673 133
916 3300047443 Ga0495687_014261 Ga0495687_014261_902_1321 133
917 3300047443 Ga0495687_030558 Ga0495687_030558_1817_2227 133
918 3300048905 Ga0496102_0004117 Ga0496102_0004117_8156_8584 133
919 3300048910 Ga0496107_0497102 Ga0496107_0497102_33_461 133
920 3300037471 Ga0395905_0001323 Ga0395905_0001323_23650_24066 134
921 3300002705 JGI25156J39149_1001186 JGI25156J39149_10011866 135
922 3300002738 JGI25154J39366_1001057 JGI25154J39366_10010574 135
923 3300003187 JGI25151J46595_10005067 JGI25151J46595_100050676 135
924 3300003187 JGI25151J46595_10067132 JGI25151J46595_100671322 135
925 3300003322 rootL2_10001292 rootL2_100012923 135
926 3300003574 Ga0007410J51695_1074680 Ga0007410J51695_10746801 135
927 3300003575 Ga0007409J51694_1010148 Ga0007409J51694_10101482 135
928 3300003577 Ga0007416J51690_1030046 Ga0007416J51690_10300463 135
929 3300003771 Ga0055526_1006081 Ga0055526_10060813 135
930 3300003771 Ga0055526_1006214 Ga0055526_10062143 135
931 3300003775 Ga0055524_1027986 Ga0055524_10279862 135
932 3300003781 Ga0055536_1000150 Ga0055536_100015048 135
933 3300003784 Ga0055534_1002354 Ga0055534_10023545 135
934 3300004625 Ga0055543_1058690 Ga0055543_10586901 135
935 3300005262 Ga0065165_1001336 Ga0065165_100133623 135
936 3300005262 Ga0065165_1030399 Ga0065165_10303994 135
937 3300005327 Ga0070658_10649225 Ga0070658_106492252 135
938 3300005327 Ga0070658_10875855 Ga0070658_108758551 135
939 3300005339 Ga0070660_100601408 Ga0070660_1006014081 135
940 3300005366 Ga0070659_100101143 Ga0070659_1001011433 135
941 3300005455 Ga0070663_100940293 Ga0070663_1009402932 135
942 3300005457 Ga0070662_100254611 Ga0070662_1002546111 135
943 3300005530 Ga0070679_100410893 Ga0070679_1004108932 135
944 3300005539 Ga0068853_100860240 Ga0068853_1008602401 135
945 3300005563 Ga0068855_100042921 Ga0068855_1000429213 135
946 3300005563 Ga0068855_100654019 Ga0068855_1006540192 135
947 3300005564 Ga0070664_100478778 Ga0070664_1004787782 135
948 3300005614 Ga0068856_100154981 Ga0068856_1001549812 135
949 3300005834 Ga0068851_10525089 Ga0068851_105250892 135
950 3300006028 Ga0070717_10057081 Ga0070717_100570814 135
951 3300009098 Ga0105245_10520117 Ga0105245_105201172 135
952 3300009148 Ga0105243_10004726 Ga0105243_100047263 135
953 3300009174 Ga0105241_10010400 Ga0105241_100104006 135
954 3300009174 Ga0105241_11737655 Ga0105241_117376551 135
955 3300009176 Ga0105242_10088648 Ga0105242_100886483 135
956 3300009545 Ga0105237_10226287 Ga0105237_102262873 135
957 3300009551 Ga0105238_10065910 Ga0105238_100659105 135
958 3300013100 Ga0157373_10038808 Ga0157373_100388086 135
959 3300013102 Ga0157371_10000064 Ga0157371_10000064121 135
960 3300013105 Ga0157369_10381445 Ga0157369_103814452 135
961 3300013296 Ga0157374_10353469 Ga0157374_103534694 135
962 3300014497 Ga0182008_10061920 Ga0182008_100619202 135
963 3300015262 Ga0182007_10017984 Ga0182007_100179844 135
964 3300025206 Ga0209435_100323 Ga0209435_1003237 135
965 3300025246 Ga0209646_1000283 Ga0209646_10002838 135
966 3300025254 Ga0209148_1001569 Ga0209148_100156911 135
967 3300025256 Ga0209759_1000548 Ga0209759_100054840 135
968 3300025263 Ga0209565_1016465 Ga0209565_10164652 135
969 3300025263 Ga0209565_1017675 Ga0209565_10176752 135
970 3300025284 Ga0209130_1010299 Ga0209130_10102993 135
971 3300025291 Ga0209675_1000449 Ga0209675_100044914 135
972 3300025292 Ga0209676_1000064 Ga0209676_1000064172 135
973 3300025294 Ga0209025_1000690 Ga0209025_100069045 135
974 3300025294 Ga0209025_1000746 Ga0209025_100074649 135
975 3300025295 Ga0209564_1000891 Ga0209564_100089131 135
976 3300025295 Ga0209564_1001109 Ga0209564_100110916 135
977 3300025299 Ga0209256_1000193 Ga0209256_100019353 135
978 3300025303 Ga0209051_1012476 Ga0209051_10124762 135
979 3300025909 Ga0207705_10006851 Ga0207705_100068519 135
980 3300025909 Ga0207705_10561058 Ga0207705_105610581 135
981 3300025911 Ga0207654_10005360 Ga0207654_100053605 135
982 3300025913 Ga0207695_10414780 Ga0207695_104147802 135
983 3300025914 Ga0207671_10137847 Ga0207671_101378472 135
984 3300025917 Ga0207660_11171119 Ga0207660_111711191 135
985 3300025919 Ga0207657_10037997 Ga0207657_100379976 135
986 3300025921 Ga0207652_10696569 Ga0207652_106965692 135
987 3300025924 Ga0207694_10125141 Ga0207694_101251413 135
988 3300025927 Ga0207687_10513131 Ga0207687_105131312 135
989 3300025932 Ga0207690_10032989 Ga0207690_100329894 135
990 3300025932 Ga0207690_11669074 Ga0207690_116690742 135
991 3300025933 Ga0207706_10091464 Ga0207706_100914643 135
992 3300025934 Ga0207686_10023141 Ga0207686_100231412 135
993 3300025940 Ga0207691_10341381 Ga0207691_103413811 135
994 3300025945 Ga0207679_10087149 Ga0207679_100871493 135
995 3300025949 Ga0207667_10016294 Ga0207667_1001629410 135
996 3300026041 Ga0207639_11485460 Ga0207639_114854601 135
997 3300026142 Ga0207698_10129121 Ga0207698_101291212 135
998 3300031251 Ga0265327_10000235 Ga0265327_1000023539 135
999 3300037312 Ga0395899_0007451 Ga0395899_0007451_3681_4094 135
