F494484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1513 | 557 | 1504 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_1269221|Ga0466957_1269221_27_482 |
| Length | 151 |
| Sequence | VSGFACGLTPTYGIRDLAIIARMRILHTMLRVGDLQRSIDFYTKVLGMKLLRTTDRPEQKYSLAFVGYGTNPEHAELELTYNYGVERYEMGTAYGHIAIGVEDAYAACDRIRAAGGNITREPGPVKGGTTVIAFVTDPDGYKIELIQRDAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 3 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 4 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 5 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 6 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 7 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 126 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 147 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 300 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 308 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 309 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 310 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 311 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 312 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 315 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 318 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 319 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 320 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 321 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 322 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 323 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 324 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 325 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 326 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 327 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 328 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 329 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 330 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 331 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 332 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 333 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 334 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 335 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 336 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 337 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 338 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 339 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 340 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 341 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 342 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 343 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 344 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 345 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 346 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 347 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 348 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 349 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 350 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 353 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 354 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 453 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 454 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 455 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 456 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 457 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 460 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 461 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 462 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 463 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 464 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 465 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 466 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 467 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 468 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 469 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 470 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 475 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 476 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 491 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 492 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 495 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 498 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 499 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 500 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 501 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 502 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 503 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 504 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 513 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 518 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 519 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 522 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 524 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 525 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 556 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 557 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.37 |
| Metatranscriptomes | 4.03 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.01 |
| Nodule | 0 |
| Rhizoplane | 4.3 |
| Rhizosphere | 87.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001186 | 3300002705 | Bacteria | 11587 |
| 2 | JGI25154J39366_1001057 | 3300002738 | Bacteria | 10924 |
| 3 | JGI25151J46595_10005067 | 3300003187 | Bacteria | 6853 |
| 4 | JGI25151J46595_10067132 | 3300003187 | Bacteria | 1107 |
| 5 | JGI25406J46586_10104663 | 3300003203 | Bacteria | 841 |
| 6 | rootL2_10001292 | 3300003322 | Bacteria | 4012 |
| 7 | rootL2_10016479 | 3300003322 | Bacteria | 4719 |
| 8 | Ga0007410J51695_1074680 | 3300003574 | Bacteria | 676 |
| 9 | Ga0007409J51694_1010148 | 3300003575 | Bacteria | 1329 |
| 10 | Ga0007416J51690_1030046 | 3300003577 | Bacteria | 1798 |
| 11 | Ga0055526_1000063 | 3300003771 | Bacteria | 103612 |
| 12 | Ga0055526_1006081 | 3300003771 | Bacteria | 6668 |
| 13 | Ga0055526_1006214 | 3300003771 | Bacteria | 6557 |
| 14 | Ga0055524_1027986 | 3300003775 | Bacteria | 1698 |
| 15 | Ga0055536_1000150 | 3300003781 | Bacteria | 59586 |
| 16 | Ga0055534_1002354 | 3300003784 | Bacteria | 6597 |
| 17 | Ga0055540_1006946 | 3300003792 | Bacteria | 4377 |
| 18 | Ga0055531_10000992 | 3300003794 | Bacteria | 22548 |
| 19 | Ga0055543_1058690 | 3300004625 | Bacteria | 620 |
| 20 | Ga0058862_12693219 | 3300004803 | Bacteria | 504 |
| 21 | Ga0065165_1001336 | 3300005262 | Bacteria | 27356 |
| 22 | Ga0065165_1030399 | 3300005262 | Bacteria | 1719 |
| 23 | Ga0065715_10761580 | 3300005293 | Bacteria | 625 |
| 24 | Ga0065715_11035556 | 3300005293 | Bacteria | 536 |
| 25 | Ga0070658_10083823 | 3300005327 | Bacteria | 2621 |
| 26 | Ga0070658_10102909 | 3300005327 | Bacteria | 2362 |
| 27 | Ga0070658_10202820 | 3300005327 | Bacteria | 1674 |
| 28 | Ga0070658_10590896 | 3300005327 | Bacteria | 962 |
| 29 | Ga0070658_10649225 | 3300005327 | Bacteria | 915 |
| 30 | Ga0070658_10875855 | 3300005327 | Bacteria | 781 |
| 31 | Ga0070658_11690645 | 3300005327 | Bacteria | 548 |
| 32 | Ga0070676_10009290 | 3300005328 | Bacteria | 5317 |
| 33 | Ga0070676_10095408 | 3300005328 | Bacteria | 1829 |
| 34 | Ga0070676_10605056 | 3300005328 | Bacteria | 791 |
| 35 | Ga0070683_100005352 | 3300005329 | Bacteria | 10701 |
| 36 | Ga0070683_100713129 | 3300005329 | Bacteria | 961 |
| 37 | Ga0070670_100003584 | 3300005331 | Bacteria | 12922 |
| 38 | Ga0070670_100009851 | 3300005331 | Bacteria | 8160 |
| 39 | Ga0070670_100631372 | 3300005331 | Bacteria | 960 |
| 40 | Ga0070677_10164781 | 3300005333 | Bacteria | 1043 |
| 41 | Ga0068869_100069759 | 3300005334 | Bacteria | 2599 |
| 42 | Ga0068869_100628228 | 3300005334 | Bacteria | 910 |
| 43 | Ga0068869_101294863 | 3300005334 | Bacteria | 643 |
| 44 | Ga0070666_10113018 | 3300005335 | Bacteria | 1879 |
| 45 | Ga0070680_100157683 | 3300005336 | Bacteria | 1907 |
| 46 | Ga0070682_100013740 | 3300005337 | Bacteria | 4667 |
| 47 | Ga0068868_100001157 | 3300005338 | Bacteria | 18078 |
| 48 | Ga0068868_100761222 | 3300005338 | Bacteria | 871 |
| 49 | Ga0070660_100002145 | 3300005339 | Bacteria | 13621 |
| 50 | Ga0070660_100073236 | 3300005339 | Bacteria | 2678 |
| 51 | Ga0070660_100182808 | 3300005339 | Bacteria | 1697 |
| 52 | Ga0070660_100601408 | 3300005339 | Bacteria | 919 |
| 53 | Ga0070689_100954472 | 3300005340 | Bacteria | 761 |
| 54 | Ga0070691_10164712 | 3300005341 | Bacteria | 1145 |
| 55 | Ga0070661_100003784 | 3300005344 | Bacteria | 10428 |
| 56 | Ga0070661_100033962 | 3300005344 | Bacteria | 3698 |
| 57 | Ga0070661_100037349 | 3300005344 | Bacteria | 3533 |
| 58 | Ga0070661_101388409 | 3300005344 | Bacteria | 591 |
| 59 | Ga0070668_100069229 | 3300005347 | Bacteria | 2745 |
| 60 | Ga0070668_101073529 | 3300005347 | Bacteria | 726 |
| 61 | Ga0070669_100118703 | 3300005353 | Bacteria | 2015 |
| 62 | Ga0070669_101456430 | 3300005353 | Bacteria | 595 |
| 63 | Ga0070675_100001801 | 3300005354 | Bacteria | 15832 |
| 64 | Ga0070675_100022306 | 3300005354 | Bacteria | 5058 |
| 65 | Ga0070671_100010623 | 3300005355 | Bacteria | 7389 |
| 66 | Ga0070671_100020902 | 3300005355 | Bacteria | 5340 |
| 67 | Ga0070671_100208905 | 3300005355 | Bacteria | 1656 |
| 68 | Ga0070671_100299367 | 3300005355 | Bacteria | 1369 |
| 69 | Ga0070673_100865695 | 3300005364 | Bacteria | 837 |
| 70 | Ga0070659_100014894 | 3300005366 | Bacteria | 5816 |
| 71 | Ga0070659_100101143 | 3300005366 | Bacteria | 2320 |
| 72 | Ga0070659_100125477 | 3300005366 | Bacteria | 2082 |
| 73 | Ga0070667_100088937 | 3300005367 | Bacteria | 2652 |
| 74 | Ga0070703_10124524 | 3300005406 | Bacteria | 939 |
| 75 | Ga0070714_100370316 | 3300005435 | Bacteria | 1349 |
| 76 | Ga0070714_102296400 | 3300005435 | Bacteria | 525 |
| 77 | Ga0070713_100042585 | 3300005436 | Bacteria | 3707 |
| 78 | Ga0070713_100193456 | 3300005436 | Bacteria | 1834 |
| 79 | Ga0070713_100354967 | 3300005436 | Bacteria | 1361 |
| 80 | Ga0070713_102466974 | 3300005436 | Bacteria | 502 |
| 81 | Ga0070701_10242541 | 3300005438 | Bacteria | 1085 |
| 82 | Ga0070711_100634673 | 3300005439 | Bacteria | 894 |
| 83 | Ga0070705_100016436 | 3300005440 | Bacteria | 3845 |
| 84 | Ga0070705_100367620 | 3300005440 | Bacteria | 1054 |
| 85 | Ga0070700_100529171 | 3300005441 | Bacteria | 912 |
| 86 | Ga0070694_100384794 | 3300005444 | Bacteria | 1095 |
| 87 | Ga0070694_100562711 | 3300005444 | Bacteria | 914 |
| 88 | Ga0070708_100156079 | 3300005445 | Bacteria | 2125 |
| 89 | Ga0070708_100249276 | 3300005445 | Bacteria | 1668 |
| 90 | Ga0070663_100040127 | 3300005455 | Bacteria | 3275 |
| 91 | Ga0070663_100572541 | 3300005455 | Bacteria | 947 |
| 92 | Ga0070663_100940293 | 3300005455 | Bacteria | 749 |
| 93 | Ga0070663_100968974 | 3300005455 | Bacteria | 738 |
| 94 | Ga0070678_100005974 | 3300005456 | Bacteria | 7092 |
| 95 | Ga0070678_100046649 | 3300005456 | Bacteria | 3109 |
| 96 | Ga0070678_100278890 | 3300005456 | Bacteria | 1413 |
| 97 | Ga0070678_100279362 | 3300005456 | Bacteria | 1411 |
| 98 | Ga0070678_100409481 | 3300005456 | Bacteria | 1180 |
| 99 | Ga0070662_100000867 | 3300005457 | Bacteria | 18517 |
| 100 | Ga0070662_100024603 | 3300005457 | Bacteria | 4150 |
| 101 | Ga0070662_100110025 | 3300005457 | Bacteria | 2097 |
| 102 | Ga0070662_100254611 | 3300005457 | Bacteria | 1413 |
| 103 | Ga0070681_10493180 | 3300005458 | Bacteria | 1138 |
| 104 | Ga0068867_100099511 | 3300005459 | Bacteria | 2218 |
| 105 | Ga0068867_100691765 | 3300005459 | Bacteria | 899 |
| 106 | Ga0070707_100536809 | 3300005468 | Bacteria | 1132 |
| 107 | Ga0070707_101522555 | 3300005468 | Bacteria | 636 |
| 108 | Ga0070679_100059905 | 3300005530 | Bacteria | 3794 |
| 109 | Ga0070679_100410893 | 3300005530 | Bacteria | 1299 |
| 110 | Ga0070684_100027307 | 3300005535 | Bacteria | 4815 |
| 111 | Ga0070684_100409742 | 3300005535 | Bacteria | 1250 |
| 112 | Ga0070684_101134418 | 3300005535 | Bacteria | 735 |
| 113 | Ga0068853_100002880 | 3300005539 | Bacteria | 13055 |
| 114 | Ga0068853_100369445 | 3300005539 | Bacteria | 1338 |
| 115 | Ga0068853_100860240 | 3300005539 | Bacteria | 870 |
| 116 | Ga0070672_100000535 | 3300005543 | Bacteria | 22337 |
| 117 | Ga0070686_100969540 | 3300005544 | Bacteria | 696 |
| 118 | Ga0070695_100000692 | 3300005545 | Bacteria | 18036 |
| 119 | Ga0070695_100150230 | 3300005545 | Bacteria | 1625 |
| 120 | Ga0070696_100008854 | 3300005546 | Bacteria | 6731 |
| 121 | Ga0070696_100311941 | 3300005546 | Bacteria | 1208 |
| 122 | Ga0070696_100475830 | 3300005546 | Bacteria | 990 |
| 123 | Ga0070693_100029302 | 3300005547 | Bacteria | 3001 |
| 124 | Ga0070693_101101446 | 3300005547 | Bacteria | 605 |
| 125 | Ga0070665_100694432 | 3300005548 | Bacteria | 1031 |
| 126 | Ga0070704_100476839 | 3300005549 | Bacteria | 1079 |
| 127 | Ga0070704_101842160 | 3300005549 | Bacteria | 560 |
| 128 | Ga0068855_100005319 | 3300005563 | Bacteria | 15724 |
| 129 | Ga0068855_100042921 | 3300005563 | Bacteria | 5358 |
| 130 | Ga0068855_100051204 | 3300005563 | Bacteria | 4864 |
| 131 | Ga0068855_100155710 | 3300005563 | Bacteria | 2596 |
| 132 | Ga0068855_100654019 | 3300005563 | Bacteria | 1128 |
| 133 | Ga0068855_101218898 | 3300005563 | Bacteria | 782 |
| 134 | Ga0068855_101614744 | 3300005563 | Bacteria | 663 |
| 135 | Ga0070664_100016501 | 3300005564 | Bacteria | 6054 |
| 136 | Ga0070664_100055141 | 3300005564 | Bacteria | 3373 |
| 137 | Ga0070664_100478778 | 3300005564 | Bacteria | 1145 |
| 138 | Ga0068857_100270774 | 3300005577 | Bacteria | 1561 |
| 139 | Ga0068857_101165040 | 3300005577 | Bacteria | 746 |
| 140 | Ga0068854_100027581 | 3300005578 | Bacteria | 3915 |
| 141 | Ga0068854_100032147 | 3300005578 | Bacteria | 3650 |
| 142 | Ga0068854_100034288 | 3300005578 | Bacteria | 3545 |
| 143 | Ga0068856_100004035 | 3300005614 | Bacteria | 14702 |
| 144 | Ga0068856_100154981 | 3300005614 | Bacteria | 2301 |
| 145 | Ga0068856_100539159 | 3300005614 | Bacteria | 1188 |
| 146 | Ga0068856_100625174 | 3300005614 | Bacteria | 1098 |
| 147 | Ga0070702_100014791 | 3300005615 | Bacteria | 3968 |
| 148 | Ga0068852_100018568 | 3300005616 | Bacteria | 5481 |
| 149 | Ga0068852_100054887 | 3300005616 | Bacteria | 3436 |
| 150 | Ga0068852_100072682 | 3300005616 | Bacteria | 3023 |
| 151 | Ga0068852_100094552 | 3300005616 | Bacteria | 2681 |
| 152 | Ga0068852_100447083 | 3300005616 | Bacteria | 1279 |
| 153 | Ga0068852_101228262 | 3300005616 | Bacteria | 771 |
| 154 | Ga0068852_101390769 | 3300005616 | Bacteria | 724 |
| 155 | Ga0068859_101072680 | 3300005617 | Bacteria | 886 |
| 156 | Ga0068859_101236815 | 3300005617 | Bacteria | 822 |
| 157 | Ga0068864_100011769 | 3300005618 | Bacteria | 7227 |
| 158 | Ga0068864_100024340 | 3300005618 | Bacteria | 5093 |
| 159 | Ga0068864_100194010 | 3300005618 | Bacteria | 1863 |
| 160 | Ga0068861_100003855 | 3300005719 | Bacteria | 10017 |
| 161 | Ga0068861_102265949 | 3300005719 | Bacteria | 545 |
| 162 | Ga0068851_10009705 | 3300005834 | Bacteria | 4482 |
| 163 | Ga0068851_10020198 | 3300005834 | Bacteria | 3222 |
| 164 | Ga0068851_10042872 | 3300005834 | Bacteria | 2279 |
| 165 | Ga0068851_10044956 | 3300005834 | Bacteria | 2231 |
| 166 | Ga0068851_10525089 | 3300005834 | Bacteria | 712 |
| 167 | Ga0068863_100183411 | 3300005841 | Bacteria | 2009 |
| 168 | Ga0068858_100160326 | 3300005842 | Bacteria | 2118 |
| 169 | Ga0068858_100257075 | 3300005842 | Bacteria | 1659 |
| 170 | Ga0068858_100977808 | 3300005842 | Bacteria | 829 |
| 171 | Ga0068858_102136059 | 3300005842 | Bacteria | 554 |
| 172 | Ga0068860_100247347 | 3300005843 | Bacteria | 1736 |
| 173 | Ga0068860_100503270 | 3300005843 | Bacteria | 1210 |
| 174 | Ga0068860_100616457 | 3300005843 | Bacteria | 1091 |
| 175 | Ga0068860_101683473 | 3300005843 | Bacteria | 656 |
| 176 | Ga0068862_100887250 | 3300005844 | Bacteria | 876 |
| 177 | Ga0081539_10000226 | 3300005985 | Bacteria | 132618 |
| 178 | Ga0070717_10057081 | 3300006028 | Bacteria | 3227 |
| 179 | Ga0070717_10123117 | 3300006028 | Bacteria | 2224 |
| 180 | Ga0070717_10301328 | 3300006028 | Bacteria | 1425 |
| 181 | Ga0075365_10085227 | 3300006038 | Bacteria | 2146 |
| 182 | Ga0075365_10238977 | 3300006038 | Bacteria | 1276 |
| 183 | Ga0075365_10430610 | 3300006038 | Bacteria | 931 |
| 184 | Ga0075368_10306824 | 3300006042 | Bacteria | 686 |
| 185 | Ga0075368_10561871 | 3300006042 | Bacteria | 514 |
| 186 | Ga0075363_100011747 | 3300006048 | Bacteria | 4203 |
| 187 | Ga0075363_100193098 | 3300006048 | Bacteria | 1161 |
| 188 | Ga0075364_10051591 | 3300006051 | Bacteria | 2687 |
| 189 | Ga0075364_10690641 | 3300006051 | Bacteria | 697 |
| 190 | Ga0070716_100259837 | 3300006173 | Bacteria | 1188 |
| 191 | Ga0070712_100247407 | 3300006175 | Bacteria | 1423 |
| 192 | Ga0075362_10008211 | 3300006177 | Bacteria | 3985 |
| 193 | Ga0075362_10289212 | 3300006177 | Bacteria | 812 |
| 194 | Ga0075367_10023342 | 3300006178 | Bacteria | 3479 |
| 195 | Ga0075367_10433559 | 3300006178 | Bacteria | 832 |
| 196 | Ga0075367_10731337 | 3300006178 | Bacteria | 630 |
| 197 | Ga0075369_10169756 | 3300006186 | Bacteria | 1001 |
| 198 | Ga0075366_10000574 | 3300006195 | Bacteria | 17235 |
| 199 | Ga0075366_10009384 | 3300006195 | Bacteria | 5460 |
| 200 | Ga0075366_10024978 | 3300006195 | Bacteria | 3487 |
| 201 | Ga0075366_10096764 | 3300006195 | Bacteria | 1770 |
| 202 | Ga0075366_10364572 | 3300006195 | Bacteria | 887 |
| 203 | Ga0075366_10481328 | 3300006195 | Bacteria | 767 |
| 204 | Ga0075366_10692919 | 3300006195 | Bacteria | 632 |
| 205 | Ga0097621_100037998 | 3300006237 | Bacteria | 3862 |
| 206 | Ga0097621_100786463 | 3300006237 | Bacteria | 881 |
| 207 | Ga0075370_10000101 | 3300006353 | Bacteria | 27175 |
| 208 | Ga0075370_10003489 | 3300006353 | Bacteria | 7492 |
| 209 | Ga0075370_10013018 | 3300006353 | Bacteria | 4413 |
| 210 | Ga0075370_10412510 | 3300006353 | Bacteria | 811 |
| 211 | Ga0068871_100012983 | 3300006358 | Bacteria | 6169 |
| 212 | Ga0068871_100168797 | 3300006358 | Bacteria | 1874 |
| 213 | Ga0068871_101127584 | 3300006358 | Bacteria | 734 |
| 214 | Ga0075428_100011487 | 3300006844 | Bacteria | 9851 |
| 215 | Ga0075433_10028132 | 3300006852 | Bacteria | 4777 |
| 216 | Ga0075433_10570812 | 3300006852 | Bacteria | 994 |
| 217 | Ga0075433_10713891 | 3300006852 | Bacteria | 878 |
| 218 | Ga0075434_100000306 | 3300006871 | Bacteria | 34874 |
| 219 | Ga0075434_100211503 | 3300006871 | Bacteria | 1959 |
| 220 | Ga0075434_100403542 | 3300006871 | Bacteria | 1388 |
| 221 | Ga0075434_100715280 | 3300006871 | Bacteria | 1019 |
| 222 | Ga0075429_100333108 | 3300006880 | Bacteria | 1328 |
| 223 | Ga0068865_100503981 | 3300006881 | Bacteria | 1010 |
| 224 | Ga0075436_100000087 | 3300006914 | Bacteria | 53435 |
| 225 | Ga0075436_100044693 | 3300006914 | Bacteria | 3055 |
| 226 | Ga0075436_100796252 | 3300006914 | Bacteria | 704 |
| 227 | Ga0097620_101072672 | 3300006931 | Bacteria | 886 |
| 228 | Ga0097620_101236828 | 3300006931 | Bacteria | 822 |
| 229 | Ga0075435_100049500 | 3300007076 | Bacteria | 3380 |
| 230 | Ga0075435_100476717 | 3300007076 | Bacteria | 1077 |
| 231 | Ga0075435_101437372 | 3300007076 | Bacteria | 604 |
| 232 | Ga0099794_10050309 | 3300007265 | Bacteria | 2004 |
| 233 | Ga0099794_10114266 | 3300007265 | Bacteria | 1355 |
| 234 | Ga0099794_10355707 | 3300007265 | Bacteria | 762 |
| 235 | Ga0099794_10795900 | 3300007265 | Bacteria | 506 |
| 236 | Ga0105240_10032391 | 3300009093 | Bacteria | 6768 |
| 237 | Ga0105240_10215520 | 3300009093 | Bacteria | 2240 |
| 238 | Ga0105240_10775247 | 3300009093 | Bacteria | 1041 |
| 239 | Ga0111539_10542659 | 3300009094 | Bacteria | 1354 |
| 240 | Ga0111539_11826380 | 3300009094 | Bacteria | 705 |
| 241 | Ga0105245_10045639 | 3300009098 | Bacteria | 3914 |
| 242 | Ga0105245_10520117 | 3300009098 | Bacteria | 1208 |
| 243 | Ga0105245_10578523 | 3300009098 | Bacteria | 1147 |
| 244 | Ga0105247_10582324 | 3300009101 | Bacteria | 827 |
| 245 | Ga0105247_11383283 | 3300009101 | Bacteria | 569 |
| 246 | Ga0114129_10829948 | 3300009147 | Bacteria | 1177 |
| 247 | Ga0105243_10004726 | 3300009148 | Bacteria | 10716 |
| 248 | Ga0105243_10102716 | 3300009148 | Bacteria | 2376 |
| 249 | Ga0105243_12196051 | 3300009148 | Bacteria | 589 |
| 250 | Ga0105241_10010400 | 3300009174 | Bacteria | 6827 |
| 251 | Ga0105241_10398868 | 3300009174 | Bacteria | 1206 |
| 252 | Ga0105241_11711613 | 3300009174 | Unclassified | 611 |
| 253 | Ga0105241_11737655 | 3300009174 | Bacteria | 607 |
| 254 | Ga0105242_10088648 | 3300009176 | Bacteria | 2599 |
| 255 | Ga0105242_10577028 | 3300009176 | Bacteria | 1082 |
| 256 | Ga0105248_10016659 | 3300009177 | Bacteria | 8090 |
| 257 | Ga0105248_10032211 | 3300009177 | Bacteria | 5860 |
| 258 | Ga0105248_10205361 | 3300009177 | Bacteria | 2220 |
| 259 | Ga0105248_11062085 | 3300009177 | Bacteria | 915 |
| 260 | Ga0105237_10018505 | 3300009545 | Bacteria | 7209 |
| 261 | Ga0105237_10226287 | 3300009545 | Bacteria | 1871 |
| 262 | Ga0105237_10514705 | 3300009545 | Bacteria | 1203 |
| 263 | Ga0105237_10948551 | 3300009545 | Bacteria | 867 |
| 264 | Ga0105237_12087580 | 3300009545 | Bacteria | 576 |
| 265 | Ga0105237_12645292 | 3300009545 | Bacteria | 513 |
| 266 | Ga0105238_10045282 | 3300009551 | Bacteria | 4445 |
| 267 | Ga0105238_10065910 | 3300009551 | Bacteria | 3623 |
| 268 | Ga0105238_10358793 | 3300009551 | Unclassified | 1447 |
| 269 | Ga0105238_11617213 | 3300009551 | Bacteria | 678 |
| 270 | Ga0105238_12606685 | 3300009551 | Bacteria | 542 |
| 271 | Ga0105249_10957232 | 3300009553 | Bacteria | 924 |
| 272 | Ga0105249_11130627 | 3300009553 | Bacteria | 854 |
| 273 | Ga0105249_11285878 | 3300009553 | Bacteria | 803 |
| 274 | Ga0105239_10050731 | 3300010375 | Bacteria | 4549 |
| 275 | Ga0105239_10057462 | 3300010375 | Bacteria | 4268 |
| 276 | Ga0105246_10225508 | 3300011119 | Bacteria | 1472 |
| 277 | Ga0157328_1016793 | 3300012478 | Bacteria | 579 |
| 278 | Ga0157318_1009564 | 3300012482 | Bacteria | 702 |
| 279 | Ga0157373_10038808 | 3300013100 | Bacteria | 3411 |
| 280 | Ga0157373_10056085 | 3300013100 | Bacteria | 2798 |
| 281 | Ga0157371_10000064 | 3300013102 | Bacteria | 169056 |
| 282 | Ga0157371_10044279 | 3300013102 | Bacteria | 3169 |
| 283 | Ga0157370_10126001 | 3300013104 | Bacteria | 2390 |
| 284 | Ga0157370_10292270 | 3300013104 | Bacteria | 1505 |
| 285 | Ga0157370_10923974 | 3300013104 | Bacteria | 791 |
| 286 | Ga0157369_10381445 | 3300013105 | Bacteria | 1463 |
| 287 | Ga0157374_10009658 | 3300013296 | Bacteria | 8284 |
| 288 | Ga0157374_10353469 | 3300013296 | Bacteria | 1460 |
| 289 | Ga0157374_11470716 | 3300013296 | Bacteria | 704 |
| 290 | Ga0157374_11846605 | 3300013296 | Bacteria | 630 |
| 291 | Ga0157378_10706173 | 3300013297 | Bacteria | 1028 |
| 292 | Ga0157378_11504214 | 3300013297 | Bacteria | 718 |
| 293 | Ga0157378_12518481 | 3300013297 | Bacteria | 567 |
| 294 | Ga0163162_10016188 | 3300013306 | Bacteria | 7293 |
| 295 | Ga0163162_11337283 | 3300013306 | Bacteria | 814 |
| 296 | Ga0163162_12939054 | 3300013306 | Bacteria | 548 |
| 297 | Ga0157372_10156872 | 3300013307 | Bacteria | 2629 |
| 298 | Ga0157372_10428020 | 3300013307 | Bacteria | 1543 |
| 299 | Ga0157375_10375005 | 3300013308 | Bacteria | 1589 |
| 300 | Ga0157375_10485292 | 3300013308 | Bacteria | 1401 |
| 301 | Ga0157375_11259186 | 3300013308 | Bacteria | 869 |
| 302 | Ga0157375_13194834 | 3300013308 | Bacteria | 546 |
| 303 | Ga0163163_10191753 | 3300014325 | Bacteria | 2092 |
| 304 | Ga0163163_11422140 | 3300014325 | Bacteria | 755 |
| 305 | Ga0163163_12741624 | 3300014325 | Bacteria | 550 |
| 306 | Ga0157380_10028623 | 3300014326 | Bacteria | 4251 |
| 307 | Ga0157380_10045978 | 3300014326 | Bacteria | 3427 |
| 308 | Ga0157380_10502146 | 3300014326 | Bacteria | 1178 |
| 309 | Ga0157380_11027379 | 3300014326 | Bacteria | 859 |
| 310 | Ga0182008_10036875 | 3300014497 | Bacteria | 2446 |
| 311 | Ga0182008_10061920 | 3300014497 | Bacteria | 1845 |
| 312 | Ga0157379_10010369 | 3300014968 | Bacteria | 8119 |
| 313 | Ga0157379_10054527 | 3300014968 | Bacteria | 3572 |
| 314 | Ga0157379_10072587 | 3300014968 | Bacteria | 3079 |
| 315 | Ga0157379_10872353 | 3300014968 | Bacteria | 852 |
| 316 | Ga0157376_10005027 | 3300014969 | Bacteria | 9221 |
| 317 | Ga0157376_12490579 | 3300014969 | Bacteria | 557 |
| 318 | Ga0157376_12959438 | 3300014969 | Bacteria | 514 |
| 319 | Ga0182007_10017984 | 3300015262 | Bacteria | 2571 |
| 320 | Ga0163161_10003912 | 3300017792 | Bacteria | 10448 |
| 321 | Ga0197907_10339444 | 3300020069 | Bacteria | 806 |
| 322 | Ga0206356_11187003 | 3300020070 | Bacteria | 1200 |
| 323 | Ga0206356_11700594 | 3300020070 | Bacteria | 584 |
| 324 | Ga0206349_1530087 | 3300020075 | Bacteria | 845 |
| 325 | Ga0206355_1211932 | 3300020076 | Bacteria | 566 |
| 326 | Ga0206351_10140964 | 3300020077 | Bacteria | 543 |
| 327 | Ga0206352_10593072 | 3300020078 | Bacteria | 919 |
| 328 | Ga0206350_11130271 | 3300020080 | Bacteria | 856 |
| 329 | Ga0206350_11406840 | 3300020080 | Bacteria | 668 |
| 330 | Ga0206354_11246408 | 3300020081 | Bacteria | 943 |
| 331 | Ga0154015_1086285 | 3300020610 | Bacteria | 861 |
| 332 | Ga0213872_10002261 | 3300021361 | Bacteria | 11488 |
| 333 | Ga0213876_10108926 | 3300021384 | Bacteria | 1470 |
| 334 | Ga0213875_10528058 | 3300021388 | Bacteria | 568 |
| 335 | Ga0213871_10314223 | 3300021441 | Bacteria | 508 |
| 336 | Ga0224712_10124612 | 3300022467 | Bacteria | 1119 |
| 337 | Ga0224712_10393493 | 3300022467 | Bacteria | 660 |
| 338 | Ga0247551_105375 | 3300023552 | Bacteria | 532 |
| 339 | Ga0209435_100323 | 3300025206 | Bacteria | 11442 |
| 340 | Ga0209646_1000283 | 3300025246 | Bacteria | 44163 |
| 341 | Ga0209026_1001836 | 3300025250 | Bacteria | 8710 |
| 342 | Ga0209148_1001569 | 3300025254 | Bacteria | 10901 |
| 343 | Ga0209759_1000548 | 3300025256 | Bacteria | 38674 |
| 344 | Ga0209565_1016465 | 3300025263 | Bacteria | 1643 |
| 345 | Ga0209565_1017675 | 3300025263 | Bacteria | 1559 |