1000 3300037312 Ga0395899_0035375 Ga0395899_0035375_1453_1866 135
1001 3300037312 Ga0395899_0240357 Ga0395899_0240357_806_1219 135
1002 3300037418 Ga0395900_0000846 Ga0395900_0000846_9506_9919 135
1003 3300037418 Ga0395900_0016251 Ga0395900_0016251_2269_2682 135
1004 3300037418 Ga0395900_0032975 Ga0395900_0032975_2487_2900 135
1005 3300037418 Ga0395900_0076227 Ga0395900_0076227_2652_3065 135
1006 3300037418 Ga0395900_0192550 Ga0395900_0192550_591_1004 135
1007 3300037418 Ga0395900_0451656 Ga0395900_0451656_56_469 135
1008 3300037418 Ga0395900_0702634 Ga0395900_0702634_336_749 135
1009 3300037466 Ga0395898_0535860 Ga0395898_0535860_426_839 135
1010 3300037466 Ga0395898_0807538 Ga0395898_0807538_49_462 135
1011 3300037471 Ga0395905_0047866 Ga0395905_0047866_3180_3593 135
1012 3300037471 Ga0395905_0981921 Ga0395905_0981921_286_699 135
1013 3300037471 Ga0395905_1358427 Ga0395905_1358427_95_508 135
1014 3300038443 Ga0395901_0000730 Ga0395901_0000730_4407_4820 135
1015 3300038443 Ga0395901_0203522 Ga0395901_0203522_749_1162 135
1016 3300038443 Ga0395901_0280083 Ga0395901_0280083_182_595 135
1017 3300038443 Ga0395901_0456038 Ga0395901_0456038_291_704 135
1018 3300042005 Ga0439448_0005764 Ga0439448_0005764_950_1363 135
1019 3300042007 Ga0439449_0113655 Ga0439449_0113655_448_861 135
1020 3300042139 Ga0450904_000433 Ga0450904_000433_7346_7759 135
1021 3300042157 Ga0439458_0049411 Ga0439458_0049411_239_652 135
1022 3300044656 Ga0466969_0073557 Ga0466969_0073557_321_734 135
1023 3300044656 Ga0466969_0547412 Ga0466969_0547412_26_439 135
1024 3300044683 Ga0466965_0022215 Ga0466965_0022215_912_1325 135
1025 3300044683 Ga0466965_0056211 Ga0466965_0056211_117_530 135
1026 3300044684 Ga0466966_0009286 Ga0466966_0009286_2007_2420 135
1027 3300044684 Ga0466966_0058816 Ga0466966_0058816_1486_1899 135
1028 3300044684 Ga0466966_0124631 Ga0466966_0124631_515_928 135
1029 3300044693 Ga0466961_0304783 Ga0466961_0304783_182_595 135
1030 3300044693 Ga0466961_0314475 Ga0466961_0314475_450_863 135
1031 3300044694 Ga0466963_0217135 Ga0466963_0217135_425_838 135
1032 3300044694 Ga0466963_0455532 Ga0466963_0455532_52_465 135
1033 3300044706 Ga0466964_0124520 Ga0466964_0124520_39_452 135
1034 3300044719 Ga0466971_0048746 Ga0466971_0048746_861_1274 135
1035 3300044719 Ga0466971_0699625 Ga0466971_0699625_77_490 135
1036 3300044842 Ga0466957_0002989 Ga0466957_0002989_3522_3935 135
1037 3300044842 Ga0466957_0096678 Ga0466957_0096678_718_1131 135
1038 3300045049 Ga0466959_0080761 Ga0466959_0080761_954_1367 135
1039 3300045049 Ga0466959_0321614 Ga0466959_0321614_320_733 135
1040 3300045049 Ga0466959_0488701 Ga0466959_0488701_80_493 135
1041 3300045836 Ga0466958_0007467 Ga0466958_0007467_1413_1826 135
1042 3300045836 Ga0466958_0350471 Ga0466958_0350471_155_568 135
1043 3300045836 Ga0466958_0396849 Ga0466958_0396849_203_616 135
1044 3300045836 Ga0466958_0432877 Ga0466958_0432877_284_697 135
1045 3300045976 Ga0466967_0185836 Ga0466967_0185836_1518_1931 135
1046 3300046452 Ga0495617_000134 Ga0495617_000134_9601_10014 135
1047 3300046452 Ga0495617_000305 Ga0495617_000305_9732_10145 135
1048 3300046453 Ga0495627_000458 Ga0495627_000458_26232_26645 135
1049 3300046453 Ga0495627_007824 Ga0495627_007824_99_512 135
1050 3300046455 Ga0495603_0038945 Ga0495603_0038945_482_895 135
1051 3300046455 Ga0495603_0587554 Ga0495603_0587554_27_440 135
1052 3300046455 Ga0495603_0587564 Ga0495603_0587564_198_611 135
1053 3300046457 Ga0495590_0000186 Ga0495590_0000186_9006_9419 135
1054 3300046457 Ga0495590_0000538 Ga0495590_0000538_10313_10726 135
1055 3300046457 Ga0495590_0006291 Ga0495590_0006291_2678_3091 135
1056 3300046458 Ga0495591_000149 Ga0495591_000149_17822_18235 135
1057 3300046458 Ga0495591_013030 Ga0495591_013030_1942_2355 135
1058 3300046459 Ga0495629_0019066 Ga0495629_0019066_2970_3383 135
1059 3300046459 Ga0495629_0377036 Ga0495629_0377036_198_611 135
1060 3300046459 Ga0495629_0767210 Ga0495629_0767210_198_611 135
1061 3300046460 Ga0495638_0009109 Ga0495638_0009109_4451_4864 135
1062 3300046460 Ga0495638_0137305 Ga0495638_0137305_95_508 135
1063 3300046463 Ga0495653_0047322 Ga0495653_0047322_539_952 135
1064 3300046471 Ga0495650_0000499 Ga0495650_0000499_140_553 135
1065 3300046471 Ga0495650_0000666 Ga0495650_0000666_16026_16436 135
1066 3300046471 Ga0495650_0029067 Ga0495650_0029067_2003_2413 135
1067 3300046472 Ga0495580_0364301 Ga0495580_0364301_270_683 135
1068 3300046472 Ga0495580_0371736 Ga0495580_0371736_108_521 135
1069 3300046473 Ga0495582_0017109 Ga0495582_0017109_181_594 135
1070 3300046473 Ga0495582_0112802 Ga0495582_0112802_49_462 135
1071 3300046474 Ga0495605_0000317 Ga0495605_0000317_42271_42684 135
1072 3300046474 Ga0495605_0000351 Ga0495605_0000351_39526_39939 135
1073 3300046474 Ga0495605_0003626 Ga0495605_0003626_8579_8992 135
1074 3300046474 Ga0495605_0008785 Ga0495605_0008785_209_622 135
1075 3300046474 Ga0495605_0017514 Ga0495605_0017514_1913_2326 135
1076 3300046474 Ga0495605_0033194 Ga0495605_0033194_2194_2607 135
1077 3300046474 Ga0495605_0040894 Ga0495605_0040894_791_1204 135
1078 3300046474 Ga0495605_0054808 Ga0495605_0054808_803_1216 135
1079 3300046474 Ga0495605_0055543 Ga0495605_0055543_578_991 135
1080 3300046474 Ga0495605_0114338 Ga0495605_0114338_562_975 135
1081 3300046475 Ga0495639_0264113 Ga0495639_0264113_106_519 135
1082 3300046476 Ga0495662_0678381 Ga0495662_0678381_42_455 135
1083 3300046477 Ga0495664_0444856 Ga0495664_0444856_157_570 135
1084 3300046491 Ga0495584_0000413 Ga0495584_0000413_4101_4514 135
1085 3300046491 Ga0495584_0000642 Ga0495584_0000642_14467_14880 135
1086 3300046491 Ga0495584_0002667 Ga0495584_0002667_7575_7988 135
1087 3300046491 Ga0495584_0010340 Ga0495584_0010340_1921_2334 135
1088 3300046491 Ga0495584_0012542 Ga0495584_0012542_1943_2356 135
1089 3300046491 Ga0495584_0013009 Ga0495584_0013009_2376_2789 135
1090 3300046491 Ga0495584_0027897 Ga0495584_0027897_2007_2420 135
1091 3300046491 Ga0495584_0029248 Ga0495584_0029248_2134_2547 135
1092 3300046491 Ga0495584_0029393 Ga0495584_0029393_502_915 135
1093 3300046491 Ga0495584_0046724 Ga0495584_0046724_660_1073 135
1094 3300046491 Ga0495584_0076889 Ga0495584_0076889_1202_1615 135
1095 3300046491 Ga0495584_0087146 Ga0495584_0087146_427_840 135
1096 3300046491 Ga0495584_0088426 Ga0495584_0088426_89_502 135
1097 3300046491 Ga0495584_0093697 Ga0495584_0093697_613_1026 135
1098 3300046491 Ga0495584_0119517 Ga0495584_0119517_693_1106 135
1099 3300046491 Ga0495584_0389238 Ga0495584_0389238_237_650 135
1100 3300046492 Ga0495585_0000148 Ga0495585_0000148_9179_9592 135
1101 3300046492 Ga0495585_0000500 Ga0495585_0000500_27376_27789 135
1102 3300046492 Ga0495585_0003434 Ga0495585_0003434_1728_2141 135
1103 3300046492 Ga0495585_0003975 Ga0495585_0003975_538_951 135
1104 3300046492 Ga0495585_0004965 Ga0495585_0004965_3230_3643 135
1105 3300046492 Ga0495585_0010663 Ga0495585_0010663_469_882 135
1106 3300046492 Ga0495585_0015683 Ga0495585_0015683_3767_4180 135
1107 3300046492 Ga0495585_0021337 Ga0495585_0021337_12_425 135
1108 3300046492 Ga0495585_0051903 Ga0495585_0051903_368_781 135
1109 3300046492 Ga0495585_0158739 Ga0495585_0158739_589_1002 135
1110 3300046499 Ga0495594_0005043 Ga0495594_0005043_3646_4059 135
1111 3300046499 Ga0495594_0009434 Ga0495594_0009434_19_432 135
1112 3300046499 Ga0495594_0024113 Ga0495594_0024113_1258_1671 135
1113 3300046499 Ga0495594_0029417 Ga0495594_0029417_1590_2015 135
1114 3300046499 Ga0495594_0103591 Ga0495594_0103591_187_600 135
1115 3300046500 Ga0495596_0001037 Ga0495596_0001037_9573_9986 135
1116 3300046500 Ga0495596_0002079 Ga0495596_0002079_5723_6136 135
1117 3300046500 Ga0495596_0002643 Ga0495596_0002643_328_741 135
1118 3300046500 Ga0495596_0002945 Ga0495596_0002945_311_724 135
1119 3300046500 Ga0495596_0006916 Ga0495596_0006916_46_459 135
1120 3300046500 Ga0495596_0023774 Ga0495596_0023774_1685_2098 135
1121 3300046500 Ga0495596_0035603 Ga0495596_0035603_1023_1436 135
1122 3300046500 Ga0495596_0050451 Ga0495596_0050451_975_1388 135
1123 3300046500 Ga0495596_0288781 Ga0495596_0288781_26_439 135
1124 3300046501 Ga0495607_0000409 Ga0495607_0000409_34817_35230 135
1125 3300046501 Ga0495607_0000558 Ga0495607_0000558_9826_10239 135
1126 3300046501 Ga0495607_0000899 Ga0495607_0000899_8794_9207 135
1127 3300046501 Ga0495607_0002604 Ga0495607_0002604_5847_6260 135
1128 3300046501 Ga0495607_0006007 Ga0495607_0006007_3522_3935 135
1129 3300046501 Ga0495607_0010344 Ga0495607_0010344_3468_3881 135
1130 3300046501 Ga0495607_0010968 Ga0495607_0010968_1935_2348 135
1131 3300046501 Ga0495607_0019907 Ga0495607_0019907_3632_4045 135
1132 3300046501 Ga0495607_0115168 Ga0495607_0115168_202_615 135
1133 3300046501 Ga0495607_0367984 Ga0495607_0367984_100_513 135
1134 3300046501 Ga0495607_0508411 Ga0495607_0508411_104_517 135
1135 3300046506 Ga0495583_0000590 Ga0495583_0000590_7420_7833 135
1136 3300046506 Ga0495583_0000856 Ga0495583_0000856_30787_31200 135
1137 3300046506 Ga0495583_0001490 Ga0495583_0001490_8784_9197 135
1138 3300046506 Ga0495583_0007409 Ga0495583_0007409_371_784 135
1139 3300046506 Ga0495583_0013563 Ga0495583_0013563_173_586 135
1140 3300046506 Ga0495583_0014742 Ga0495583_0014742_2253_2666 135
1141 3300046506 Ga0495583_0022669 Ga0495583_0022669_228_641 135
1142 3300046506 Ga0495583_0079968 Ga0495583_0079968_871_1284 135
1143 3300046507 Ga0495606_0011116 Ga0495606_0011116_513_926 135
1144 3300046507 Ga0495606_0012532 Ga0495606_0012532_2480_2893 135
1145 3300046507 Ga0495606_0042722 Ga0495606_0042722_1159_1572 135
1146 3300046507 Ga0495606_0170705 Ga0495606_0170705_787_1200 135
1147 3300046512 Ga0495610_0000555 Ga0495610_0000555_9049_9462 135
1148 3300046513 Ga0495616_0000052 Ga0495616_0000052_95644_96057 135
1149 3300046513 Ga0495616_0001914 Ga0495616_0001914_4371_4784 135
1150 3300046513 Ga0495616_0003379 Ga0495616_0003379_5324_5737 135
1151 3300046513 Ga0495616_0006221 Ga0495616_0006221_3520_3933 135
1152 3300046513 Ga0495616_0010286 Ga0495616_0010286_2372_2785 135