| 346 | Ga0207666_1010509 | 3300025271 | Bacteria | 1267 |
| 347 | Ga0209673_1014580 | 3300025273 | Bacteria | 3034 |
| 348 | Ga0209673_1046816 | 3300025273 | Bacteria | 1177 |
| 349 | Ga0209130_1010299 | 3300025284 | Bacteria | 2587 |
| 350 | Ga0209675_1000449 | 3300025291 | Bacteria | 31892 |
| 351 | Ga0209676_1000064 | 3300025292 | Bacteria | 321700 |
| 352 | Ga0209025_1000690 | 3300025294 | Bacteria | 57778 |
| 353 | Ga0209025_1000746 | 3300025294 | Bacteria | 54767 |
| 354 | Ga0209564_1000891 | 3300025295 | Bacteria | 39249 |
| 355 | Ga0209564_1001109 | 3300025295 | Bacteria | 31794 |
| 356 | Ga0209256_1000193 | 3300025299 | Bacteria | 117486 |
| 357 | Ga0209051_1000281 | 3300025303 | Bacteria | 83196 |
| 358 | Ga0209051_1000980 | 3300025303 | Bacteria | 27699 |
| 359 | Ga0209051_1012476 | 3300025303 | Bacteria | 4108 |
| 360 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 361 | Ga0207697_10129333 | 3300025315 | Bacteria | 1090 |
| 362 | Ga0207656_10120352 | 3300025321 | Bacteria | 1222 |
| 363 | Ga0207682_10245409 | 3300025893 | Bacteria | 833 |
| 364 | Ga0207688_10236596 | 3300025901 | Bacteria | 1103 |
| 365 | Ga0207680_10182205 | 3300025903 | Bacteria | 1421 |
| 366 | Ga0207685_10457549 | 3300025905 | Bacteria | 665 |
| 367 | Ga0207699_10032668 | 3300025906 | Bacteria | 2934 |
| 368 | Ga0207645_10005684 | 3300025907 | Bacteria | 9010 |
| 369 | Ga0207645_10239960 | 3300025907 | Bacteria | 1197 |
| 370 | Ga0207645_10323101 | 3300025907 | Bacteria | 1029 |
| 371 | Ga0207643_10421149 | 3300025908 | Bacteria | 846 |
| 372 | Ga0207643_10706685 | 3300025908 | Bacteria | 652 |
| 373 | Ga0207705_10006851 | 3300025909 | Bacteria | 8421 |
| 374 | Ga0207705_10181070 | 3300025909 | Bacteria | 1590 |
| 375 | Ga0207705_10276060 | 3300025909 | Bacteria | 1286 |
| 376 | Ga0207705_10398586 | 3300025909 | Bacteria | 1064 |
| 377 | Ga0207705_10561058 | 3300025909 | Bacteria | 888 |
| 378 | Ga0207684_10037357 | 3300025910 | Bacteria | 4121 |
| 379 | Ga0207654_10005360 | 3300025911 | Bacteria | 6480 |
| 380 | Ga0207654_11180043 | 3300025911 | Bacteria | 558 |
| 381 | Ga0207707_10885989 | 3300025912 | Bacteria | 739 |
| 382 | Ga0207695_10414780 | 3300025913 | Bacteria | 1231 |
| 383 | Ga0207671_10080363 | 3300025914 | Bacteria | 2444 |
| 384 | Ga0207671_10137847 | 3300025914 | Bacteria | 1877 |
| 385 | Ga0207693_10076579 | 3300025915 | Bacteria | 2619 |
| 386 | Ga0207693_10469920 | 3300025915 | Bacteria | 982 |
| 387 | Ga0207663_10054098 | 3300025916 | Bacteria | 2512 |
| 388 | Ga0207663_10173167 | 3300025916 | Bacteria | 1535 |
| 389 | Ga0207663_11181642 | 3300025916 | Bacteria | 616 |
| 390 | Ga0207660_10709516 | 3300025917 | Bacteria | 820 |
| 391 | Ga0207660_11171119 | 3300025917 | Bacteria | 626 |
| 392 | Ga0207662_10124229 | 3300025918 | Bacteria | 1621 |
| 393 | Ga0207657_10001356 | 3300025919 | Bacteria | 26083 |
| 394 | Ga0207657_10037493 | 3300025919 | Bacteria | 4327 |
| 395 | Ga0207657_10037997 | 3300025919 | Bacteria | 4292 |
| 396 | Ga0207657_10435813 | 3300025919 | Bacteria | 1029 |
| 397 | Ga0207657_10765997 | 3300025919 | Bacteria | 747 |
| 398 | Ga0207649_10008692 | 3300025920 | Bacteria | 5546 |
| 399 | Ga0207649_10213913 | 3300025920 | Bacteria | 1369 |
| 400 | Ga0207652_10299460 | 3300025921 | Bacteria | 1451 |
| 401 | Ga0207652_10696569 | 3300025921 | Bacteria | 907 |
| 402 | Ga0207652_10914042 | 3300025921 | Bacteria | 775 |
| 403 | Ga0207652_11174352 | 3300025921 | Bacteria | 669 |
| 404 | Ga0207646_10958276 | 3300025922 | Bacteria | 757 |
| 405 | Ga0207681_10041950 | 3300025923 | Bacteria | 3053 |
| 406 | Ga0207681_10091869 | 3300025923 | Bacteria | 2169 |
| 407 | Ga0207681_10568204 | 3300025923 | Bacteria | 935 |
| 408 | Ga0207694_10038457 | 3300025924 | Bacteria | 3679 |
| 409 | Ga0207694_10125141 | 3300025924 | Bacteria | 2056 |
| 410 | Ga0207694_10169738 | 3300025924 | Bacteria | 1766 |
| 411 | Ga0207694_10283236 | 3300025924 | Unclassified | 1362 |
| 412 | Ga0207650_10749426 | 3300025925 | Bacteria | 826 |
| 413 | Ga0207659_10005215 | 3300025926 | Bacteria | 7866 |
| 414 | Ga0207659_10048380 | 3300025926 | Bacteria | 3012 |
| 415 | Ga0207659_11436307 | 3300025926 | Bacteria | 591 |
| 416 | Ga0207687_10059961 | 3300025927 | Bacteria | 2682 |
| 417 | Ga0207687_10135575 | 3300025927 | Bacteria | 1861 |
| 418 | Ga0207687_10513131 | 3300025927 | Bacteria | 1002 |
| 419 | Ga0207700_10100054 | 3300025928 | Bacteria | 2310 |
| 420 | Ga0207700_10118043 | 3300025928 | Bacteria | 2146 |
| 421 | Ga0207700_10174177 | 3300025928 | Bacteria | 1797 |
| 422 | Ga0207700_10481255 | 3300025928 | Bacteria | 1097 |
| 423 | Ga0207700_11522786 | 3300025928 | Bacteria | 593 |
| 424 | Ga0207664_10039415 | 3300025929 | Bacteria | 3668 |
| 425 | Ga0207664_11014766 | 3300025929 | Bacteria | 743 |
| 426 | Ga0207644_10079813 | 3300025931 | Bacteria | 2415 |
| 427 | Ga0207644_10088455 | 3300025931 | Bacteria | 2304 |
| 428 | Ga0207644_10289327 | 3300025931 | Bacteria | 1317 |
| 429 | Ga0207644_11081445 | 3300025931 | Bacteria | 674 |
| 430 | Ga0207690_10008492 | 3300025932 | Bacteria | 6092 |
| 431 | Ga0207690_10032989 | 3300025932 | Bacteria | 3326 |
| 432 | Ga0207690_10294649 | 3300025932 | Bacteria | 1267 |
| 433 | Ga0207690_10305092 | 3300025932 | Bacteria | 1247 |
| 434 | Ga0207690_11669074 | 3300025932 | Bacteria | 532 |
| 435 | Ga0207706_10000933 | 3300025933 | Bacteria | 29885 |
| 436 | Ga0207706_10020371 | 3300025933 | Bacteria | 5962 |
| 437 | Ga0207706_10091464 | 3300025933 | Bacteria | 2675 |
| 438 | Ga0207706_10137030 | 3300025933 | Bacteria | 2153 |
| 439 | Ga0207706_10203567 | 3300025933 | Bacteria | 1736 |
| 440 | Ga0207706_10976996 | 3300025933 | Bacteria | 712 |
| 441 | Ga0207686_10023141 | 3300025934 | Bacteria | 3585 |
| 442 | Ga0207686_10910490 | 3300025934 | Bacteria | 710 |
| 443 | Ga0207709_10813999 | 3300025935 | Bacteria | 755 |
| 444 | Ga0207709_11750571 | 3300025935 | Bacteria | 517 |
| 445 | Ga0207670_10122033 | 3300025936 | Bacteria | 1896 |
| 446 | Ga0207670_10797064 | 3300025936 | Bacteria | 787 |
| 447 | Ga0207670_10993567 | 3300025936 | Bacteria | 706 |
| 448 | Ga0207669_11606463 | 3300025937 | Bacteria | 555 |
| 449 | Ga0207704_10293317 | 3300025938 | Bacteria | 1242 |
| 450 | Ga0207704_11224007 | 3300025938 | Bacteria | 641 |
| 451 | Ga0207665_10119669 | 3300025939 | Bacteria | 1859 |
| 452 | Ga0207665_10363817 | 3300025939 | Bacteria | 1094 |
| 453 | Ga0207691_10008515 | 3300025940 | Bacteria | 9852 |
| 454 | Ga0207691_10083769 | 3300025940 | Bacteria | 2863 |
| 455 | Ga0207691_10341381 | 3300025940 | Bacteria | 1282 |
| 456 | Ga0207691_11130370 | 3300025940 | Bacteria | 651 |
| 457 | Ga0207711_10046230 | 3300025941 | Bacteria | 3719 |
| 458 | Ga0207711_10118967 | 3300025941 | Bacteria | 2357 |
| 459 | Ga0207711_11271343 | 3300025941 | Bacteria | 678 |
| 460 | Ga0207689_10000150 | 3300025942 | Bacteria | 60037 |
| 461 | Ga0207689_10729710 | 3300025942 | Bacteria | 836 |
| 462 | Ga0207661_10784722 | 3300025944 | Bacteria | 877 |
| 463 | Ga0207679_10012145 | 3300025945 | Bacteria | 5607 |
| 464 | Ga0207679_10020511 | 3300025945 | Bacteria | 4461 |
| 465 | Ga0207679_10083942 | 3300025945 | Bacteria | 2443 |
| 466 | Ga0207679_10087149 | 3300025945 | Bacteria | 2403 |
| 467 | Ga0207679_10277740 | 3300025945 | Bacteria | 1435 |
| 468 | Ga0207679_11498423 | 3300025945 | Bacteria | 619 |
| 469 | Ga0207667_10016294 | 3300025949 | Bacteria | 8399 |
| 470 | Ga0207667_10163526 | 3300025949 | Bacteria | 2288 |
| 471 | Ga0207667_10223884 | 3300025949 | Bacteria | 1927 |
| 472 | Ga0207667_10307577 | 3300025949 | Bacteria | 1619 |
| 473 | Ga0207667_10821888 | 3300025949 | Bacteria | 925 |
| 474 | Ga0207651_10036335 | 3300025960 | Bacteria | 3214 |
| 475 | Ga0207651_10182804 | 3300025960 | Bacteria | 1665 |
| 476 | Ga0207651_10550739 | 3300025960 | Bacteria | 1003 |
| 477 | Ga0207668_10171906 | 3300025972 | Bacteria | 1700 |
| 478 | Ga0207668_11098077 | 3300025972 | Bacteria | 713 |
| 479 | Ga0207640_10017371 | 3300025981 | Bacteria | 4209 |
| 480 | Ga0207640_10061385 | 3300025981 | Bacteria | 2490 |
| 481 | Ga0207640_10159840 | 3300025981 | Bacteria | 1666 |
| 482 | Ga0207640_11002290 | 3300025981 | Bacteria | 735 |
| 483 | Ga0207658_10275815 | 3300025986 | Bacteria | 1439 |
| 484 | Ga0207658_10365469 | 3300025986 | Bacteria | 1260 |
| 485 | Ga0207658_11133683 | 3300025986 | Bacteria | 715 |
| 486 | Ga0207677_10012436 | 3300026023 | Bacteria | 4893 |
| 487 | Ga0207677_10902991 | 3300026023 | Bacteria | 796 |
| 488 | Ga0207677_11004334 | 3300026023 | Bacteria | 757 |
| 489 | Ga0207703_10030559 | 3300026035 | Bacteria | 4258 |
| 490 | Ga0207703_10047106 | 3300026035 | Bacteria | 3475 |
| 491 | Ga0207703_10875308 | 3300026035 | Bacteria | 860 |
| 492 | Ga0207639_10053565 | 3300026041 | Bacteria | 3079 |
| 493 | Ga0207639_10140530 | 3300026041 | Bacteria | 2011 |
| 494 | Ga0207639_11485460 | 3300026041 | Bacteria | 636 |
| 495 | Ga0207639_11580365 | 3300026041 | Bacteria | 615 |
| 496 | Ga0207678_10002944 | 3300026067 | Bacteria | 15425 |
| 497 | Ga0207708_10547373 | 3300026075 | Bacteria | 975 |
| 498 | Ga0207708_10680046 | 3300026075 | Bacteria | 878 |
| 499 | Ga0207702_10046560 | 3300026078 | Bacteria | 3652 |
| 500 | Ga0207702_10401949 | 3300026078 | Bacteria | 1321 |
| 501 | Ga0207702_10815597 | 3300026078 | Bacteria | 923 |
| 502 | Ga0207641_10576045 | 3300026088 | Bacteria | 1100 |
| 503 | Ga0207641_10919223 | 3300026088 | Bacteria | 869 |
| 504 | Ga0207641_11041584 | 3300026088 | Bacteria | 816 |
| 505 | Ga0207648_10067687 | 3300026089 | Bacteria | 3113 |
| 506 | Ga0207648_10561469 | 3300026089 | Bacteria | 1049 |
| 507 | Ga0207648_10746705 | 3300026089 | Bacteria | 909 |
| 508 | Ga0207648_10765479 | 3300026089 | Bacteria | 897 |
| 509 | Ga0207676_10063161 | 3300026095 | Bacteria | 2940 |
| 510 | Ga0207676_10063624 | 3300026095 | Bacteria | 2931 |
| 511 | Ga0207676_10184572 | 3300026095 | Bacteria | 1829 |
| 512 | Ga0207674_10020946 | 3300026116 | Bacteria | 7053 |
| 513 | Ga0207674_10023098 | 3300026116 | Bacteria | 6669 |
| 514 | Ga0207674_10878405 | 3300026116 | Bacteria | 864 |
| 515 | Ga0207675_100001131 | 3300026118 | Bacteria | 26465 |
| 516 | Ga0207675_102018693 | 3300026118 | Bacteria | 594 |
| 517 | Ga0207683_10034729 | 3300026121 | Bacteria | 4383 |
| 518 | Ga0207683_10064766 | 3300026121 | Bacteria | 3222 |
| 519 | Ga0207683_10145903 | 3300026121 | Bacteria | 2134 |
| 520 | Ga0207698_10016066 | 3300026142 | Bacteria | 5035 |
| 521 | Ga0207698_10054479 | 3300026142 | Bacteria | 3077 |
| 522 | Ga0207698_10129121 | 3300026142 | Bacteria | 2156 |
| 523 | Ga0207698_10289791 | 3300026142 | Bacteria | 1519 |
| 524 | Ga0209981_1058634 | 3300027378 | Bacteria | 588 |
| 525 | Ga0209588_1052034 | 3300027671 | Bacteria | 1324 |
| 526 | Ga0209966_1001722 | 3300027695 | Bacteria | 3714 |
| 527 | Ga0209813_10092905 | 3300027866 | Bacteria | 1016 |
| 528 | Ga0209813_10463238 | 3300027866 | Bacteria | 520 |
| 529 | Ga0207428_10076303 | 3300027907 | Bacteria | 2625 |
| 530 | Ga0268266_10042112 | 3300028379 | Bacteria | 3899 |
| 531 | Ga0268264_10080643 | 3300028381 | Bacteria | 2779 |
| 532 | Ga0268264_11569700 | 3300028381 | Bacteria | 669 |
| 533 | Ga0307517_10142655 | 3300028786 | Bacteria | 1675 |
| 534 | Ga0265338_11112225 | 3300028800 | Bacteria | 532 |
| 535 | Ga0265332_10024451 | 3300031238 | Bacteria | 2658 |
| 536 | Ga0265328_10052951 | 3300031239 | Bacteria | 1489 |
| 537 | Ga0265328_10082897 | 3300031239 | Bacteria | 1182 |
| 538 | Ga0265329_10013217 | 3300031242 | Bacteria | 2950 |
| 539 | Ga0265331_10069940 | 3300031250 | Bacteria | 1643 |
| 540 | Ga0265327_10000235 | 3300031251 | Bacteria | 111362 |
| 541 | Ga0265316_10273699 | 3300031344 | Bacteria | 1235 |
| 542 | Ga0307408_100168832 | 3300031548 | Bacteria | 1745 |
| 543 | Ga0265314_10069835 | 3300031711 | Bacteria | 2356 |
| 544 | Ga0265342_10375356 | 3300031712 | Bacteria | 737 |
| 545 | Ga0307516_10784276 | 3300031730 | Bacteria | 614 |
| 546 | Ga0307405_10100216 | 3300031731 | Bacteria | 1941 |
| 547 | Ga0307413_10281625 | 3300031824 | Bacteria | 1251 |
| 548 | Ga0307410_10198657 | 3300031852 | Bacteria | 1530 |
| 549 | Ga0307406_10647142 | 3300031901 | Bacteria | 877 |
| 550 | Ga0307406_10872865 | 3300031901 | Bacteria | 764 |
| 551 | Ga0307406_11098634 | 3300031901 | Bacteria | 687 |
| 552 | Ga0307407_10333253 | 3300031903 | Bacteria | 1069 |
| 553 | Ga0307407_11169890 | 3300031903 | Bacteria | 600 |
| 554 | Ga0307412_10012955 | 3300031911 | Bacteria | 4876 |
| 555 | Ga0307409_100325083 | 3300031995 | Bacteria | 1441 |
| 556 | Ga0307409_100393451 | 3300031995 | Bacteria | 1321 |
| 557 | Ga0307416_100002702 | 3300032002 | Bacteria | 10275 |
| 558 | Ga0307416_100180331 | 3300032002 | Bacteria | 1978 |
| 559 | Ga0307416_100333748 | 3300032002 | Bacteria | 1525 |
| 560 | Ga0307416_100460126 | 3300032002 | Bacteria | 1327 |
| 561 | Ga0307416_103638900 | 3300032002 | Bacteria | 516 |
| 562 | Ga0307414_10483247 | 3300032004 | Bacteria | 1093 |
| 563 | Ga0307411_10325565 | 3300032005 | Bacteria | 1243 |
| 564 | Ga0307411_10382218 | 3300032005 | Bacteria | 1158 |
| 565 | Ga0307411_11783030 | 3300032005 | Bacteria | 571 |
| 566 | Ga0373930_0094068 | 3300034816 | Bacteria | 706 |
| 567 | Ga0373948_0029739 | 3300034817 | Bacteria | 1094 |
| 568 | Ga0373958_0209027 | 3300034819 | Bacteria | 514 |
| 569 | Ga0373938_0177643 | 3300034957 | Bacteria | 580 |
| 570 | Ga0373926_0000087 | 3300035083 | Bacteria | 17710 |
| 571 | Ga0373926_0297034 | 3300035083 | Bacteria | 630 |
| 572 | Ga0373928_0008445 | 3300035084 | Bacteria | 2000 |
| 573 | Ga0373934_0156273 | 3300035086 | Bacteria | 935 |
| 574 | Ga0373934_0168803 | 3300035086 | Unclassified | 898 |
| 575 | Ga0373944_0026731 | 3300035089 | Bacteria | 1706 |
| 576 | Ga0373944_0093003 | 3300035089 | Bacteria | 1010 |
| 577 | Ga0373951_0182670 | 3300035091 | Bacteria | 603 |
| 578 | Ga0373923_0103358 | 3300035111 | Bacteria | 1259 |
| 579 | Ga0373923_0586749 | 3300035111 | Unclassified | 548 |
| 580 | Ga0373932_0042968 | 3300035112 | Bacteria | 1313 |
| 581 | Ga0373936_0003309 | 3300035113 | Bacteria | 6045 |
| 582 | Ga0373939_0010456 | 3300035114 | Bacteria | 2321 |
| 583 | Ga0373941_0428948 | 3300035115 | Bacteria | 551 |
| 584 | Ga0373945_0010919 | 3300035116 | Bacteria | 2995 |
| 585 | Ga0373953_0068564 | 3300035117 | Bacteria | 1460 |
| 586 | Ga0373956_0056907 | 3300035119 | Unclassified | 1766 |
| 587 | Ga0373956_0157436 | 3300035119 | Bacteria | 1070 |
| 588 | Ga0373957_0098280 | 3300035120 | Bacteria | 1170 |
| 589 | Ga0373943_0007648 | 3300035170 | Bacteria | 4855 |
| 590 | Ga0373943_0023074 | 3300035170 | Bacteria | 2890 |
| 591 | Ga0373943_0196052 | 3300035170 | Bacteria | 1116 |
| 592 | Ga0373943_0322287 | 3300035170 | Bacteria | 881 |
| 593 | Ga0373943_0680074 | 3300035170 | Bacteria | 609 |
| 594 | Ga0373946_0007723 | 3300035171 | Bacteria | 3941 |
| 595 | Ga0373946_0101427 | 3300035171 | Bacteria | 1291 |
| 596 | Ga0373955_0063053 | 3300035172 | Bacteria | 2052 |
| 597 | Ga0373955_0080380 | 3300035172 | Unclassified | 1841 |
| 598 | Ga0373942_0063074 | 3300035207 | Bacteria | 1066 |
| 599 | Ga0373961_0024198 | 3300035241 | Bacteria | 1641 |
| 600 | Ga0373962_0053205 | 3300035242 | Bacteria | 1171 |
| 601 | Ga0373962_0071634 | 3300035242 | Bacteria | 1037 |
| 602 | Ga0373931_0004895 | 3300035691 | Bacteria | 6157 |
| 603 | Ga0373931_0020515 | 3300035691 | Bacteria | 3307 |
| 604 | Ga0373931_0557768 | 3300035691 | Bacteria | 745 |
| 605 | Ga0373931_0669130 | 3300035691 | Bacteria | 683 |
| 606 | Ga0373935_0145650 | 3300035692 | Bacteria | 1603 |
| 607 | Ga0373935_0317902 | 3300035692 | Bacteria | 1104 |
| 608 | Ga0373935_1293747 | 3300035692 | Bacteria | 544 |
| 609 | Ga0373927_0027669 | 3300035695 | Bacteria | 3701 |
| 610 | Ga0373933_0178501 | 3300035724 | Bacteria | 1354 |
| 611 | Ga0373933_0494155 | 3300035724 | Unclassified | 801 |
| 612 | Ga0373947_0002298 | 3300035725 | Bacteria | 11557 |
| 613 | Ga0373947_0066867 | 3300035725 | Unclassified | 2194 |
| 614 | Ga0373947_0076151 | 3300035725 | Bacteria | 2067 |
| 615 | Ga0373947_0347720 | 3300035725 | Bacteria | 994 |
| 616 | Ga0373947_0847437 | 3300035725 | Bacteria | 624 |
| 617 | Ga0373937_0010585 | 3300036401 | Bacteria | 8060 |
| 618 | Ga0373937_0013598 | 3300036401 | Bacteria | 7171 |
| 619 | Ga0373937_0024912 | 3300036401 | Bacteria | 5400 |
| 620 | Ga0373937_1062308 | 3300036401 | Bacteria | 758 |
| 621 | Ga0373925_0031082 | 3300037068 | Bacteria | 3921 |
| 622 | Ga0373925_0043519 | 3300037068 | Bacteria | 3333 |
| 623 | Ga0373925_0766317 | 3300037068 | Bacteria | 795 |
| 624 | Ga0373925_1234211 | 3300037068 | Bacteria | 614 |
| 625 | Ga0395899_0007451 | 3300037312 | Bacteria | 8454 |
| 626 | Ga0395899_0035375 | 3300037312 | Bacteria | 3750 |
| 627 | Ga0395899_0240357 | 3300037312 | Bacteria | 1246 |
| 628 | Ga0395900_0000846 | 3300037418 | Bacteria | 40292 |
| 629 | Ga0395900_0016251 | 3300037418 | Bacteria | 7583 |
| 630 | Ga0395900_0032975 | 3300037418 | Bacteria | 5330 |
| 631 | Ga0395900_0037359 | 3300037418 | Bacteria | 5008 |
| 632 | Ga0395900_0068359 | 3300037418 | Bacteria | 3650 |
| 633 | Ga0395900_0076227 | 3300037418 | Bacteria | 3447 |
| 634 | Ga0395900_0192550 | 3300037418 | Bacteria | 2067 |
| 635 | Ga0395900_0451656 | 3300037418 | Bacteria | 1241 |
| 636 | Ga0395900_0489864 | 3300037418 | Bacteria | 1181 |
| 637 | Ga0395900_0702634 | 3300037418 | Bacteria | 944 |
| 638 | Ga0395898_0063565 | 3300037466 | Bacteria | 3581 |
| 639 | Ga0395898_0535860 | 3300037466 | Bacteria | 1112 |
| 640 | Ga0395898_0807538 | 3300037466 | Bacteria | 878 |
| 641 | Ga0395905_0000589 | 3300037471 | Bacteria | 48792 |
| 642 | Ga0395905_0001323 | 3300037471 | Bacteria | 30288 |
| 643 | Ga0395905_0010865 | 3300037471 | Bacteria | 8818 |
| 644 | Ga0395905_0011469 | 3300037471 | Bacteria | 8565 |
| 645 | Ga0395905_0047866 | 3300037471 | Bacteria | 4007 |
| 646 | Ga0395905_0054452 | 3300037471 | Bacteria | 3744 |
| 647 | Ga0395905_0148918 | 3300037471 | Bacteria | 2202 |
| 648 | Ga0395905_0304019 | 3300037471 | Bacteria | 1483 |
| 649 | Ga0395905_0612190 | 3300037471 | Bacteria | 991 |
| 650 | Ga0395905_0981921 | 3300037471 | Bacteria | 747 |
| 651 | Ga0395905_1110335 | 3300037471 | Bacteria | 694 |
| 652 | Ga0395905_1358427 | 3300037471 | Bacteria | 614 |
| 653 | Ga0436364_0111886 | 3300037853 | Bacteria | 3128 |
| 654 | Ga0395901_0000730 | 3300038443 | Bacteria | 37345 |
| 655 | Ga0395901_0203522 | 3300038443 | Bacteria | 2074 |
| 656 | Ga0395901_0280083 | 3300038443 | Bacteria | 1732 |
| 657 | Ga0395901_0387167 | 3300038443 | Bacteria | 1438 |
| 658 | Ga0395901_0407129 | 3300038443 | Bacteria | 1397 |
| 659 | Ga0395901_0456038 | 3300038443 | Bacteria | 1307 |
| 660 | Ga0400483_078643 | 3300039062 | Bacteria | 13677 |
| 661 | Ga0400483_260254 | 3300039062 | Bacteria | 8241 |
| 662 | Ga0436365_0322561 | 3300039437 | Bacteria | 902 |
| 663 | Ga0436365_1519697 | 3300039437 | Bacteria | 1791 |
| 664 | Ga0436360_0707490 | 3300039438 | Bacteria | 1646 |
| 665 | Ga0436361_0239425 | 3300039447 | Bacteria | 40455 |
| 666 | Ga0436363_1012411 | 3300039450 | Bacteria | 918 |
| 667 | Ga0436363_1219339 | 3300039450 | Bacteria | 4090 |
| 668 | Ga0439436_0082677 | 3300041404 | Bacteria | 894 |
| 669 | Ga0439436_0175784 | 3300041404 | Bacteria | 608 |
| 670 | Ga0439438_085533 | 3300041405 | Bacteria | 771 |
| 671 | Ga0439439_0187321 | 3300041406 | Bacteria | 598 |
| 672 | Ga0439453_0006038 | 3300041408 | Bacteria | 1870 |
| 673 | Ga0439461_0133137 | 3300041410 | Bacteria | 630 |
| 674 | Ga0451791_0640864 | 3300041451 | Bacteria | 627 |
| 675 | Ga0451802_0100909 | 3300041460 | Bacteria | 1391 |
| 676 | Ga0451839_0242961 | 3300041496 | Bacteria | 509 |
| 677 | Ga0451841_0820842 | 3300041498 | Bacteria | 552 |
| 678 | Ga0451853_1927380 | 3300041512 | Bacteria | 638 |
| 679 | Ga0439433_0064245 | 3300041999 | Bacteria | 878 |
| 680 | Ga0439433_0093801 | 3300041999 | Bacteria | 740 |
| 681 | Ga0439441_024765 | 3300042001 | Bacteria | 1129 |
| 682 | Ga0439443_124526 | 3300042003 | Bacteria | 508 |
| 683 | Ga0439448_0005764 | 3300042005 | Bacteria | 3538 |
| 684 | Ga0439449_0007009 | 3300042007 | Bacteria | 4293 |
| 685 | Ga0439449_0113627 | 3300042007 | Bacteria | 1004 |
| 686 | Ga0439449_0113655 | 3300042007 | Bacteria | 1003 |
| 687 | Ga0439450_093737 | 3300042008 | Bacteria | 756 |
| 688 | Ga0439455_0232008 | 3300042012 | Bacteria | 538 |
| 689 | Ga0439457_038319 | 3300042014 | Bacteria | 1067 |
| 690 | Ga0439462_0031644 | 3300042015 | Bacteria | 1401 |
| 691 | Ga0450896_017071 | 3300042133 | Bacteria | 1046 |
| 692 | Ga0450904_000433 | 3300042139 | Bacteria | 8384 |
| 693 | Ga0450906_065311 | 3300042145 | Bacteria | 649 |
| 694 | Ga0439446_0015332 | 3300042156 | Bacteria | 2125 |
| 695 | Ga0439446_0044458 | 3300042156 | Bacteria | 1314 |
| 696 | Ga0439458_0049411 | 3300042157 | Bacteria | 1035 |
| 697 | Ga0439458_0170571 | 3300042157 | Bacteria | 588 |
| 698 | Ga0450908_019422 | 3300042184 | Bacteria | 1196 |
| 699 | Ga0450909_030549 | 3300042185 | Bacteria | 817 |
| 700 | Ga0439464_0028302 | 3300042439 | Bacteria | 1561 |
| 701 | Ga0439460_0006452 | 3300042461 | Bacteria | 2911 |
| 702 | Ga0451577_0002065 | 3300042876 | Bacteria | 24794 |
| 703 | Ga0451577_0028662 | 3300042876 | Bacteria | 5033 |
| 704 | Ga0451577_0074388 | 3300042876 | Bacteria | 3030 |
| 705 | Ga0451577_0103577 | 3300042876 | Bacteria | 2543 |
| 706 | Ga0451577_0641176 | 3300042876 | Bacteria | 963 |
| 707 | Ga0451577_0796240 | 3300042876 | Bacteria | 854 |
| 708 | Ga0439440_0280101 | 3300042993 | Bacteria | 515 |
| 709 | Ga0466969_0000349 | 3300044656 | Bacteria | 25360 |
| 710 | Ga0466969_0073557 | 3300044656 | Bacteria | 1640 |
| 711 | Ga0466969_0276076 | 3300044656 | Bacteria | 761 |
| 712 | Ga0466969_0547412 | 3300044656 | Bacteria | 529 |
| 713 | Ga0466972_0003323 | 3300044658 | Bacteria | 7976 |
| 714 | Ga0466972_0010708 | 3300044658 | Bacteria | 4601 |
| 715 | Ga0466972_0285913 | 3300044658 | Bacteria | 770 |
| 716 | Ga0466965_0000489 | 3300044683 | Bacteria | 14080 |
| 717 | Ga0466965_0003742 | 3300044683 | Bacteria | 6715 |
| 718 | Ga0466965_0022215 | 3300044683 | Bacteria | 3058 |
| 719 | Ga0466965_0056211 | 3300044683 | Bacteria | 1959 |
| 720 | Ga0466965_0174393 | 3300044683 | Bacteria | 1132 |
| 721 | Ga0466965_0228009 | 3300044683 | Bacteria | 994 |
| 722 | Ga0466965_0357395 | 3300044683 | Bacteria | 801 |
| 723 | Ga0466966_0009286 | 3300044684 | Bacteria | 6510 |
| 724 | Ga0466966_0015545 | 3300044684 | Bacteria | 5030 |
| 725 | Ga0466966_0058816 | 3300044684 | Bacteria | 2428 |
| 726 | Ga0466966_0124631 | 3300044684 | Bacteria | 1580 |
| 727 | Ga0466966_0659804 | 3300044684 | Bacteria | 630 |
| 728 | Ga0466966_0800219 | 3300044684 | Bacteria | 568 |
| 729 | Ga0466961_0304783 | 3300044693 | Bacteria | 972 |
| 730 | Ga0466961_0314475 | 3300044693 | Bacteria | 955 |
| 731 | Ga0466961_0502743 | 3300044693 | Bacteria | 732 |
| 732 | Ga0466963_0217135 | 3300044694 | Bacteria | 1339 |
| 733 | Ga0466963_0303647 | 3300044694 | Bacteria | 1123 |
| 734 | Ga0466963_0455532 | 3300044694 | Bacteria | 903 |
| 735 | Ga0466964_0002101 | 3300044706 | Bacteria | 7014 |
| 736 | Ga0466964_0020999 | 3300044706 | Bacteria | 2521 |
| 737 | Ga0466964_0101537 | 3300044706 | Bacteria | 1269 |
| 738 | Ga0466964_0124520 | 3300044706 | Bacteria | 1166 |
| 739 | Ga0453684_0064524 | 3300044712 | Bacteria | 4677 |
| 740 | Ga0453684_0231499 | 3300044712 | Bacteria | 2133 |
| 741 | Ga0453684_0352917 | 3300044712 | Bacteria | 1658 |
| 742 | Ga0453684_0636998 | 3300044712 | Bacteria | 1164 |
| 743 | Ga0453684_0860025 | 3300044712 | Bacteria | 974 |
| 744 | Ga0466971_0048746 | 3300044719 | Bacteria | 1904 |
| 745 | Ga0466971_0699625 | 3300044719 | Bacteria | 509 |
| 746 | Ga0466968_0012041 | 3300044735 | Bacteria | 3379 |
| 747 | Ga0466968_0014107 | 3300044735 | Bacteria | 3153 |
| 748 | Ga0466968_0043104 | 3300044735 | Bacteria | 1909 |
| 749 | Ga0466970_0095225 | 3300044765 | Bacteria | 1618 |
| 750 | Ga0466970_0183982 | 3300044765 | Bacteria | 1160 |
| 751 | Ga0466957_0002989 | 3300044842 | Bacteria | 9180 |
| 752 | Ga0466957_0096678 | 3300044842 | Bacteria | 1856 |
| 753 | Ga0466957_1269221 | 3300044842 | Bacteria | 534 |
| 754 | Ga0466960_0006510 | 3300044901 | Bacteria | 4688 |
| 755 | Ga0466959_0080761 | 3300045049 | Bacteria | 2343 |
| 756 | Ga0466959_0185276 | 3300045049 | Bacteria | 1454 |
| 757 | Ga0466959_0321614 | 3300045049 | Bacteria | 1057 |
| 758 | Ga0466959_0367182 | 3300045049 | Bacteria | 980 |
| 759 | Ga0466959_0488701 | 3300045049 | Bacteria | 833 |
| 760 | Ga0466959_0594114 | 3300045049 | Bacteria | 745 |
| 761 | Ga0451576_0001787 | 3300045051 | Bacteria | 35253 |
| 762 | Ga0451576_0004860 | 3300045051 | Bacteria | 17216 |
| 763 | Ga0451576_0013709 | 3300045051 | Bacteria | 9056 |
| 764 | Ga0451576_0032108 | 3300045051 | Bacteria | 5596 |
| 765 | Ga0451576_0073133 | 3300045051 | Bacteria | 3567 |
| 766 | Ga0451576_0125359 | 3300045051 | Bacteria | 2676 |
| 767 | Ga0451576_0151188 | 3300045051 | Bacteria | 2421 |
| 768 | Ga0451576_0442008 | 3300045051 | Bacteria | 1365 |
| 769 | Ga0451576_0611557 | 3300045051 | Bacteria | 1145 |
| 770 | Ga0466958_0007467 | 3300045836 | Bacteria | 6018 |
| 771 | Ga0466958_0328258 | 3300045836 | Bacteria | 984 |
| 772 | Ga0466958_0350471 | 3300045836 | Bacteria | 950 |
| 773 | Ga0466958_0396849 | 3300045836 | Bacteria | 890 |
| 774 | Ga0466958_0432877 | 3300045836 | Bacteria | 851 |
| 775 | Ga0466958_0692050 | 3300045836 | Bacteria | 664 |
| 776 | Ga0466967_0185836 | 3300045976 | Bacteria | 1962 |
| 777 | Ga0466967_0555119 | 3300045976 | Bacteria | 1131 |
| 778 | Ga0466967_1997079 | 3300045976 | Bacteria | 577 |
| 779 | Ga0495617_000134 | 3300046452 | Bacteria | 49612 |
| 780 | Ga0495617_000305 | 3300046452 | Bacteria | 27697 |
| 781 | Ga0495627_000458 | 3300046453 | Bacteria | 35419 |
| 782 | Ga0495627_007824 | 3300046453 | Bacteria | 4063 |
| 783 | Ga0495592_0066694 | 3300046454 | Bacteria | 2633 |
| 784 | Ga0495592_0273776 | 3300046454 | Bacteria | 1107 |
| 785 | Ga0495592_0897617 | 3300046454 | Bacteria | 521 |
| 786 | Ga0495603_0008086 | 3300046455 | Bacteria | 6356 |