1153 3300046513 Ga0495616_0011821 Ga0495616_0011821_3211_3624 135
1154 3300046513 Ga0495616_0015289 Ga0495616_0015289_3657_4070 135
1155 3300046513 Ga0495616_0042250 Ga0495616_0042250_1609_2022 135
1156 3300046513 Ga0495616_0074785 Ga0495616_0074785_199_612 135
1157 3300046513 Ga0495616_0075075 Ga0495616_0075075_175_588 135
1158 3300046513 Ga0495616_0261990 Ga0495616_0261990_79_492 135
1159 3300046513 Ga0495616_0377891 Ga0495616_0377891_96_509 135
1160 3300046517 Ga0495630_0046294 Ga0495630_0046294_2612_3025 135
1161 3300046518 Ga0495631_0003928 Ga0495631_0003928_4540_4953 135
1162 3300046518 Ga0495631_0004117 Ga0495631_0004117_111_524 135
1163 3300046518 Ga0495631_0004219 Ga0495631_0004219_2446_2859 135
1164 3300046518 Ga0495631_0007135 Ga0495631_0007135_731_1144 135
1165 3300046518 Ga0495631_0014570 Ga0495631_0014570_42_455 135
1166 3300046518 Ga0495631_0016096 Ga0495631_0016096_2066_2479 135
1167 3300046518 Ga0495631_0021100 Ga0495631_0021100_437_850 135
1168 3300046518 Ga0495631_0049397 Ga0495631_0049397_785_1198 135
1169 3300046518 Ga0495631_0260011 Ga0495631_0260011_208_621 135
1170 3300046519 Ga0495632_0001106 Ga0495632_0001106_3505_3918 135
1171 3300046519 Ga0495632_0005873 Ga0495632_0005873_199_612 135
1172 3300046519 Ga0495632_0007321 Ga0495632_0007321_5745_6158 135
1173 3300046519 Ga0495632_0024796 Ga0495632_0024796_624_1037 135
1174 3300046520 Ga0495637_0000014 Ga0495637_0000014_188090_188503 135
1175 3300046520 Ga0495637_0008808 Ga0495637_0008808_2861_3274 135
1176 3300046520 Ga0495637_0021157 Ga0495637_0021157_1572_1985 135
1177 3300046522 Ga0495643_0000079 Ga0495643_0000079_151492_151905 135
1178 3300046522 Ga0495643_0000569 Ga0495643_0000569_37157_37570 135
1179 3300046522 Ga0495643_0000966 Ga0495643_0000966_3724_4137 135
1180 3300046522 Ga0495643_0009289 Ga0495643_0009289_277_690 135
1181 3300046522 Ga0495643_0010544 Ga0495643_0010544_5259_5672 135
1182 3300046522 Ga0495643_0037601 Ga0495643_0037601_190_603 135
1183 3300046522 Ga0495643_0062438 Ga0495643_0062438_1358_1771 135
1184 3300046522 Ga0495643_0138436 Ga0495643_0138436_428_844 135
1185 3300046522 Ga0495643_0284444 Ga0495643_0284444_217_630 135
1186 3300046522 Ga0495643_0346991 Ga0495643_0346991_176_589 135
1187 3300046523 Ga0495644_0000343 Ga0495644_0000343_11706_12119 135
1188 3300046523 Ga0495644_0003670 Ga0495644_0003670_4165_4578 135
1189 3300046523 Ga0495644_0013674 Ga0495644_0013674_2263_2676 135
1190 3300046523 Ga0495644_0022045 Ga0495644_0022045_80_493 135
1191 3300046523 Ga0495644_0025467 Ga0495644_0025467_1632_2045 135
1192 3300046523 Ga0495644_0056819 Ga0495644_0056819_175_588 135
1193 3300046523 Ga0495644_0114482 Ga0495644_0114482_138_551 135
1194 3300046524 Ga0495648_0000117 Ga0495648_0000117_11177_11590 135
1195 3300046524 Ga0495648_0001357 Ga0495648_0001357_8615_9028 135
1196 3300046524 Ga0495648_0004461 Ga0495648_0004461_8342_8755 135
1197 3300046524 Ga0495648_0006377 Ga0495648_0006377_8945_9358 135
1198 3300046524 Ga0495648_0037677 Ga0495648_0037677_2678_3091 135
1199 3300046525 Ga0495663_0002287 Ga0495663_0002287_1834_2247 135
1200 3300046525 Ga0495663_0004095 Ga0495663_0004095_1926_2342 135
1201 3300046525 Ga0495663_0006624 Ga0495663_0006624_1920_2333 135
1202 3300046526 Ga0495666_0000105 Ga0495666_0000105_5906_6319 135
1203 3300046526 Ga0495666_0028590 Ga0495666_0028590_2306_2719 135
1204 3300046526 Ga0495666_0101215 Ga0495666_0101215_758_1171 135
1205 3300046528 Ga0495642_0000716 Ga0495642_0000716_8402_8815 135
1206 3300046528 Ga0495642_0002469 Ga0495642_0002469_2539_2952 135
1207 3300046528 Ga0495642_0005378 Ga0495642_0005378_4209_4622 135
1208 3300046528 Ga0495642_0093700 Ga0495642_0093700_813_1226 135
1209 3300046528 Ga0495642_0109076 Ga0495642_0109076_455_868 135
1210 3300046528 Ga0495642_0131698 Ga0495642_0131698_290_703 135
1211 3300046529 Ga0495652_0006184 Ga0495652_0006184_2145_2558 135
1212 3300046530 Ga0495654_0005316 Ga0495654_0005316_4444_4857 135
1213 3300046530 Ga0495654_0013571 Ga0495654_0013571_2390_2803 135
1214 3300046530 Ga0495654_0078627 Ga0495654_0078627_362_775 135
1215 3300046531 Ga0495665_0003288 Ga0495665_0003288_1309_1722 135
1216 3300046531 Ga0495665_0004480 Ga0495665_0004480_1143_1556 135
1217 3300046531 Ga0495665_0052457 Ga0495665_0052457_791_1204 135
1218 3300046531 Ga0495665_0172907 Ga0495665_0172907_123_548 135
1219 3300046533 Ga0495640_0009203 Ga0495640_0009203_1405_1818 135
1220 3300046535 Ga0495586_0005523 Ga0495586_0005523_1897_2322 135
1221 3300046535 Ga0495586_0255862 Ga0495586_0255862_227_640 135
1222 3300046536 Ga0495587_0054464 Ga0495587_0054464_181_594 135
1223 3300046536 Ga0495587_0468215 Ga0495587_0468215_53_466 135
1224 3300046538 Ga0495609_0000028 Ga0495609_0000028_151198_151611 135
1225 3300046538 Ga0495609_0001458 Ga0495609_0001458_9232_9645 135
1226 3300046538 Ga0495609_0001649 Ga0495609_0001649_8996_9409 135
1227 3300046538 Ga0495609_0001938 Ga0495609_0001938_7471_7884 135
1228 3300046538 Ga0495609_0002982 Ga0495609_0002982_8475_8888 135
1229 3300046538 Ga0495609_0048464 Ga0495609_0048464_1379_1792 135