| 787 | Ga0495603_0038945 | 3300046455 | Bacteria | 2849 |
| 788 | Ga0495603_0587554 | 3300046455 | Bacteria | 637 |
| 789 | Ga0495603_0587564 | 3300046455 | Bacteria | 637 |
| 790 | Ga0495590_0000186 | 3300046457 | Bacteria | 35464 |
| 791 | Ga0495590_0000538 | 3300046457 | Bacteria | 18178 |
| 792 | Ga0495590_0006291 | 3300046457 | Bacteria | 4646 |
| 793 | Ga0495591_000149 | 3300046458 | Bacteria | 74051 |
| 794 | Ga0495591_013030 | 3300046458 | Bacteria | 3064 |
| 795 | Ga0495629_0019066 | 3300046459 | Bacteria | 4905 |
| 796 | Ga0495629_0090904 | 3300046459 | Bacteria | 2130 |
| 797 | Ga0495629_0373516 | 3300046459 | Bacteria | 971 |
| 798 | Ga0495629_0377036 | 3300046459 | Bacteria | 965 |
| 799 | Ga0495629_0409631 | 3300046459 | Unclassified | 921 |
| 800 | Ga0495629_0767210 | 3300046459 | Bacteria | 637 |
| 801 | Ga0495638_0009109 | 3300046460 | Bacteria | 6988 |
| 802 | Ga0495638_0137305 | 3300046460 | Bacteria | 1430 |
| 803 | Ga0495638_0309513 | 3300046460 | Bacteria | 848 |
| 804 | Ga0495651_0048106 | 3300046462 | Bacteria | 3294 |
| 805 | Ga0495651_0473713 | 3300046462 | Bacteria | 805 |
| 806 | Ga0495653_0047322 | 3300046463 | Bacteria | 3327 |
| 807 | Ga0495653_0121713 | 3300046463 | Unclassified | 1859 |
| 808 | Ga0495653_0133827 | 3300046463 | Bacteria | 1751 |
| 809 | Ga0495650_0000499 | 3300046471 | Bacteria | 59360 |
| 810 | Ga0495650_0000666 | 3300046471 | Bacteria | 44724 |
| 811 | Ga0495650_0005914 | 3300046471 | Bacteria | 7773 |
| 812 | Ga0495650_0029067 | 3300046471 | Bacteria | 2525 |
| 813 | Ga0495650_0195072 | 3300046471 | Bacteria | 706 |
| 814 | Ga0495580_0010068 | 3300046472 | Bacteria | 7388 |
| 815 | Ga0495580_0212768 | 3300046472 | Bacteria | 1330 |
| 816 | Ga0495580_0238257 | 3300046472 | Bacteria | 1248 |
| 817 | Ga0495580_0259921 | 3300046472 | Bacteria | 1187 |
| 818 | Ga0495580_0364301 | 3300046472 | Bacteria | 978 |
| 819 | Ga0495580_0371736 | 3300046472 | Bacteria | 966 |
| 820 | Ga0495582_0017109 | 3300046473 | Bacteria | 3968 |
| 821 | Ga0495582_0035632 | 3300046473 | Bacteria | 2737 |
| 822 | Ga0495582_0112802 | 3300046473 | Bacteria | 1527 |
| 823 | Ga0495605_0000317 | 3300046474 | Bacteria | 50604 |
| 824 | Ga0495605_0000351 | 3300046474 | Bacteria | 44529 |
| 825 | Ga0495605_0003626 | 3300046474 | Bacteria | 9160 |
| 826 | Ga0495605_0008785 | 3300046474 | Bacteria | 5701 |
| 827 | Ga0495605_0017514 | 3300046474 | Bacteria | 3853 |
| 828 | Ga0495605_0033194 | 3300046474 | Bacteria | 2622 |
| 829 | Ga0495605_0040894 | 3300046474 | Bacteria | 2311 |
| 830 | Ga0495605_0054808 | 3300046474 | Bacteria | 1929 |
| 831 | Ga0495605_0055543 | 3300046474 | Bacteria | 1913 |
| 832 | Ga0495605_0114338 | 3300046474 | Bacteria | 1228 |
| 833 | Ga0495639_0039448 | 3300046475 | Bacteria | 2123 |
| 834 | Ga0495639_0264113 | 3300046475 | Bacteria | 853 |
| 835 | Ga0495662_0678381 | 3300046476 | Bacteria | 503 |
| 836 | Ga0495664_0001723 | 3300046477 | Bacteria | 11632 |
| 837 | Ga0495664_0444856 | 3300046477 | Bacteria | 776 |
| 838 | Ga0495664_0606109 | 3300046477 | Bacteria | 651 |
| 839 | Ga0495584_0000413 | 3300046491 | Bacteria | 29405 |
| 840 | Ga0495584_0000642 | 3300046491 | Bacteria | 23292 |
| 841 | Ga0495584_0000875 | 3300046491 | Bacteria | 19432 |
| 842 | Ga0495584_0002667 | 3300046491 | Bacteria | 10048 |
| 843 | Ga0495584_0010340 | 3300046491 | Bacteria | 4797 |
| 844 | Ga0495584_0012542 | 3300046491 | Bacteria | 4326 |
| 845 | Ga0495584_0013009 | 3300046491 | Bacteria | 4246 |
| 846 | Ga0495584_0027897 | 3300046491 | Bacteria | 2860 |
| 847 | Ga0495584_0029248 | 3300046491 | Bacteria | 2792 |
| 848 | Ga0495584_0029393 | 3300046491 | Bacteria | 2784 |
| 849 | Ga0495584_0046724 | 3300046491 | Bacteria | 2184 |
| 850 | Ga0495584_0076889 | 3300046491 | Bacteria | 1678 |
| 851 | Ga0495584_0087146 | 3300046491 | Bacteria | 1573 |
| 852 | Ga0495584_0088426 | 3300046491 | Bacteria | 1562 |
| 853 | Ga0495584_0093697 | 3300046491 | Bacteria | 1515 |
| 854 | Ga0495584_0119517 | 3300046491 | Bacteria | 1334 |
| 855 | Ga0495584_0151355 | 3300046491 | Bacteria | 1179 |
| 856 | Ga0495584_0192953 | 3300046491 | Bacteria | 1035 |
| 857 | Ga0495584_0389238 | 3300046491 | Bacteria | 708 |
| 858 | Ga0495585_0000148 | 3300046492 | Bacteria | 76376 |
| 859 | Ga0495585_0000500 | 3300046492 | Bacteria | 37095 |
| 860 | Ga0495585_0003434 | 3300046492 | Bacteria | 10705 |
| 861 | Ga0495585_0003975 | 3300046492 | Bacteria | 9757 |
| 862 | Ga0495585_0004965 | 3300046492 | Bacteria | 8506 |
| 863 | Ga0495585_0010663 | 3300046492 | Bacteria | 5460 |
| 864 | Ga0495585_0015683 | 3300046492 | Bacteria | 4400 |
| 865 | Ga0495585_0021337 | 3300046492 | Bacteria | 3719 |
| 866 | Ga0495585_0051903 | 3300046492 | Bacteria | 2271 |
| 867 | Ga0495585_0158739 | 3300046492 | Bacteria | 1174 |
| 868 | Ga0495594_0005043 | 3300046499 | Bacteria | 6796 |
| 869 | Ga0495594_0009434 | 3300046499 | Bacteria | 5039 |
| 870 | Ga0495594_0024113 | 3300046499 | Bacteria | 3265 |
| 871 | Ga0495594_0029417 | 3300046499 | Bacteria | 2968 |
| 872 | Ga0495594_0103591 | 3300046499 | Bacteria | 1601 |
| 873 | Ga0495596_0001037 | 3300046500 | Bacteria | 16509 |
| 874 | Ga0495596_0002079 | 3300046500 | Bacteria | 10979 |
| 875 | Ga0495596_0002643 | 3300046500 | Bacteria | 9485 |
| 876 | Ga0495596_0002945 | 3300046500 | Bacteria | 8834 |
| 877 | Ga0495596_0006916 | 3300046500 | Bacteria | 5168 |
| 878 | Ga0495596_0023774 | 3300046500 | Bacteria | 2485 |
| 879 | Ga0495596_0035603 | 3300046500 | Bacteria | 1973 |
| 880 | Ga0495596_0050451 | 3300046500 | Bacteria | 1630 |
| 881 | Ga0495596_0288781 | 3300046500 | Bacteria | 637 |
| 882 | Ga0495607_0000409 | 3300046501 | Bacteria | 43547 |
| 883 | Ga0495607_0000558 | 3300046501 | Bacteria | 36357 |
| 884 | Ga0495607_0000899 | 3300046501 | Bacteria | 27679 |
| 885 | Ga0495607_0002604 | 3300046501 | Bacteria | 14508 |
| 886 | Ga0495607_0006007 | 3300046501 | Bacteria | 8611 |
| 887 | Ga0495607_0010344 | 3300046501 | Bacteria | 6276 |
| 888 | Ga0495607_0010963 | 3300046501 | Bacteria | 6062 |
| 889 | Ga0495607_0010968 | 3300046501 | Bacteria | 6060 |
| 890 | Ga0495607_0019907 | 3300046501 | Bacteria | 4252 |
| 891 | Ga0495607_0115168 | 3300046501 | Bacteria | 1419 |
| 892 | Ga0495607_0367984 | 3300046501 | Bacteria | 660 |
| 893 | Ga0495607_0508411 | 3300046501 | Bacteria | 533 |
| 894 | Ga0495583_0000590 | 3300046506 | Bacteria | 49812 |
| 895 | Ga0495583_0000856 | 3300046506 | Bacteria | 37034 |
| 896 | Ga0495583_0001490 | 3300046506 | Bacteria | 23383 |
| 897 | Ga0495583_0007409 | 3300046506 | Bacteria | 6902 |
| 898 | Ga0495583_0013563 | 3300046506 | Bacteria | 4538 |
| 899 | Ga0495583_0014742 | 3300046506 | Bacteria | 4293 |
| 900 | Ga0495583_0022669 | 3300046506 | Bacteria | 3197 |
| 901 | Ga0495583_0044197 | 3300046506 | Bacteria | 2069 |
| 902 | Ga0495583_0079968 | 3300046506 | Bacteria | 1421 |
| 903 | Ga0495606_0002227 | 3300046507 | Bacteria | 23133 |
| 904 | Ga0495606_0004441 | 3300046507 | Bacteria | 14017 |
| 905 | Ga0495606_0011116 | 3300046507 | Bacteria | 7380 |
| 906 | Ga0495606_0012532 | 3300046507 | Bacteria | 6791 |
| 907 | Ga0495606_0042722 | 3300046507 | Bacteria | 3029 |
| 908 | Ga0495606_0170705 | 3300046507 | Bacteria | 1262 |
| 909 | Ga0495608_0036509 | 3300046511 | Bacteria | 3308 |
| 910 | Ga0495610_0000555 | 3300046512 | Bacteria | 37362 |
| 911 | Ga0495616_0000052 | 3300046513 | Bacteria | 105258 |
| 912 | Ga0495616_0001914 | 3300046513 | Bacteria | 14016 |
| 913 | Ga0495616_0003379 | 3300046513 | Bacteria | 10233 |
| 914 | Ga0495616_0006221 | 3300046513 | Bacteria | 7255 |
| 915 | Ga0495616_0010286 | 3300046513 | Bacteria | 5422 |
| 916 | Ga0495616_0011821 | 3300046513 | Bacteria | 4980 |
| 917 | Ga0495616_0015289 | 3300046513 | Bacteria | 4268 |
| 918 | Ga0495616_0042250 | 3300046513 | Bacteria | 2321 |
| 919 | Ga0495616_0074785 | 3300046513 | Bacteria | 1631 |
| 920 | Ga0495616_0075075 | 3300046513 | Bacteria | 1627 |
| 921 | Ga0495616_0174567 | 3300046513 | Bacteria | 959 |
| 922 | Ga0495616_0261990 | 3300046513 | Bacteria | 739 |
| 923 | Ga0495616_0377891 | 3300046513 | Bacteria | 586 |
| 924 | Ga0495618_0413609 | 3300046514 | Bacteria | 823 |
| 925 | Ga0495628_0063065 | 3300046516 | Bacteria | 2904 |
| 926 | Ga0495630_0046294 | 3300046517 | Bacteria | 3251 |
| 927 | Ga0495630_0948879 | 3300046517 | Bacteria | 654 |
| 928 | Ga0495631_0003928 | 3300046518 | Bacteria | 8030 |
| 929 | Ga0495631_0004117 | 3300046518 | Bacteria | 7805 |
| 930 | Ga0495631_0004219 | 3300046518 | Bacteria | 7686 |
| 931 | Ga0495631_0007135 | 3300046518 | Bacteria | 5710 |
| 932 | Ga0495631_0014570 | 3300046518 | Bacteria | 3789 |
| 933 | Ga0495631_0016096 | 3300046518 | Bacteria | 3573 |
| 934 | Ga0495631_0021100 | 3300046518 | Bacteria | 3035 |
| 935 | Ga0495631_0049397 | 3300046518 | Bacteria | 1841 |
| 936 | Ga0495631_0094953 | 3300046518 | Bacteria | 1284 |
| 937 | Ga0495631_0260011 | 3300046518 | Bacteria | 739 |
| 938 | Ga0495632_0001106 | 3300046519 | Bacteria | 23102 |
| 939 | Ga0495632_0005873 | 3300046519 | Bacteria | 8016 |
| 940 | Ga0495632_0007321 | 3300046519 | Bacteria | 6952 |
| 941 | Ga0495632_0011776 | 3300046519 | Bacteria | 5090 |
| 942 | Ga0495632_0024796 | 3300046519 | Bacteria | 3180 |
| 943 | Ga0495637_0000014 | 3300046520 | Bacteria | 228956 |
| 944 | Ga0495637_0008808 | 3300046520 | Bacteria | 4941 |
| 945 | Ga0495637_0021157 | 3300046520 | Bacteria | 2984 |
| 946 | Ga0495643_0000079 | 3300046522 | Bacteria | 162735 |
| 947 | Ga0495643_0000569 | 3300046522 | Bacteria | 45560 |
| 948 | Ga0495643_0000966 | 3300046522 | Bacteria | 29456 |
| 949 | Ga0495643_0006666 | 3300046522 | Bacteria | 7568 |
| 950 | Ga0495643_0009289 | 3300046522 | Bacteria | 6123 |
| 951 | Ga0495643_0010544 | 3300046522 | Bacteria | 5682 |
| 952 | Ga0495643_0037601 | 3300046522 | Bacteria | 2654 |
| 953 | Ga0495643_0062438 | 3300046522 | Bacteria | 1972 |
| 954 | Ga0495643_0138436 | 3300046522 | Bacteria | 1216 |
| 955 | Ga0495643_0284444 | 3300046522 | Bacteria | 759 |
| 956 | Ga0495643_0346991 | 3300046522 | Bacteria | 665 |
| 957 | Ga0495644_0000343 | 3300046523 | Bacteria | 21147 |
| 958 | Ga0495644_0003670 | 3300046523 | Bacteria | 6045 |
| 959 | Ga0495644_0013674 | 3300046523 | Bacteria | 3112 |
| 960 | Ga0495644_0022045 | 3300046523 | Bacteria | 2428 |
| 961 | Ga0495644_0025467 | 3300046523 | Bacteria | 2245 |
| 962 | Ga0495644_0056819 | 3300046523 | Bacteria | 1470 |
| 963 | Ga0495644_0114482 | 3300046523 | Bacteria | 1024 |
| 964 | Ga0495648_0000117 | 3300046524 | Bacteria | 97341 |
| 965 | Ga0495648_0001357 | 3300046524 | Bacteria | 24183 |
| 966 | Ga0495648_0004461 | 3300046524 | Bacteria | 11954 |
| 967 | Ga0495648_0006377 | 3300046524 | Bacteria | 9642 |
| 968 | Ga0495648_0037677 | 3300046524 | Bacteria | 3103 |
| 969 | Ga0495663_0002287 | 3300046525 | Bacteria | 5804 |
| 970 | Ga0495663_0004095 | 3300046525 | Bacteria | 4129 |
| 971 | Ga0495663_0006624 | 3300046525 | Bacteria | 3196 |
| 972 | Ga0495663_0018299 | 3300046525 | Bacteria | 1995 |
| 973 | Ga0495666_0000105 | 3300046526 | Bacteria | 34314 |
| 974 | Ga0495666_0028590 | 3300046526 | Bacteria | 2743 |
| 975 | Ga0495666_0101215 | 3300046526 | Bacteria | 1357 |
| 976 | Ga0495642_0000716 | 3300046528 | Bacteria | 16513 |
| 977 | Ga0495642_0002469 | 3300046528 | Bacteria | 7518 |
| 978 | Ga0495642_0005378 | 3300046528 | Bacteria | 4912 |
| 979 | Ga0495642_0093700 | 3300046528 | Bacteria | 1273 |
| 980 | Ga0495642_0098491 | 3300046528 | Bacteria | 1243 |
| 981 | Ga0495642_0109076 | 3300046528 | Bacteria | 1182 |
| 982 | Ga0495642_0131698 | 3300046528 | Bacteria | 1076 |
| 983 | Ga0495652_0006184 | 3300046529 | Bacteria | 11170 |
| 984 | Ga0495652_0147524 | 3300046529 | Bacteria | 1842 |
| 985 | Ga0495654_0005316 | 3300046530 | Bacteria | 7507 |
| 986 | Ga0495654_0013571 | 3300046530 | Bacteria | 4358 |
| 987 | Ga0495654_0059332 | 3300046530 | Bacteria | 1843 |
| 988 | Ga0495654_0078627 | 3300046530 | Bacteria | 1550 |
| 989 | Ga0495665_0003288 | 3300046531 | Bacteria | 8756 |
| 990 | Ga0495665_0004480 | 3300046531 | Bacteria | 7537 |
| 991 | Ga0495665_0052457 | 3300046531 | Bacteria | 2159 |
| 992 | Ga0495665_0093842 | 3300046531 | Bacteria | 1577 |
| 993 | Ga0495665_0172907 | 3300046531 | Bacteria | 1124 |
| 994 | Ga0495640_0009203 | 3300046533 | Bacteria | 7705 |
| 995 | Ga0495640_0220259 | 3300046533 | Bacteria | 1197 |
| 996 | Ga0495640_0323356 | 3300046533 | Unclassified | 955 |
| 997 | Ga0495640_0906700 | 3300046533 | Bacteria | 522 |
| 998 | Ga0495586_0005523 | 3300046535 | Bacteria | 6758 |
| 999 | Ga0495586_0007775 | 3300046535 | Bacteria | 5716 |
| 1000 | Ga0495586_0255862 | 3300046535 | Bacteria | 999 |
| 1001 | Ga0495587_0009016 | 3300046536 | Bacteria | 6404 |
| 1002 | Ga0495587_0054464 | 3300046536 | Bacteria | 2357 |
| 1003 | Ga0495587_0468215 | 3300046536 | Bacteria | 697 |
| 1004 | Ga0495598_0211522 | 3300046537 | Bacteria | 704 |
| 1005 | Ga0495598_0239456 | 3300046537 | Bacteria | 668 |
| 1006 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 1007 | Ga0495609_0001458 | 3300046538 | Bacteria | 15690 |
| 1008 | Ga0495609_0001649 | 3300046538 | Bacteria | 14549 |
| 1009 | Ga0495609_0001938 | 3300046538 | Bacteria | 13171 |
| 1010 | Ga0495609_0002982 | 3300046538 | Bacteria | 10002 |
| 1011 | Ga0495609_0048464 | 3300046538 | Bacteria | 1898 |
| 1012 | Ga0495609_0134826 | 3300046538 | Bacteria | 1056 |
| 1013 | Ga0495609_0138102 | 3300046538 | Bacteria | 1041 |
| 1014 | Ga0495609_0155752 | 3300046538 | Bacteria | 970 |
| 1015 | Ga0495621_0047082 | 3300046539 | Bacteria | 1532 |
| 1016 | Ga0495621_0153539 | 3300046539 | Bacteria | 907 |
| 1017 | Ga0495621_0169521 | 3300046539 | Bacteria | 867 |
| 1018 | Ga0495621_0525679 | 3300046539 | Bacteria | 512 |
| 1019 | Ga0495597_0000315 | 3300046542 | Bacteria | 43611 |
| 1020 | Ga0495597_0000369 | 3300046542 | Bacteria | 39539 |
| 1021 | Ga0495597_0001487 | 3300046542 | Bacteria | 16767 |
| 1022 | Ga0495597_0001633 | 3300046542 | Bacteria | 15702 |
| 1023 | Ga0495597_0002233 | 3300046542 | Bacteria | 12649 |
| 1024 | Ga0495597_0002969 | 3300046542 | Bacteria | 10278 |
| 1025 | Ga0495597_0029514 | 3300046542 | Bacteria | 2503 |
| 1026 | Ga0495597_0054524 | 3300046542 | Bacteria | 1755 |
| 1027 | Ga0495597_0131597 | 3300046542 | Bacteria | 1037 |
| 1028 | Ga0495597_0157791 | 3300046542 | Bacteria | 927 |
| 1029 | Ga0495597_0205346 | 3300046542 | Bacteria | 788 |
| 1030 | Ga0495597_0429416 | 3300046542 | Bacteria | 500 |
| 1031 | Ga0495645_0039341 | 3300046543 | Bacteria | 3449 |
| 1032 | Ga0495645_0041323 | 3300046543 | Bacteria | 3363 |
| 1033 | Ga0495645_0422672 | 3300046543 | Bacteria | 845 |
| 1034 | Ga0495622_0194110 | 3300046557 | Bacteria | 906 |
| 1035 | Ga0495633_0001752 | 3300046558 | Bacteria | 16133 |
| 1036 | Ga0495633_0003558 | 3300046558 | Bacteria | 10307 |
| 1037 | Ga0495633_0005489 | 3300046558 | Bacteria | 7723 |
| 1038 | Ga0495633_0011443 | 3300046558 | Bacteria | 4784 |
| 1039 | Ga0495633_0042182 | 3300046558 | Bacteria | 2168 |
| 1040 | Ga0495633_0100659 | 3300046558 | Bacteria | 1341 |
| 1041 | Ga0495633_0128894 | 3300046558 | Bacteria | 1170 |
| 1042 | Ga0495633_0577675 | 3300046558 | Bacteria | 506 |
| 1043 | Ga0495667_0158011 | 3300046559 | Bacteria | 1458 |
| 1044 | Ga0495667_0206325 | 3300046559 | Bacteria | 1257 |
| 1045 | Ga0495667_0377060 | 3300046559 | Bacteria | 895 |
| 1046 | Ga0495656_0001105 | 3300046615 | Bacteria | 8760 |
| 1047 | Ga0495656_0004033 | 3300046615 | Bacteria | 4993 |
| 1048 | Ga0495656_0011557 | 3300046615 | Bacteria | 3242 |
| 1049 | Ga0495656_0037732 | 3300046615 | Bacteria | 1998 |
| 1050 | Ga0495656_0170437 | 3300046615 | Bacteria | 1064 |
| 1051 | Ga0495656_0303892 | 3300046615 | Bacteria | 818 |
| 1052 | Ga0495656_0364352 | 3300046615 | Bacteria | 751 |
| 1053 | Ga0495656_0388561 | 3300046615 | Bacteria | 728 |
| 1054 | Ga0495656_0649248 | 3300046615 | Bacteria | 566 |
| 1055 | Ga0495668_0001207 | 3300046616 | Bacteria | 26142 |
| 1056 | Ga0495668_0005271 | 3300046616 | Bacteria | 8844 |
| 1057 | Ga0495668_0018322 | 3300046616 | Bacteria | 4045 |
| 1058 | Ga0495668_0067916 | 3300046616 | Bacteria | 1961 |
| 1059 | Ga0495668_0086604 | 3300046616 | Bacteria | 1718 |
| 1060 | Ga0495668_0164494 | 3300046616 | Bacteria | 1215 |
| 1061 | Ga0495634_0007567 | 3300046642 | Bacteria | 8143 |
| 1062 | Ga0495611_0003145 | 3300046648 | Bacteria | 7318 |
| 1063 | Ga0495611_0005991 | 3300046648 | Bacteria | 5186 |
| 1064 | Ga0495611_0012887 | 3300046648 | Bacteria | 3553 |
| 1065 | Ga0495611_0024143 | 3300046648 | Bacteria | 2643 |
| 1066 | Ga0495611_0038803 | 3300046648 | Bacteria | 2119 |
| 1067 | Ga0495611_0352213 | 3300046648 | Bacteria | 675 |
| 1068 | Ga0495625_0008448 | 3300046660 | Bacteria | 8788 |
| 1069 | Ga0495625_0030164 | 3300046660 | Bacteria | 4049 |
| 1070 | Ga0495625_0074545 | 3300046660 | Bacteria | 2377 |
| 1071 | Ga0495625_0204564 | 3300046660 | Bacteria | 1301 |
| 1072 | Ga0495625_0225021 | 3300046660 | Bacteria | 1227 |
| 1073 | Ga0495635_0002078 | 3300046663 | Bacteria | 13585 |
| 1074 | Ga0495635_0067519 | 3300046663 | Bacteria | 2453 |
| 1075 | Ga0495635_0189678 | 3300046663 | Bacteria | 1396 |
| 1076 | Ga0495635_0617384 | 3300046663 | Bacteria | 707 |
| 1077 | Ga0495661_0000950 | 3300046665 | Bacteria | 26304 |
| 1078 | Ga0495661_0001346 | 3300046665 | Bacteria | 20826 |
| 1079 | Ga0495661_0002468 | 3300046665 | Bacteria | 14233 |
| 1080 | Ga0495661_0003746 | 3300046665 | Bacteria | 11128 |
| 1081 | Ga0495661_0004402 | 3300046665 | Bacteria | 10180 |
| 1082 | Ga0495661_0006222 | 3300046665 | Bacteria | 8394 |
| 1083 | Ga0495661_0008157 | 3300046665 | Bacteria | 7261 |
| 1084 | Ga0495661_0010000 | 3300046665 | Bacteria | 6486 |
| 1085 | Ga0495661_0012582 | 3300046665 | Bacteria | 5711 |
| 1086 | Ga0495661_0021461 | 3300046665 | Bacteria | 4210 |
| 1087 | Ga0495661_0037402 | 3300046665 | Bacteria | 3030 |
| 1088 | Ga0495661_0058144 | 3300046665 | Bacteria | 2305 |
| 1089 | Ga0495661_0100637 | 3300046665 | Bacteria | 1627 |
| 1090 | Ga0495661_0117116 | 3300046665 | Bacteria | 1476 |
| 1091 | Ga0495661_0118233 | 3300046665 | Bacteria | 1467 |
| 1092 | Ga0495661_0149104 | 3300046665 | Bacteria | 1265 |
| 1093 | Ga0495661_0178653 | 3300046665 | Bacteria | 1126 |
| 1094 | Ga0495661_0326186 | 3300046665 | Bacteria | 762 |
| 1095 | Ga0495661_0403427 | 3300046665 | Bacteria | 664 |
| 1096 | Ga0495588_0000248 | 3300046674 | Bacteria | 45277 |
| 1097 | Ga0495588_0003529 | 3300046674 | Bacteria | 6822 |
| 1098 | Ga0495588_0009619 | 3300046674 | Bacteria | 4474 |
| 1099 | Ga0495588_0058560 | 3300046674 | Bacteria | 1991 |
| 1100 | Ga0495588_0067437 | 3300046674 | Bacteria | 1857 |
| 1101 | Ga0495588_0121539 | 3300046674 | Bacteria | 1376 |
| 1102 | Ga0495657_0639337 | 3300046675 | Bacteria | 614 |
| 1103 | Ga0495599_0014270 | 3300046678 | Bacteria | 4919 |
| 1104 | Ga0495599_0208901 | 3300046678 | Bacteria | 1198 |
| 1105 | Ga0495623_0002488 | 3300046679 | Bacteria | 12217 |
| 1106 | Ga0495623_0017205 | 3300046679 | Bacteria | 4670 |
| 1107 | Ga0495623_0073006 | 3300046679 | Bacteria | 2133 |
| 1108 | Ga0495623_0273312 | 3300046679 | Bacteria | 943 |
| 1109 | Ga0495623_0654775 | 3300046679 | Bacteria | 541 |
| 1110 | Ga0495646_0023334 | 3300046680 | Bacteria | 3896 |
| 1111 | Ga0495647_0000233 | 3300046681 | Bacteria | 15143 |
| 1112 | Ga0495658_0043733 | 3300046683 | Bacteria | 2507 |
| 1113 | Ga0495658_0153852 | 3300046683 | Bacteria | 1414 |
| 1114 | Ga0495669_0000228 | 3300046684 | Bacteria | 33234 |
| 1115 | Ga0495669_0000859 | 3300046684 | Bacteria | 12862 |
| 1116 | Ga0495669_0001640 | 3300046684 | Bacteria | 9200 |
| 1117 | Ga0495669_0009038 | 3300046684 | Bacteria | 4199 |
| 1118 | Ga0495669_0044475 | 3300046684 | Bacteria | 1978 |
| 1119 | Ga0495669_0050355 | 3300046684 | Bacteria | 1867 |
| 1120 | Ga0495669_0081242 | 3300046684 | Bacteria | 1488 |
| 1121 | Ga0495613_0034223 | 3300046689 | Bacteria | 3775 |
| 1122 | Ga0495613_0105051 | 3300046689 | Bacteria | 2039 |
| 1123 | Ga0495613_0488989 | 3300046689 | Bacteria | 830 |
| 1124 | Ga0495670_0000237 | 3300046691 | Bacteria | 25310 |
| 1125 | Ga0495670_0002403 | 3300046691 | Bacteria | 9233 |
| 1126 | Ga0495670_0005782 | 3300046691 | Bacteria | 6061 |
| 1127 | Ga0495670_0017160 | 3300046691 | Bacteria | 3561 |
| 1128 | Ga0495670_0019739 | 3300046691 | Bacteria | 3321 |
| 1129 | Ga0495670_0381426 | 3300046691 | Bacteria | 760 |
| 1130 | Ga0495670_0485398 | 3300046691 | Bacteria | 670 |
| 1131 | Ga0495671_0002737 | 3300046692 | Bacteria | 11049 |
| 1132 | Ga0495671_0004717 | 3300046692 | Bacteria | 8057 |
| 1133 | Ga0495671_0005286 | 3300046692 | Bacteria | 7577 |
| 1134 | Ga0495671_0157001 | 3300046692 | Bacteria | 1107 |
| 1135 | Ga0495671_0644246 | 3300046692 | Bacteria | 503 |
| 1136 | Ga0495649_0003105 | 3300046694 | Bacteria | 11370 |
| 1137 | Ga0495649_0005628 | 3300046694 | Bacteria | 7919 |
| 1138 | Ga0495649_0013683 | 3300046694 | Bacteria | 4676 |
| 1139 | Ga0495649_0049656 | 3300046694 | Bacteria | 2278 |
| 1140 | Ga0495649_0054436 | 3300046694 | Bacteria | 2164 |
| 1141 | Ga0495649_0103965 | 3300046694 | Bacteria | 1508 |
| 1142 | Ga0495649_0242534 | 3300046694 | Bacteria | 928 |
| 1143 | Ga0495649_0330477 | 3300046694 | Bacteria | 772 |
| 1144 | Ga0495649_0372416 | 3300046694 | Bacteria | 719 |
| 1145 | Ga0495589_0000113 | 3300046794 | Bacteria | 76949 |
| 1146 | Ga0495589_0000178 | 3300046794 | Bacteria | 56371 |
| 1147 | Ga0495589_0000225 | 3300046794 | Bacteria | 48078 |
| 1148 | Ga0495589_0001893 | 3300046794 | Bacteria | 11861 |
| 1149 | Ga0495589_0014360 | 3300046794 | Bacteria | 4080 |
| 1150 | Ga0495589_0034468 | 3300046794 | Bacteria | 2541 |
| 1151 | Ga0495589_0117337 | 3300046794 | Bacteria | 1282 |
| 1152 | Ga0495589_0138689 | 3300046794 | Bacteria | 1165 |
| 1153 | Ga0495589_0268108 | 3300046794 | Bacteria | 795 |
| 1154 | Ga0495589_0547608 | 3300046794 | Bacteria | 527 |
| 1155 | Ga0495589_0598773 | 3300046794 | Bacteria | 502 |
| 1156 | Ga0495600_0005904 | 3300046809 | Bacteria | 7406 |
| 1157 | Ga0495600_0099892 | 3300046809 | Bacteria | 1891 |
| 1158 | Ga0495600_0682745 | 3300046809 | Bacteria | 619 |
| 1159 | Ga0495660_0000438 | 3300046810 | Bacteria | 34904 |
| 1160 | Ga0495660_0005112 | 3300046810 | Bacteria | 7882 |
| 1161 | Ga0495660_0034709 | 3300046810 | Bacteria | 2821 |
| 1162 | Ga0495660_0038091 | 3300046810 | Bacteria | 2675 |
| 1163 | Ga0495660_0061568 | 3300046810 | Bacteria | 2013 |
| 1164 | Ga0495660_0071424 | 3300046810 | Bacteria | 1840 |
| 1165 | Ga0495660_0072926 | 3300046810 | Bacteria | 1817 |
| 1166 | Ga0495660_0177336 | 3300046810 | Bacteria | 1033 |
| 1167 | Ga0495660_0374577 | 3300046810 | Bacteria | 628 |
| 1168 | Ga0495604_0011002 | 3300047317 | Bacteria | 7184 |
| 1169 | Ga0495604_0024580 | 3300047317 | Bacteria | 4806 |
| 1170 | Ga0495604_0028211 | 3300047317 | Bacteria | 4465 |
| 1171 | Ga0495604_0034503 | 3300047317 | Bacteria | 4002 |
| 1172 | Ga0495604_0051039 | 3300047317 | Bacteria | 3209 |
| 1173 | Ga0495604_0094873 | 3300047317 | Bacteria | 2205 |
| 1174 | Ga0495636_0033788 | 3300047318 | Bacteria | 2103 |
| 1175 | Ga0495636_0161378 | 3300047318 | Bacteria | 1010 |
| 1176 | Ga0495636_0351316 | 3300047318 | Bacteria | 696 |
| 1177 | Ga0495674_0137727 | 3300047319 | Bacteria | 2053 |
| 1178 | Ga0495674_0146396 | 3300047319 | Bacteria | 1983 |
| 1179 | Ga0495674_0305594 | 3300047319 | Bacteria | 1298 |
| 1180 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 1181 | Ga0495672_0000140 | 3300047320 | Bacteria | 106637 |
| 1182 | Ga0495672_0000471 | 3300047320 | Bacteria | 47689 |
| 1183 | Ga0495672_0000521 | 3300047320 | Bacteria | 43978 |
| 1184 | Ga0495672_0000997 | 3300047320 | Bacteria | 29222 |
| 1185 | Ga0495672_0033283 | 3300047320 | Bacteria | 3194 |
| 1186 | Ga0495672_0040958 | 3300047320 | Bacteria | 2805 |
| 1187 | Ga0495672_0130712 | 3300047320 | Bacteria | 1321 |
| 1188 | Ga0495672_0140029 | 3300047320 | Bacteria | 1264 |
| 1189 | Ga0495672_0186770 | 3300047320 | Bacteria | 1045 |
| 1190 | Ga0495676_0000180 | 3300047321 | Bacteria | 49779 |
| 1191 | Ga0495676_0072447 | 3300047321 | Bacteria | 2645 |
| 1192 | Ga0495676_0303869 | 3300047321 | Bacteria | 1075 |
| 1193 | Ga0495676_0831603 | 3300047321 | Bacteria | 593 |
| 1194 | Ga0495680_0003335 | 3300047322 | Bacteria | 15874 |
| 1195 | Ga0495680_0049898 | 3300047322 | Bacteria | 3275 |
| 1196 | Ga0495680_0169825 | 3300047322 | Bacteria | 1579 |
| 1197 | Ga0495680_0179794 | 3300047322 | Bacteria | 1527 |
| 1198 | Ga0495683_0000242 | 3300047323 | Bacteria | 49547 |
| 1199 | Ga0495683_0001445 | 3300047323 | Bacteria | 15590 |
| 1200 | Ga0495683_0025695 | 3300047323 | Bacteria | 3017 |
| 1201 | Ga0495683_0036376 | 3300047323 | Bacteria | 2499 |
| 1202 | Ga0495683_0072086 | 3300047323 | Bacteria | 1694 |
| 1203 | Ga0495683_0219826 | 3300047323 | Bacteria | 847 |
| 1204 | Ga0495683_0259558 | 3300047323 | Bacteria | 759 |
| 1205 | Ga0495683_0261753 | 3300047323 | Bacteria | 755 |
| 1206 | Ga0495687_000054 | 3300047443 | Bacteria | 194607 |
| 1207 | Ga0495687_001284 | 3300047443 | Bacteria | 23652 |
| 1208 | Ga0495687_002185 | 3300047443 | Bacteria | 16281 |
| 1209 | Ga0495687_002656 | 3300047443 | Bacteria | 13937 |
| 1210 | Ga0495687_003943 | 3300047443 | Bacteria | 10379 |
| 1211 | Ga0495687_014261 | 3300047443 | Bacteria | 4097 |
| 1212 | Ga0495687_022632 | 3300047443 | Bacteria | 3013 |
| 1213 | Ga0495687_030558 | 3300047443 | Bacteria | 2479 |
| 1214 | Ga0495675_0003293 | 3300047444 | Bacteria | 9712 |
| 1215 | Ga0495675_0025019 | 3300047444 | Bacteria | 3808 |
| 1216 | Ga0495675_0045772 | 3300047444 | Bacteria | 2787 |
| 1217 | Ga0495675_0062223 | 3300047444 | Bacteria | 2363 |
| 1218 | Ga0495675_0129201 | 3300047444 | Bacteria | 1571 |
| 1219 | Ga0495675_0168430 | 3300047444 | Unclassified | 1346 |
| 1220 | Ga0495675_0439275 | 3300047444 | Bacteria | 756 |
| 1221 | Ga0495677_0000084 | 3300047445 | Bacteria | 48271 |
| 1222 | Ga0495677_0000723 | 3300047445 | Bacteria | 13329 |
| 1223 | Ga0495677_0001366 | 3300047445 | Bacteria | 9760 |
| 1224 | Ga0495677_0005230 | 3300047445 | Bacteria | 4936 |
| 1225 | Ga0495677_0006688 | 3300047445 | Bacteria | 4341 |
| 1226 | Ga0495677_0013840 | 3300047445 | Bacteria | 2937 |
| 1227 | Ga0495677_0014184 | 3300047445 | Bacteria | 2902 |
| 1228 | Ga0495677_0034073 | 3300047445 | Bacteria | 1857 |
| 1229 | Ga0495677_0064659 | 3300047445 | Bacteria | 1359 |
| 1230 | Ga0495677_0080774 | 3300047445 | Bacteria | 1218 |
| 1231 | Ga0495677_0089770 | 3300047445 | Bacteria | 1157 |
| 1232 | Ga0495677_0135459 | 3300047445 | Bacteria | 944 |
| 1233 | Ga0495677_0266002 | 3300047445 | Bacteria | 672 |
| 1234 | Ga0495679_001674 | 3300047446 | Bacteria | 12320 |
| 1235 | Ga0495679_001847 | 3300047446 | Bacteria | 11452 |
| 1236 | Ga0495679_027729 | 3300047446 | Bacteria | 1864 |
| 1237 | Ga0495679_185390 | 3300047446 | Bacteria | 550 |
| 1238 | Ga0495685_007440 | 3300047447 | Bacteria | 3615 |
| 1239 | Ga0495685_038942 | 3300047447 | Bacteria | 1627 |
| 1240 | Ga0495685_099939 | 3300047447 | Bacteria | 958 |
| 1241 | Ga0495685_106286 | 3300047447 | Bacteria | 925 |
| 1242 | Ga0495673_0018181 | 3300047469 | Bacteria | 3551 |
| 1243 | Ga0495673_0117228 | 3300047469 | Bacteria | 1058 |
| 1244 | Ga0495673_0182490 | 3300047469 | Bacteria | 794 |
| 1245 | Ga0495681_0000840 | 3300047470 | Bacteria | 23654 |
| 1246 | Ga0495681_0002247 | 3300047470 | Bacteria | 13893 |
| 1247 | Ga0495681_0003545 | 3300047470 | Bacteria | 10858 |
| 1248 | Ga0495681_0004805 | 3300047470 | Bacteria | 9155 |
| 1249 | Ga0495681_0023127 | 3300047470 | Bacteria | 3308 |
| 1250 | Ga0495681_0024760 | 3300047470 | Bacteria | 3152 |
| 1251 | Ga0495681_0030058 | 3300047470 | Bacteria | 2772 |
| 1252 | Ga0495681_0285687 | 3300047470 | Bacteria | 642 |
| 1253 | Ga0495684_0592518 | 3300047471 | Bacteria | 749 |
| 1254 | Ga0495684_0725708 | 3300047471 | Bacteria | 656 |
| 1255 | Ga0495684_1065892 | 3300047471 | Bacteria | 509 |
| 1256 | Ga0495686_0000285 | 3300047472 | Bacteria | 88880 |
| 1257 | Ga0495686_0004901 | 3300047472 | Bacteria | 10786 |
| 1258 | Ga0495686_0051766 | 3300047472 | Bacteria | 2576 |
| 1259 | Ga0495686_0057530 | 3300047472 | Bacteria | 2426 |
| 1260 | Ga0495686_0083086 | 3300047472 | Bacteria | 1954 |
| 1261 | Ga0495593_0023218 | 3300047673 | Bacteria | 3449 |
| 1262 | Ga0495593_0265975 | 3300047673 | Bacteria | 858 |
| 1263 | Ga0495602_0015309 | 3300048088 | Bacteria | 7747 |
| 1264 | Ga0495602_0107551 | 3300048088 | Bacteria | 2273 |
| 1265 | Ga0495614_0003105 | 3300048089 | Bacteria | 7396 |
| 1266 | Ga0495614_0406643 | 3300048089 | Bacteria | 640 |
| 1267 | Ga0495615_0068646 | 3300048090 | Bacteria | 951 |
| 1268 | Ga0495626_0000036 | 3300048091 | Bacteria | 180464 |
| 1269 | Ga0495626_0000044 | 3300048091 | Bacteria | 165533 |
| 1270 | Ga0495626_0000629 | 3300048091 | Bacteria | 34299 |
| 1271 | Ga0495626_0001081 | 3300048091 | Bacteria | 23187 |
| 1272 | Ga0495626_0002963 | 3300048091 | Bacteria | 11267 |
| 1273 | Ga0495626_0006613 | 3300048091 | Bacteria | 6571 |
| 1274 | Ga0495626_0017553 | 3300048091 | Bacteria | 3610 |
| 1275 | Ga0495626_0028012 | 3300048091 | Bacteria | 2734 |
| 1276 | Ga0495626_0038454 | 3300048091 | Bacteria | 2268 |
| 1277 | Ga0495626_0042084 | 3300048091 | Bacteria | 2147 |
| 1278 | Ga0495626_0060279 | 3300048091 | Bacteria | 1729 |
| 1279 | Ga0495626_0112058 | 3300048091 | Bacteria | 1180 |
| 1280 | Ga0495626_0112206 | 3300048091 | Bacteria | 1179 |
| 1281 | Ga0495626_0129400 | 3300048091 | Bacteria | 1079 |
| 1282 | Ga0495626_0138925 | 3300048091 | Bacteria | 1031 |
| 1283 | Ga0495626_0301151 | 3300048091 | Bacteria | 633 |
| 1284 | Ga0496100_0001165 | 3300048903 | Bacteria | 12784 |
| 1285 | Ga0496100_0123007 | 3300048903 | Bacteria | 1818 |
| 1286 | Ga0496100_0832291 | 3300048903 | Bacteria | 724 |
| 1287 | Ga0496101_0064188 | 3300048904 | Bacteria | 2674 |
| 1288 | Ga0496101_0122159 | 3300048904 | Bacteria | 1970 |
| 1289 | Ga0496101_0456086 | 3300048904 | Bacteria | 1009 |
| 1290 | Ga0496102_0000422 | 3300048905 | Bacteria | 48884 |
| 1291 | Ga0496102_0004117 | 3300048905 | Bacteria | 12329 |
| 1292 | Ga0496102_0010119 | 3300048905 | Bacteria | 8113 |
| 1293 | Ga0496102_0074965 | 3300048905 | Bacteria | 3110 |
| 1294 | Ga0496102_0128757 | 3300048905 | Bacteria | 2368 |
| 1295 | Ga0496102_0190643 | 3300048905 | Bacteria | 1932 |
| 1296 | Ga0496102_0333326 | 3300048905 | Bacteria | 1429 |
| 1297 | Ga0496102_0881966 | 3300048905 | Bacteria | 816 |
| 1298 | Ga0496102_1433809 | 3300048905 | Bacteria | 609 |
| 1299 | Ga0496104_0022451 | 3300048907 | Bacteria | 5798 |
| 1300 | Ga0496104_0090739 | 3300048907 | Bacteria | 2920 |
| 1301 | Ga0496104_0559640 | 3300048907 | Bacteria | 1054 |
| 1302 | Ga0496104_0927991 | 3300048907 | Bacteria | 775 |
| 1303 | Ga0496105_0078861 | 3300048908 | Bacteria | 2719 |
| 1304 | Ga0496105_0392841 | 3300048908 | Bacteria | 1102 |
| 1305 | Ga0496105_0907311 | 3300048908 | Bacteria | 664 |
| 1306 | Ga0496106_0001957 | 3300048909 | Bacteria | 15478 |
| 1307 | Ga0496106_0072734 | 3300048909 | Bacteria | 2629 |
| 1308 | Ga0496106_0973228 | 3300048909 | Bacteria | 668 |
| 1309 | Ga0496107_0009370 | 3300048910 | Bacteria | 6788 |
| 1310 | Ga0496107_0246498 | 3300048910 | Bacteria | 1329 |
| 1311 | Ga0496107_0497102 | 3300048910 | Bacteria | 905 |
| 1312 | Ga0496108_0012798 | 3300048911 | Bacteria | 6832 |
| 1313 | Ga0496108_0243780 | 3300048911 | Bacteria | 1563 |
| 1314 | Ga0496108_0620621 | 3300048911 | Bacteria | 941 |
| 1315 | Ga0496108_0912411 | 3300048911 | Bacteria | 754 |
| 1316 | Ga0496108_1747674 | 3300048911 | Bacteria | 511 |
| 1317 | Ga0496109_0006063 | 3300048912 | Bacteria | 10156 |
| 1318 | Ga0496109_0028870 | 3300048912 | Bacteria | 4966 |
| 1319 | Ga0496109_0064236 | 3300048912 | Bacteria | 3359 |
| 1320 | Ga0496109_0162874 | 3300048912 | Bacteria | 2090 |
| 1321 | Ga0496109_0167622 | 3300048912 | Bacteria | 2060 |
| 1322 | Ga0496109_0313007 | 3300048912 | Bacteria | 1481 |
| 1323 | Ga0496109_0317221 | 3300048912 | Bacteria | 1471 |
| 1324 | Ga0496110_0000233 | 3300048913 | Bacteria | 35865 |
| 1325 | Ga0496110_0104317 | 3300048913 | Bacteria | 2543 |
| 1326 | Ga0496110_0790936 | 3300048913 | Bacteria | 853 |
| 1327 | Ga0496110_0910842 | 3300048913 | Bacteria | 785 |
| 1328 | Ga0496111_0133604 | 3300048914 | Bacteria | 1837 |
| 1329 | Ga0496111_0152684 | 3300048914 | Bacteria | 1713 |
| 1330 | Ga0496111_0293917 | 3300048914 | Bacteria | 1205 |
| 1331 | Ga0496111_0399718 | 3300048914 | Bacteria | 1015 |
| 1332 | Ga0496111_0951895 | 3300048914 | Bacteria | 617 |
| 1333 | Ga0496112_0187678 | 3300048915 | Bacteria | 2030 |
| 1334 | Ga0496112_0541582 | 3300048915 | Bacteria | 1098 |
| 1335 | Ga0496112_0611479 | 3300048915 | Bacteria | 1021 |
| 1336 | Ga0496112_0770753 | 3300048915 | Bacteria | 887 |
| 1337 | Ga0496112_0816915 | 3300048915 | Bacteria | 857 |
| 1338 | Ga0496113_0008052 | 3300048916 | Bacteria | 6839 |
| 1339 | Ga0496113_0080967 | 3300048916 | Bacteria | 2488 |
| 1340 | Ga0496113_0204380 | 3300048916 | Bacteria | 1570 |
| 1341 | Ga0496113_0387803 | 3300048916 | Bacteria | 1121 |
| 1342 | Ga0496114_0062115 | 3300048917 | Bacteria | 3126 |
| 1343 | Ga0496114_0072365 | 3300048917 | Bacteria | 2899 |
| 1344 | Ga0496114_0115597 | 3300048917 | Bacteria | 2302 |
| 1345 | Ga0496114_0828258 | 3300048917 | Bacteria | 805 |
| 1346 | Ga0496115_0297697 | 3300048918 | Bacteria | 1322 |
| 1347 | Ga0496121_0255560 | 3300048924 | Bacteria | 1213 |
| 1348 | Ga0496122_0001269 | 3300048925 | Bacteria | 42288 |
| 1349 | Ga0496122_0018535 | 3300048925 | Bacteria | 6422 |
| 1350 | Ga0496123_0000780 | 3300048926 | Bacteria | 51494 |
| 1351 | Ga0496123_0003906 | 3300048926 | Bacteria | 16199 |
| 1352 | Ga0496124_0036489 | 3300048927 | Bacteria | 4287 |
| 1353 | Ga0496124_0235880 | 3300048927 | Bacteria | 1364 |
| 1354 | Ga0496124_0282901 | 3300048927 | Bacteria | 1208 |
| 1355 | Ga0496125_0000870 | 3300048928 | Bacteria | 48206 |
| 1356 | Ga0496125_0360110 | 3300048928 | Bacteria | 865 |
| 1357 | Ga0501308_000453 | 3300049128 | Bacteria | 2669 |
| 1358 | Ga0501304_008560 | 3300049160 | Bacteria | 864 |
| 1359 | Ga0495678_000150 | 3300049459 | Bacteria | 84562 |
| 1360 | Ga0495678_000327 | 3300049459 | Bacteria | 50475 |
| 1361 | Ga0495678_000413 | 3300049459 | Bacteria | 43138 |
| 1362 | Ga0495678_008087 | 3300049459 | Bacteria | 5357 |
| 1363 | Ga0495682_0019126 | 3300049460 | Bacteria | 2577 |
| 1364 | Ga0501297_074797 | 3300049520 | Bacteria | 540 |
| 1365 | Ga0501298_119295 | 3300049521 | Bacteria | 620 |
| 1366 | Ga0501031_0761371 | 3300049568 | Bacteria | 621 |
| 1367 | Ga0501033_0259284 | 3300049570 | Bacteria | 1231 |
| 1368 | Ga0501034_0511114 | 3300049571 | Bacteria | 1114 |
| 1369 | Ga0501034_0552216 | 3300049571 | Bacteria | 1061 |
| 1370 | Ga0501037_0165891 | 3300049573 | Bacteria | 1573 |
| 1371 | Ga0501038_0204781 | 3300049574 | Bacteria | 1582 |
| 1372 | Ga0501042_1158471 | 3300049578 | Bacteria | 564 |
| 1373 | Ga0501046_0320910 | 3300049580 | Bacteria | 1129 |
| 1374 | Ga0501047_0198473 | 3300049581 | Bacteria | 1868 |
| 1375 | Ga0501047_0581272 | 3300049581 | Bacteria | 943 |
| 1376 | Ga0501047_0689797 | 3300049581 | Bacteria | 839 |
| 1377 | Ga0501048_0641277 | 3300049582 | Bacteria | 763 |
| 1378 | Ga0501048_1093814 | 3300049582 | Bacteria | 573 |
| 1379 | Ga0501067_0872232 | 3300049583 | Bacteria | 508 |
| 1380 | Ga0501069_0927362 | 3300049585 | Bacteria | 530 |
| 1381 | Ga0501073_1186734 | 3300049589 | Bacteria | 524 |
| 1382 | Ga0501074_0813146 | 3300049590 | Bacteria | 658 |
| 1383 | Ga0501076_0130391 | 3300049592 | Bacteria | 2039 |
| 1384 | Ga0501076_1607252 | 3300049592 | Bacteria | 533 |
| 1385 | Ga0501235_177894 | 3300049669 | Bacteria | 565 |
| 1386 | Ga0501249_025427 | 3300049679 | Bacteria | 1307 |
| 1387 | Ga0501249_113046 | 3300049679 | Bacteria | 658 |
| 1388 | Ga0501079_0230779 | 3300049741 | Bacteria | 1446 |
| 1389 | Ga0501080_0798529 | 3300049742 | Bacteria | 828 |
| 1390 | Ga0501080_1203144 | 3300049742 | Bacteria | 651 |
| 1391 | Ga0501232_030868 | 3300049757 | Bacteria | 744 |
| 1392 | Ga0501035_0006628 | 3300049822 | Bacteria | 10837 |
| 1393 | Ga0501035_0995495 | 3300049822 | Bacteria | 659 |
| 1394 | Ga0501044_0037408 | 3300049823 | Bacteria | 5073 |
| 1395 | Ga0501044_0191265 | 3300049823 | Bacteria | 2009 |
| 1396 | Ga0501044_0283310 | 3300049823 | Bacteria | 1590 |
| 1397 | nmdc:mga03683_76329_c1 | 3300050489 | Bacteria | 1440 |
| 1398 | nmdc:mga03n38_5373_c1 | 3300050490 | Bacteria | 4354 |
| 1399 | nmdc:mga00v17_292411_c1 | 3300050491 | Bacteria | 1058 |
| 1400 | nmdc:mga00v17_676460_c1 | 3300050491 | Bacteria | 663 |
| 1401 | nmdc:mga0yw44_1206841_c1 | 3300050492 | Bacteria | 510 |
| 1402 | nmdc:mga0yw44_254161_c1 | 3300050492 | Bacteria | 1170 |
| 1403 | nmdc:mga0yw44_89847_c1 | 3300050492 | Bacteria | 1939 |
| 1404 | nmdc:mga0k408_100132_c1 | 3300050493 | Bacteria | 1708 |
| 1405 | nmdc:mga0k408_158619_c1 | 3300050493 | Bacteria | 1348 |
| 1406 | nmdc:mga0k408_15900_c1 | 3300050493 | Bacteria | 4167 |
| 1407 | nmdc:mga0k408_1682_c1 | 3300050493 | Bacteria | 11938 |
| 1408 | nmdc:mga0k408_16862_c1 | 3300050493 | Bacteria | 4061 |
| 1409 | nmdc:mga0k408_201322_c1 | 3300050493 | Bacteria | 1189 |
| 1410 | nmdc:mga0k408_45759_c1 | 3300050493 | Bacteria | 2526 |
| 1411 | nmdc:mga0k408_463930_c1 | 3300050493 | Bacteria | 752 |
| 1412 | nmdc:mga0k408_650255_c1 | 3300050493 | Bacteria | 620 |
| 1413 | nmdc:mga06z11_206918_c1 | 3300050494 | Bacteria | 1142 |
| 1414 | nmdc:mga06z11_293909_c1 | 3300050494 | Bacteria | 965 |
| 1415 | nmdc:mga04h51_301457_c1 | 3300050495 | Bacteria | 653 |
| 1416 | nmdc:mga04h51_386840_c1 | 3300050495 | Bacteria | 584 |
| 1417 | nmdc:mga07m45_101201_c1 | 3300050496 | Bacteria | 1654 |
| 1418 | nmdc:mga07m45_1045_c1 | 3300050496 | Bacteria | 12330 |
| 1419 | nmdc:mga07m45_157133_c1 | 3300050496 | Bacteria | 1320 |
| 1420 | nmdc:mga07m45_22889_c1 | 3300050496 | Bacteria | 3413 |
| 1421 | nmdc:mga07m45_54386_c1 | 3300050496 | Bacteria | 2263 |
| 1422 | nmdc:mga05p37_305446_c1 | 3300050507 | Bacteria | 1888 |
| 1423 | nmdc:mga0qj67_388631_c1 | 3300050509 | Bacteria | 1126 |
| 1424 | nmdc:mga08y16_211143_c1 | 3300050511 | Bacteria | 2010 |
| 1425 | nmdc:mga08y16_57458_c1 | 3300050511 | Bacteria | 4066 |
| 1426 | nmdc:mga0n895_103710_c1 | 3300050512 | Bacteria | 2855 |
| 1427 | nmdc:mga0n895_1281284_c1 | 3300050512 | Bacteria | 704 |
| 1428 | nmdc:mga0n895_151356_c1 | 3300050512 | Bacteria | 2351 |
| 1429 | nmdc:mga0n895_432_c1 | 3300050512 | Bacteria | 28136 |
| 1430 | nmdc:mga0rr50_173645_c1 | 3300050513 | Bacteria | 1758 |
| 1431 | nmdc:mga0rr50_61261_c1 | 3300050513 | Bacteria | 2834 |
| 1432 | nmdc:mga0rr50_67511_c1 | 3300050513 | Bacteria | 2716 |
| 1433 | nmdc:mga08x19_142626_c1 | 3300050514 | Bacteria | 1619 |
| 1434 | nmdc:mga08x19_2248_c1 | 3300050514 | Bacteria | 11784 |
| 1435 | nmdc:mga08x19_430068_c1 | 3300050514 | Bacteria | 928 |
| 1436 | nmdc:mga08x19_45268_c1 | 3300050514 | Bacteria | 2812 |
| 1437 | nmdc:mga08x19_487_c1 | 3300050514 | Bacteria | 26435 |
| 1438 | nmdc:mga0a205_27965_c1 | 3300050515 | Bacteria | 3937 |
| 1439 | nmdc:mga0a205_612497_c1 | 3300050515 | Bacteria | 941 |
| 1440 | nmdc:mga0a205_799884_c1 | 3300050515 | Bacteria | 791 |
| 1441 | nmdc:mga0a205_829583_c1 | 3300050515 | Bacteria | 772 |
| 1442 | nmdc:mga0sz30_160192_c1 | 3300050516 | Bacteria | 997 |
| 1443 | nmdc:mga0sz30_261490_c1 | 3300050516 | Bacteria | 771 |
| 1444 | nmdc:mga0sz30_385315_c1 | 3300050516 | Bacteria | 628 |
| 1445 | Ga0495601_0110597 | 3300053077 | Bacteria | 1779 |
| 1446 | Ga0495601_0127073 | 3300053077 | Bacteria | 1659 |
| 1447 | Ga0495601_1079756 | 3300053077 | Bacteria | 503 |
| 1448 | Ga0495612_0039584 | 3300053078 | Bacteria | 1918 |
| 1449 | Ga0495612_0176323 | 3300053078 | Bacteria | 937 |
| 1450 | Ga0495595_0052108 | 3300053084 | Bacteria | 1898 |
| 1451 | Ga0495595_0334568 | 3300053084 | Bacteria | 763 |
| 1452 | Ga0495619_0029087 | 3300053085 | Bacteria | 3568 |
| 1453 | Ga0495619_0141124 | 3300053085 | Unclassified | 1659 |
| 1454 | Ga0500578_0257492 | 3300053086 | Bacteria | 1049 |
| 1455 | Ga0500628_178306 | 3300053129 | Bacteria | 606 |
| 1456 | Ga0500658_0003329 | 3300053134 | Bacteria | 6093 |
| 1457 | Ga0500568_0047444 | 3300053139 | Bacteria | 1701 |
| 1458 | Ga0500633_0177078 | 3300053160 | Bacteria | 800 |
| 1459 | Ga0501084_0493912 | 3300054114 | Bacteria | 1034 |
| 1460 | Ga0590071_065942 | 3300059421 | Bacteria | 889 |
| 1461 | Ga0590075_015049 | 3300059424 | Bacteria | 1896 |
| 1462 | Ga0587084_128763 | 3300059477 | Bacteria | 539 |
| 1463 | Ga0587066_059248 | 3300059490 | Bacteria | 777 |
| 1464 | Ga0587070_013077 | 3300059491 | Bacteria | 1274 |
| 1465 | Ga0587073_0011612 | 3300059492 | Bacteria | 1507 |
| 1466 | Ga0587073_0057516 | 3300059492 | Bacteria | 901 |
| 1467 | Ga0587077_083970 | 3300059493 | Bacteria | 736 |
| 1468 | Ga0587080_007413 | 3300059503 | Bacteria | 1541 |
| 1469 | Ga0587080_086770 | 3300059503 | Bacteria | 651 |
| 1470 | Ga0587080_115170 | 3300059503 | Bacteria | 590 |
| 1471 | Ga0587082_008167 | 3300059504 | Bacteria | 1451 |
| 1472 | Ga0587083_0002695 | 3300059505 | Bacteria | 2250 |
| 1473 | Ga0587083_0022683 | 3300059505 | Bacteria | 1178 |
| 1474 | Ga0587086_055246 | 3300059507 | Bacteria | 649 |
| 1475 | Ga0587088_027587 | 3300059508 | Bacteria | 993 |
| 1476 | Ga0587088_177939 | 3300059508 | Bacteria | 531 |
| 1477 | Ga0587089_050168 | 3300059509 | Bacteria | 668 |
| 1478 | Ga0587090_097530 | 3300059510 | Bacteria | 611 |
| 1479 | Ga0587091_010283 | 3300059511 | Bacteria | 1428 |
| 1480 | Ga0587091_014194 | 3300059511 | Bacteria | 1293 |
| 1481 | Ga0587098_011816 | 3300059604 | Bacteria | 989 |
| 1482 | Ga0587098_043611 | 3300059604 | Bacteria | 660 |
| 1483 | Ga0587098_097312 | 3300059604 | Bacteria | 509 |
| 1484 | Ga0587106_051010 | 3300059605 | Bacteria | 733 |
| 1485 | Ga0587099_009391 | 3300059622 | Bacteria | 960 |
| 1486 | Ga0587101_009356 | 3300059623 | Bacteria | 1207 |
| 1487 | Ga0587101_076736 | 3300059623 | Bacteria | 626 |
| 1488 | Ga0587113_012529 | 3300059625 | Bacteria | 808 |
| 1489 | Ga0587115_110139 | 3300059626 | Bacteria | 520 |
| 1490 | Ga0587128_170952 | 3300059630 | Bacteria | 507 |
| 1491 | Ga0587062_030309 | 3300059639 | Bacteria | 825 |
| 1492 | Ga0587062_107422 | 3300059639 | Bacteria | 550 |
| 1493 | Ga0587067_008287 | 3300059640 | Bacteria | 1515 |
| 1494 | Ga0587068_012974 | 3300059641 | Bacteria | 1279 |
| 1495 | Ga0587069_006057 | 3300059642 | Bacteria | 1438 |
| 1496 | Ga0587076_143311 | 3300059645 | Bacteria | 573 |
| 1497 | Ga0587078_073249 | 3300059646 | Bacteria | 538 |
| 1498 | Ga0587078_081511 | 3300059646 | Bacteria | 519 |
| 1499 | Ga0587079_010086 | 3300059647 | Bacteria | 1488 |
| 1500 | Ga0587102_026987 | 3300059649 | Bacteria | 682 |
| 1501 | Ga0587119_059417 | 3300059658 | Bacteria | 586 |
| 1502 | Ga0587111_0031246 | 3300060346 | Bacteria | 1089 |
| 1503 | Ga0466962_0044798 | 3300061719 | Bacteria | 2116 |
| 1504 | Ga0466962_0669419 | 3300061719 | Bacteria | 531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0557768 | Ga0373931_0557768_399_722 | 107 |
| 2 | 3300005843 | Ga0068860_101683473 | Ga0068860_1016834732 | 121 |
| 3 | 3300028381 | Ga0268264_11569700 | Ga0268264_115697001 | 121 |
| 4 | 3300035242 | Ga0373962_0071634 | Ga0373962_0071634_119_484 | 121 |
| 5 | 3300045051 | Ga0451576_0611557 | Ga0451576_0611557_346_711 | 121 |
| 6 | 3300046491 | Ga0495584_0192953 | Ga0495584_0192953_632_997 | 121 |
| 7 | 3300046525 | Ga0495663_0018299 | Ga0495663_0018299_443_808 | 121 |
| 8 | 3300046684 | Ga0495669_0050355 | Ga0495669_0050355_485_850 | 121 |
| 9 | 3300049574 | Ga0501038_0204781 | Ga0501038_0204781_88_453 | 121 |
| 10 | 3300050507 | nmdc:mga05p37_305446_c1 | nmdc:mga05p37_305446_c1_331_696 | 121 |
| 11 | 3300059658 | Ga0587119_059417 | Ga0587119_059417_97_465 | 121 |
| 12 | 3300006178 | Ga0075367_10731337 | Ga0075367_107313372 | 122 |
| 13 | 3300007265 | Ga0099794_10050309 | Ga0099794_100503093 | 122 |
| 14 | 3300007265 | Ga0099794_10795900 | Ga0099794_107959002 | 122 |
| 15 | 3300009093 | Ga0105240_10775247 | Ga0105240_107752472 | 122 |
| 16 | 3300009098 | Ga0105245_10045639 | Ga0105245_100456394 | 122 |
| 17 | 3300009148 | Ga0105243_10102716 | Ga0105243_101027163 | 122 |
| 18 | 3300009177 | Ga0105248_10016659 | Ga0105248_100166594 | 122 |
| 19 | 3300009177 | Ga0105248_10032211 | Ga0105248_100322117 | 122 |
| 20 | 3300009177 | Ga0105248_10205361 | Ga0105248_102053614 | 122 |
| 21 | 3300009545 | Ga0105237_10948551 | Ga0105237_109485511 | 122 |
| 22 | 3300009545 | Ga0105237_12645292 | Ga0105237_126452921 | 122 |
| 23 | 3300009551 | Ga0105238_10045282 | Ga0105238_100452826 | 122 |
| 24 | 3300009551 | Ga0105238_11617213 | Ga0105238_116172132 | 122 |
| 25 | 3300009553 | Ga0105249_11130627 | Ga0105249_111306272 | 122 |
| 26 | 3300010375 | Ga0105239_10057462 | Ga0105239_100574622 | 122 |
| 27 | 3300012478 | Ga0157328_1016793 | Ga0157328_10167932 | 122 |
| 28 | 3300012482 | Ga0157318_1009564 | Ga0157318_10095641 | 122 |
| 29 | 3300013100 | Ga0157373_10056085 | Ga0157373_100560853 | 122 |
| 30 | 3300013102 | Ga0157371_10044279 | Ga0157371_100442794 | 122 |
| 31 | 3300013104 | Ga0157370_10292270 | Ga0157370_102922702 | 122 |
| 32 | 3300013296 | Ga0157374_10009658 | Ga0157374_100096588 | 122 |
| 33 | 3300013296 | Ga0157374_11846605 | Ga0157374_118466051 | 122 |
| 34 | 3300013306 | Ga0163162_10016188 | Ga0163162_100161882 | 122 |
| 35 | 3300013307 | Ga0157372_10156872 | Ga0157372_101568724 | 122 |
| 36 | 3300013308 | Ga0157375_10375005 | Ga0157375_103750053 | 122 |
| 37 | 3300013308 | Ga0157375_10485292 | Ga0157375_104852924 | 122 |
| 38 | 3300014326 | Ga0157380_10028623 | Ga0157380_100286232 | 122 |
| 39 | 3300014326 | Ga0157380_11027379 | Ga0157380_110273792 | 122 |
| 40 | 3300014968 | Ga0157379_10010369 | Ga0157379_100103692 | 122 |
| 41 | 3300014968 | Ga0157379_10054527 | Ga0157379_100545274 | 122 |
| 42 | 3300014968 | Ga0157379_10072587 | Ga0157379_100725873 | 122 |
| 43 | 3300014969 | Ga0157376_10005027 | Ga0157376_100050273 | 122 |
| 44 | 3300014969 | Ga0157376_12959438 | Ga0157376_129594382 | 122 |
| 45 | 3300025273 | Ga0209673_1014580 | Ga0209673_10145802 | 122 |
| 46 | 3300034816 | Ga0373930_0094068 | Ga0373930_0094068_14_382 | 122 |
| 47 | 3300034817 | Ga0373948_0029739 | Ga0373948_0029739_272_640 | 122 |
| 48 | 3300034819 | Ga0373958_0209027 | Ga0373958_0209027_117_485 | 122 |
| 49 | 3300035084 | Ga0373928_0008445 | Ga0373928_0008445_456_824 | 122 |
| 50 | 3300035114 | Ga0373939_0010456 | Ga0373939_0010456_460_828 | 122 |
| 51 | 3300035242 | Ga0373962_0053205 | Ga0373962_0053205_440_808 | 122 |
| 52 | 3300035691 | Ga0373931_0004895 | Ga0373931_0004895_61_429 | 122 |
| 53 | 3300035691 | Ga0373931_0020515 | Ga0373931_0020515_2490_2858 | 122 |
| 54 | 3300035691 | Ga0373931_0669130 | Ga0373931_0669130_302_670 | 122 |
| 55 | 3300035692 | Ga0373935_0317902 | Ga0373935_0317902_195_563 | 122 |
| 56 | 3300037466 | Ga0395898_0063565 | Ga0395898_0063565_2964_3332 | 122 |
| 57 | 3300039437 | Ga0436365_0322561 | Ga0436365_0322561_109_477 | 122 |
| 58 | 3300039450 | Ga0436363_1219339 | Ga0436363_1219339_2439_2807 | 122 |
| 59 | 3300041451 | Ga0451791_0640864 | Ga0451791_0640864_116_484 | 122 |
| 60 | 3300041460 | Ga0451802_0100909 | Ga0451802_0100909_575_946 | 122 |
| 61 | 3300041498 | Ga0451841_0820842 | Ga0451841_0820842_140_508 | 122 |
| 62 | 3300041512 | Ga0451853_1927380 | Ga0451853_1927380_26_394 | 122 |
| 63 | 3300041999 | Ga0439433_0064245 | Ga0439433_0064245_212_580 | 122 |
| 64 | 3300042007 | Ga0439449_0007009 | Ga0439449_0007009_2825_3193 | 122 |
| 65 | 3300042015 | Ga0439462_0031644 | Ga0439462_0031644_956_1324 | 122 |
| 66 | 3300042157 | Ga0439458_0170571 | Ga0439458_0170571_27_395 | 122 |
| 67 | 3300042876 | Ga0451577_0641176 | Ga0451577_0641176_537_905 | 122 |
| 68 | 3300042993 | Ga0439440_0280101 | Ga0439440_0280101_85_453 | 122 |
| 69 | 3300044712 | Ga0453684_0231499 | Ga0453684_0231499_569_937 | 122 |
| 70 | 3300044712 | Ga0453684_0352917 | Ga0453684_0352917_1087_1455 | 122 |
| 71 | 3300044712 | Ga0453684_0636998 | Ga0453684_0636998_468_836 | 122 |
| 72 | 3300045051 | Ga0451576_0032108 | Ga0451576_0032108_1359_1727 | 122 |
| 73 | 3300045051 | Ga0451576_0125359 | Ga0451576_0125359_563_931 | 122 |
| 74 | 3300045051 | Ga0451576_0151188 | Ga0451576_0151188_1445_1813 | 122 |
| 75 | 3300046454 | Ga0495592_0273776 | Ga0495592_0273776_511_879 | 122 |
| 76 | 3300046459 | Ga0495629_0373516 | Ga0495629_0373516_578_946 | 122 |
| 77 | 3300046460 | Ga0495638_0309513 | Ga0495638_0309513_289_657 | 122 |
| 78 | 3300046471 | Ga0495650_0005914 | Ga0495650_0005914_6581_6961 | 122 |
| 79 | 3300046472 | Ga0495580_0238257 | Ga0495580_0238257_869_1237 | 122 |
| 80 | 3300046472 | Ga0495580_0259921 | Ga0495580_0259921_675_1043 | 122 |
| 81 | 3300046491 | Ga0495584_0000875 | Ga0495584_0000875_5865_6245 | 122 |
| 82 | 3300046533 | Ga0495640_0906700 | Ga0495640_0906700_115_483 | 122 |
| 83 | 3300046539 | Ga0495621_0169521 | Ga0495621_0169521_327_695 | 122 |
| 84 | 3300046543 | Ga0495645_0041323 | Ga0495645_0041323_2197_2565 | 122 |
| 85 | 3300046616 | Ga0495668_0067916 | Ga0495668_0067916_95_475 | 122 |
| 86 | 3300046663 | Ga0495635_0189678 | Ga0495635_0189678_430_798 | 122 |
| 87 | 3300046683 | Ga0495658_0043733 | Ga0495658_0043733_1512_1880 | 122 |
| 88 | 3300046809 | Ga0495600_0682745 | Ga0495600_0682745_113_481 | 122 |
| 89 | 3300047447 | Ga0495685_007440 | Ga0495685_007440_1377_1757 | 122 |
| 90 | 3300047470 | Ga0495681_0285687 | Ga0495681_0285687_136_504 | 122 |
| 91 | 3300047471 | Ga0495684_1065892 | Ga0495684_1065892_90_458 | 122 |
| 92 | 3300047472 | Ga0495686_0004901 | Ga0495686_0004901_7617_7985 | 122 |
| 93 | 3300048903 | Ga0496100_0123007 | Ga0496100_0123007_1411_1779 | 122 |
| 94 | 3300048904 | Ga0496101_0122159 | Ga0496101_0122159_511_879 | 122 |
| 95 | 3300048904 | Ga0496101_0456086 | Ga0496101_0456086_190_570 | 122 |
| 96 | 3300048905 | Ga0496102_0010119 | Ga0496102_0010119_507_875 | 122 |
| 97 | 3300048905 | Ga0496102_0190643 | Ga0496102_0190643_542_922 | 122 |
| 98 | 3300048907 | Ga0496104_0022451 | Ga0496104_0022451_4652_5032 | 122 |
| 99 | 3300048907 | Ga0496104_0090739 | Ga0496104_0090739_35_403 | 122 |
| 100 | 3300048908 | Ga0496105_0392841 | Ga0496105_0392841_641_1009 | 122 |
| 101 | 3300048909 | Ga0496106_0072734 | Ga0496106_0072734_2076_2444 | 122 |
| 102 | 3300048910 | Ga0496107_0009370 | Ga0496107_0009370_523_891 | 122 |
| 103 | 3300048911 | Ga0496108_0012798 | Ga0496108_0012798_2900_3280 | 122 |
| 104 | 3300048911 | Ga0496108_0243780 | Ga0496108_0243780_411_779 | 122 |
| 105 | 3300048912 | Ga0496109_0028870 | Ga0496109_0028870_3972_4340 | 122 |
| 106 | 3300048912 | Ga0496109_0064236 | Ga0496109_0064236_650_1030 | 122 |
| 107 | 3300048914 | Ga0496111_0152684 | Ga0496111_0152684_884_1252 | 122 |
| 108 | 3300048914 | Ga0496111_0293917 | Ga0496111_0293917_746_1126 | 122 |
| 109 | 3300048915 | Ga0496112_0541582 | Ga0496112_0541582_48_416 | 122 |
| 110 | 3300048915 | Ga0496112_0770753 | Ga0496112_0770753_44_424 | 122 |
| 111 | 3300048916 | Ga0496113_0204380 | Ga0496113_0204380_1087_1467 | 122 |
| 112 | 3300048917 | Ga0496114_0062115 | Ga0496114_0062115_666_1034 | 122 |
| 113 | 3300049573 | Ga0501037_0165891 | Ga0501037_0165891_734_1102 | 122 |
| 114 | 3300049581 | Ga0501047_0581272 | Ga0501047_0581272_117_485 | 122 |
| 115 | 3300049582 | Ga0501048_0641277 | Ga0501048_0641277_58_426 | 122 |
| 116 | 3300049679 | Ga0501249_025427 | Ga0501249_025427_115_483 | 122 |
| 117 | 3300049679 | Ga0501249_113046 | Ga0501249_113046_59_427 | 122 |
| 118 | 3300049741 | Ga0501079_0230779 | Ga0501079_0230779_442_822 | 122 |
| 119 | 3300049823 | Ga0501044_0037408 | Ga0501044_0037408_4127_4495 | 122 |
| 120 | 3300049823 | Ga0501044_0283310 | Ga0501044_0283310_976_1344 | 122 |
| 121 | 3300050489 | nmdc:mga03683_76329_c1 | nmdc:mga03683_76329_c1_968_1336 | 122 |
| 122 | 3300050493 | nmdc:mga0k408_100132_c1 | nmdc:mga0k408_100132_c1_983_1351 | 122 |
| 123 | 3300050493 | nmdc:mga0k408_16862_c1 | nmdc:mga0k408_16862_c1_808_1176 | 122 |
| 124 | 3300050493 | nmdc:mga0k408_201322_c1 | nmdc:mga0k408_201322_c1_759_1127 | 122 |
| 125 | 3300050493 | nmdc:mga0k408_463930_c1 | nmdc:mga0k408_463930_c1_86_454 | 122 |
| 126 | 3300050493 | nmdc:mga0k408_650255_c1 | nmdc:mga0k408_650255_c1_113_493 | 122 |