1230 3300046538 Ga0495609_0138102 Ga0495609_0138102_71_484 135
1231 3300046538 Ga0495609_0155752 Ga0495609_0155752_315_728 135
1232 3300046542 Ga0495597_0000315 Ga0495597_0000315_8858_9271 135
1233 3300046542 Ga0495597_0000369 Ga0495597_0000369_9068_9481 135
1234 3300046542 Ga0495597_0001487 Ga0495597_0001487_400_813 135
1235 3300046542 Ga0495597_0001633 Ga0495597_0001633_7921_8334 135
1236 3300046542 Ga0495597_0002233 Ga0495597_0002233_8502_8915 135
1237 3300046542 Ga0495597_0002969 Ga0495597_0002969_7516_7929 135
1238 3300046542 Ga0495597_0054524 Ga0495597_0054524_842_1255 135
1239 3300046542 Ga0495597_0131597 Ga0495597_0131597_159_572 135
1240 3300046542 Ga0495597_0157791 Ga0495597_0157791_183_596 135
1241 3300046542 Ga0495597_0205346 Ga0495597_0205346_178_591 135
1242 3300046557 Ga0495622_0194110 Ga0495622_0194110_475_888 135
1243 3300046558 Ga0495633_0001752 Ga0495633_0001752_8881_9294 135
1244 3300046558 Ga0495633_0003558 Ga0495633_0003558_3156_3569 135
1245 3300046558 Ga0495633_0005489 Ga0495633_0005489_2257_2670 135
1246 3300046558 Ga0495633_0011443 Ga0495633_0011443_2125_2538 135
1247 3300046558 Ga0495633_0042182 Ga0495633_0042182_1508_1921 135
1248 3300046558 Ga0495633_0100659 Ga0495633_0100659_22_435 135
1249 3300046558 Ga0495633_0128894 Ga0495633_0128894_54_467 135
1250 3300046559 Ga0495667_0206325 Ga0495667_0206325_256_669 135
1251 3300046615 Ga0495656_0001105 Ga0495656_0001105_5075_5488 135
1252 3300046615 Ga0495656_0004033 Ga0495656_0004033_220_633 135
1253 3300046615 Ga0495656_0011557 Ga0495656_0011557_2361_2774 135
1254 3300046615 Ga0495656_0303892 Ga0495656_0303892_339_752 135
1255 3300046615 Ga0495656_0364352 Ga0495656_0364352_222_635 135
1256 3300046615 Ga0495656_0388561 Ga0495656_0388561_136_549 135
1257 3300046615 Ga0495656_0649248 Ga0495656_0649248_11_427 135
1258 3300046616 Ga0495668_0001207 Ga0495668_0001207_7739_8152 135
1259 3300046616 Ga0495668_0005271 Ga0495668_0005271_8221_8634 135
1260 3300046616 Ga0495668_0018322 Ga0495668_0018322_1376_1789 135
1261 3300046616 Ga0495668_0086604 Ga0495668_0086604_1218_1631 135
1262 3300046642 Ga0495634_0007567 Ga0495634_0007567_5929_6342 135
1263 3300046648 Ga0495611_0003145 Ga0495611_0003145_2535_2948 135
1264 3300046648 Ga0495611_0005991 Ga0495611_0005991_1449_1862 135
1265 3300046648 Ga0495611_0012887 Ga0495611_0012887_1683_2096 135
1266 3300046648 Ga0495611_0024143 Ga0495611_0024143_826_1239 135
1267 3300046648 Ga0495611_0038803 Ga0495611_0038803_1200_1613 135
1268 3300046648 Ga0495611_0352213 Ga0495611_0352213_61_474 135
1269 3300046660 Ga0495625_0008448 Ga0495625_0008448_5296_5709 135
1270 3300046660 Ga0495625_0030164 Ga0495625_0030164_370_783 135
1271 3300046660 Ga0495625_0074545 Ga0495625_0074545_1012_1425 135
1272 3300046660 Ga0495625_0204564 Ga0495625_0204564_819_1232 135
1273 3300046663 Ga0495635_0002078 Ga0495635_0002078_9139_9564 135
1274 3300046663 Ga0495635_0617384 Ga0495635_0617384_274_687 135
1275 3300046665 Ga0495661_0000950 Ga0495661_0000950_4296_4709 135
1276 3300046665 Ga0495661_0001346 Ga0495661_0001346_3709_4122 135
1277 3300046665 Ga0495661_0003746 Ga0495661_0003746_2007_2420 135
1278 3300046665 Ga0495661_0004402 Ga0495661_0004402_8795_9208 135
1279 3300046665 Ga0495661_0006222 Ga0495661_0006222_1908_2321 135
1280 3300046665 Ga0495661_0008157 Ga0495661_0008157_1095_1508 135
1281 3300046665 Ga0495661_0010000 Ga0495661_0010000_3798_4211 135
1282 3300046665 Ga0495661_0012582 Ga0495661_0012582_3988_4401 135
1283 3300046665 Ga0495661_0021461 Ga0495661_0021461_3331_3744 135
1284 3300046665 Ga0495661_0037402 Ga0495661_0037402_2440_2853 135
1285 3300046665 Ga0495661_0058144 Ga0495661_0058144_853_1266 135
1286 3300046665 Ga0495661_0100637 Ga0495661_0100637_674_1087 135
1287 3300046665 Ga0495661_0117116 Ga0495661_0117116_239_652 135
1288 3300046665 Ga0495661_0118233 Ga0495661_0118233_786_1199 135
1289 3300046665 Ga0495661_0149104 Ga0495661_0149104_418_831 135
1290 3300046665 Ga0495661_0178653 Ga0495661_0178653_158_571 135
1291 3300046674 Ga0495588_0003529 Ga0495588_0003529_3048_3461 135
1292 3300046674 Ga0495588_0058560 Ga0495588_0058560_208_621 135
1293 3300046674 Ga0495588_0067437 Ga0495588_0067437_376_801 135
1294 3300046674 Ga0495588_0121539 Ga0495588_0121539_942_1355 135
1295 3300046678 Ga0495599_0208901 Ga0495599_0208901_517_930 135
1296 3300046679 Ga0495623_0002488 Ga0495623_0002488_2701_3114 135
1297 3300046679 Ga0495623_0017205 Ga0495623_0017205_2298_2711 135
1298 3300046679 Ga0495623_0073006 Ga0495623_0073006_902_1315 135
1299 3300046679 Ga0495623_0273312 Ga0495623_0273312_39_452 135
1300 3300046679 Ga0495623_0654775 Ga0495623_0654775_110_523 135
1301 3300046684 Ga0495669_0000228 Ga0495669_0000228_8846_9259 135
1302 3300046684 Ga0495669_0000859 Ga0495669_0000859_8593_9006 135
1303 3300046684 Ga0495669_0001640 Ga0495669_0001640_1585_1998 135
1304 3300046684 Ga0495669_0009038 Ga0495669_0009038_3556_3969 135
1305 3300046684 Ga0495669_0044475 Ga0495669_0044475_107_520 135
1306 3300046689 Ga0495613_0034223 Ga0495613_0034223_511_936 135
1307 3300046689 Ga0495613_0105051 Ga0495613_0105051_247_660 135
1308 3300046691 Ga0495670_0000237 Ga0495670_0000237_16091_16504 135
1309 3300046691 Ga0495670_0002403 Ga0495670_0002403_4388_4801 135
1310 3300046691 Ga0495670_0005782 Ga0495670_0005782_251_664 135
1311 3300046691 Ga0495670_0017160 Ga0495670_0017160_31_444 135
1312 3300046691 Ga0495670_0019739 Ga0495670_0019739_45_458 135
1313 3300046691 Ga0495670_0381426 Ga0495670_0381426_305_718 135
1314 3300046691 Ga0495670_0485398 Ga0495670_0485398_196_609 135
1315 3300046692 Ga0495671_0002737 Ga0495671_0002737_2539_2952 135
1316 3300046692 Ga0495671_0004717 Ga0495671_0004717_871_1284 135
1317 3300046692 Ga0495671_0005286 Ga0495671_0005286_2260_2673 135
1318 3300046692 Ga0495671_0157001 Ga0495671_0157001_224_637 135
1319 3300046692 Ga0495671_0644246 Ga0495671_0644246_35_448 135
1320 3300046694 Ga0495649_0003105 Ga0495649_0003105_7329_7742 135
1321 3300046694 Ga0495649_0005628 Ga0495649_0005628_7492_7905 135
1322 3300046694 Ga0495649_0049656 Ga0495649_0049656_1793_2206 135
1323 3300046694 Ga0495649_0054436 Ga0495649_0054436_1586_1999 135
1324 3300046694 Ga0495649_0103965 Ga0495649_0103965_639_1052 135
1325 3300046694 Ga0495649_0242534 Ga0495649_0242534_351_764 135
1326 3300046694 Ga0495649_0330477 Ga0495649_0330477_304_717 135
1327 3300046694 Ga0495649_0372416 Ga0495649_0372416_39_452 135
1328 3300046794 Ga0495589_0000113 Ga0495589_0000113_67256_67669 135
1329 3300046794 Ga0495589_0000178 Ga0495589_0000178_8724_9137 135
1330 3300046794 Ga0495589_0000225 Ga0495589_0000225_38840_39253 135
1331 3300046794 Ga0495589_0001893 Ga0495589_0001893_2576_2989 135
1332 3300046794 Ga0495589_0014360 Ga0495589_0014360_2155_2568 135
1333 3300046794 Ga0495589_0034468 Ga0495589_0034468_62_475 135
1334 3300046794 Ga0495589_0117337 Ga0495589_0117337_819_1232 135
1335 3300046794 Ga0495589_0138689 Ga0495589_0138689_646_1059 135
1336 3300046794 Ga0495589_0268108 Ga0495589_0268108_92_505 135
1337 3300046794 Ga0495589_0547608 Ga0495589_0547608_20_433 135
1338 3300046794 Ga0495589_0598773 Ga0495589_0598773_39_452 135
1339 3300046809 Ga0495600_0005904 Ga0495600_0005904_2407_2820 135
1340 3300046810 Ga0495660_0000438 Ga0495660_0000438_25561_25974 135
1341 3300046810 Ga0495660_0005112 Ga0495660_0005112_1930_2343 135
1342 3300046810 Ga0495660_0038091 Ga0495660_0038091_570_983 135
1343 3300046810 Ga0495660_0061568 Ga0495660_0061568_48_461 135
1344 3300046810 Ga0495660_0071424 Ga0495660_0071424_175_588 135
1345 3300046810 Ga0495660_0072926 Ga0495660_0072926_123_536 135
1346 3300046810 Ga0495660_0177336 Ga0495660_0177336_194_607 135
1347 3300046810 Ga0495660_0374577 Ga0495660_0374577_13_426 135
1348 3300047317 Ga0495604_0024580 Ga0495604_0024580_3875_4300 135
1349 3300047317 Ga0495604_0028211 Ga0495604_0028211_1154_1567 135
1350 3300047317 Ga0495604_0034503 Ga0495604_0034503_2921_3334 135
1351 3300047317 Ga0495604_0051039 Ga0495604_0051039_165_578 135
1352 3300047318 Ga0495636_0033788 Ga0495636_0033788_1512_1925 135
1353 3300047318 Ga0495636_0161378 Ga0495636_0161378_425_838 135
1354 3300047320 Ga0495672_0000140 Ga0495672_0000140_51769_52182 135
1355 3300047320 Ga0495672_0000471 Ga0495672_0000471_8867_9280 135
1356 3300047320 Ga0495672_0000521 Ga0495672_0000521_123_536 135
1357 3300047320 Ga0495672_0000997 Ga0495672_0000997_8839_9252 135
1358 3300047320 Ga0495672_0033283 Ga0495672_0033283_1170_1583 135
1359 3300047320 Ga0495672_0040958 Ga0495672_0040958_89_502 135
1360 3300047320 Ga0495672_0130712 Ga0495672_0130712_633_1046 135
1361 3300047320 Ga0495672_0140029 Ga0495672_0140029_524_937 135
1362 3300047320 Ga0495672_0186770 Ga0495672_0186770_356_769 135
1363 3300047321 Ga0495676_0000180 Ga0495676_0000180_39671_40084 135
1364 3300047321 Ga0495676_0072447 Ga0495676_0072447_152_565 135
1365 3300047321 Ga0495676_0303869 Ga0495676_0303869_342_755 135
1366 3300047322 Ga0495680_0003335 Ga0495680_0003335_9032_9457 135
1367 3300047322 Ga0495680_0179794 Ga0495680_0179794_939_1352 135
1368 3300047323 Ga0495683_0000242 Ga0495683_0000242_9006_9419 135
1369 3300047323 Ga0495683_0001445 Ga0495683_0001445_15052_15465 135
1370 3300047323 Ga0495683_0025695 Ga0495683_0025695_1703_2116 135
1371 3300047323 Ga0495683_0036376 Ga0495683_0036376_2028_2438 135
1372 3300047323 Ga0495683_0072086 Ga0495683_0072086_1263_1676 135
1373 3300047323 Ga0495683_0219826 Ga0495683_0219826_139_552 135
1374 3300047323 Ga0495683_0259558 Ga0495683_0259558_316_729 135
1375 3300047323 Ga0495683_0261753 Ga0495683_0261753_35_448 135
1376 3300047443 Ga0495687_000054 Ga0495687_000054_185241_185654 135
1377 3300047443 Ga0495687_001284 Ga0495687_001284_9631_10044 135
1378 3300047443 Ga0495687_002185 Ga0495687_002185_7470_7883 135
1379 3300047443 Ga0495687_002656 Ga0495687_002656_4108_4521 135
1380 3300047443 Ga0495687_003943 Ga0495687_003943_1154_1567 135
1381 3300047444 Ga0495675_0003293 Ga0495675_0003293_6267_6680 135
1382 3300047444 Ga0495675_0025019 Ga0495675_0025019_2341_2766 135