| 127 | 3300050494 | nmdc:mga06z11_206918_c1 | nmdc:mga06z11_206918_c1_396_764 | 122 |
| 128 | 3300050496 | nmdc:mga07m45_22889_c1 | nmdc:mga07m45_22889_c1_838_1206 | 122 |
| 129 | 3300050511 | nmdc:mga08y16_57458_c1 | nmdc:mga08y16_57458_c1_2492_2860 | 122 |
| 130 | 3300050512 | nmdc:mga0n895_103710_c1 | nmdc:mga0n895_103710_c1_251_619 | 122 |
| 131 | 3300050515 | nmdc:mga0a205_612497_c1 | nmdc:mga0a205_612497_c1_449_817 | 122 |
| 132 | 3300053077 | Ga0495601_0127073 | Ga0495601_0127073_44_412 | 122 |
| 133 | 3300053078 | Ga0495612_0039584 | Ga0495612_0039584_672_1040 | 122 |
| 134 | 3300053086 | Ga0500578_0257492 | Ga0500578_0257492_357_725 | 122 |
| 135 | iso_pu_bacteria | 2916178963 | 2916180032 | 122 |
| 136 | 3300005293 | Ga0065715_10761580 | Ga0065715_107615801 | 123 |
| 137 | 3300006038 | Ga0075365_10085227 | Ga0075365_100852271 | 123 |
| 138 | 3300006038 | Ga0075365_10430610 | Ga0075365_104306102 | 123 |
| 139 | 3300006042 | Ga0075368_10561871 | Ga0075368_105618711 | 123 |
| 140 | 3300006195 | Ga0075366_10000574 | Ga0075366_1000057410 | 123 |
| 141 | 3300006195 | Ga0075366_10024978 | Ga0075366_100249784 | 123 |
| 142 | 3300006353 | Ga0075370_10000101 | Ga0075370_1000010110 | 123 |
| 143 | 3300006881 | Ga0068865_100503981 | Ga0068865_1005039813 | 123 |
| 144 | 3300009093 | Ga0105240_10032391 | Ga0105240_100323915 | 123 |
| 145 | 3300009098 | Ga0105245_10578523 | Ga0105245_105785231 | 123 |
| 146 | 3300009148 | Ga0105243_12196051 | Ga0105243_121960511 | 123 |
| 147 | 3300009174 | Ga0105241_10398868 | Ga0105241_103988682 | 123 |
| 148 | 3300009176 | Ga0105242_10577028 | Ga0105242_105770282 | 123 |
| 149 | 3300009177 | Ga0105248_11062085 | Ga0105248_110620852 | 123 |
| 150 | 3300009545 | Ga0105237_10018505 | Ga0105237_100185059 | 123 |
| 151 | 3300010375 | Ga0105239_10050731 | Ga0105239_100507314 | 123 |
| 152 | 3300013297 | Ga0157378_11504214 | Ga0157378_115042142 | 123 |
| 153 | 3300013308 | Ga0157375_11259186 | Ga0157375_112591862 | 123 |
| 154 | 3300025931 | Ga0207644_11081445 | Ga0207644_110814452 | 123 |
| 155 | 3300025938 | Ga0207704_11224007 | Ga0207704_112240071 | 123 |
| 156 | 3300025981 | Ga0207640_10017371 | Ga0207640_100173711 | 123 |
| 157 | 3300026089 | Ga0207648_10067687 | Ga0207648_100676874 | 123 |
| 158 | 3300026142 | Ga0207698_10054479 | Ga0207698_100544794 | 123 |
| 159 | 3300027866 | Ga0209813_10463238 | Ga0209813_104632381 | 123 |
| 160 | 3300028786 | Ga0307517_10142655 | Ga0307517_101426552 | 123 |
| 161 | 3300034957 | Ga0373938_0177643 | Ga0373938_0177643_199_570 | 123 |
| 162 | 3300035083 | Ga0373926_0000087 | Ga0373926_0000087_15748_16119 | 123 |
| 163 | 3300035089 | Ga0373944_0026731 | Ga0373944_0026731_1076_1447 | 123 |
| 164 | 3300035113 | Ga0373936_0003309 | Ga0373936_0003309_5464_5835 | 123 |
| 165 | 3300035116 | Ga0373945_0010919 | Ga0373945_0010919_1004_1375 | 123 |
| 166 | 3300035170 | Ga0373943_0007648 | Ga0373943_0007648_212_583 | 123 |
| 167 | 3300035170 | Ga0373943_0023074 | Ga0373943_0023074_1609_1980 | 123 |
| 168 | 3300035171 | Ga0373946_0007723 | Ga0373946_0007723_214_585 | 123 |
| 169 | 3300035692 | Ga0373935_0145650 | Ga0373935_0145650_42_413 | 123 |
| 170 | 3300035695 | Ga0373927_0027669 | Ga0373927_0027669_1503_1874 | 123 |
| 171 | 3300035725 | Ga0373947_0002298 | Ga0373947_0002298_3464_3835 | 123 |
| 172 | 3300035725 | Ga0373947_0347720 | Ga0373947_0347720_179_550 | 123 |
| 173 | 3300035725 | Ga0373947_0847437 | Ga0373947_0847437_135_506 | 123 |
| 174 | 3300037068 | Ga0373925_0031082 | Ga0373925_0031082_1460_1831 | 123 |
| 175 | 3300037471 | Ga0395905_0010865 | Ga0395905_0010865_7192_7575 | 123 |
| 176 | 3300037471 | Ga0395905_0148918 | Ga0395905_0148918_748_1131 | 123 |
| 177 | 3300042001 | Ga0439441_024765 | Ga0439441_024765_290_661 | 123 |
| 178 | 3300042876 | Ga0451577_0074388 | Ga0451577_0074388_1914_2285 | 123 |
| 179 | 3300044706 | Ga0466964_0020999 | Ga0466964_0020999_129_500 | 123 |
| 180 | 3300044712 | Ga0453684_0860025 | Ga0453684_0860025_154_525 | 123 |
| 181 | 3300044735 | Ga0466968_0012041 | Ga0466968_0012041_1994_2365 | 123 |
| 182 | 3300045051 | Ga0451576_0001787 | Ga0451576_0001787_18131_18502 | 123 |
| 183 | 3300045051 | Ga0451576_0013709 | Ga0451576_0013709_4543_4914 | 123 |
| 184 | 3300045836 | Ga0466958_0692050 | Ga0466958_0692050_248_619 | 123 |
| 185 | 3300046455 | Ga0495603_0008086 | Ga0495603_0008086_614_985 | 123 |
| 186 | 3300046471 | Ga0495650_0195072 | Ga0495650_0195072_321_692 | 123 |
| 187 | 3300046472 | Ga0495580_0010068 | Ga0495580_0010068_1613_1984 | 123 |
| 188 | 3300046473 | Ga0495582_0035632 | Ga0495582_0035632_1328_1699 | 123 |
| 189 | 3300046475 | Ga0495639_0039448 | Ga0495639_0039448_553_924 | 123 |
| 190 | 3300046491 | Ga0495584_0151355 | Ga0495584_0151355_577_948 | 123 |
| 191 | 3300046517 | Ga0495630_0948879 | Ga0495630_0948879_224_595 | 123 |
| 192 | 3300046535 | Ga0495586_0007775 | Ga0495586_0007775_4668_5039 | 123 |
| 193 | 3300046542 | Ga0495597_0429416 | Ga0495597_0429416_113_484 | 123 |
| 194 | 3300046615 | Ga0495656_0037732 | Ga0495656_0037732_641_1012 | 123 |
| 195 | 3300046665 | Ga0495661_0326186 | Ga0495661_0326186_182_553 | 123 |
| 196 | 3300046674 | Ga0495588_0009619 | Ga0495588_0009619_2802_3173 | 123 |
| 197 | 3300046681 | Ga0495647_0000233 | Ga0495647_0000233_1038_1409 | 123 |
| 198 | 3300046683 | Ga0495658_0153852 | Ga0495658_0153852_128_499 | 123 |
| 199 | 3300047321 | Ga0495676_0831603 | Ga0495676_0831603_95_466 | 123 |
| 200 | 3300047445 | Ga0495677_0135459 | Ga0495677_0135459_528_899 | 123 |
| 201 | 3300048908 | Ga0496105_0078861 | Ga0496105_0078861_720_1091 | 123 |
| 202 | 3300048917 | Ga0496114_0072365 | Ga0496114_0072365_2116_2487 | 123 |
| 203 | 3300048917 | Ga0496114_0115597 | Ga0496114_0115597_1760_2131 | 123 |
| 204 | 3300049580 | Ga0501046_0320910 | Ga0501046_0320910_44_415 | 123 |
| 205 | 3300050491 | nmdc:mga00v17_676460_c1 | nmdc:mga00v17_676460_c1_106_477 | 123 |
| 206 | 3300050492 | nmdc:mga0yw44_1206841_c1 | nmdc:mga0yw44_1206841_c1_63_434 | 123 |
| 207 | 3300050493 | nmdc:mga0k408_158619_c1 | nmdc:mga0k408_158619_c1_862_1233 | 123 |
| 208 | 3300050493 | nmdc:mga0k408_15900_c1 | nmdc:mga0k408_15900_c1_1930_2301 | 123 |
| 209 | 3300050493 | nmdc:mga0k408_45759_c1 | nmdc:mga0k408_45759_c1_653_1024 | 123 |
| 210 | 3300050495 | nmdc:mga04h51_301457_c1 | nmdc:mga04h51_301457_c1_29_400 | 123 |
| 211 | 3300050496 | nmdc:mga07m45_1045_c1 | nmdc:mga07m45_1045_c1_412_783 | 123 |
| 212 | 3300050496 | nmdc:mga07m45_54386_c1 | nmdc:mga07m45_54386_c1_1162_1533 | 123 |
| 213 | 3300050512 | nmdc:mga0n895_1281284_c1 | nmdc:mga0n895_1281284_c1_164_535 | 123 |
| 214 | 3300050513 | nmdc:mga0rr50_67511_c1 | nmdc:mga0rr50_67511_c1_1984_2355 | 123 |
| 215 | 3300050516 | nmdc:mga0sz30_160192_c1 | nmdc:mga0sz30_160192_c1_166_537 | 123 |
| 216 | 3300050516 | nmdc:mga0sz30_385315_c1 | nmdc:mga0sz30_385315_c1_69_440 | 123 |
| 217 | 3300053129 | Ga0500628_178306 | Ga0500628_178306_169_540 | 123 |
| 218 | 3300003792 | Ga0055540_1006946 | Ga0055540_10069463 | 124 |
| 219 | 3300025303 | Ga0209051_1000281 | Ga0209051_100028165 | 124 |
| 220 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039117 | 124 |
| 221 | 3300035091 | Ga0373951_0182670 | Ga0373951_0182670_206_592 | 124 |
| 222 | 3300037471 | Ga0395905_0054452 | Ga0395905_0054452_2394_2780 | 124 |
| 223 | 3300044683 | Ga0466965_0228009 | Ga0466965_0228009_405_791 | 124 |
| 224 | 3300044684 | Ga0466966_0015545 | Ga0466966_0015545_1657_2043 | 124 |
| 225 | 3300044765 | Ga0466970_0183982 | Ga0466970_0183982_146_532 | 124 |
| 226 | 3300045049 | Ga0466959_0185276 | Ga0466959_0185276_894_1280 | 124 |
| 227 | 3300048912 | Ga0496109_0162874 | Ga0496109_0162874_1514_1900 | 124 |
| 228 | 3300048913 | Ga0496110_0910842 | Ga0496110_0910842_41_427 | 124 |
| 229 | 3300050496 | nmdc:mga07m45_101201_c1 | nmdc:mga07m45_101201_c1_841_1215 | 124 |
| 230 | 3300005339 | Ga0070660_100182808 | Ga0070660_1001828082 | 125 |
| 231 | 3300005341 | Ga0070691_10164712 | Ga0070691_101647122 | 125 |
| 232 | 3300005458 | Ga0070681_10493180 | Ga0070681_104931802 | 125 |
| 233 | 3300005563 | Ga0068855_100005319 | Ga0068855_1000053193 | 125 |
| 234 | 3300009093 | Ga0105240_10215520 | Ga0105240_102155203 | 125 |
| 235 | 3300025912 | Ga0207707_10885989 | Ga0207707_108859892 | 125 |
| 236 | 3300025919 | Ga0207657_10037493 | Ga0207657_100374934 | 125 |
| 237 | 3300025921 | Ga0207652_10299460 | Ga0207652_102994602 | 125 |
| 238 | 3300025924 | Ga0207694_10169738 | Ga0207694_101697382 | 125 |
| 239 | 3300025949 | Ga0207667_10163526 | Ga0207667_101635263 | 125 |
| 240 | 3300026089 | Ga0207648_10746705 | Ga0207648_107467052 | 125 |
| 241 | 3300031711 | Ga0265314_10069835 | Ga0265314_100698353 | 125 |
| 242 | 3300031712 | Ga0265342_10375356 | Ga0265342_103753562 | 125 |
| 243 | 3300041404 | Ga0439436_0082677 | Ga0439436_0082677_10_387 | 125 |
| 244 | 3300041406 | Ga0439439_0187321 | Ga0439439_0187321_151_528 | 125 |
| 245 | 3300042007 | Ga0439449_0113627 | Ga0439449_0113627_522_917 | 125 |
| 246 | 3300049571 | Ga0501034_0552216 | Ga0501034_0552216_400_777 | 125 |
| 247 | 3300049578 | Ga0501042_1158471 | Ga0501042_1158471_80_457 | 125 |
| 248 | 3300050492 | nmdc:mga0yw44_89847_c1 | nmdc:mga0yw44_89847_c1_1031_1408 | 125 |
| 249 | 3300050514 | nmdc:mga08x19_487_c1 | nmdc:mga08x19_487_c1_21570_21947 | 125 |
| 250 | 3300059424 | Ga0590075_015049 | Ga0590075_015049_58_435 | 125 |
| 251 | 3300005293 | Ga0065715_11035556 | Ga0065715_110355561 | 126 |
| 252 | 3300005329 | Ga0070683_100713129 | Ga0070683_1007131292 | 126 |
| 253 | 3300005338 | Ga0068868_100761222 | Ga0068868_1007612222 | 126 |
| 254 | 3300005347 | Ga0070668_100069229 | Ga0070668_1000692292 | 126 |
| 255 | 3300005353 | Ga0070669_100118703 | Ga0070669_1001187034 | 126 |
| 256 | 3300005435 | Ga0070714_102296400 | Ga0070714_1022964001 | 126 |
| 257 | 3300005456 | Ga0070678_100279362 | Ga0070678_1002793622 | 126 |
| 258 | 3300005614 | Ga0068856_100625174 | Ga0068856_1006251742 | 126 |
| 259 | 3300005719 | Ga0068861_102265949 | Ga0068861_1022659491 | 126 |
| 260 | 3300009094 | Ga0111539_10542659 | Ga0111539_105426592 | 126 |
| 261 | 3300009545 | Ga0105237_10514705 | Ga0105237_105147051 | 126 |
| 262 | 3300009553 | Ga0105249_10957232 | Ga0105249_109572321 | 126 |
| 263 | 3300011119 | Ga0105246_10225508 | Ga0105246_102255082 | 126 |
| 264 | 3300013296 | Ga0157374_11470716 | Ga0157374_114707162 | 126 |
| 265 | 3300013297 | Ga0157378_12518481 | Ga0157378_125184811 | 126 |
| 266 | 3300014325 | Ga0163163_10191753 | Ga0163163_101917533 | 126 |
| 267 | 3300014326 | Ga0157380_10045978 | Ga0157380_100459785 | 126 |
| 268 | 3300020080 | Ga0206350_11406840 | Ga0206350_114068402 | 126 |
| 269 | 3300025303 | Ga0209051_1000980 | Ga0209051_10009805 | 126 |
| 270 | 3300025923 | Ga0207681_10091869 | Ga0207681_100918692 | 126 |
| 271 | 3300025936 | Ga0207670_10122033 | Ga0207670_101220334 | 126 |
| 272 | 3300025944 | Ga0207661_10784722 | Ga0207661_107847222 | 126 |
| 273 | 3300026023 | Ga0207677_11004334 | Ga0207677_110043341 | 126 |
| 274 | 3300026078 | Ga0207702_10815597 | Ga0207702_108155971 | 126 |
| 275 | 3300026118 | Ga0207675_102018693 | Ga0207675_1020186931 | 126 |
| 276 | 3300026121 | Ga0207683_10145903 | Ga0207683_101459034 | 126 |
| 277 | 3300028379 | Ga0268266_10042112 | Ga0268266_100421121 | 126 |
| 278 | 3300037068 | Ga0373925_1234211 | Ga0373925_1234211_10_390 | 126 |
| 279 | 3300039450 | Ga0436363_1012411 | Ga0436363_1012411_373_756 | 126 |
| 280 | 3300041496 | Ga0451839_0242961 | Ga0451839_0242961_50_430 | 126 |
| 281 | 3300046454 | Ga0495592_0897617 | Ga0495592_0897617_29_412 | 126 |
| 282 | 3300046472 | Ga0495580_0212768 | Ga0495580_0212768_537_920 | 126 |
| 283 | 3300047319 | Ga0495674_0137727 | Ga0495674_0137727_1535_1918 | 126 |
| 284 | 3300047471 | Ga0495684_0725708 | Ga0495684_0725708_194_577 | 126 |
| 285 | 3300048912 | Ga0496109_0313007 | Ga0496109_0313007_11_394 | 126 |
| 286 | 3300049568 | Ga0501031_0761371 | Ga0501031_0761371_115_495 | 126 |
| 287 | 3300049592 | Ga0501076_1607252 | Ga0501076_1607252_35_415 | 126 |
| 288 | 3300050511 | nmdc:mga08y16_211143_c1 | nmdc:mga08y16_211143_c1_508_888 | 126 |
| 289 | 3300003203 | JGI25406J46586_10104663 | JGI25406J46586_101046632 | 127 |
| 290 | 3300004803 | Ga0058862_12693219 | Ga0058862_126932191 | 127 |
| 291 | 3300005327 | Ga0070658_10590896 | Ga0070658_105908962 | 127 |
| 292 | 3300005327 | Ga0070658_11690645 | Ga0070658_116906451 | 127 |
| 293 | 3300005435 | Ga0070714_100370316 | Ga0070714_1003703163 | 127 |
| 294 | 3300005436 | Ga0070713_100042585 | Ga0070713_1000425853 | 127 |
| 295 | 3300005436 | Ga0070713_100354967 | Ga0070713_1003549672 | 127 |
| 296 | 3300005436 | Ga0070713_102466974 | Ga0070713_1024669741 | 127 |
| 297 | 3300005439 | Ga0070711_100634673 | Ga0070711_1006346732 | 127 |
| 298 | 3300005440 | Ga0070705_100016436 | Ga0070705_1000164363 | 127 |
| 299 | 3300005441 | Ga0070700_100529171 | Ga0070700_1005291712 | 127 |
| 300 | 3300005444 | Ga0070694_100384794 | Ga0070694_1003847942 | 127 |
| 301 | 3300005445 | Ga0070708_100249276 | Ga0070708_1002492762 | 127 |
| 302 | 3300005468 | Ga0070707_100536809 | Ga0070707_1005368092 | 127 |
| 303 | 3300005468 | Ga0070707_101522555 | Ga0070707_1015225551 | 127 |
| 304 | 3300005530 | Ga0070679_100059905 | Ga0070679_1000599054 | 127 |
| 305 | 3300005535 | Ga0070684_101134418 | Ga0070684_1011344181 | 127 |
| 306 | 3300005545 | Ga0070695_100000692 | Ga0070695_1000006927 | 127 |
| 307 | 3300005545 | Ga0070695_100150230 | Ga0070695_1001502302 | 127 |
| 308 | 3300005546 | Ga0070696_100008854 | Ga0070696_1000088545 | 127 |
| 309 | 3300005546 | Ga0070696_100311941 | Ga0070696_1003119412 | 127 |
| 310 | 3300005549 | Ga0070704_101842160 | Ga0070704_1018421601 | 127 |
| 311 | 3300005614 | Ga0068856_100539159 | Ga0068856_1005391591 | 127 |
| 312 | 3300005985 | Ga0081539_10000226 | Ga0081539_10000226143 | 127 |
| 313 | 3300006028 | Ga0070717_10123117 | Ga0070717_101231173 | 127 |
| 314 | 3300006028 | Ga0070717_10301328 | Ga0070717_103013281 | 127 |
| 315 | 3300006173 | Ga0070716_100259837 | Ga0070716_1002598372 | 127 |
| 316 | 3300006175 | Ga0070712_100247407 | Ga0070712_1002474072 | 127 |
| 317 | 3300006358 | Ga0068871_101127584 | Ga0068871_1011275842 | 127 |
| 318 | 3300006844 | Ga0075428_100011487 | Ga0075428_1000114876 | 127 |
| 319 | 3300006852 | Ga0075433_10028132 | Ga0075433_100281325 | 127 |
| 320 | 3300006852 | Ga0075433_10713891 | Ga0075433_107138912 | 127 |
| 321 | 3300006871 | Ga0075434_100211503 | Ga0075434_1002115034 | 127 |
| 322 | 3300006871 | Ga0075434_100403542 | Ga0075434_1004035422 | 127 |
| 323 | 3300006914 | Ga0075436_100000087 | Ga0075436_10000008733 | 127 |
| 324 | 3300006914 | Ga0075436_100044693 | Ga0075436_1000446932 | 127 |
| 325 | 3300006914 | Ga0075436_100796252 | Ga0075436_1007962522 | 127 |
| 326 | 3300007076 | Ga0075435_100476717 | Ga0075435_1004767172 | 127 |
| 327 | 3300007076 | Ga0075435_101437372 | Ga0075435_1014373721 | 127 |
| 328 | 3300009101 | Ga0105247_11383283 | Ga0105247_113832832 | 127 |
| 329 | 3300009174 | Ga0105241_11711613 | Ga0105241_117116132 | 127 |
| 330 | 3300009551 | Ga0105238_10358793 | Ga0105238_103587932 | 127 |
| 331 | 3300009551 | Ga0105238_12606685 | Ga0105238_126066851 | 127 |
| 332 | 3300009553 | Ga0105249_11285878 | Ga0105249_112858781 | 127 |
| 333 | 3300013104 | Ga0157370_10126001 | Ga0157370_101260013 | 127 |
| 334 | 3300013297 | Ga0157378_10706173 | Ga0157378_107061732 | 127 |
| 335 | 3300013306 | Ga0163162_11337283 | Ga0163162_113372832 | 127 |
| 336 | 3300013308 | Ga0157375_13194834 | Ga0157375_131948341 | 127 |
| 337 | 3300014497 | Ga0182008_10036875 | Ga0182008_100368753 | 127 |
| 338 | 3300020069 | Ga0197907_10339444 | Ga0197907_103394442 | 127 |
| 339 | 3300020070 | Ga0206356_11187003 | Ga0206356_111870032 | 127 |
| 340 | 3300020070 | Ga0206356_11700594 | Ga0206356_117005942 | 127 |
| 341 | 3300020075 | Ga0206349_1530087 | Ga0206349_15300872 | 127 |
| 342 | 3300020076 | Ga0206355_1211932 | Ga0206355_12119321 | 127 |
| 343 | 3300020077 | Ga0206351_10140964 | Ga0206351_101409642 | 127 |
| 344 | 3300020078 | Ga0206352_10593072 | Ga0206352_105930722 | 127 |
| 345 | 3300020080 | Ga0206350_11130271 | Ga0206350_111302712 | 127 |
| 346 | 3300020081 | Ga0206354_11246408 | Ga0206354_112464082 | 127 |
| 347 | 3300020610 | Ga0154015_1086285 | Ga0154015_10862852 | 127 |
| 348 | 3300021388 | Ga0213875_10528058 | Ga0213875_105280581 | 127 |
| 349 | 3300021441 | Ga0213871_10314223 | Ga0213871_103142231 | 127 |
| 350 | 3300022467 | Ga0224712_10124612 | Ga0224712_101246122 | 127 |
| 351 | 3300022467 | Ga0224712_10393493 | Ga0224712_103934932 | 127 |
| 352 | 3300023552 | Ga0247551_105375 | Ga0247551_1053751 | 127 |
| 353 | 3300025905 | Ga0207685_10457549 | Ga0207685_104575492 | 127 |
| 354 | 3300025906 | Ga0207699_10032668 | Ga0207699_100326682 | 127 |
| 355 | 3300025909 | Ga0207705_10181070 | Ga0207705_101810703 | 127 |
| 356 | 3300025910 | Ga0207684_10037357 | Ga0207684_100373574 | 127 |
| 357 | 3300025915 | Ga0207693_10076579 | Ga0207693_100765792 | 127 |
| 358 | 3300025915 | Ga0207693_10469920 | Ga0207693_104699202 | 127 |
| 359 | 3300025916 | Ga0207663_10054098 | Ga0207663_100540981 | 127 |
| 360 | 3300025916 | Ga0207663_11181642 | Ga0207663_111816421 | 127 |
| 361 | 3300025922 | Ga0207646_10958276 | Ga0207646_109582762 | 127 |
| 362 | 3300025924 | Ga0207694_10283236 | Ga0207694_102832362 | 127 |
| 363 | 3300025926 | Ga0207659_11436307 | Ga0207659_114363071 | 127 |
| 364 | 3300025928 | Ga0207700_10100054 | Ga0207700_101000542 | 127 |
| 365 | 3300025928 | Ga0207700_10118043 | Ga0207700_101180433 | 127 |
| 366 | 3300025928 | Ga0207700_10174177 | Ga0207700_101741772 | 127 |
| 367 | 3300025928 | Ga0207700_10481255 | Ga0207700_104812552 | 127 |
| 368 | 3300025928 | Ga0207700_11522786 | Ga0207700_115227861 | 127 |
| 369 | 3300025929 | Ga0207664_10039415 | Ga0207664_100394152 | 127 |
| 370 | 3300025929 | Ga0207664_11014766 | Ga0207664_110147662 | 127 |
| 371 | 3300025937 | Ga0207669_11606463 | Ga0207669_116064631 | 127 |
| 372 | 3300025939 | Ga0207665_10363817 | Ga0207665_103638172 | 127 |
| 373 | 3300025986 | Ga0207658_10365469 | Ga0207658_103654692 | 127 |
| 374 | 3300026075 | Ga0207708_10547373 | Ga0207708_105473732 | 127 |
| 375 | 3300026078 | Ga0207702_10401949 | Ga0207702_104019492 | 127 |
| 376 | 3300027378 | Ga0209981_1058634 | Ga0209981_10586342 | 127 |
| 377 | 3300028800 | Ga0265338_11112225 | Ga0265338_111122251 | 127 |
| 378 | 3300035083 | Ga0373926_0297034 | Ga0373926_0297034_207_593 | 127 |
| 379 | 3300035086 | Ga0373934_0156273 | Ga0373934_0156273_509_895 | 127 |
| 380 | 3300035086 | Ga0373934_0168803 | Ga0373934_0168803_34_420 | 127 |
| 381 | 3300035089 | Ga0373944_0093003 | Ga0373944_0093003_505_891 | 127 |
| 382 | 3300035111 | Ga0373923_0586749 | Ga0373923_0586749_114_500 | 127 |
| 383 | 3300035115 | Ga0373941_0428948 | Ga0373941_0428948_110_493 | 127 |
| 384 | 3300035117 | Ga0373953_0068564 | Ga0373953_0068564_1019_1405 | 127 |
| 385 | 3300035119 | Ga0373956_0056907 | Ga0373956_0056907_1342_1728 | 127 |
| 386 | 3300035119 | Ga0373956_0157436 | Ga0373956_0157436_581_967 | 127 |
| 387 | 3300035120 | Ga0373957_0098280 | Ga0373957_0098280_663_1049 | 127 |
| 388 | 3300035170 | Ga0373943_0196052 | Ga0373943_0196052_281_667 | 127 |
| 389 | 3300035170 | Ga0373943_0680074 | Ga0373943_0680074_71_457 | 127 |
| 390 | 3300035171 | Ga0373946_0101427 | Ga0373946_0101427_119_505 | 127 |
| 391 | 3300035172 | Ga0373955_0063053 | Ga0373955_0063053_1173_1559 | 127 |
| 392 | 3300035172 | Ga0373955_0080380 | Ga0373955_0080380_814_1200 | 127 |
| 393 | 3300035692 | Ga0373935_1293747 | Ga0373935_1293747_147_533 | 127 |
| 394 | 3300035724 | Ga0373933_0178501 | Ga0373933_0178501_128_514 | 127 |
| 395 | 3300035724 | Ga0373933_0494155 | Ga0373933_0494155_235_621 | 127 |
| 396 | 3300035725 | Ga0373947_0066867 | Ga0373947_0066867_1544_1930 | 127 |
| 397 | 3300035725 | Ga0373947_0076151 | Ga0373947_0076151_1546_1932 | 127 |
| 398 | 3300036401 | Ga0373937_0010585 | Ga0373937_0010585_4748_5134 | 127 |
| 399 | 3300036401 | Ga0373937_0013598 | Ga0373937_0013598_812_1198 | 127 |
| 400 | 3300036401 | Ga0373937_0024912 | Ga0373937_0024912_4990_5376 | 127 |
| 401 | 3300036401 | Ga0373937_1062308 | Ga0373937_1062308_341_727 | 127 |
| 402 | 3300037068 | Ga0373925_0043519 | Ga0373925_0043519_633_1019 | 127 |
| 403 | 3300037471 | Ga0395905_0000589 | Ga0395905_0000589_14427_14810 | 127 |
| 404 | 3300037471 | Ga0395905_0011469 | Ga0395905_0011469_3011_3394 | 127 |
| 405 | 3300037853 | Ga0436364_0111886 | Ga0436364_0111886_1741_2127 | 127 |
| 406 | 3300039438 | Ga0436360_0707490 | Ga0436360_0707490_1158_1541 | 127 |
| 407 | 3300042133 | Ga0450896_017071 | Ga0450896_017071_75_458 | 127 |
| 408 | 3300044706 | Ga0466964_0101537 | Ga0466964_0101537_469_852 | 127 |
| 409 | 3300045051 | Ga0451576_0073133 | Ga0451576_0073133_1068_1460 | 127 |
| 410 | 3300045976 | Ga0466967_0555119 | Ga0466967_0555119_566_952 | 127 |
| 411 | 3300045976 | Ga0466967_1997079 | Ga0466967_1997079_82_468 | 127 |
| 412 | 3300046454 | Ga0495592_0066694 | Ga0495592_0066694_2151_2537 | 127 |
| 413 | 3300046459 | Ga0495629_0090904 | Ga0495629_0090904_102_488 | 127 |
| 414 | 3300046459 | Ga0495629_0409631 | Ga0495629_0409631_490_876 | 127 |
| 415 | 3300046462 | Ga0495651_0048106 | Ga0495651_0048106_568_954 | 127 |
| 416 | 3300046462 | Ga0495651_0473713 | Ga0495651_0473713_103_489 | 127 |
| 417 | 3300046463 | Ga0495653_0121713 | Ga0495653_0121713_835_1221 | 127 |
| 418 | 3300046463 | Ga0495653_0133827 | Ga0495653_0133827_211_597 | 127 |
| 419 | 3300046477 | Ga0495664_0001723 | Ga0495664_0001723_5166_5552 | 127 |
| 420 | 3300046511 | Ga0495608_0036509 | Ga0495608_0036509_127_513 | 127 |
| 421 | 3300046514 | Ga0495618_0413609 | Ga0495618_0413609_33_419 | 127 |
| 422 | 3300046516 | Ga0495628_0063065 | Ga0495628_0063065_776_1162 | 127 |
| 423 | 3300046529 | Ga0495652_0147524 | Ga0495652_0147524_1072_1458 | 127 |
| 424 | 3300046533 | Ga0495640_0220259 | Ga0495640_0220259_49_435 | 127 |
| 425 | 3300046533 | Ga0495640_0323356 | Ga0495640_0323356_292_678 | 127 |
| 426 | 3300046536 | Ga0495587_0009016 | Ga0495587_0009016_385_771 | 127 |
| 427 | 3300046537 | Ga0495598_0211522 | Ga0495598_0211522_47_430 | 127 |
| 428 | 3300046539 | Ga0495621_0047082 | Ga0495621_0047082_630_1013 | 127 |
| 429 | 3300046543 | Ga0495645_0039341 | Ga0495645_0039341_1576_1962 | 127 |
| 430 | 3300046559 | Ga0495667_0158011 | Ga0495667_0158011_812_1198 | 127 |
| 431 | 3300046559 | Ga0495667_0377060 | Ga0495667_0377060_18_404 | 127 |
| 432 | 3300046663 | Ga0495635_0067519 | Ga0495635_0067519_1507_1893 | 127 |
| 433 | 3300046675 | Ga0495657_0639337 | Ga0495657_0639337_56_442 | 127 |
| 434 | 3300046678 | Ga0495599_0014270 | Ga0495599_0014270_2202_2588 | 127 |
| 435 | 3300046680 | Ga0495646_0023334 | Ga0495646_0023334_1981_2367 | 127 |
| 436 | 3300046689 | Ga0495613_0488989 | Ga0495613_0488989_431_817 | 127 |
| 437 | 3300046809 | Ga0495600_0099892 | Ga0495600_0099892_311_697 | 127 |
| 438 | 3300047317 | Ga0495604_0011002 | Ga0495604_0011002_3934_4320 | 127 |
| 439 | 3300047318 | Ga0495636_0351316 | Ga0495636_0351316_283_666 | 127 |
| 440 | 3300047319 | Ga0495674_0146396 | Ga0495674_0146396_1556_1942 | 127 |
| 441 | 3300047319 | Ga0495674_0305594 | Ga0495674_0305594_127_513 | 127 |
| 442 | 3300047322 | Ga0495680_0049898 | Ga0495680_0049898_2183_2569 | 127 |
| 443 | 3300047322 | Ga0495680_0169825 | Ga0495680_0169825_636_1022 | 127 |
| 444 | 3300047444 | Ga0495675_0062223 | Ga0495675_0062223_1808_2194 | 127 |
| 445 | 3300047444 | Ga0495675_0129201 | Ga0495675_0129201_36_422 | 127 |
| 446 | 3300047444 | Ga0495675_0168430 | Ga0495675_0168430_571_957 | 127 |
| 447 | 3300047471 | Ga0495684_0592518 | Ga0495684_0592518_36_422 | 127 |
| 448 | 3300048088 | Ga0495602_0015309 | Ga0495602_0015309_1192_1578 | 127 |
| 449 | 3300048903 | Ga0496100_0832291 | Ga0496100_0832291_24_410 | 127 |
| 450 | 3300048915 | Ga0496112_0611479 | Ga0496112_0611479_604_990 | 127 |
| 451 | 3300049581 | Ga0501047_0689797 | Ga0501047_0689797_435_821 | 127 |
| 452 | 3300049582 | Ga0501048_1093814 | Ga0501048_1093814_51_434 | 127 |
| 453 | 3300049585 | Ga0501069_0927362 | Ga0501069_0927362_96_479 | 127 |
| 454 | 3300050512 | nmdc:mga0n895_151356_c1 | nmdc:mga0n895_151356_c1_344_727 | 127 |
| 455 | 3300050513 | nmdc:mga0rr50_61261_c1 | nmdc:mga0rr50_61261_c1_37_420 | 127 |
| 456 | 3300050514 | nmdc:mga08x19_142626_c1 | nmdc:mga08x19_142626_c1_699_1082 | 127 |
| 457 | 3300050514 | nmdc:mga08x19_2248_c1 | nmdc:mga08x19_2248_c1_6886_7269 | 127 |
| 458 | 3300050514 | nmdc:mga08x19_430068_c1 | nmdc:mga08x19_430068_c1_455_838 | 127 |
| 459 | 3300050515 | nmdc:mga0a205_27965_c1 | nmdc:mga0a205_27965_c1_221_604 | 127 |
| 460 | 3300050515 | nmdc:mga0a205_829583_c1 | nmdc:mga0a205_829583_c1_248_631 | 127 |
| 461 | 3300053077 | Ga0495601_0110597 | Ga0495601_0110597_579_965 | 127 |
| 462 | 3300053077 | Ga0495601_1079756 | Ga0495601_1079756_84_470 | 127 |
| 463 | 3300053078 | Ga0495612_0176323 | Ga0495612_0176323_183_569 | 127 |
| 464 | 3300053084 | Ga0495595_0052108 | Ga0495595_0052108_211_597 | 127 |
| 465 | 3300053085 | Ga0495619_0029087 | Ga0495619_0029087_629_1015 | 127 |
| 466 | 3300053085 | Ga0495619_0141124 | Ga0495619_0141124_50_436 | 127 |
| 467 | 3300059507 | Ga0587086_055246 | Ga0587086_055246_194_580 | 127 |
| 468 | 3300059508 | Ga0587088_177939 | Ga0587088_177939_69_455 | 127 |
| 469 | 3300059509 | Ga0587089_050168 | Ga0587089_050168_66_452 | 127 |
| 470 | 3300059604 | Ga0587098_097312 | Ga0587098_097312_66_452 | 127 |
| 471 | 3300059623 | Ga0587101_076736 | Ga0587101_076736_69_455 | 127 |
| 472 | 3300059626 | Ga0587115_110139 | Ga0587115_110139_68_454 | 127 |
| 473 | 3300059630 | Ga0587128_170952 | Ga0587128_170952_85_471 | 127 |
| 474 | 3300059646 | Ga0587078_073249 | Ga0587078_073249_69_455 | 127 |
| 475 | 3300059646 | Ga0587078_081511 | Ga0587078_081511_77_463 | 127 |
| 476 | 3300003322 | rootL2_10016479 | rootL2_100164791 | 128 |
| 477 | 3300005327 | Ga0070658_10083823 | Ga0070658_100838234 | 128 |
| 478 | 3300005327 | Ga0070658_10102909 | Ga0070658_101029091 | 128 |
| 479 | 3300005327 | Ga0070658_10202820 | Ga0070658_102028201 | 128 |
| 480 | 3300005328 | Ga0070676_10009290 | Ga0070676_100092905 | 128 |
| 481 | 3300005328 | Ga0070676_10095408 | Ga0070676_100954082 | 128 |
| 482 | 3300005328 | Ga0070676_10605056 | Ga0070676_106050562 | 128 |
| 483 | 3300005329 | Ga0070683_100005352 | Ga0070683_1000053526 | 128 |
| 484 | 3300005331 | Ga0070670_100003584 | Ga0070670_10000358411 | 128 |
| 485 | 3300005331 | Ga0070670_100009851 | Ga0070670_1000098518 | 128 |
| 486 | 3300005333 | Ga0070677_10164781 | Ga0070677_101647812 | 128 |
| 487 | 3300005334 | Ga0068869_100069759 | Ga0068869_1000697594 | 128 |
| 488 | 3300005334 | Ga0068869_101294863 | Ga0068869_1012948632 | 128 |
| 489 | 3300005335 | Ga0070666_10113018 | Ga0070666_101130183 | 128 |
| 490 | 3300005336 | Ga0070680_100157683 | Ga0070680_1001576833 | 128 |
| 491 | 3300005338 | Ga0068868_100001157 | Ga0068868_1000011578 | 128 |
| 492 | 3300005339 | Ga0070660_100073236 | Ga0070660_1000732365 | 128 |
| 493 | 3300005344 | Ga0070661_100033962 | Ga0070661_1000339625 | 128 |
| 494 | 3300005344 | Ga0070661_100037349 | Ga0070661_1000373494 | 128 |
| 495 | 3300005344 | Ga0070661_101388409 | Ga0070661_1013884091 | 128 |
| 496 | 3300005353 | Ga0070669_101456430 | Ga0070669_1014564301 | 128 |
| 497 | 3300005354 | Ga0070675_100001801 | Ga0070675_1000018017 | 128 |
| 498 | 3300005354 | Ga0070675_100022306 | Ga0070675_1000223066 | 128 |
| 499 | 3300005355 | Ga0070671_100010623 | Ga0070671_1000106236 | 128 |
| 500 | 3300005355 | Ga0070671_100020902 | Ga0070671_1000209027 | 128 |
| 501 | 3300005355 | Ga0070671_100208905 | Ga0070671_1002089053 | 128 |
| 502 | 3300005355 | Ga0070671_100299367 | Ga0070671_1002993673 | 128 |
| 503 | 3300005364 | Ga0070673_100865695 | Ga0070673_1008656952 | 128 |
| 504 | 3300005366 | Ga0070659_100125477 | Ga0070659_1001254773 | 128 |
| 505 | 3300005367 | Ga0070667_100088937 | Ga0070667_1000889372 | 128 |
| 506 | 3300005438 | Ga0070701_10242541 | Ga0070701_102425412 | 128 |
| 507 | 3300005440 | Ga0070705_100367620 | Ga0070705_1003676202 | 128 |
| 508 | 3300005444 | Ga0070694_100562711 | Ga0070694_1005627111 | 128 |
| 509 | 3300005455 | Ga0070663_100040127 | Ga0070663_1000401272 | 128 |
| 510 | 3300005455 | Ga0070663_100572541 | Ga0070663_1005725412 | 128 |
| 511 | 3300005456 | Ga0070678_100005974 | Ga0070678_1000059749 | 128 |
| 512 | 3300005456 | Ga0070678_100046649 | Ga0070678_1000466494 | 128 |
| 513 | 3300005456 | Ga0070678_100278890 | Ga0070678_1002788901 | 128 |
| 514 | 3300005457 | Ga0070662_100000867 | Ga0070662_1000008678 | 128 |
| 515 | 3300005457 | Ga0070662_100110025 | Ga0070662_1001100251 | 128 |
| 516 | 3300005535 | Ga0070684_100027307 | Ga0070684_1000273075 | 128 |
| 517 | 3300005535 | Ga0070684_100409742 | Ga0070684_1004097423 | 128 |
| 518 | 3300005539 | Ga0068853_100002880 | Ga0068853_1000028808 | 128 |
| 519 | 3300005543 | Ga0070672_100000535 | Ga0070672_1000005358 | 128 |
| 520 | 3300005544 | Ga0070686_100969540 | Ga0070686_1009695401 | 128 |
| 521 | 3300005546 | Ga0070696_100475830 | Ga0070696_1004758302 | 128 |
| 522 | 3300005547 | Ga0070693_100029302 | Ga0070693_1000293022 | 128 |
| 523 | 3300005547 | Ga0070693_101101446 | Ga0070693_1011014462 | 128 |
| 524 | 3300005548 | Ga0070665_100694432 | Ga0070665_1006944322 | 128 |
| 525 | 3300005563 | Ga0068855_100051204 | Ga0068855_1000512045 | 128 |
| 526 | 3300005563 | Ga0068855_100155710 | Ga0068855_1001557101 | 128 |
| 527 | 3300005563 | Ga0068855_101218898 | Ga0068855_1012188982 | 128 |
| 528 | 3300005564 | Ga0070664_100055141 | Ga0070664_1000551413 | 128 |
| 529 | 3300005577 | Ga0068857_101165040 | Ga0068857_1011650402 | 128 |
| 530 | 3300005578 | Ga0068854_100027581 | Ga0068854_1000275815 | 128 |
| 531 | 3300005578 | Ga0068854_100032147 | Ga0068854_1000321471 | 128 |
| 532 | 3300005614 | Ga0068856_100004035 | Ga0068856_1000040358 | 128 |
| 533 | 3300005615 | Ga0070702_100014791 | Ga0070702_1000147913 | 128 |
| 534 | 3300005616 | Ga0068852_100018568 | Ga0068852_1000185687 | 128 |
| 535 | 3300005616 | Ga0068852_100054887 | Ga0068852_1000548872 | 128 |
| 536 | 3300005616 | Ga0068852_100072682 | Ga0068852_1000726824 | 128 |
| 537 | 3300005616 | Ga0068852_100447083 | Ga0068852_1004470833 | 128 |
| 538 | 3300005616 | Ga0068852_101228262 | Ga0068852_1012282622 | 128 |
| 539 | 3300005616 | Ga0068852_101390769 | Ga0068852_1013907692 | 128 |
| 540 | 3300005617 | Ga0068859_101072680 | Ga0068859_1010726802 | 128 |
| 541 | 3300005617 | Ga0068859_101236815 | Ga0068859_1012368152 | 128 |
| 542 | 3300005618 | Ga0068864_100011769 | Ga0068864_10001176910 | 128 |
| 543 | 3300005618 | Ga0068864_100024340 | Ga0068864_1000243404 | 128 |
| 544 | 3300005618 | Ga0068864_100194010 | Ga0068864_1001940104 | 128 |
| 545 | 3300005719 | Ga0068861_100003855 | Ga0068861_10000385510 | 128 |
| 546 | 3300005834 | Ga0068851_10009705 | Ga0068851_100097055 | 128 |
| 547 | 3300005834 | Ga0068851_10020198 | Ga0068851_100201985 | 128 |
| 548 | 3300005834 | Ga0068851_10042872 | Ga0068851_100428724 | 128 |
| 549 | 3300005834 | Ga0068851_10044956 | Ga0068851_100449561 | 128 |
| 550 | 3300005841 | Ga0068863_100183411 | Ga0068863_1001834113 | 128 |
| 551 | 3300005842 | Ga0068858_100160326 | Ga0068858_1001603263 | 128 |
| 552 | 3300005842 | Ga0068858_100257075 | Ga0068858_1002570753 | 128 |
| 553 | 3300005842 | Ga0068858_102136059 | Ga0068858_1021360592 | 128 |
| 554 | 3300005843 | Ga0068860_100247347 | Ga0068860_1002473474 | 128 |
| 555 | 3300005843 | Ga0068860_100616457 | Ga0068860_1006164572 | 128 |
| 556 | 3300005844 | Ga0068862_100887250 | Ga0068862_1008872502 | 128 |
| 557 | 3300006038 | Ga0075365_10238977 | Ga0075365_102389771 | 128 |
| 558 | 3300006042 | Ga0075368_10306824 | Ga0075368_103068242 | 128 |
| 559 | 3300006048 | Ga0075363_100011747 | Ga0075363_1000117473 | 128 |
| 560 | 3300006051 | Ga0075364_10051591 | Ga0075364_100515911 | 128 |
| 561 | 3300006177 | Ga0075362_10008211 | Ga0075362_100082113 | 128 |
| 562 | 3300006177 | Ga0075362_10289212 | Ga0075362_102892121 | 128 |
| 563 | 3300006178 | Ga0075367_10023342 | Ga0075367_100233422 | 128 |
| 564 | 3300006186 | Ga0075369_10169756 | Ga0075369_101697562 | 128 |
| 565 | 3300006195 | Ga0075366_10009384 | Ga0075366_100093841 | 128 |
| 566 | 3300006195 | Ga0075366_10096764 | Ga0075366_100967642 | 128 |
| 567 | 3300006195 | Ga0075366_10364572 | Ga0075366_103645722 | 128 |
| 568 | 3300006195 | Ga0075366_10481328 | Ga0075366_104813282 | 128 |
| 569 | 3300006195 | Ga0075366_10692919 | Ga0075366_106929191 | 128 |
| 570 | 3300006237 | Ga0097621_100037998 | Ga0097621_1000379983 | 128 |
| 571 | 3300006237 | Ga0097621_100786463 | Ga0097621_1007864632 | 128 |
| 572 | 3300006353 | Ga0075370_10003489 | Ga0075370_100034898 | 128 |
| 573 | 3300006353 | Ga0075370_10013018 | Ga0075370_100130184 | 128 |
| 574 | 3300006358 | Ga0068871_100012983 | Ga0068871_1000129834 | 128 |
| 575 | 3300006358 | Ga0068871_100168797 | Ga0068871_1001687973 | 128 |
| 576 | 3300006852 | Ga0075433_10570812 | Ga0075433_105708122 | 128 |
| 577 | 3300006871 | Ga0075434_100000306 | Ga0075434_10000030631 | 128 |
| 578 | 3300006871 | Ga0075434_100715280 | Ga0075434_1007152802 | 128 |
| 579 | 3300006880 | Ga0075429_100333108 | Ga0075429_1003331082 | 128 |
| 580 | 3300006931 | Ga0097620_101072672 | Ga0097620_1010726722 | 128 |
| 581 | 3300006931 | Ga0097620_101236828 | Ga0097620_1012368282 | 128 |
| 582 | 3300007076 | Ga0075435_100049500 | Ga0075435_1000495003 | 128 |
| 583 | 3300007265 | Ga0099794_10114266 | Ga0099794_101142661 | 128 |
| 584 | 3300007265 | Ga0099794_10355707 | Ga0099794_103557072 | 128 |
| 585 | 3300009101 | Ga0105247_10582324 | Ga0105247_105823241 | 128 |
| 586 | 3300009147 | Ga0114129_10829948 | Ga0114129_108299481 | 128 |
| 587 | 3300009545 | Ga0105237_12087580 | Ga0105237_120875802 | 128 |
| 588 | 3300013306 | Ga0163162_12939054 | Ga0163162_129390541 | 128 |
| 589 | 3300014325 | Ga0163163_11422140 | Ga0163163_114221402 | 128 |
| 590 | 3300014325 | Ga0163163_12741624 | Ga0163163_127416241 | 128 |
| 591 | 3300014326 | Ga0157380_10502146 | Ga0157380_105021462 | 128 |
| 592 | 3300014968 | Ga0157379_10872353 | Ga0157379_108723532 | 128 |
| 593 | 3300017792 | Ga0163161_10003912 | Ga0163161_100039128 | 128 |
| 594 | 3300021361 | Ga0213872_10002261 | Ga0213872_1000226110 | 128 |
| 595 | 3300021384 | Ga0213876_10108926 | Ga0213876_101089263 | 128 |
| 596 | 3300025271 | Ga0207666_1010509 | Ga0207666_10105092 | 128 |
| 597 | 3300025315 | Ga0207697_10129333 | Ga0207697_101293332 | 128 |
| 598 | 3300025321 | Ga0207656_10120352 | Ga0207656_101203523 | 128 |
| 599 | 3300025893 | Ga0207682_10245409 | Ga0207682_102454092 | 128 |
| 600 | 3300025901 | Ga0207688_10236596 | Ga0207688_102365962 | 128 |
| 601 | 3300025903 | Ga0207680_10182205 | Ga0207680_101822052 | 128 |
| 602 | 3300025907 | Ga0207645_10005684 | Ga0207645_100056845 | 128 |
| 603 | 3300025907 | Ga0207645_10239960 | Ga0207645_102399602 | 128 |
| 604 | 3300025908 | Ga0207643_10421149 | Ga0207643_104211492 | 128 |
| 605 | 3300025909 | Ga0207705_10276060 | Ga0207705_102760601 | 128 |
| 606 | 3300025909 | Ga0207705_10398586 | Ga0207705_103985862 | 128 |
| 607 | 3300025916 | Ga0207663_10173167 | Ga0207663_101731673 | 128 |
| 608 | 3300025917 | Ga0207660_10709516 | Ga0207660_107095162 | 128 |
| 609 | 3300025918 | Ga0207662_10124229 | Ga0207662_101242293 | 128 |
| 610 | 3300025919 | Ga0207657_10435813 | Ga0207657_104358132 | 128 |
| 611 | 3300025919 | Ga0207657_10765997 | Ga0207657_107659972 | 128 |
| 612 | 3300025921 | Ga0207652_10914042 | Ga0207652_109140422 | 128 |
| 613 | 3300025921 | Ga0207652_11174352 | Ga0207652_111743522 | 128 |
| 614 | 3300025923 | Ga0207681_10041950 | Ga0207681_100419503 | 128 |
| 615 | 3300025923 | Ga0207681_10568204 | Ga0207681_105682041 | 128 |
| 616 | 3300025924 | Ga0207694_10038457 | Ga0207694_100384574 | 128 |
| 617 | 3300025926 | Ga0207659_10005215 | Ga0207659_100052158 | 128 |
| 618 | 3300025926 | Ga0207659_10048380 | Ga0207659_100483804 | 128 |
| 619 | 3300025927 | Ga0207687_10059961 | Ga0207687_100599612 | 128 |
| 620 | 3300025931 | Ga0207644_10079813 | Ga0207644_100798134 | 128 |
| 621 | 3300025931 | Ga0207644_10088455 | Ga0207644_100884554 | 128 |
| 622 | 3300025931 | Ga0207644_10289327 | Ga0207644_102893273 | 128 |
| 623 | 3300025932 | Ga0207690_10294649 | Ga0207690_102946492 | 128 |
| 624 | 3300025933 | Ga0207706_10000933 | Ga0207706_1000093325 | 128 |
| 625 | 3300025933 | Ga0207706_10137030 | Ga0207706_101370304 | 128 |
| 626 | 3300025933 | Ga0207706_10203567 | Ga0207706_102035674 | 128 |
| 627 | 3300025933 | Ga0207706_10976996 | Ga0207706_109769961 | 128 |
| 628 | 3300025936 | Ga0207670_10993567 | Ga0207670_109935672 | 128 |
| 629 | 3300025938 | Ga0207704_10293317 | Ga0207704_102933171 | 128 |
| 630 | 3300025940 | Ga0207691_10008515 | Ga0207691_100085158 | 128 |
| 631 | 3300025940 | Ga0207691_10083769 | Ga0207691_100837693 | 128 |
| 632 | 3300025941 | Ga0207711_10046230 | Ga0207711_100462303 | 128 |
| 633 | 3300025941 | Ga0207711_10118967 | Ga0207711_101189674 | 128 |
| 634 | 3300025942 | Ga0207689_10000150 | Ga0207689_1000015052 | 128 |
| 635 | 3300025945 | Ga0207679_10083942 | Ga0207679_100839423 | 128 |
| 636 | 3300025945 | Ga0207679_10277740 | Ga0207679_102777402 | 128 |
| 637 | 3300025945 | Ga0207679_11498423 | Ga0207679_114984232 | 128 |
| 638 | 3300025949 | Ga0207667_10223884 | Ga0207667_102238842 | 128 |
| 639 | 3300025949 | Ga0207667_10307577 | Ga0207667_103075771 | 128 |
| 640 | 3300025949 | Ga0207667_10821888 | Ga0207667_108218882 | 128 |
| 641 | 3300025960 | Ga0207651_10036335 | Ga0207651_100363352 | 128 |
| 642 | 3300025960 | Ga0207651_10182804 | Ga0207651_101828042 | 128 |
| 643 | 3300025972 | Ga0207668_10171906 | Ga0207668_101719062 | 128 |
| 644 | 3300025981 | Ga0207640_10061385 | Ga0207640_100613854 | 128 |
| 645 | 3300025981 | Ga0207640_10159840 | Ga0207640_101598402 | 128 |
| 646 | 3300025981 | Ga0207640_11002290 | Ga0207640_110022901 | 128 |
| 647 | 3300025986 | Ga0207658_10275815 | Ga0207658_102758152 | 128 |
| 648 | 3300025986 | Ga0207658_11133683 | Ga0207658_111336832 | 128 |
| 649 | 3300026023 | Ga0207677_10012436 | Ga0207677_100124366 | 128 |
| 650 | 3300026035 | Ga0207703_10030559 | Ga0207703_100305596 | 128 |
| 651 | 3300026035 | Ga0207703_10047106 | Ga0207703_100471063 | 128 |
| 652 | 3300026035 | Ga0207703_10875308 | Ga0207703_108753082 | 128 |
| 653 | 3300026041 | Ga0207639_10053565 | Ga0207639_100535652 | 128 |
| 654 | 3300026041 | Ga0207639_11580365 | Ga0207639_115803652 | 128 |
| 655 | 3300026067 | Ga0207678_10002944 | Ga0207678_100029449 | 128 |
| 656 | 3300026075 | Ga0207708_10680046 | Ga0207708_106800462 | 128 |
| 657 | 3300026078 | Ga0207702_10046560 | Ga0207702_100465606 | 128 |
| 658 | 3300026088 | Ga0207641_10576045 | Ga0207641_105760452 | 128 |
| 659 | 3300026088 | Ga0207641_10919223 | Ga0207641_109192232 | 128 |
| 660 | 3300026088 | Ga0207641_11041584 | Ga0207641_110415842 | 128 |
| 661 | 3300026089 | Ga0207648_10561469 | Ga0207648_105614691 | 128 |
| 662 | 3300026089 | Ga0207648_10765479 | Ga0207648_107654791 | 128 |
| 663 | 3300026095 | Ga0207676_10063161 | Ga0207676_100631614 | 128 |
| 664 | 3300026095 | Ga0207676_10063624 | Ga0207676_100636244 | 128 |
| 665 | 3300026095 | Ga0207676_10184572 | Ga0207676_101845722 | 128 |
| 666 | 3300026116 | Ga0207674_10020946 | Ga0207674_100209466 | 128 |
| 667 | 3300026116 | Ga0207674_10878405 | Ga0207674_108784052 | 128 |
| 668 | 3300026118 | Ga0207675_100001131 | Ga0207675_10000113129 | 128 |
| 669 | 3300026121 | Ga0207683_10034729 | Ga0207683_100347293 | 128 |
| 670 | 3300026121 | Ga0207683_10064766 | Ga0207683_100647664 | 128 |
| 671 | 3300026142 | Ga0207698_10016066 | Ga0207698_100160666 | 128 |
| 672 | 3300026142 | Ga0207698_10289791 | Ga0207698_102897913 | 128 |
| 673 | 3300027671 | Ga0209588_1052034 | Ga0209588_10520341 | 128 |
| 674 | 3300027866 | Ga0209813_10092905 | Ga0209813_100929051 | 128 |
| 675 | 3300027907 | Ga0207428_10076303 | Ga0207428_100763033 | 128 |
| 676 | 3300028381 | Ga0268264_10080643 | Ga0268264_100806434 | 128 |
| 677 | 3300031238 | Ga0265332_10024451 | Ga0265332_100244512 | 128 |
| 678 | 3300031239 | Ga0265328_10052951 | Ga0265328_100529513 | 128 |
| 679 | 3300031242 | Ga0265329_10013217 | Ga0265329_100132173 | 128 |
| 680 | 3300031250 | Ga0265331_10069940 | Ga0265331_100699402 | 128 |
| 681 | 3300031344 | Ga0265316_10273699 | Ga0265316_102736992 | 128 |
| 682 | 3300031548 | Ga0307408_100168832 | Ga0307408_1001688323 | 128 |
| 683 | 3300031731 | Ga0307405_10100216 | Ga0307405_101002162 | 128 |
| 684 | 3300031824 | Ga0307413_10281625 | Ga0307413_102816252 | 128 |
| 685 | 3300031852 | Ga0307410_10198657 | Ga0307410_101986573 | 128 |
| 686 | 3300031901 | Ga0307406_10647142 | Ga0307406_106471421 | 128 |
| 687 | 3300031901 | Ga0307406_10872865 | Ga0307406_108728652 | 128 |
| 688 | 3300031901 | Ga0307406_11098634 | Ga0307406_110986342 | 128 |
| 689 | 3300031903 | Ga0307407_10333253 | Ga0307407_103332531 | 128 |
| 690 | 3300031903 | Ga0307407_11169890 | Ga0307407_111698902 | 128 |
| 691 | 3300031911 | Ga0307412_10012955 | Ga0307412_100129552 | 128 |
| 692 | 3300031995 | Ga0307409_100325083 | Ga0307409_1003250832 | 128 |
| 693 | 3300031995 | Ga0307409_100393451 | Ga0307409_1003934512 | 128 |
| 694 | 3300032002 | Ga0307416_100002702 | Ga0307416_10000270214 | 128 |
| 695 | 3300032002 | Ga0307416_103638900 | Ga0307416_1036389001 | 128 |
| 696 | 3300032005 | Ga0307411_10325565 | Ga0307411_103255652 | 128 |
| 697 | 3300032005 | Ga0307411_10382218 | Ga0307411_103822182 | 128 |
| 698 | 3300032005 | Ga0307411_11783030 | Ga0307411_117830301 | 128 |
| 699 | 3300035207 | Ga0373942_0063074 | Ga0373942_0063074_587_973 | 128 |
| 700 | 3300035241 | Ga0373961_0024198 | Ga0373961_0024198_186_572 | 128 |
| 701 | 3300037418 | Ga0395900_0068359 | Ga0395900_0068359_1604_1990 | 128 |
| 702 | 3300037471 | Ga0395905_0612190 | Ga0395905_0612190_182_568 | 128 |
| 703 | 3300038443 | Ga0395901_0407129 | Ga0395901_0407129_20_415 | 128 |
| 704 | 3300039062 | Ga0400483_078643 | Ga0400483_078643_3077_3466 | 128 |
| 705 | 3300039062 | Ga0400483_260254 | Ga0400483_260254_4348_4737 | 128 |
| 706 | 3300039437 | Ga0436365_1519697 | Ga0436365_1519697_431_817 | 128 |
| 707 | 3300039447 | Ga0436361_0239425 | Ga0436361_0239425_3983_4378 | 128 |
| 708 | 3300041999 | Ga0439433_0093801 | Ga0439433_0093801_189_575 | 128 |
| 709 | 3300042008 | Ga0439450_093737 | Ga0439450_093737_146_532 | 128 |
| 710 | 3300042012 | Ga0439455_0232008 | Ga0439455_0232008_43_429 | 128 |
| 711 | 3300042014 | Ga0439457_038319 | Ga0439457_038319_499_885 | 128 |
| 712 | 3300042145 | Ga0450906_065311 | Ga0450906_065311_30_416 | 128 |
| 713 | 3300042156 | Ga0439446_0044458 | Ga0439446_0044458_434_820 | 128 |
| 714 | 3300042439 | Ga0439464_0028302 | Ga0439464_0028302_127_513 | 128 |
| 715 | 3300042461 | Ga0439460_0006452 | Ga0439460_0006452_94_480 | 128 |
| 716 | 3300042876 | Ga0451577_0796240 | Ga0451577_0796240_172_558 | 128 |
| 717 | 3300044684 | Ga0466966_0800219 | Ga0466966_0800219_74_460 | 128 |
| 718 | 3300044694 | Ga0466963_0303647 | Ga0466963_0303647_54_443 | 128 |
| 719 | 3300045836 | Ga0466958_0328258 | Ga0466958_0328258_444_833 | 128 |
| 720 | 3300046477 | Ga0495664_0606109 | Ga0495664_0606109_65_451 | 128 |
| 721 | 3300046513 | Ga0495616_0174567 | Ga0495616_0174567_553_939 | 128 |
| 722 | 3300046518 | Ga0495631_0094953 | Ga0495631_0094953_629_1015 | 128 |
| 723 | 3300046519 | Ga0495632_0011776 | Ga0495632_0011776_1081_1467 | 128 |
| 724 | 3300046531 | Ga0495665_0093842 | Ga0495665_0093842_108_494 | 128 |
| 725 | 3300046539 | Ga0495621_0153539 | Ga0495621_0153539_487_882 | 128 |
| 726 | 3300046558 | Ga0495633_0577675 | Ga0495633_0577675_40_426 | 128 |
| 727 | 3300046660 | Ga0495625_0225021 | Ga0495625_0225021_162_548 | 128 |
| 728 | 3300046684 | Ga0495669_0081242 | Ga0495669_0081242_573_959 | 128 |
| 729 | 3300046694 | Ga0495649_0013683 | Ga0495649_0013683_268_654 | 128 |
| 730 | 3300046810 | Ga0495660_0034709 | Ga0495660_0034709_433_819 | 128 |
| 731 | 3300048907 | Ga0496104_0559640 | Ga0496104_0559640_106_492 | 128 |
| 732 | 3300048911 | Ga0496108_1747674 | Ga0496108_1747674_44_433 | 128 |
| 733 | 3300048912 | Ga0496109_0317221 | Ga0496109_0317221_74_463 | 128 |
| 734 | 3300049570 | Ga0501033_0259284 | Ga0501033_0259284_468_854 | 128 |
| 735 | 3300049583 | Ga0501067_0872232 | Ga0501067_0872232_82_468 | 128 |
| 736 | 3300049590 | Ga0501074_0813146 | Ga0501074_0813146_183_569 | 128 |
| 737 | 3300049592 | Ga0501076_0130391 | Ga0501076_0130391_1047_1433 | 128 |
| 738 | 3300049742 | Ga0501080_1203144 | Ga0501080_1203144_59_445 | 128 |
| 739 | 3300049822 | Ga0501035_0995495 | Ga0501035_0995495_27_413 | 128 |
| 740 | 3300050490 | nmdc:mga03n38_5373_c1 | nmdc:mga03n38_5373_c1_3801_4187 | 128 |
| 741 | 3300050491 | nmdc:mga00v17_292411_c1 | nmdc:mga00v17_292411_c1_384_770 | 128 |
| 742 | 3300050492 | nmdc:mga0yw44_254161_c1 | nmdc:mga0yw44_254161_c1_734_1120 | 128 |
| 743 | 3300050493 | nmdc:mga0k408_1682_c1 | nmdc:mga0k408_1682_c1_9099_9485 | 128 |
| 744 | 3300050494 | nmdc:mga06z11_293909_c1 | nmdc:mga06z11_293909_c1_267_653 | 128 |
| 745 | 3300050495 | nmdc:mga04h51_386840_c1 | nmdc:mga04h51_386840_c1_130_516 | 128 |
| 746 | 3300050496 | nmdc:mga07m45_157133_c1 | nmdc:mga07m45_157133_c1_490_876 | 128 |
| 747 | 3300050509 | nmdc:mga0qj67_388631_c1 | nmdc:mga0qj67_388631_c1_634_1020 | 128 |
| 748 | 3300050512 | nmdc:mga0n895_432_c1 | nmdc:mga0n895_432_c1_2873_3259 | 128 |
| 749 | 3300050513 | nmdc:mga0rr50_173645_c1 | nmdc:mga0rr50_173645_c1_1345_1731 | 128 |
| 750 | 3300050514 | nmdc:mga08x19_45268_c1 | nmdc:mga08x19_45268_c1_1577_1963 | 128 |
| 751 | 3300050515 | nmdc:mga0a205_799884_c1 | nmdc:mga0a205_799884_c1_171_557 | 128 |
| 752 | 3300050516 | nmdc:mga0sz30_261490_c1 | nmdc:mga0sz30_261490_c1_169_555 | 128 |
| 753 | 3300053160 | Ga0500633_0177078 | Ga0500633_0177078_132_518 | 128 |
| 754 | 3300054114 | Ga0501084_0493912 | Ga0501084_0493912_510_896 | 128 |
| 755 | 3300059421 | Ga0590071_065942 | Ga0590071_065942_484_870 | 128 |
| 756 | 3300003771 | Ga0055526_1000063 | Ga0055526_100006312 | 129 |
| 757 | 3300005334 | Ga0068869_100628228 | Ga0068869_1006282282 | 129 |
| 758 | 3300005337 | Ga0070682_100013740 | Ga0070682_1000137403 | 129 |
| 759 | 3300005339 | Ga0070660_100002145 | Ga0070660_1000021453 | 129 |
| 760 | 3300005340 | Ga0070689_100954472 | Ga0070689_1009544722 | 129 |
| 761 | 3300005344 | Ga0070661_100003784 | Ga0070661_1000037842 | 129 |
| 762 | 3300005347 | Ga0070668_101073529 | Ga0070668_1010735291 | 129 |
| 763 | 3300005366 | Ga0070659_100014894 | Ga0070659_1000148945 | 129 |
| 764 | 3300005406 | Ga0070703_10124524 | Ga0070703_101245242 | 129 |
| 765 | 3300005445 | Ga0070708_100156079 | Ga0070708_1001560794 | 129 |
| 766 | 3300005455 | Ga0070663_100968974 | Ga0070663_1009689742 | 129 |
| 767 | 3300005456 | Ga0070678_100409481 | Ga0070678_1004094812 | 129 |
| 768 | 3300005457 | Ga0070662_100024603 | Ga0070662_1000246034 | 129 |
| 769 | 3300005459 | Ga0068867_100099511 | Ga0068867_1000995114 | 129 |
| 770 | 3300005539 | Ga0068853_100369445 | Ga0068853_1003694453 | 129 |
| 771 | 3300005563 | Ga0068855_101614744 | Ga0068855_1016147441 | 129 |
| 772 | 3300005564 | Ga0070664_100016501 | Ga0070664_1000165015 | 129 |
| 773 | 3300005577 | Ga0068857_100270774 | Ga0068857_1002707742 | 129 |
| 774 | 3300005578 | Ga0068854_100034288 | Ga0068854_1000342881 | 129 |
| 775 | 3300005616 | Ga0068852_100094552 | Ga0068852_1000945522 | 129 |
| 776 | 3300005842 | Ga0068858_100977808 | Ga0068858_1009778081 | 129 |
| 777 | 3300005843 | Ga0068860_100503270 | Ga0068860_1005032702 | 129 |
| 778 | 3300006048 | Ga0075363_100193098 | Ga0075363_1001930982 | 129 |
| 779 | 3300006051 | Ga0075364_10690641 | Ga0075364_106906412 | 129 |
| 780 | 3300006178 | Ga0075367_10433559 | Ga0075367_104335592 | 129 |
| 781 | 3300009094 | Ga0111539_11826380 | Ga0111539_118263802 | 129 |
| 782 | 3300025250 | Ga0209026_1001836 | Ga0209026_10018363 | 129 |
| 783 | 3300025907 | Ga0207645_10323101 | Ga0207645_103231011 | 129 |
| 784 | 3300025908 | Ga0207643_10706685 | Ga0207643_107066851 | 129 |
| 785 | 3300025911 | Ga0207654_11180043 | Ga0207654_111800431 | 129 |
| 786 | 3300025914 | Ga0207671_10080363 | Ga0207671_100803632 | 129 |
| 787 | 3300025919 | Ga0207657_10001356 | Ga0207657_100013568 | 129 |
| 788 | 3300025920 | Ga0207649_10008692 | Ga0207649_100086923 | 129 |
| 789 | 3300025920 | Ga0207649_10213913 | Ga0207649_102139131 | 129 |
| 790 | 3300025927 | Ga0207687_10135575 | Ga0207687_101355752 | 129 |
| 791 | 3300025932 | Ga0207690_10008492 | Ga0207690_100084925 | 129 |
| 792 | 3300025933 | Ga0207706_10020371 | Ga0207706_100203713 | 129 |
| 793 | 3300025934 | Ga0207686_10910490 | Ga0207686_109104901 | 129 |
| 794 | 3300025935 | Ga0207709_10813999 | Ga0207709_108139992 | 129 |
| 795 | 3300025935 | Ga0207709_11750571 | Ga0207709_117505711 | 129 |
| 796 | 3300025936 | Ga0207670_10797064 | Ga0207670_107970642 | 129 |
| 797 | 3300025940 | Ga0207691_11130370 | Ga0207691_111303702 | 129 |
| 798 | 3300025941 | Ga0207711_11271343 | Ga0207711_112713431 | 129 |
| 799 | 3300025942 | Ga0207689_10729710 | Ga0207689_107297102 | 129 |
| 800 | 3300025945 | Ga0207679_10012145 | Ga0207679_100121455 | 129 |
| 801 | 3300025945 | Ga0207679_10020511 | Ga0207679_100205113 | 129 |
| 802 | 3300025960 | Ga0207651_10550739 | Ga0207651_105507392 | 129 |
| 803 | 3300025972 | Ga0207668_11098077 | Ga0207668_110980771 | 129 |
| 804 | 3300026023 | Ga0207677_10902991 | Ga0207677_109029911 | 129 |
| 805 | 3300026041 | Ga0207639_10140530 | Ga0207639_101405302 | 129 |
| 806 | 3300026116 | Ga0207674_10023098 | Ga0207674_100230986 | 129 |
| 807 | 3300027695 | Ga0209966_1001722 | Ga0209966_10017224 | 129 |
| 808 | 3300031730 | Ga0307516_10784276 | Ga0307516_107842762 | 129 |
| 809 | 3300032002 | Ga0307416_100180331 | Ga0307416_1001803312 | 129 |
| 810 | 3300032002 | Ga0307416_100460126 | Ga0307416_1004601263 | 129 |
| 811 | 3300035111 | Ga0373923_0103358 | Ga0373923_0103358_394_783 | 129 |
| 812 | 3300035112 | Ga0373932_0042968 | Ga0373932_0042968_767_1159 | 129 |
| 813 | 3300035170 | Ga0373943_0322287 | Ga0373943_0322287_435_824 | 129 |
| 814 | 3300037068 | Ga0373925_0766317 | Ga0373925_0766317_391_780 | 129 |
| 815 | 3300038443 | Ga0395901_0387167 | Ga0395901_0387167_664_1053 | 129 |
| 816 | 3300042876 | Ga0451577_0103577 | Ga0451577_0103577_339_728 | 129 |
| 817 | 3300044656 | Ga0466969_0276076 | Ga0466969_0276076_269_658 | 129 |
| 818 | 3300044658 | Ga0466972_0003323 | Ga0466972_0003323_5330_5719 | 129 |
| 819 | 3300044658 | Ga0466972_0285913 | Ga0466972_0285913_185_574 | 129 |
| 820 | 3300044683 | Ga0466965_0000489 | Ga0466965_0000489_10921_11310 | 129 |
| 821 | 3300044683 | Ga0466965_0174393 | Ga0466965_0174393_145_534 | 129 |
| 822 | 3300044684 | Ga0466966_0659804 | Ga0466966_0659804_198_587 | 129 |
| 823 | 3300044706 | Ga0466964_0002101 | Ga0466964_0002101_3679_4068 | 129 |
| 824 | 3300044712 | Ga0453684_0064524 | Ga0453684_0064524_2517_2906 | 129 |
| 825 | 3300044735 | Ga0466968_0014107 | Ga0466968_0014107_2291_2680 | 129 |
| 826 | 3300044842 | Ga0466957_1269221 | Ga0466957_1269221_27_482 | 129 |
| 827 | 3300044901 | Ga0466960_0006510 | Ga0466960_0006510_2812_3204 | 129 |
| 828 | 3300045049 | Ga0466959_0367182 | Ga0466959_0367182_371_760 | 129 |
| 829 | 3300045049 | Ga0466959_0594114 | Ga0466959_0594114_101_490 | 129 |
| 830 | 3300045051 | Ga0451576_0442008 | Ga0451576_0442008_444_845 | 129 |
| 831 | 3300046501 | Ga0495607_0010963 | Ga0495607_0010963_1948_2337 | 129 |
| 832 | 3300046506 | Ga0495583_0044197 | Ga0495583_0044197_1667_2056 | 129 |
| 833 | 3300046507 | Ga0495606_0002227 | Ga0495606_0002227_9869_10297 | 129 |
| 834 | 3300046507 | Ga0495606_0004441 | Ga0495606_0004441_1718_2107 | 129 |
| 835 | 3300046528 | Ga0495642_0098491 | Ga0495642_0098491_579_968 | 129 |
| 836 | 3300046530 | Ga0495654_0059332 | Ga0495654_0059332_1441_1830 | 129 |
| 837 | 3300046538 | Ga0495609_0134826 | Ga0495609_0134826_544_933 | 129 |
| 838 | 3300046539 | Ga0495621_0525679 | Ga0495621_0525679_28_417 | 129 |
| 839 | 3300046543 | Ga0495645_0422672 | Ga0495645_0422672_68_460 | 129 |
| 840 | 3300046615 | Ga0495656_0170437 | Ga0495656_0170437_234_626 | 129 |
| 841 | 3300046665 | Ga0495661_0403427 | Ga0495661_0403427_257_652 | 129 |
| 842 | 3300046674 | Ga0495588_0000248 | Ga0495588_0000248_9302_9697 | 129 |