1383 3300047444 Ga0495675_0045772 Ga0495675_0045772_1682_2095 135
1384 3300047444 Ga0495675_0439275 Ga0495675_0439275_285_698 135
1385 3300047445 Ga0495677_0000084 Ga0495677_0000084_8795_9208 135
1386 3300047445 Ga0495677_0000723 Ga0495677_0000723_9361_9774 135
1387 3300047445 Ga0495677_0001366 Ga0495677_0001366_3121_3534 135
1388 3300047445 Ga0495677_0005230 Ga0495677_0005230_4060_4473 135
1389 3300047445 Ga0495677_0013840 Ga0495677_0013840_270_683 135
1390 3300047445 Ga0495677_0014184 Ga0495677_0014184_177_590 135
1391 3300047445 Ga0495677_0034073 Ga0495677_0034073_367_780 135
1392 3300047445 Ga0495677_0064659 Ga0495677_0064659_842_1255 135
1393 3300047445 Ga0495677_0080774 Ga0495677_0080774_476_889 135
1394 3300047445 Ga0495677_0089770 Ga0495677_0089770_208_621 135
1395 3300047445 Ga0495677_0266002 Ga0495677_0266002_58_474 135
1396 3300047446 Ga0495679_001674 Ga0495679_001674_4247_4660 135
1397 3300047446 Ga0495679_001847 Ga0495679_001847_7515_7928 135
1398 3300047446 Ga0495679_027729 Ga0495679_027729_193_606 135
1399 3300047446 Ga0495679_185390 Ga0495679_185390_92_505 135
1400 3300047447 Ga0495685_038942 Ga0495685_038942_175_588 135
1401 3300047447 Ga0495685_099939 Ga0495685_099939_185_598 135
1402 3300047447 Ga0495685_106286 Ga0495685_106286_310_723 135
1403 3300047469 Ga0495673_0018181 Ga0495673_0018181_2723_3136 135
1404 3300047469 Ga0495673_0117228 Ga0495673_0117228_202_615 135
1405 3300047470 Ga0495681_0000840 Ga0495681_0000840_8987_9400 135
1406 3300047470 Ga0495681_0002247 Ga0495681_0002247_4546_4959 135
1407 3300047470 Ga0495681_0003545 Ga0495681_0003545_140_553 135
1408 3300047470 Ga0495681_0004805 Ga0495681_0004805_8508_8921 135
1409 3300047470 Ga0495681_0023127 Ga0495681_0023127_1816_2229 135
1410 3300047470 Ga0495681_0024760 Ga0495681_0024760_866_1279 135
1411 3300047470 Ga0495681_0030058 Ga0495681_0030058_2224_2637 135
1412 3300047472 Ga0495686_0000285 Ga0495686_0000285_45009_45422 135
1413 3300047472 Ga0495686_0051766 Ga0495686_0051766_74_487 135
1414 3300047472 Ga0495686_0057530 Ga0495686_0057530_858_1271 135
1415 3300047472 Ga0495686_0083086 Ga0495686_0083086_536_949 135
1416 3300047673 Ga0495593_0023218 Ga0495593_0023218_1414_1839 135
1417 3300047673 Ga0495593_0265975 Ga0495593_0265975_41_454 135
1418 3300048088 Ga0495602_0107551 Ga0495602_0107551_124_537 135
1419 3300048089 Ga0495614_0003105 Ga0495614_0003105_6069_6494 135
1420 3300048089 Ga0495614_0406643 Ga0495614_0406643_155_568 135
1421 3300048090 Ga0495615_0068646 Ga0495615_0068646_61_474 135
1422 3300048091 Ga0495626_0000036 Ga0495626_0000036_206_619 135
1423 3300048091 Ga0495626_0000044 Ga0495626_0000044_8117_8530 135
1424 3300048091 Ga0495626_0000629 Ga0495626_0000629_6357_6770 135
1425 3300048091 Ga0495626_0001081 Ga0495626_0001081_14037_14450 135
1426 3300048091 Ga0495626_0002963 Ga0495626_0002963_3135_3548 135
1427 3300048091 Ga0495626_0006613 Ga0495626_0006613_5897_6310 135
1428 3300048091 Ga0495626_0017553 Ga0495626_0017553_809_1222 135
1429 3300048091 Ga0495626_0028012 Ga0495626_0028012_998_1411 135
1430 3300048091 Ga0495626_0038454 Ga0495626_0038454_1341_1754 135
1431 3300048091 Ga0495626_0042084 Ga0495626_0042084_748_1161 135
1432 3300048091 Ga0495626_0060279 Ga0495626_0060279_365_778 135
1433 3300048091 Ga0495626_0112058 Ga0495626_0112058_441_854 135
1434 3300048091 Ga0495626_0112206 Ga0495626_0112206_24_437 135
1435 3300048091 Ga0495626_0138925 Ga0495626_0138925_140_553 135
1436 3300048091 Ga0495626_0301151 Ga0495626_0301151_144_557 135
1437 3300048903 Ga0496100_0001165 Ga0496100_0001165_10296_10709 135
1438 3300048904 Ga0496101_0064188 Ga0496101_0064188_765_1178 135
1439 3300048905 Ga0496102_0000422 Ga0496102_0000422_8795_9208 135
1440 3300048905 Ga0496102_0074965 Ga0496102_0074965_781_1194 135
1441 3300048905 Ga0496102_0333326 Ga0496102_0333326_163_576 135
1442 3300048905 Ga0496102_0881966 Ga0496102_0881966_232_645 135
1443 3300048905 Ga0496102_1433809 Ga0496102_1433809_180_593 135
1444 3300048907 Ga0496104_0927991 Ga0496104_0927991_288_701 135
1445 3300048908 Ga0496105_0907311 Ga0496105_0907311_204_617 135
1446 3300048909 Ga0496106_0001957 Ga0496106_0001957_6115_6528 135
1447 3300048909 Ga0496106_0973228 Ga0496106_0973228_197_610 135
1448 3300048910 Ga0496107_0246498 Ga0496107_0246498_336_749 135
1449 3300048911 Ga0496108_0620621 Ga0496108_0620621_19_432 135
1450 3300048911 Ga0496108_0912411 Ga0496108_0912411_316_729 135
1451 3300048912 Ga0496109_0006063 Ga0496109_0006063_6413_6826 135
1452 3300048912 Ga0496109_0167622 Ga0496109_0167622_1076_1498 135
1453 3300048913 Ga0496110_0000233 Ga0496110_0000233_26292_26705 135
1454 3300048913 Ga0496110_0104317 Ga0496110_0104317_1923_2345 135
1455 3300048913 Ga0496110_0790936 Ga0496110_0790936_58_471 135
1456 3300048914 Ga0496111_0133604 Ga0496111_0133604_1301_1714 135
1457 3300048914 Ga0496111_0399718 Ga0496111_0399718_77_490 135
1458 3300048915 Ga0496112_0187678 Ga0496112_0187678_1156_1569 135
1459 3300048915 Ga0496112_0816915 Ga0496112_0816915_34_447 135
1460 3300048916 Ga0496113_0008052 Ga0496113_0008052_5851_6264 135
1461 3300048916 Ga0496113_0080967 Ga0496113_0080967_667_1080 135
1462 3300048916 Ga0496113_0387803 Ga0496113_0387803_74_487 135
1463 3300048924 Ga0496121_0255560 Ga0496121_0255560_237_650 135
1464 3300048925 Ga0496122_0001269 Ga0496122_0001269_31899_32312 135
1465 3300048925 Ga0496122_0018535 Ga0496122_0018535_867_1280 135
1466 3300048926 Ga0496123_0000780 Ga0496123_0000780_10795_11208 135
1467 3300048926 Ga0496123_0003906 Ga0496123_0003906_15570_15983 135
1468 3300048927 Ga0496124_0036489 Ga0496124_0036489_2041_2454 135
1469 3300048927 Ga0496124_0235880 Ga0496124_0235880_701_1114 135
1470 3300048928 Ga0496125_0000870 Ga0496125_0000870_8960_9373 135
1471 3300048928 Ga0496125_0360110 Ga0496125_0360110_404_817 135
1472 3300049128 Ga0501308_000453 Ga0501308_000453_2158_2571 135
1473 3300049160 Ga0501304_008560 Ga0501304_008560_363_776 135
1474 3300049459 Ga0495678_000150 Ga0495678_000150_74985_75398 135
1475 3300049459 Ga0495678_000327 Ga0495678_000327_8823_9236 135
1476 3300049459 Ga0495678_000413 Ga0495678_000413_8305_8715 135
1477 3300049459 Ga0495678_008087 Ga0495678_008087_3606_4019 135
1478 3300049460 Ga0495682_0019126 Ga0495682_0019126_64_477 135
1479 3300049581 Ga0501047_0198473 Ga0501047_0198473_900_1313 135
1480 3300049669 Ga0501235_177894 Ga0501235_177894_133_543 135
1481 3300049822 Ga0501035_0006628 Ga0501035_0006628_3818_4231 135
1482 3300049823 Ga0501044_0191265 Ga0501044_0191265_1483_1896 135
1483 3300059477 Ga0587084_128763 Ga0587084_128763_54_467 135
1484 3300059490 Ga0587066_059248 Ga0587066_059248_281_694 135
1485 3300059491 Ga0587070_013077 Ga0587070_013077_54_467 135
1486 3300059492 Ga0587073_0011612 Ga0587073_0011612_966_1379 135
1487 3300059492 Ga0587073_0057516 Ga0587073_0057516_405_818 135
1488 3300059493 Ga0587077_083970 Ga0587077_083970_38_451 135
1489 3300059503 Ga0587080_007413 Ga0587080_007413_344_757 135
1490 3300059503 Ga0587080_086770 Ga0587080_086770_148_561 135
1491 3300059503 Ga0587080_115170 Ga0587080_115170_100_513 135
1492 3300059504 Ga0587082_008167 Ga0587082_008167_566_979 135
1493 3300059505 Ga0587083_0002695 Ga0587083_0002695_795_1208 135
1494 3300059505 Ga0587083_0022683 Ga0587083_0022683_86_499 135
1495 3300059508 Ga0587088_027587 Ga0587088_027587_427_840 135
1496 3300059510 Ga0587090_097530 Ga0587090_097530_47_460 135
1497 3300059511 Ga0587091_010283 Ga0587091_010283_16_429 135
1498 3300059511 Ga0587091_014194 Ga0587091_014194_672_1085 135
1499 3300059604 Ga0587098_011816 Ga0587098_011816_493_906 135
1500 3300059604 Ga0587098_043611 Ga0587098_043611_211_624 135
1501 3300059605 Ga0587106_051010 Ga0587106_051010_191_604 135
1502 3300059622 Ga0587099_009391 Ga0587099_009391_389_802 135
1503 3300059623 Ga0587101_009356 Ga0587101_009356_47_460 135
1504 3300059625 Ga0587113_012529 Ga0587113_012529_15_428 135
1505 3300059639 Ga0587062_030309 Ga0587062_030309_231_644 135
1506 3300059639 Ga0587062_107422 Ga0587062_107422_64_477 135
1507 3300059640 Ga0587067_008287 Ga0587067_008287_1038_1451 135
1508 3300059641 Ga0587068_012974 Ga0587068_012974_86_499 135
1509 3300059642 Ga0587069_006057 Ga0587069_006057_971_1384 135
1510 3300059645 Ga0587076_143311 Ga0587076_143311_75_488 135
1511 3300059647 Ga0587079_010086 Ga0587079_010086_984_1397 135
1512 3300059649 Ga0587102_026987 Ga0587102_026987_215_628 135
1513 3300060346 Ga0587111_0031246 Ga0587111_0031246_624_1037 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

145

0.88

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

134

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

27

146

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.9829 1 126
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.9603 1 126
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.9463 1 126
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.9352 1 127
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.933 2 128
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9849 1 59 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9595 4 126 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9352 1 127 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9303 1 127 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9276 1 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A354IS86-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 1.001 1 62 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A379VT79-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9874 1 62 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A653VI79-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9852 1 62 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A354IS86-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.985 1 62 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-K7AKL3-F1-model_v4 VOC domain-containing protein 0.9841 3 77 GO:0004462
GO:0005737
GO:0019243
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map