| 843 | 3300047317 | Ga0495604_0094873 | Ga0495604_0094873_983_1372 | 129 |
| 844 | 3300047320 | Ga0495672_0000014 | Ga0495672_0000014_203929_204324 | 129 |
| 845 | 3300047443 | Ga0495687_022632 | Ga0495687_022632_2163_2552 | 129 |
| 846 | 3300047445 | Ga0495677_0006688 | Ga0495677_0006688_15_410 | 129 |
| 847 | 3300047469 | Ga0495673_0182490 | Ga0495673_0182490_17_406 | 129 |
| 848 | 3300048091 | Ga0495626_0129400 | Ga0495626_0129400_278_667 | 129 |
| 849 | 3300048905 | Ga0496102_0128757 | Ga0496102_0128757_1118_1513 | 129 |
| 850 | 3300048914 | Ga0496111_0951895 | Ga0496111_0951895_212_607 | 129 |
| 851 | 3300048917 | Ga0496114_0828258 | Ga0496114_0828258_392_781 | 129 |
| 852 | 3300048918 | Ga0496115_0297697 | Ga0496115_0297697_159_548 | 129 |
| 853 | 3300048927 | Ga0496124_0282901 | Ga0496124_0282901_572_970 | 129 |
| 854 | 3300049520 | Ga0501297_074797 | Ga0501297_074797_124_513 | 129 |
| 855 | 3300049521 | Ga0501298_119295 | Ga0501298_119295_99_488 | 129 |
| 856 | 3300049571 | Ga0501034_0511114 | Ga0501034_0511114_180_569 | 129 |
| 857 | 3300049589 | Ga0501073_1186734 | Ga0501073_1186734_99_488 | 129 |
| 858 | 3300049742 | Ga0501080_0798529 | Ga0501080_0798529_246_758 | 129 |
| 859 | 3300049757 | Ga0501232_030868 | Ga0501232_030868_256_657 | 129 |
| 860 | 3300053134 | Ga0500658_0003329 | Ga0500658_0003329_4587_4976 | 129 |
| 861 | 3300053139 | Ga0500568_0047444 | Ga0500568_0047444_353_742 | 129 |
| 862 | 3300061719 | Ga0466962_0044798 | Ga0466962_0044798_680_1069 | 129 |
| 863 | 3300003794 | Ga0055531_10000992 | Ga0055531_100009922 | 130 |
| 864 | 3300005436 | Ga0070713_100193456 | Ga0070713_1001934563 | 130 |
| 865 | 3300006353 | Ga0075370_10412510 | Ga0075370_104125102 | 130 |
| 866 | 3300025273 | Ga0209673_1046816 | Ga0209673_10468162 | 130 |
| 867 | 3300025932 | Ga0207690_10305092 | Ga0207690_103050922 | 130 |
| 868 | 3300025939 | Ga0207665_10119669 | Ga0207665_101196693 | 130 |
| 869 | 3300031239 | Ga0265328_10082897 | Ga0265328_100828972 | 130 |
| 870 | 3300032002 | Ga0307416_100333748 | Ga0307416_1003337483 | 130 |
| 871 | 3300037418 | Ga0395900_0037359 | Ga0395900_0037359_1480_1872 | 130 |
| 872 | 3300042876 | Ga0451577_0002065 | Ga0451577_0002065_7418_7822 | 130 |
| 873 | 3300044656 | Ga0466969_0000349 | Ga0466969_0000349_12684_13088 | 130 |
| 874 | 3300044658 | Ga0466972_0010708 | Ga0466972_0010708_2767_3159 | 130 |
| 875 | 3300044683 | Ga0466965_0003742 | Ga0466965_0003742_3513_3905 | 130 |
| 876 | 3300044693 | Ga0466961_0502743 | Ga0466961_0502743_316_708 | 130 |
| 877 | 3300044735 | Ga0466968_0043104 | Ga0466968_0043104_369_761 | 130 |
| 878 | 3300044765 | Ga0466970_0095225 | Ga0466970_0095225_873_1265 | 130 |
| 879 | 3300053084 | Ga0495595_0334568 | Ga0495595_0334568_349_744 | 130 |
| 880 | 3300061719 | Ga0466962_0669419 | Ga0466962_0669419_81_473 | 130 |
| 881 | 3300005459 | Ga0068867_100691765 | Ga0068867_1006917652 | 131 |
| 882 | 3300005549 | Ga0070704_100476839 | Ga0070704_1004768392 | 131 |
| 883 | 3300013307 | Ga0157372_10428020 | Ga0157372_104280203 | 131 |
| 884 | 3300037471 | Ga0395905_1110335 | Ga0395905_1110335_197_616 | 131 |
| 885 | 3300041404 | Ga0439436_0175784 | Ga0439436_0175784_36_431 | 131 |
| 886 | 3300041405 | Ga0439438_085533 | Ga0439438_085533_296_691 | 131 |
| 887 | 3300041408 | Ga0439453_0006038 | Ga0439453_0006038_1188_1583 | 131 |
| 888 | 3300041410 | Ga0439461_0133137 | Ga0439461_0133137_26_421 | 131 |
| 889 | 3300042003 | Ga0439443_124526 | Ga0439443_124526_77_472 | 131 |
| 890 | 3300042156 | Ga0439446_0015332 | Ga0439446_0015332_59_454 | 131 |
| 891 | 3300042184 | Ga0450908_019422 | Ga0450908_019422_456_851 | 131 |
| 892 | 3300042185 | Ga0450909_030549 | Ga0450909_030549_275_670 | 131 |
| 893 | 3300045051 | Ga0451576_0004860 | Ga0451576_0004860_5677_6072 | 131 |
| 894 | 3300046537 | Ga0495598_0239456 | Ga0495598_0239456_10_405 | 131 |
| 895 | iso_pu_bacteria | 2511231003 | 2511248102 | 131 |
| 896 | iso_pu_bacteria | 2643221556 | 2643800509 | 131 |
| 897 | iso_pu_bacteria | 2643221684 | 2644470418 | 131 |
| 898 | iso_pu_bacteria | 2808606418 | 2809144018 | 131 |
| 899 | iso_pu_bacteria | 2834641062 | 2834645437 | 131 |
| 900 | iso_pu_bacteria | 2857564685 | 2857566205 | 131 |
| 901 | iso_pu_bacteria | 8003400568 | 8003400645 | 131 |
| 902 | iso_pu_bacteria | 8047673197 | 8047678814 | 131 |
| 903 | 3300032004 | Ga0307414_10483247 | Ga0307414_104832472 | 132 |
| 904 | 3300042876 | Ga0451577_0028662 | Ga0451577_0028662_240_638 | 132 |
| 905 | 3300005331 | Ga0070670_100631372 | Ga0070670_1006313721 | 133 |
| 906 | 3300013104 | Ga0157370_10923974 | Ga0157370_109239742 | 133 |
| 907 | 3300014969 | Ga0157376_12490579 | Ga0157376_124905791 | 133 |
| 908 | 3300025925 | Ga0207650_10749426 | Ga0207650_107494261 | 133 |
| 909 | 3300037418 | Ga0395900_0489864 | Ga0395900_0489864_176_589 | 133 |
| 910 | 3300037471 | Ga0395905_0304019 | Ga0395905_0304019_265_678 | 133 |
| 911 | 3300044683 | Ga0466965_0357395 | Ga0466965_0357395_122_523 | 133 |
| 912 | 3300046522 | Ga0495643_0006666 | Ga0495643_0006666_4783_5202 | 133 |
| 913 | 3300046542 | Ga0495597_0029514 | Ga0495597_0029514_185_604 | 133 |
| 914 | 3300046616 | Ga0495668_0164494 | Ga0495668_0164494_54_473 | 133 |
| 915 | 3300046665 | Ga0495661_0002468 | Ga0495661_0002468_6254_6673 | 133 |
| 916 | 3300047443 | Ga0495687_014261 | Ga0495687_014261_902_1321 | 133 |
| 917 | 3300047443 | Ga0495687_030558 | Ga0495687_030558_1817_2227 | 133 |
| 918 | 3300048905 | Ga0496102_0004117 | Ga0496102_0004117_8156_8584 | 133 |
| 919 | 3300048910 | Ga0496107_0497102 | Ga0496107_0497102_33_461 | 133 |
| 920 | 3300037471 | Ga0395905_0001323 | Ga0395905_0001323_23650_24066 | 134 |
| 921 | 3300002705 | JGI25156J39149_1001186 | JGI25156J39149_10011866 | 135 |
| 922 | 3300002738 | JGI25154J39366_1001057 | JGI25154J39366_10010574 | 135 |
| 923 | 3300003187 | JGI25151J46595_10005067 | JGI25151J46595_100050676 | 135 |
| 924 | 3300003187 | JGI25151J46595_10067132 | JGI25151J46595_100671322 | 135 |
| 925 | 3300003322 | rootL2_10001292 | rootL2_100012923 | 135 |
| 926 | 3300003574 | Ga0007410J51695_1074680 | Ga0007410J51695_10746801 | 135 |
| 927 | 3300003575 | Ga0007409J51694_1010148 | Ga0007409J51694_10101482 | 135 |
| 928 | 3300003577 | Ga0007416J51690_1030046 | Ga0007416J51690_10300463 | 135 |
| 929 | 3300003771 | Ga0055526_1006081 | Ga0055526_10060813 | 135 |
| 930 | 3300003771 | Ga0055526_1006214 | Ga0055526_10062143 | 135 |
| 931 | 3300003775 | Ga0055524_1027986 | Ga0055524_10279862 | 135 |
| 932 | 3300003781 | Ga0055536_1000150 | Ga0055536_100015048 | 135 |
| 933 | 3300003784 | Ga0055534_1002354 | Ga0055534_10023545 | 135 |
| 934 | 3300004625 | Ga0055543_1058690 | Ga0055543_10586901 | 135 |
| 935 | 3300005262 | Ga0065165_1001336 | Ga0065165_100133623 | 135 |
| 936 | 3300005262 | Ga0065165_1030399 | Ga0065165_10303994 | 135 |
| 937 | 3300005327 | Ga0070658_10649225 | Ga0070658_106492252 | 135 |
| 938 | 3300005327 | Ga0070658_10875855 | Ga0070658_108758551 | 135 |
| 939 | 3300005339 | Ga0070660_100601408 | Ga0070660_1006014081 | 135 |
| 940 | 3300005366 | Ga0070659_100101143 | Ga0070659_1001011433 | 135 |
| 941 | 3300005455 | Ga0070663_100940293 | Ga0070663_1009402932 | 135 |
| 942 | 3300005457 | Ga0070662_100254611 | Ga0070662_1002546111 | 135 |
| 943 | 3300005530 | Ga0070679_100410893 | Ga0070679_1004108932 | 135 |
| 944 | 3300005539 | Ga0068853_100860240 | Ga0068853_1008602401 | 135 |
| 945 | 3300005563 | Ga0068855_100042921 | Ga0068855_1000429213 | 135 |
| 946 | 3300005563 | Ga0068855_100654019 | Ga0068855_1006540192 | 135 |
| 947 | 3300005564 | Ga0070664_100478778 | Ga0070664_1004787782 | 135 |
| 948 | 3300005614 | Ga0068856_100154981 | Ga0068856_1001549812 | 135 |
| 949 | 3300005834 | Ga0068851_10525089 | Ga0068851_105250892 | 135 |
| 950 | 3300006028 | Ga0070717_10057081 | Ga0070717_100570814 | 135 |
| 951 | 3300009098 | Ga0105245_10520117 | Ga0105245_105201172 | 135 |
| 952 | 3300009148 | Ga0105243_10004726 | Ga0105243_100047263 | 135 |
| 953 | 3300009174 | Ga0105241_10010400 | Ga0105241_100104006 | 135 |
| 954 | 3300009174 | Ga0105241_11737655 | Ga0105241_117376551 | 135 |
| 955 | 3300009176 | Ga0105242_10088648 | Ga0105242_100886483 | 135 |
| 956 | 3300009545 | Ga0105237_10226287 | Ga0105237_102262873 | 135 |
| 957 | 3300009551 | Ga0105238_10065910 | Ga0105238_100659105 | 135 |
| 958 | 3300013100 | Ga0157373_10038808 | Ga0157373_100388086 | 135 |
| 959 | 3300013102 | Ga0157371_10000064 | Ga0157371_10000064121 | 135 |
| 960 | 3300013105 | Ga0157369_10381445 | Ga0157369_103814452 | 135 |
| 961 | 3300013296 | Ga0157374_10353469 | Ga0157374_103534694 | 135 |
| 962 | 3300014497 | Ga0182008_10061920 | Ga0182008_100619202 | 135 |
| 963 | 3300015262 | Ga0182007_10017984 | Ga0182007_100179844 | 135 |
| 964 | 3300025206 | Ga0209435_100323 | Ga0209435_1003237 | 135 |
| 965 | 3300025246 | Ga0209646_1000283 | Ga0209646_10002838 | 135 |
| 966 | 3300025254 | Ga0209148_1001569 | Ga0209148_100156911 | 135 |
| 967 | 3300025256 | Ga0209759_1000548 | Ga0209759_100054840 | 135 |
| 968 | 3300025263 | Ga0209565_1016465 | Ga0209565_10164652 | 135 |
| 969 | 3300025263 | Ga0209565_1017675 | Ga0209565_10176752 | 135 |
| 970 | 3300025284 | Ga0209130_1010299 | Ga0209130_10102993 | 135 |
| 971 | 3300025291 | Ga0209675_1000449 | Ga0209675_100044914 | 135 |
| 972 | 3300025292 | Ga0209676_1000064 | Ga0209676_1000064172 | 135 |
| 973 | 3300025294 | Ga0209025_1000690 | Ga0209025_100069045 | 135 |
| 974 | 3300025294 | Ga0209025_1000746 | Ga0209025_100074649 | 135 |
| 975 | 3300025295 | Ga0209564_1000891 | Ga0209564_100089131 | 135 |
| 976 | 3300025295 | Ga0209564_1001109 | Ga0209564_100110916 | 135 |
| 977 | 3300025299 | Ga0209256_1000193 | Ga0209256_100019353 | 135 |
| 978 | 3300025303 | Ga0209051_1012476 | Ga0209051_10124762 | 135 |
| 979 | 3300025909 | Ga0207705_10006851 | Ga0207705_100068519 | 135 |
| 980 | 3300025909 | Ga0207705_10561058 | Ga0207705_105610581 | 135 |
| 981 | 3300025911 | Ga0207654_10005360 | Ga0207654_100053605 | 135 |
| 982 | 3300025913 | Ga0207695_10414780 | Ga0207695_104147802 | 135 |
| 983 | 3300025914 | Ga0207671_10137847 | Ga0207671_101378472 | 135 |
| 984 | 3300025917 | Ga0207660_11171119 | Ga0207660_111711191 | 135 |
| 985 | 3300025919 | Ga0207657_10037997 | Ga0207657_100379976 | 135 |
| 986 | 3300025921 | Ga0207652_10696569 | Ga0207652_106965692 | 135 |
| 987 | 3300025924 | Ga0207694_10125141 | Ga0207694_101251413 | 135 |
| 988 | 3300025927 | Ga0207687_10513131 | Ga0207687_105131312 | 135 |
| 989 | 3300025932 | Ga0207690_10032989 | Ga0207690_100329894 | 135 |
| 990 | 3300025932 | Ga0207690_11669074 | Ga0207690_116690742 | 135 |
| 991 | 3300025933 | Ga0207706_10091464 | Ga0207706_100914643 | 135 |
| 992 | 3300025934 | Ga0207686_10023141 | Ga0207686_100231412 | 135 |
| 993 | 3300025940 | Ga0207691_10341381 | Ga0207691_103413811 | 135 |
| 994 | 3300025945 | Ga0207679_10087149 | Ga0207679_100871493 | 135 |
| 995 | 3300025949 | Ga0207667_10016294 | Ga0207667_1001629410 | 135 |
| 996 | 3300026041 | Ga0207639_11485460 | Ga0207639_114854601 | 135 |
| 997 | 3300026142 | Ga0207698_10129121 | Ga0207698_101291212 | 135 |
| 998 | 3300031251 | Ga0265327_10000235 | Ga0265327_1000023539 | 135 |
| 999 | 3300037312 | Ga0395899_0007451 | Ga0395899_0007451_3681_4094 | 135 |
| 1000 | 3300037312 | Ga0395899_0035375 | Ga0395899_0035375_1453_1866 | 135 |
| 1001 | 3300037312 | Ga0395899_0240357 | Ga0395899_0240357_806_1219 | 135 |
| 1002 | 3300037418 | Ga0395900_0000846 | Ga0395900_0000846_9506_9919 | 135 |
| 1003 | 3300037418 | Ga0395900_0016251 | Ga0395900_0016251_2269_2682 | 135 |
| 1004 | 3300037418 | Ga0395900_0032975 | Ga0395900_0032975_2487_2900 | 135 |
| 1005 | 3300037418 | Ga0395900_0076227 | Ga0395900_0076227_2652_3065 | 135 |
| 1006 | 3300037418 | Ga0395900_0192550 | Ga0395900_0192550_591_1004 | 135 |
| 1007 | 3300037418 | Ga0395900_0451656 | Ga0395900_0451656_56_469 | 135 |
| 1008 | 3300037418 | Ga0395900_0702634 | Ga0395900_0702634_336_749 | 135 |
| 1009 | 3300037466 | Ga0395898_0535860 | Ga0395898_0535860_426_839 | 135 |
| 1010 | 3300037466 | Ga0395898_0807538 | Ga0395898_0807538_49_462 | 135 |
| 1011 | 3300037471 | Ga0395905_0047866 | Ga0395905_0047866_3180_3593 | 135 |
| 1012 | 3300037471 | Ga0395905_0981921 | Ga0395905_0981921_286_699 | 135 |
| 1013 | 3300037471 | Ga0395905_1358427 | Ga0395905_1358427_95_508 | 135 |
| 1014 | 3300038443 | Ga0395901_0000730 | Ga0395901_0000730_4407_4820 | 135 |
| 1015 | 3300038443 | Ga0395901_0203522 | Ga0395901_0203522_749_1162 | 135 |
| 1016 | 3300038443 | Ga0395901_0280083 | Ga0395901_0280083_182_595 | 135 |
| 1017 | 3300038443 | Ga0395901_0456038 | Ga0395901_0456038_291_704 | 135 |
| 1018 | 3300042005 | Ga0439448_0005764 | Ga0439448_0005764_950_1363 | 135 |
| 1019 | 3300042007 | Ga0439449_0113655 | Ga0439449_0113655_448_861 | 135 |
| 1020 | 3300042139 | Ga0450904_000433 | Ga0450904_000433_7346_7759 | 135 |
| 1021 | 3300042157 | Ga0439458_0049411 | Ga0439458_0049411_239_652 | 135 |
| 1022 | 3300044656 | Ga0466969_0073557 | Ga0466969_0073557_321_734 | 135 |
| 1023 | 3300044656 | Ga0466969_0547412 | Ga0466969_0547412_26_439 | 135 |
| 1024 | 3300044683 | Ga0466965_0022215 | Ga0466965_0022215_912_1325 | 135 |
| 1025 | 3300044683 | Ga0466965_0056211 | Ga0466965_0056211_117_530 | 135 |
| 1026 | 3300044684 | Ga0466966_0009286 | Ga0466966_0009286_2007_2420 | 135 |
| 1027 | 3300044684 | Ga0466966_0058816 | Ga0466966_0058816_1486_1899 | 135 |
| 1028 | 3300044684 | Ga0466966_0124631 | Ga0466966_0124631_515_928 | 135 |
| 1029 | 3300044693 | Ga0466961_0304783 | Ga0466961_0304783_182_595 | 135 |
| 1030 | 3300044693 | Ga0466961_0314475 | Ga0466961_0314475_450_863 | 135 |
| 1031 | 3300044694 | Ga0466963_0217135 | Ga0466963_0217135_425_838 | 135 |
| 1032 | 3300044694 | Ga0466963_0455532 | Ga0466963_0455532_52_465 | 135 |
| 1033 | 3300044706 | Ga0466964_0124520 | Ga0466964_0124520_39_452 | 135 |
| 1034 | 3300044719 | Ga0466971_0048746 | Ga0466971_0048746_861_1274 | 135 |
| 1035 | 3300044719 | Ga0466971_0699625 | Ga0466971_0699625_77_490 | 135 |
| 1036 | 3300044842 | Ga0466957_0002989 | Ga0466957_0002989_3522_3935 | 135 |
| 1037 | 3300044842 | Ga0466957_0096678 | Ga0466957_0096678_718_1131 | 135 |
| 1038 | 3300045049 | Ga0466959_0080761 | Ga0466959_0080761_954_1367 | 135 |
| 1039 | 3300045049 | Ga0466959_0321614 | Ga0466959_0321614_320_733 | 135 |
| 1040 | 3300045049 | Ga0466959_0488701 | Ga0466959_0488701_80_493 | 135 |
| 1041 | 3300045836 | Ga0466958_0007467 | Ga0466958_0007467_1413_1826 | 135 |
| 1042 | 3300045836 | Ga0466958_0350471 | Ga0466958_0350471_155_568 | 135 |
| 1043 | 3300045836 | Ga0466958_0396849 | Ga0466958_0396849_203_616 | 135 |
| 1044 | 3300045836 | Ga0466958_0432877 | Ga0466958_0432877_284_697 | 135 |
| 1045 | 3300045976 | Ga0466967_0185836 | Ga0466967_0185836_1518_1931 | 135 |
| 1046 | 3300046452 | Ga0495617_000134 | Ga0495617_000134_9601_10014 | 135 |
| 1047 | 3300046452 | Ga0495617_000305 | Ga0495617_000305_9732_10145 | 135 |
| 1048 | 3300046453 | Ga0495627_000458 | Ga0495627_000458_26232_26645 | 135 |
| 1049 | 3300046453 | Ga0495627_007824 | Ga0495627_007824_99_512 | 135 |
| 1050 | 3300046455 | Ga0495603_0038945 | Ga0495603_0038945_482_895 | 135 |
| 1051 | 3300046455 | Ga0495603_0587554 | Ga0495603_0587554_27_440 | 135 |
| 1052 | 3300046455 | Ga0495603_0587564 | Ga0495603_0587564_198_611 | 135 |
| 1053 | 3300046457 | Ga0495590_0000186 | Ga0495590_0000186_9006_9419 | 135 |
| 1054 | 3300046457 | Ga0495590_0000538 | Ga0495590_0000538_10313_10726 | 135 |
| 1055 | 3300046457 | Ga0495590_0006291 | Ga0495590_0006291_2678_3091 | 135 |
| 1056 | 3300046458 | Ga0495591_000149 | Ga0495591_000149_17822_18235 | 135 |
| 1057 | 3300046458 | Ga0495591_013030 | Ga0495591_013030_1942_2355 | 135 |
| 1058 | 3300046459 | Ga0495629_0019066 | Ga0495629_0019066_2970_3383 | 135 |
| 1059 | 3300046459 | Ga0495629_0377036 | Ga0495629_0377036_198_611 | 135 |
| 1060 | 3300046459 | Ga0495629_0767210 | Ga0495629_0767210_198_611 | 135 |
| 1061 | 3300046460 | Ga0495638_0009109 | Ga0495638_0009109_4451_4864 | 135 |
| 1062 | 3300046460 | Ga0495638_0137305 | Ga0495638_0137305_95_508 | 135 |
| 1063 | 3300046463 | Ga0495653_0047322 | Ga0495653_0047322_539_952 | 135 |
| 1064 | 3300046471 | Ga0495650_0000499 | Ga0495650_0000499_140_553 | 135 |
| 1065 | 3300046471 | Ga0495650_0000666 | Ga0495650_0000666_16026_16436 | 135 |
| 1066 | 3300046471 | Ga0495650_0029067 | Ga0495650_0029067_2003_2413 | 135 |
| 1067 | 3300046472 | Ga0495580_0364301 | Ga0495580_0364301_270_683 | 135 |
| 1068 | 3300046472 | Ga0495580_0371736 | Ga0495580_0371736_108_521 | 135 |
| 1069 | 3300046473 | Ga0495582_0017109 | Ga0495582_0017109_181_594 | 135 |
| 1070 | 3300046473 | Ga0495582_0112802 | Ga0495582_0112802_49_462 | 135 |
| 1071 | 3300046474 | Ga0495605_0000317 | Ga0495605_0000317_42271_42684 | 135 |
| 1072 | 3300046474 | Ga0495605_0000351 | Ga0495605_0000351_39526_39939 | 135 |
| 1073 | 3300046474 | Ga0495605_0003626 | Ga0495605_0003626_8579_8992 | 135 |
| 1074 | 3300046474 | Ga0495605_0008785 | Ga0495605_0008785_209_622 | 135 |
| 1075 | 3300046474 | Ga0495605_0017514 | Ga0495605_0017514_1913_2326 | 135 |
| 1076 | 3300046474 | Ga0495605_0033194 | Ga0495605_0033194_2194_2607 | 135 |
| 1077 | 3300046474 | Ga0495605_0040894 | Ga0495605_0040894_791_1204 | 135 |
| 1078 | 3300046474 | Ga0495605_0054808 | Ga0495605_0054808_803_1216 | 135 |
| 1079 | 3300046474 | Ga0495605_0055543 | Ga0495605_0055543_578_991 | 135 |
| 1080 | 3300046474 | Ga0495605_0114338 | Ga0495605_0114338_562_975 | 135 |
| 1081 | 3300046475 | Ga0495639_0264113 | Ga0495639_0264113_106_519 | 135 |
| 1082 | 3300046476 | Ga0495662_0678381 | Ga0495662_0678381_42_455 | 135 |
| 1083 | 3300046477 | Ga0495664_0444856 | Ga0495664_0444856_157_570 | 135 |
| 1084 | 3300046491 | Ga0495584_0000413 | Ga0495584_0000413_4101_4514 | 135 |
| 1085 | 3300046491 | Ga0495584_0000642 | Ga0495584_0000642_14467_14880 | 135 |
| 1086 | 3300046491 | Ga0495584_0002667 | Ga0495584_0002667_7575_7988 | 135 |
| 1087 | 3300046491 | Ga0495584_0010340 | Ga0495584_0010340_1921_2334 | 135 |
| 1088 | 3300046491 | Ga0495584_0012542 | Ga0495584_0012542_1943_2356 | 135 |
| 1089 | 3300046491 | Ga0495584_0013009 | Ga0495584_0013009_2376_2789 | 135 |
| 1090 | 3300046491 | Ga0495584_0027897 | Ga0495584_0027897_2007_2420 | 135 |
| 1091 | 3300046491 | Ga0495584_0029248 | Ga0495584_0029248_2134_2547 | 135 |
| 1092 | 3300046491 | Ga0495584_0029393 | Ga0495584_0029393_502_915 | 135 |
| 1093 | 3300046491 | Ga0495584_0046724 | Ga0495584_0046724_660_1073 | 135 |
| 1094 | 3300046491 | Ga0495584_0076889 | Ga0495584_0076889_1202_1615 | 135 |
| 1095 | 3300046491 | Ga0495584_0087146 | Ga0495584_0087146_427_840 | 135 |
| 1096 | 3300046491 | Ga0495584_0088426 | Ga0495584_0088426_89_502 | 135 |
| 1097 | 3300046491 | Ga0495584_0093697 | Ga0495584_0093697_613_1026 | 135 |
| 1098 | 3300046491 | Ga0495584_0119517 | Ga0495584_0119517_693_1106 | 135 |
| 1099 | 3300046491 | Ga0495584_0389238 | Ga0495584_0389238_237_650 | 135 |
| 1100 | 3300046492 | Ga0495585_0000148 | Ga0495585_0000148_9179_9592 | 135 |
| 1101 | 3300046492 | Ga0495585_0000500 | Ga0495585_0000500_27376_27789 | 135 |
| 1102 | 3300046492 | Ga0495585_0003434 | Ga0495585_0003434_1728_2141 | 135 |
| 1103 | 3300046492 | Ga0495585_0003975 | Ga0495585_0003975_538_951 | 135 |
| 1104 | 3300046492 | Ga0495585_0004965 | Ga0495585_0004965_3230_3643 | 135 |
| 1105 | 3300046492 | Ga0495585_0010663 | Ga0495585_0010663_469_882 | 135 |
| 1106 | 3300046492 | Ga0495585_0015683 | Ga0495585_0015683_3767_4180 | 135 |
| 1107 | 3300046492 | Ga0495585_0021337 | Ga0495585_0021337_12_425 | 135 |
| 1108 | 3300046492 | Ga0495585_0051903 | Ga0495585_0051903_368_781 | 135 |
| 1109 | 3300046492 | Ga0495585_0158739 | Ga0495585_0158739_589_1002 | 135 |
| 1110 | 3300046499 | Ga0495594_0005043 | Ga0495594_0005043_3646_4059 | 135 |
| 1111 | 3300046499 | Ga0495594_0009434 | Ga0495594_0009434_19_432 | 135 |
| 1112 | 3300046499 | Ga0495594_0024113 | Ga0495594_0024113_1258_1671 | 135 |
| 1113 | 3300046499 | Ga0495594_0029417 | Ga0495594_0029417_1590_2015 | 135 |
| 1114 | 3300046499 | Ga0495594_0103591 | Ga0495594_0103591_187_600 | 135 |
| 1115 | 3300046500 | Ga0495596_0001037 | Ga0495596_0001037_9573_9986 | 135 |
| 1116 | 3300046500 | Ga0495596_0002079 | Ga0495596_0002079_5723_6136 | 135 |
| 1117 | 3300046500 | Ga0495596_0002643 | Ga0495596_0002643_328_741 | 135 |
| 1118 | 3300046500 | Ga0495596_0002945 | Ga0495596_0002945_311_724 | 135 |
| 1119 | 3300046500 | Ga0495596_0006916 | Ga0495596_0006916_46_459 | 135 |
| 1120 | 3300046500 | Ga0495596_0023774 | Ga0495596_0023774_1685_2098 | 135 |
| 1121 | 3300046500 | Ga0495596_0035603 | Ga0495596_0035603_1023_1436 | 135 |
| 1122 | 3300046500 | Ga0495596_0050451 | Ga0495596_0050451_975_1388 | 135 |
| 1123 | 3300046500 | Ga0495596_0288781 | Ga0495596_0288781_26_439 | 135 |
| 1124 | 3300046501 | Ga0495607_0000409 | Ga0495607_0000409_34817_35230 | 135 |
| 1125 | 3300046501 | Ga0495607_0000558 | Ga0495607_0000558_9826_10239 | 135 |
| 1126 | 3300046501 | Ga0495607_0000899 | Ga0495607_0000899_8794_9207 | 135 |
| 1127 | 3300046501 | Ga0495607_0002604 | Ga0495607_0002604_5847_6260 | 135 |
| 1128 | 3300046501 | Ga0495607_0006007 | Ga0495607_0006007_3522_3935 | 135 |
| 1129 | 3300046501 | Ga0495607_0010344 | Ga0495607_0010344_3468_3881 | 135 |
| 1130 | 3300046501 | Ga0495607_0010968 | Ga0495607_0010968_1935_2348 | 135 |
| 1131 | 3300046501 | Ga0495607_0019907 | Ga0495607_0019907_3632_4045 | 135 |
| 1132 | 3300046501 | Ga0495607_0115168 | Ga0495607_0115168_202_615 | 135 |
| 1133 | 3300046501 | Ga0495607_0367984 | Ga0495607_0367984_100_513 | 135 |
| 1134 | 3300046501 | Ga0495607_0508411 | Ga0495607_0508411_104_517 | 135 |
| 1135 | 3300046506 | Ga0495583_0000590 | Ga0495583_0000590_7420_7833 | 135 |
| 1136 | 3300046506 | Ga0495583_0000856 | Ga0495583_0000856_30787_31200 | 135 |
| 1137 | 3300046506 | Ga0495583_0001490 | Ga0495583_0001490_8784_9197 | 135 |
| 1138 | 3300046506 | Ga0495583_0007409 | Ga0495583_0007409_371_784 | 135 |
| 1139 | 3300046506 | Ga0495583_0013563 | Ga0495583_0013563_173_586 | 135 |
| 1140 | 3300046506 | Ga0495583_0014742 | Ga0495583_0014742_2253_2666 | 135 |
| 1141 | 3300046506 | Ga0495583_0022669 | Ga0495583_0022669_228_641 | 135 |
| 1142 | 3300046506 | Ga0495583_0079968 | Ga0495583_0079968_871_1284 | 135 |
| 1143 | 3300046507 | Ga0495606_0011116 | Ga0495606_0011116_513_926 | 135 |
| 1144 | 3300046507 | Ga0495606_0012532 | Ga0495606_0012532_2480_2893 | 135 |
| 1145 | 3300046507 | Ga0495606_0042722 | Ga0495606_0042722_1159_1572 | 135 |
| 1146 | 3300046507 | Ga0495606_0170705 | Ga0495606_0170705_787_1200 | 135 |
| 1147 | 3300046512 | Ga0495610_0000555 | Ga0495610_0000555_9049_9462 | 135 |
| 1148 | 3300046513 | Ga0495616_0000052 | Ga0495616_0000052_95644_96057 | 135 |
| 1149 | 3300046513 | Ga0495616_0001914 | Ga0495616_0001914_4371_4784 | 135 |
| 1150 | 3300046513 | Ga0495616_0003379 | Ga0495616_0003379_5324_5737 | 135 |
| 1151 | 3300046513 | Ga0495616_0006221 | Ga0495616_0006221_3520_3933 | 135 |
| 1152 | 3300046513 | Ga0495616_0010286 | Ga0495616_0010286_2372_2785 | 135 |
| 1153 | 3300046513 | Ga0495616_0011821 | Ga0495616_0011821_3211_3624 | 135 |
| 1154 | 3300046513 | Ga0495616_0015289 | Ga0495616_0015289_3657_4070 | 135 |
| 1155 | 3300046513 | Ga0495616_0042250 | Ga0495616_0042250_1609_2022 | 135 |
| 1156 | 3300046513 | Ga0495616_0074785 | Ga0495616_0074785_199_612 | 135 |
| 1157 | 3300046513 | Ga0495616_0075075 | Ga0495616_0075075_175_588 | 135 |
| 1158 | 3300046513 | Ga0495616_0261990 | Ga0495616_0261990_79_492 | 135 |
| 1159 | 3300046513 | Ga0495616_0377891 | Ga0495616_0377891_96_509 | 135 |
| 1160 | 3300046517 | Ga0495630_0046294 | Ga0495630_0046294_2612_3025 | 135 |
| 1161 | 3300046518 | Ga0495631_0003928 | Ga0495631_0003928_4540_4953 | 135 |
| 1162 | 3300046518 | Ga0495631_0004117 | Ga0495631_0004117_111_524 | 135 |
| 1163 | 3300046518 | Ga0495631_0004219 | Ga0495631_0004219_2446_2859 | 135 |
| 1164 | 3300046518 | Ga0495631_0007135 | Ga0495631_0007135_731_1144 | 135 |
| 1165 | 3300046518 | Ga0495631_0014570 | Ga0495631_0014570_42_455 | 135 |
| 1166 | 3300046518 | Ga0495631_0016096 | Ga0495631_0016096_2066_2479 | 135 |
| 1167 | 3300046518 | Ga0495631_0021100 | Ga0495631_0021100_437_850 | 135 |
| 1168 | 3300046518 | Ga0495631_0049397 | Ga0495631_0049397_785_1198 | 135 |
| 1169 | 3300046518 | Ga0495631_0260011 | Ga0495631_0260011_208_621 | 135 |
| 1170 | 3300046519 | Ga0495632_0001106 | Ga0495632_0001106_3505_3918 | 135 |
| 1171 | 3300046519 | Ga0495632_0005873 | Ga0495632_0005873_199_612 | 135 |
| 1172 | 3300046519 | Ga0495632_0007321 | Ga0495632_0007321_5745_6158 | 135 |
| 1173 | 3300046519 | Ga0495632_0024796 | Ga0495632_0024796_624_1037 | 135 |
| 1174 | 3300046520 | Ga0495637_0000014 | Ga0495637_0000014_188090_188503 | 135 |
| 1175 | 3300046520 | Ga0495637_0008808 | Ga0495637_0008808_2861_3274 | 135 |
| 1176 | 3300046520 | Ga0495637_0021157 | Ga0495637_0021157_1572_1985 | 135 |
| 1177 | 3300046522 | Ga0495643_0000079 | Ga0495643_0000079_151492_151905 | 135 |
| 1178 | 3300046522 | Ga0495643_0000569 | Ga0495643_0000569_37157_37570 | 135 |
| 1179 | 3300046522 | Ga0495643_0000966 | Ga0495643_0000966_3724_4137 | 135 |
| 1180 | 3300046522 | Ga0495643_0009289 | Ga0495643_0009289_277_690 | 135 |
| 1181 | 3300046522 | Ga0495643_0010544 | Ga0495643_0010544_5259_5672 | 135 |
| 1182 | 3300046522 | Ga0495643_0037601 | Ga0495643_0037601_190_603 | 135 |
| 1183 | 3300046522 | Ga0495643_0062438 | Ga0495643_0062438_1358_1771 | 135 |
| 1184 | 3300046522 | Ga0495643_0138436 | Ga0495643_0138436_428_844 | 135 |
| 1185 | 3300046522 | Ga0495643_0284444 | Ga0495643_0284444_217_630 | 135 |
| 1186 | 3300046522 | Ga0495643_0346991 | Ga0495643_0346991_176_589 | 135 |
| 1187 | 3300046523 | Ga0495644_0000343 | Ga0495644_0000343_11706_12119 | 135 |
| 1188 | 3300046523 | Ga0495644_0003670 | Ga0495644_0003670_4165_4578 | 135 |
| 1189 | 3300046523 | Ga0495644_0013674 | Ga0495644_0013674_2263_2676 | 135 |
| 1190 | 3300046523 | Ga0495644_0022045 | Ga0495644_0022045_80_493 | 135 |
| 1191 | 3300046523 | Ga0495644_0025467 | Ga0495644_0025467_1632_2045 | 135 |
| 1192 | 3300046523 | Ga0495644_0056819 | Ga0495644_0056819_175_588 | 135 |
| 1193 | 3300046523 | Ga0495644_0114482 | Ga0495644_0114482_138_551 | 135 |
| 1194 | 3300046524 | Ga0495648_0000117 | Ga0495648_0000117_11177_11590 | 135 |
| 1195 | 3300046524 | Ga0495648_0001357 | Ga0495648_0001357_8615_9028 | 135 |
| 1196 | 3300046524 | Ga0495648_0004461 | Ga0495648_0004461_8342_8755 | 135 |
| 1197 | 3300046524 | Ga0495648_0006377 | Ga0495648_0006377_8945_9358 | 135 |
| 1198 | 3300046524 | Ga0495648_0037677 | Ga0495648_0037677_2678_3091 | 135 |
| 1199 | 3300046525 | Ga0495663_0002287 | Ga0495663_0002287_1834_2247 | 135 |
| 1200 | 3300046525 | Ga0495663_0004095 | Ga0495663_0004095_1926_2342 | 135 |
| 1201 | 3300046525 | Ga0495663_0006624 | Ga0495663_0006624_1920_2333 | 135 |
| 1202 | 3300046526 | Ga0495666_0000105 | Ga0495666_0000105_5906_6319 | 135 |
| 1203 | 3300046526 | Ga0495666_0028590 | Ga0495666_0028590_2306_2719 | 135 |
| 1204 | 3300046526 | Ga0495666_0101215 | Ga0495666_0101215_758_1171 | 135 |
| 1205 | 3300046528 | Ga0495642_0000716 | Ga0495642_0000716_8402_8815 | 135 |
| 1206 | 3300046528 | Ga0495642_0002469 | Ga0495642_0002469_2539_2952 | 135 |
| 1207 | 3300046528 | Ga0495642_0005378 | Ga0495642_0005378_4209_4622 | 135 |
| 1208 | 3300046528 | Ga0495642_0093700 | Ga0495642_0093700_813_1226 | 135 |
| 1209 | 3300046528 | Ga0495642_0109076 | Ga0495642_0109076_455_868 | 135 |
| 1210 | 3300046528 | Ga0495642_0131698 | Ga0495642_0131698_290_703 | 135 |
| 1211 | 3300046529 | Ga0495652_0006184 | Ga0495652_0006184_2145_2558 | 135 |
| 1212 | 3300046530 | Ga0495654_0005316 | Ga0495654_0005316_4444_4857 | 135 |
| 1213 | 3300046530 | Ga0495654_0013571 | Ga0495654_0013571_2390_2803 | 135 |
| 1214 | 3300046530 | Ga0495654_0078627 | Ga0495654_0078627_362_775 | 135 |
| 1215 | 3300046531 | Ga0495665_0003288 | Ga0495665_0003288_1309_1722 | 135 |
| 1216 | 3300046531 | Ga0495665_0004480 | Ga0495665_0004480_1143_1556 | 135 |
| 1217 | 3300046531 | Ga0495665_0052457 | Ga0495665_0052457_791_1204 | 135 |
| 1218 | 3300046531 | Ga0495665_0172907 | Ga0495665_0172907_123_548 | 135 |
| 1219 | 3300046533 | Ga0495640_0009203 | Ga0495640_0009203_1405_1818 | 135 |
| 1220 | 3300046535 | Ga0495586_0005523 | Ga0495586_0005523_1897_2322 | 135 |
| 1221 | 3300046535 | Ga0495586_0255862 | Ga0495586_0255862_227_640 | 135 |
| 1222 | 3300046536 | Ga0495587_0054464 | Ga0495587_0054464_181_594 | 135 |
| 1223 | 3300046536 | Ga0495587_0468215 | Ga0495587_0468215_53_466 | 135 |
| 1224 | 3300046538 | Ga0495609_0000028 | Ga0495609_0000028_151198_151611 | 135 |
| 1225 | 3300046538 | Ga0495609_0001458 | Ga0495609_0001458_9232_9645 | 135 |
| 1226 | 3300046538 | Ga0495609_0001649 | Ga0495609_0001649_8996_9409 | 135 |
| 1227 | 3300046538 | Ga0495609_0001938 | Ga0495609_0001938_7471_7884 | 135 |
| 1228 | 3300046538 | Ga0495609_0002982 | Ga0495609_0002982_8475_8888 | 135 |
| 1229 | 3300046538 | Ga0495609_0048464 | Ga0495609_0048464_1379_1792 | 135 |
| 1230 | 3300046538 | Ga0495609_0138102 | Ga0495609_0138102_71_484 | 135 |
| 1231 | 3300046538 | Ga0495609_0155752 | Ga0495609_0155752_315_728 | 135 |
| 1232 | 3300046542 | Ga0495597_0000315 | Ga0495597_0000315_8858_9271 | 135 |
| 1233 | 3300046542 | Ga0495597_0000369 | Ga0495597_0000369_9068_9481 | 135 |
| 1234 | 3300046542 | Ga0495597_0001487 | Ga0495597_0001487_400_813 | 135 |
| 1235 | 3300046542 | Ga0495597_0001633 | Ga0495597_0001633_7921_8334 | 135 |
| 1236 | 3300046542 | Ga0495597_0002233 | Ga0495597_0002233_8502_8915 | 135 |
| 1237 | 3300046542 | Ga0495597_0002969 | Ga0495597_0002969_7516_7929 | 135 |
| 1238 | 3300046542 | Ga0495597_0054524 | Ga0495597_0054524_842_1255 | 135 |
| 1239 | 3300046542 | Ga0495597_0131597 | Ga0495597_0131597_159_572 | 135 |
| 1240 | 3300046542 | Ga0495597_0157791 | Ga0495597_0157791_183_596 | 135 |
| 1241 | 3300046542 | Ga0495597_0205346 | Ga0495597_0205346_178_591 | 135 |
| 1242 | 3300046557 | Ga0495622_0194110 | Ga0495622_0194110_475_888 | 135 |
| 1243 | 3300046558 | Ga0495633_0001752 | Ga0495633_0001752_8881_9294 | 135 |
| 1244 | 3300046558 | Ga0495633_0003558 | Ga0495633_0003558_3156_3569 | 135 |
| 1245 | 3300046558 | Ga0495633_0005489 | Ga0495633_0005489_2257_2670 | 135 |
| 1246 | 3300046558 | Ga0495633_0011443 | Ga0495633_0011443_2125_2538 | 135 |
| 1247 | 3300046558 | Ga0495633_0042182 | Ga0495633_0042182_1508_1921 | 135 |
| 1248 | 3300046558 | Ga0495633_0100659 | Ga0495633_0100659_22_435 | 135 |
| 1249 | 3300046558 | Ga0495633_0128894 | Ga0495633_0128894_54_467 | 135 |
| 1250 | 3300046559 | Ga0495667_0206325 | Ga0495667_0206325_256_669 | 135 |
| 1251 | 3300046615 | Ga0495656_0001105 | Ga0495656_0001105_5075_5488 | 135 |
| 1252 | 3300046615 | Ga0495656_0004033 | Ga0495656_0004033_220_633 | 135 |
| 1253 | 3300046615 | Ga0495656_0011557 | Ga0495656_0011557_2361_2774 | 135 |
| 1254 | 3300046615 | Ga0495656_0303892 | Ga0495656_0303892_339_752 | 135 |
| 1255 | 3300046615 | Ga0495656_0364352 | Ga0495656_0364352_222_635 | 135 |
| 1256 | 3300046615 | Ga0495656_0388561 | Ga0495656_0388561_136_549 | 135 |
| 1257 | 3300046615 | Ga0495656_0649248 | Ga0495656_0649248_11_427 | 135 |
| 1258 | 3300046616 | Ga0495668_0001207 | Ga0495668_0001207_7739_8152 | 135 |
| 1259 | 3300046616 | Ga0495668_0005271 | Ga0495668_0005271_8221_8634 | 135 |
| 1260 | 3300046616 | Ga0495668_0018322 | Ga0495668_0018322_1376_1789 | 135 |
| 1261 | 3300046616 | Ga0495668_0086604 | Ga0495668_0086604_1218_1631 | 135 |
| 1262 | 3300046642 | Ga0495634_0007567 | Ga0495634_0007567_5929_6342 | 135 |
| 1263 | 3300046648 | Ga0495611_0003145 | Ga0495611_0003145_2535_2948 | 135 |
| 1264 | 3300046648 | Ga0495611_0005991 | Ga0495611_0005991_1449_1862 | 135 |
| 1265 | 3300046648 | Ga0495611_0012887 | Ga0495611_0012887_1683_2096 | 135 |
| 1266 | 3300046648 | Ga0495611_0024143 | Ga0495611_0024143_826_1239 | 135 |
| 1267 | 3300046648 | Ga0495611_0038803 | Ga0495611_0038803_1200_1613 | 135 |
| 1268 | 3300046648 | Ga0495611_0352213 | Ga0495611_0352213_61_474 | 135 |
| 1269 | 3300046660 | Ga0495625_0008448 | Ga0495625_0008448_5296_5709 | 135 |
| 1270 | 3300046660 | Ga0495625_0030164 | Ga0495625_0030164_370_783 | 135 |
| 1271 | 3300046660 | Ga0495625_0074545 | Ga0495625_0074545_1012_1425 | 135 |
| 1272 | 3300046660 | Ga0495625_0204564 | Ga0495625_0204564_819_1232 | 135 |
| 1273 | 3300046663 | Ga0495635_0002078 | Ga0495635_0002078_9139_9564 | 135 |
| 1274 | 3300046663 | Ga0495635_0617384 | Ga0495635_0617384_274_687 | 135 |
| 1275 | 3300046665 | Ga0495661_0000950 | Ga0495661_0000950_4296_4709 | 135 |
| 1276 | 3300046665 | Ga0495661_0001346 | Ga0495661_0001346_3709_4122 | 135 |
| 1277 | 3300046665 | Ga0495661_0003746 | Ga0495661_0003746_2007_2420 | 135 |
| 1278 | 3300046665 | Ga0495661_0004402 | Ga0495661_0004402_8795_9208 | 135 |
| 1279 | 3300046665 | Ga0495661_0006222 | Ga0495661_0006222_1908_2321 | 135 |
| 1280 | 3300046665 | Ga0495661_0008157 | Ga0495661_0008157_1095_1508 | 135 |
| 1281 | 3300046665 | Ga0495661_0010000 | Ga0495661_0010000_3798_4211 | 135 |
| 1282 | 3300046665 | Ga0495661_0012582 | Ga0495661_0012582_3988_4401 | 135 |
| 1283 | 3300046665 | Ga0495661_0021461 | Ga0495661_0021461_3331_3744 | 135 |
| 1284 | 3300046665 | Ga0495661_0037402 | Ga0495661_0037402_2440_2853 | 135 |
| 1285 | 3300046665 | Ga0495661_0058144 | Ga0495661_0058144_853_1266 | 135 |
| 1286 | 3300046665 | Ga0495661_0100637 | Ga0495661_0100637_674_1087 | 135 |
| 1287 | 3300046665 | Ga0495661_0117116 | Ga0495661_0117116_239_652 | 135 |
| 1288 | 3300046665 | Ga0495661_0118233 | Ga0495661_0118233_786_1199 | 135 |
| 1289 | 3300046665 | Ga0495661_0149104 | Ga0495661_0149104_418_831 | 135 |
| 1290 | 3300046665 | Ga0495661_0178653 | Ga0495661_0178653_158_571 | 135 |
| 1291 | 3300046674 | Ga0495588_0003529 | Ga0495588_0003529_3048_3461 | 135 |
| 1292 | 3300046674 | Ga0495588_0058560 | Ga0495588_0058560_208_621 | 135 |
| 1293 | 3300046674 | Ga0495588_0067437 | Ga0495588_0067437_376_801 | 135 |
| 1294 | 3300046674 | Ga0495588_0121539 | Ga0495588_0121539_942_1355 | 135 |
| 1295 | 3300046678 | Ga0495599_0208901 | Ga0495599_0208901_517_930 | 135 |
| 1296 | 3300046679 | Ga0495623_0002488 | Ga0495623_0002488_2701_3114 | 135 |
| 1297 | 3300046679 | Ga0495623_0017205 | Ga0495623_0017205_2298_2711 | 135 |
| 1298 | 3300046679 | Ga0495623_0073006 | Ga0495623_0073006_902_1315 | 135 |
| 1299 | 3300046679 | Ga0495623_0273312 | Ga0495623_0273312_39_452 | 135 |
| 1300 | 3300046679 | Ga0495623_0654775 | Ga0495623_0654775_110_523 | 135 |
| 1301 | 3300046684 | Ga0495669_0000228 | Ga0495669_0000228_8846_9259 | 135 |
| 1302 | 3300046684 | Ga0495669_0000859 | Ga0495669_0000859_8593_9006 | 135 |
| 1303 | 3300046684 | Ga0495669_0001640 | Ga0495669_0001640_1585_1998 | 135 |
| 1304 | 3300046684 | Ga0495669_0009038 | Ga0495669_0009038_3556_3969 | 135 |
| 1305 | 3300046684 | Ga0495669_0044475 | Ga0495669_0044475_107_520 | 135 |
| 1306 | 3300046689 | Ga0495613_0034223 | Ga0495613_0034223_511_936 | 135 |
| 1307 | 3300046689 | Ga0495613_0105051 | Ga0495613_0105051_247_660 | 135 |
| 1308 | 3300046691 | Ga0495670_0000237 | Ga0495670_0000237_16091_16504 | 135 |
| 1309 | 3300046691 | Ga0495670_0002403 | Ga0495670_0002403_4388_4801 | 135 |
| 1310 | 3300046691 | Ga0495670_0005782 | Ga0495670_0005782_251_664 | 135 |
| 1311 | 3300046691 | Ga0495670_0017160 | Ga0495670_0017160_31_444 | 135 |
| 1312 | 3300046691 | Ga0495670_0019739 | Ga0495670_0019739_45_458 | 135 |
| 1313 | 3300046691 | Ga0495670_0381426 | Ga0495670_0381426_305_718 | 135 |
| 1314 | 3300046691 | Ga0495670_0485398 | Ga0495670_0485398_196_609 | 135 |
| 1315 | 3300046692 | Ga0495671_0002737 | Ga0495671_0002737_2539_2952 | 135 |
| 1316 | 3300046692 | Ga0495671_0004717 | Ga0495671_0004717_871_1284 | 135 |
| 1317 | 3300046692 | Ga0495671_0005286 | Ga0495671_0005286_2260_2673 | 135 |
| 1318 | 3300046692 | Ga0495671_0157001 | Ga0495671_0157001_224_637 | 135 |
| 1319 | 3300046692 | Ga0495671_0644246 | Ga0495671_0644246_35_448 | 135 |
| 1320 | 3300046694 | Ga0495649_0003105 | Ga0495649_0003105_7329_7742 | 135 |
| 1321 | 3300046694 | Ga0495649_0005628 | Ga0495649_0005628_7492_7905 | 135 |
| 1322 | 3300046694 | Ga0495649_0049656 | Ga0495649_0049656_1793_2206 | 135 |
| 1323 | 3300046694 | Ga0495649_0054436 | Ga0495649_0054436_1586_1999 | 135 |
| 1324 | 3300046694 | Ga0495649_0103965 | Ga0495649_0103965_639_1052 | 135 |
| 1325 | 3300046694 | Ga0495649_0242534 | Ga0495649_0242534_351_764 | 135 |
| 1326 | 3300046694 | Ga0495649_0330477 | Ga0495649_0330477_304_717 | 135 |
| 1327 | 3300046694 | Ga0495649_0372416 | Ga0495649_0372416_39_452 | 135 |
| 1328 | 3300046794 | Ga0495589_0000113 | Ga0495589_0000113_67256_67669 | 135 |
| 1329 | 3300046794 | Ga0495589_0000178 | Ga0495589_0000178_8724_9137 | 135 |
| 1330 | 3300046794 | Ga0495589_0000225 | Ga0495589_0000225_38840_39253 | 135 |
| 1331 | 3300046794 | Ga0495589_0001893 | Ga0495589_0001893_2576_2989 | 135 |
| 1332 | 3300046794 | Ga0495589_0014360 | Ga0495589_0014360_2155_2568 | 135 |
| 1333 | 3300046794 | Ga0495589_0034468 | Ga0495589_0034468_62_475 | 135 |
| 1334 | 3300046794 | Ga0495589_0117337 | Ga0495589_0117337_819_1232 | 135 |
| 1335 | 3300046794 | Ga0495589_0138689 | Ga0495589_0138689_646_1059 | 135 |
| 1336 | 3300046794 | Ga0495589_0268108 | Ga0495589_0268108_92_505 | 135 |
| 1337 | 3300046794 | Ga0495589_0547608 | Ga0495589_0547608_20_433 | 135 |
| 1338 | 3300046794 | Ga0495589_0598773 | Ga0495589_0598773_39_452 | 135 |
| 1339 | 3300046809 | Ga0495600_0005904 | Ga0495600_0005904_2407_2820 | 135 |
| 1340 | 3300046810 | Ga0495660_0000438 | Ga0495660_0000438_25561_25974 | 135 |
| 1341 | 3300046810 | Ga0495660_0005112 | Ga0495660_0005112_1930_2343 | 135 |
| 1342 | 3300046810 | Ga0495660_0038091 | Ga0495660_0038091_570_983 | 135 |
| 1343 | 3300046810 | Ga0495660_0061568 | Ga0495660_0061568_48_461 | 135 |
| 1344 | 3300046810 | Ga0495660_0071424 | Ga0495660_0071424_175_588 | 135 |
| 1345 | 3300046810 | Ga0495660_0072926 | Ga0495660_0072926_123_536 | 135 |
| 1346 | 3300046810 | Ga0495660_0177336 | Ga0495660_0177336_194_607 | 135 |
| 1347 | 3300046810 | Ga0495660_0374577 | Ga0495660_0374577_13_426 | 135 |
| 1348 | 3300047317 | Ga0495604_0024580 | Ga0495604_0024580_3875_4300 | 135 |
| 1349 | 3300047317 | Ga0495604_0028211 | Ga0495604_0028211_1154_1567 | 135 |
| 1350 | 3300047317 | Ga0495604_0034503 | Ga0495604_0034503_2921_3334 | 135 |
| 1351 | 3300047317 | Ga0495604_0051039 | Ga0495604_0051039_165_578 | 135 |
| 1352 | 3300047318 | Ga0495636_0033788 | Ga0495636_0033788_1512_1925 | 135 |
| 1353 | 3300047318 | Ga0495636_0161378 | Ga0495636_0161378_425_838 | 135 |
| 1354 | 3300047320 | Ga0495672_0000140 | Ga0495672_0000140_51769_52182 | 135 |
| 1355 | 3300047320 | Ga0495672_0000471 | Ga0495672_0000471_8867_9280 | 135 |
| 1356 | 3300047320 | Ga0495672_0000521 | Ga0495672_0000521_123_536 | 135 |
| 1357 | 3300047320 | Ga0495672_0000997 | Ga0495672_0000997_8839_9252 | 135 |
| 1358 | 3300047320 | Ga0495672_0033283 | Ga0495672_0033283_1170_1583 | 135 |
| 1359 | 3300047320 | Ga0495672_0040958 | Ga0495672_0040958_89_502 | 135 |
| 1360 | 3300047320 | Ga0495672_0130712 | Ga0495672_0130712_633_1046 | 135 |
| 1361 | 3300047320 | Ga0495672_0140029 | Ga0495672_0140029_524_937 | 135 |
| 1362 | 3300047320 | Ga0495672_0186770 | Ga0495672_0186770_356_769 | 135 |
| 1363 | 3300047321 | Ga0495676_0000180 | Ga0495676_0000180_39671_40084 | 135 |
| 1364 | 3300047321 | Ga0495676_0072447 | Ga0495676_0072447_152_565 | 135 |
| 1365 | 3300047321 | Ga0495676_0303869 | Ga0495676_0303869_342_755 | 135 |
| 1366 | 3300047322 | Ga0495680_0003335 | Ga0495680_0003335_9032_9457 | 135 |
| 1367 | 3300047322 | Ga0495680_0179794 | Ga0495680_0179794_939_1352 | 135 |
| 1368 | 3300047323 | Ga0495683_0000242 | Ga0495683_0000242_9006_9419 | 135 |
| 1369 | 3300047323 | Ga0495683_0001445 | Ga0495683_0001445_15052_15465 | 135 |
| 1370 | 3300047323 | Ga0495683_0025695 | Ga0495683_0025695_1703_2116 | 135 |
| 1371 | 3300047323 | Ga0495683_0036376 | Ga0495683_0036376_2028_2438 | 135 |
| 1372 | 3300047323 | Ga0495683_0072086 | Ga0495683_0072086_1263_1676 | 135 |
| 1373 | 3300047323 | Ga0495683_0219826 | Ga0495683_0219826_139_552 | 135 |
| 1374 | 3300047323 | Ga0495683_0259558 | Ga0495683_0259558_316_729 | 135 |
| 1375 | 3300047323 | Ga0495683_0261753 | Ga0495683_0261753_35_448 | 135 |
| 1376 | 3300047443 | Ga0495687_000054 | Ga0495687_000054_185241_185654 | 135 |
| 1377 | 3300047443 | Ga0495687_001284 | Ga0495687_001284_9631_10044 | 135 |
| 1378 | 3300047443 | Ga0495687_002185 | Ga0495687_002185_7470_7883 | 135 |
| 1379 | 3300047443 | Ga0495687_002656 | Ga0495687_002656_4108_4521 | 135 |
| 1380 | 3300047443 | Ga0495687_003943 | Ga0495687_003943_1154_1567 | 135 |
| 1381 | 3300047444 | Ga0495675_0003293 | Ga0495675_0003293_6267_6680 | 135 |
| 1382 | 3300047444 | Ga0495675_0025019 | Ga0495675_0025019_2341_2766 | 135 |
| 1383 | 3300047444 | Ga0495675_0045772 | Ga0495675_0045772_1682_2095 | 135 |
| 1384 | 3300047444 | Ga0495675_0439275 | Ga0495675_0439275_285_698 | 135 |
| 1385 | 3300047445 | Ga0495677_0000084 | Ga0495677_0000084_8795_9208 | 135 |
| 1386 | 3300047445 | Ga0495677_0000723 | Ga0495677_0000723_9361_9774 | 135 |
| 1387 | 3300047445 | Ga0495677_0001366 | Ga0495677_0001366_3121_3534 | 135 |
| 1388 | 3300047445 | Ga0495677_0005230 | Ga0495677_0005230_4060_4473 | 135 |
| 1389 | 3300047445 | Ga0495677_0013840 | Ga0495677_0013840_270_683 | 135 |
| 1390 | 3300047445 | Ga0495677_0014184 | Ga0495677_0014184_177_590 | 135 |
| 1391 | 3300047445 | Ga0495677_0034073 | Ga0495677_0034073_367_780 | 135 |
| 1392 | 3300047445 | Ga0495677_0064659 | Ga0495677_0064659_842_1255 | 135 |
| 1393 | 3300047445 | Ga0495677_0080774 | Ga0495677_0080774_476_889 | 135 |
| 1394 | 3300047445 | Ga0495677_0089770 | Ga0495677_0089770_208_621 | 135 |
| 1395 | 3300047445 | Ga0495677_0266002 | Ga0495677_0266002_58_474 | 135 |
| 1396 | 3300047446 | Ga0495679_001674 | Ga0495679_001674_4247_4660 | 135 |
| 1397 | 3300047446 | Ga0495679_001847 | Ga0495679_001847_7515_7928 | 135 |
| 1398 | 3300047446 | Ga0495679_027729 | Ga0495679_027729_193_606 | 135 |
| 1399 | 3300047446 | Ga0495679_185390 | Ga0495679_185390_92_505 | 135 |
| 1400 | 3300047447 | Ga0495685_038942 | Ga0495685_038942_175_588 | 135 |
| 1401 | 3300047447 | Ga0495685_099939 | Ga0495685_099939_185_598 | 135 |
| 1402 | 3300047447 | Ga0495685_106286 | Ga0495685_106286_310_723 | 135 |
| 1403 | 3300047469 | Ga0495673_0018181 | Ga0495673_0018181_2723_3136 | 135 |
| 1404 | 3300047469 | Ga0495673_0117228 | Ga0495673_0117228_202_615 | 135 |
| 1405 | 3300047470 | Ga0495681_0000840 | Ga0495681_0000840_8987_9400 | 135 |
| 1406 | 3300047470 | Ga0495681_0002247 | Ga0495681_0002247_4546_4959 | 135 |
| 1407 | 3300047470 | Ga0495681_0003545 | Ga0495681_0003545_140_553 | 135 |
| 1408 | 3300047470 | Ga0495681_0004805 | Ga0495681_0004805_8508_8921 | 135 |
| 1409 | 3300047470 | Ga0495681_0023127 | Ga0495681_0023127_1816_2229 | 135 |
| 1410 | 3300047470 | Ga0495681_0024760 | Ga0495681_0024760_866_1279 | 135 |
| 1411 | 3300047470 | Ga0495681_0030058 | Ga0495681_0030058_2224_2637 | 135 |
| 1412 | 3300047472 | Ga0495686_0000285 | Ga0495686_0000285_45009_45422 | 135 |
| 1413 | 3300047472 | Ga0495686_0051766 | Ga0495686_0051766_74_487 | 135 |
| 1414 | 3300047472 | Ga0495686_0057530 | Ga0495686_0057530_858_1271 | 135 |
| 1415 | 3300047472 | Ga0495686_0083086 | Ga0495686_0083086_536_949 | 135 |
| 1416 | 3300047673 | Ga0495593_0023218 | Ga0495593_0023218_1414_1839 | 135 |
| 1417 | 3300047673 | Ga0495593_0265975 | Ga0495593_0265975_41_454 | 135 |
| 1418 | 3300048088 | Ga0495602_0107551 | Ga0495602_0107551_124_537 | 135 |
| 1419 | 3300048089 | Ga0495614_0003105 | Ga0495614_0003105_6069_6494 | 135 |
| 1420 | 3300048089 | Ga0495614_0406643 | Ga0495614_0406643_155_568 | 135 |
| 1421 | 3300048090 | Ga0495615_0068646 | Ga0495615_0068646_61_474 | 135 |
| 1422 | 3300048091 | Ga0495626_0000036 | Ga0495626_0000036_206_619 | 135 |
| 1423 | 3300048091 | Ga0495626_0000044 | Ga0495626_0000044_8117_8530 | 135 |
| 1424 | 3300048091 | Ga0495626_0000629 | Ga0495626_0000629_6357_6770 | 135 |
| 1425 | 3300048091 | Ga0495626_0001081 | Ga0495626_0001081_14037_14450 | 135 |
| 1426 | 3300048091 | Ga0495626_0002963 | Ga0495626_0002963_3135_3548 | 135 |
| 1427 | 3300048091 | Ga0495626_0006613 | Ga0495626_0006613_5897_6310 | 135 |
| 1428 | 3300048091 | Ga0495626_0017553 | Ga0495626_0017553_809_1222 | 135 |
| 1429 | 3300048091 | Ga0495626_0028012 | Ga0495626_0028012_998_1411 | 135 |
| 1430 | 3300048091 | Ga0495626_0038454 | Ga0495626_0038454_1341_1754 | 135 |
| 1431 | 3300048091 | Ga0495626_0042084 | Ga0495626_0042084_748_1161 | 135 |
| 1432 | 3300048091 | Ga0495626_0060279 | Ga0495626_0060279_365_778 | 135 |
| 1433 | 3300048091 | Ga0495626_0112058 | Ga0495626_0112058_441_854 | 135 |
| 1434 | 3300048091 | Ga0495626_0112206 | Ga0495626_0112206_24_437 | 135 |
| 1435 | 3300048091 | Ga0495626_0138925 | Ga0495626_0138925_140_553 | 135 |
| 1436 | 3300048091 | Ga0495626_0301151 | Ga0495626_0301151_144_557 | 135 |
| 1437 | 3300048903 | Ga0496100_0001165 | Ga0496100_0001165_10296_10709 | 135 |
| 1438 | 3300048904 | Ga0496101_0064188 | Ga0496101_0064188_765_1178 | 135 |
| 1439 | 3300048905 | Ga0496102_0000422 | Ga0496102_0000422_8795_9208 | 135 |
| 1440 | 3300048905 | Ga0496102_0074965 | Ga0496102_0074965_781_1194 | 135 |
| 1441 | 3300048905 | Ga0496102_0333326 | Ga0496102_0333326_163_576 | 135 |
| 1442 | 3300048905 | Ga0496102_0881966 | Ga0496102_0881966_232_645 | 135 |
| 1443 | 3300048905 | Ga0496102_1433809 | Ga0496102_1433809_180_593 | 135 |
| 1444 | 3300048907 | Ga0496104_0927991 | Ga0496104_0927991_288_701 | 135 |
| 1445 | 3300048908 | Ga0496105_0907311 | Ga0496105_0907311_204_617 | 135 |
| 1446 | 3300048909 | Ga0496106_0001957 | Ga0496106_0001957_6115_6528 | 135 |
| 1447 | 3300048909 | Ga0496106_0973228 | Ga0496106_0973228_197_610 | 135 |
| 1448 | 3300048910 | Ga0496107_0246498 | Ga0496107_0246498_336_749 | 135 |
| 1449 | 3300048911 | Ga0496108_0620621 | Ga0496108_0620621_19_432 | 135 |
| 1450 | 3300048911 | Ga0496108_0912411 | Ga0496108_0912411_316_729 | 135 |
| 1451 | 3300048912 | Ga0496109_0006063 | Ga0496109_0006063_6413_6826 | 135 |
| 1452 | 3300048912 | Ga0496109_0167622 | Ga0496109_0167622_1076_1498 | 135 |
| 1453 | 3300048913 | Ga0496110_0000233 | Ga0496110_0000233_26292_26705 | 135 |
| 1454 | 3300048913 | Ga0496110_0104317 | Ga0496110_0104317_1923_2345 | 135 |
| 1455 | 3300048913 | Ga0496110_0790936 | Ga0496110_0790936_58_471 | 135 |
| 1456 | 3300048914 | Ga0496111_0133604 | Ga0496111_0133604_1301_1714 | 135 |
| 1457 | 3300048914 | Ga0496111_0399718 | Ga0496111_0399718_77_490 | 135 |
| 1458 | 3300048915 | Ga0496112_0187678 | Ga0496112_0187678_1156_1569 | 135 |
| 1459 | 3300048915 | Ga0496112_0816915 | Ga0496112_0816915_34_447 | 135 |
| 1460 | 3300048916 | Ga0496113_0008052 | Ga0496113_0008052_5851_6264 | 135 |
| 1461 | 3300048916 | Ga0496113_0080967 | Ga0496113_0080967_667_1080 | 135 |
| 1462 | 3300048916 | Ga0496113_0387803 | Ga0496113_0387803_74_487 | 135 |
| 1463 | 3300048924 | Ga0496121_0255560 | Ga0496121_0255560_237_650 | 135 |
| 1464 | 3300048925 | Ga0496122_0001269 | Ga0496122_0001269_31899_32312 | 135 |
| 1465 | 3300048925 | Ga0496122_0018535 | Ga0496122_0018535_867_1280 | 135 |
| 1466 | 3300048926 | Ga0496123_0000780 | Ga0496123_0000780_10795_11208 | 135 |
| 1467 | 3300048926 | Ga0496123_0003906 | Ga0496123_0003906_15570_15983 | 135 |
| 1468 | 3300048927 | Ga0496124_0036489 | Ga0496124_0036489_2041_2454 | 135 |
| 1469 | 3300048927 | Ga0496124_0235880 | Ga0496124_0235880_701_1114 | 135 |
| 1470 | 3300048928 | Ga0496125_0000870 | Ga0496125_0000870_8960_9373 | 135 |
| 1471 | 3300048928 | Ga0496125_0360110 | Ga0496125_0360110_404_817 | 135 |
| 1472 | 3300049128 | Ga0501308_000453 | Ga0501308_000453_2158_2571 | 135 |
| 1473 | 3300049160 | Ga0501304_008560 | Ga0501304_008560_363_776 | 135 |
| 1474 | 3300049459 | Ga0495678_000150 | Ga0495678_000150_74985_75398 | 135 |
| 1475 | 3300049459 | Ga0495678_000327 | Ga0495678_000327_8823_9236 | 135 |
| 1476 | 3300049459 | Ga0495678_000413 | Ga0495678_000413_8305_8715 | 135 |
| 1477 | 3300049459 | Ga0495678_008087 | Ga0495678_008087_3606_4019 | 135 |
| 1478 | 3300049460 | Ga0495682_0019126 | Ga0495682_0019126_64_477 | 135 |
| 1479 | 3300049581 | Ga0501047_0198473 | Ga0501047_0198473_900_1313 | 135 |
| 1480 | 3300049669 | Ga0501235_177894 | Ga0501235_177894_133_543 | 135 |
| 1481 | 3300049822 | Ga0501035_0006628 | Ga0501035_0006628_3818_4231 | 135 |
| 1482 | 3300049823 | Ga0501044_0191265 | Ga0501044_0191265_1483_1896 | 135 |
| 1483 | 3300059477 | Ga0587084_128763 | Ga0587084_128763_54_467 | 135 |
| 1484 | 3300059490 | Ga0587066_059248 | Ga0587066_059248_281_694 | 135 |
| 1485 | 3300059491 | Ga0587070_013077 | Ga0587070_013077_54_467 | 135 |
| 1486 | 3300059492 | Ga0587073_0011612 | Ga0587073_0011612_966_1379 | 135 |
| 1487 | 3300059492 | Ga0587073_0057516 | Ga0587073_0057516_405_818 | 135 |
| 1488 | 3300059493 | Ga0587077_083970 | Ga0587077_083970_38_451 | 135 |
| 1489 | 3300059503 | Ga0587080_007413 | Ga0587080_007413_344_757 | 135 |
| 1490 | 3300059503 | Ga0587080_086770 | Ga0587080_086770_148_561 | 135 |
| 1491 | 3300059503 | Ga0587080_115170 | Ga0587080_115170_100_513 | 135 |
| 1492 | 3300059504 | Ga0587082_008167 | Ga0587082_008167_566_979 | 135 |
| 1493 | 3300059505 | Ga0587083_0002695 | Ga0587083_0002695_795_1208 | 135 |
| 1494 | 3300059505 | Ga0587083_0022683 | Ga0587083_0022683_86_499 | 135 |
| 1495 | 3300059508 | Ga0587088_027587 | Ga0587088_027587_427_840 | 135 |
| 1496 | 3300059510 | Ga0587090_097530 | Ga0587090_097530_47_460 | 135 |
| 1497 | 3300059511 | Ga0587091_010283 | Ga0587091_010283_16_429 | 135 |
| 1498 | 3300059511 | Ga0587091_014194 | Ga0587091_014194_672_1085 | 135 |
| 1499 | 3300059604 | Ga0587098_011816 | Ga0587098_011816_493_906 | 135 |
| 1500 | 3300059604 | Ga0587098_043611 | Ga0587098_043611_211_624 | 135 |
| 1501 | 3300059605 | Ga0587106_051010 | Ga0587106_051010_191_604 | 135 |
| 1502 | 3300059622 | Ga0587099_009391 | Ga0587099_009391_389_802 | 135 |
| 1503 | 3300059623 | Ga0587101_009356 | Ga0587101_009356_47_460 | 135 |
| 1504 | 3300059625 | Ga0587113_012529 | Ga0587113_012529_15_428 | 135 |
| 1505 | 3300059639 | Ga0587062_030309 | Ga0587062_030309_231_644 | 135 |
| 1506 | 3300059639 | Ga0587062_107422 | Ga0587062_107422_64_477 | 135 |
| 1507 | 3300059640 | Ga0587067_008287 | Ga0587067_008287_1038_1451 | 135 |
| 1508 | 3300059641 | Ga0587068_012974 | Ga0587068_012974_86_499 | 135 |
| 1509 | 3300059642 | Ga0587069_006057 | Ga0587069_006057_971_1384 | 135 |
| 1510 | 3300059645 | Ga0587076_143311 | Ga0587076_143311_75_488 | 135 |
| 1511 | 3300059647 | Ga0587079_010086 | Ga0587079_010086_984_1397 | 135 |
| 1512 | 3300059649 | Ga0587102_026987 | Ga0587102_026987_215_628 | 135 |
| 1513 | 3300060346 | Ga0587111_0031246 | Ga0587111_0031246_624_1037 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fa5-assembly1.cif.gz_B | crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli | 0.9829 | 1 | 126 |
| 1fa5-assembly1.cif.gz_B | crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli | 0.9603 | 1 | 126 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.9463 | 1 | 126 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.9352 | 1 | 127 |
| 5d7z-assembly1.cif.gz_A | crystal structure of glyoxalase i from zea mays | 0.933 | 2 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9849 | 1 | 59 | 3.10.180.10 |
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9595 | 4 | 126 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9352 | 1 | 127 | 3.10.180.10 |
| af_Q948T6_1_150_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9303 | 1 | 127 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9276 | 1 | 127 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354IS86-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 1.001 | 1 | 62 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A379VT79-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.9874 | 1 | 62 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A653VI79-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.9852 | 1 | 62 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A354IS86-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.985 | 1 | 62 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-K7AKL3-F1-model_v4 | VOC domain-containing protein | 0.9841 | 3 | 77 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar