metagRoot

F494463

General Info

Members	Datasets	Scaffolds	Average Seq Length
1510	719	1307	240

Family's Representative Sequence

Representative Sequence	3300001979\|JGI24740J21852_10013460\|JGI24740J21852_100134602
Length	255
Sequence	MQATGIMIERTTEGNRVILAPTNRPPRRPADDAPHLLLVDDDRRIRDLLSRFLVGEGYRVTTALSAQDARGKLQGLHFDLLILDVMMPGESGFDLARFIRSSSSVPIIMLTARHEAESRIEGLQLGADDYVAKPFEPRELVLRIGNILKRTAPPPVETLEQVAFGPYLFHLERGELREGDGIIHLTDREREMLRLLALTPGETVSRSALTANGAVNERAVDVQINRLRRKIEHDPANPLFLQAVRGVGYRLVAAP

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
5	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
6	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
7	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
8	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
9	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
10	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
11	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
12	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
13	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
14	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
15	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
16	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
17	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
18	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
19	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
20	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
21	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
22	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
23	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
24	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
25	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
26	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
27	2791355199
28	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
29	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
30	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
31	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
32	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
33	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
34	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
35	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
36	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
37	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
38	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
39	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
40	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
41	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
42	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
43	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
44	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
45	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
46	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
47	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
48	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
49	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
50	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
51	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
52	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
53	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
54	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
55	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
56	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
57	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
58	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
59	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
60	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
61	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
62	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
63	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
64	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
65	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
66	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
67	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
68	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
69	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
70	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
71	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
72	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
73	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
74	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
75	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
76	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
77	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
78	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
79	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
80	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
81	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
82	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
83	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
84	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
85	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
86	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
87	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
88	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
89	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
90	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
91	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
92	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
93	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
94	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
95	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
96	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
97	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
98	2922368715
99	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
100	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
101	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
102	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
103	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
104	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
105	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
106	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
107	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
108	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
109	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
110	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
111	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
112	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
113	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
114	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
115	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
116	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
117	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
118	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
119	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
120	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
121	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
122	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
123	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
124	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
125	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
126	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
127	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
128	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
129	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
130	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
131	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
132	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
133	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
134	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
135	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
136	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
137	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
138	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
139	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
140	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
141	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
142	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
143	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
144	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
145	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
146	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
147	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
148	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
149	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
150	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
151	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
152	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
153	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
154	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
155	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
156	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
157	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
158	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
159	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
160	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
161	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
162	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
163	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
164	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
165	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
166	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
167	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
168	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
169	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
170	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
171	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
172	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
173	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
174	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
175	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
176	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
177	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
178	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
179	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
180	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
181	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
182	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
183	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
184	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
185	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
186	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
187	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
188	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
189	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
190	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
191	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
192	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
193	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
194	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
195	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
196	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
197	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
198	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
199	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
200	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
201	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
202	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
203	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
204	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
205	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
206	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
207	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
208	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
209	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
210	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
211	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
212	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
213	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
214	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
215	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
216	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
217	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
218	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
219	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
220	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
221	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
222	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
223	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
224	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
225	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
226	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
227	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
228	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
229	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
230	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
231	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
232	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
233	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
234	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
235	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
236	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
237	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
238	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
239	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
240	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
241	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
242	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
243	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
244	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
245	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
246	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
247	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
248	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
249	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
250	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
251	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
252	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
253	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
254	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
255	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
256	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
257	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
258	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
259	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
260	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
261	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
262	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
263	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
264	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
265	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
266	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
267	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
268	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
269	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
270	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
271	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
272	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
273	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
274	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
275	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
276	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
277	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
278	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
279	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
280	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
281	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
282	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
283	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
284	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
285	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
286	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
287	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
288	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
289	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
290	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
291	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
292	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
293	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
294	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
295	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
296	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
297	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
301	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
302	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
304	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
306	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
368	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
369	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
370	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
371	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
373	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
374	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
378	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
379	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
380	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
381	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
382	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
383	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
384	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
385	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
386	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
387	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
388	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
389	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
390	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
391	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
392	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
393	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
394	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
395	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
396	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
397	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
398	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
399	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
400	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
401	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
402	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
403	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
404	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
405	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
406	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
407	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
408	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
409	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
410	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
411	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
412	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
413	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
414	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
415	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
416	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
417	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
418	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
419	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
420	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
421	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
422	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
423	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
424	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
425	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
426	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
427	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
428	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
429	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
430	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
431	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
432	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
433	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
434	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
435	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
436	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
437	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
438	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
439	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
440	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
441	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
442	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
443	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
444	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
445	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
446	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
447	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
448	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
449	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
450	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
451	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
452	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
453	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
454	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
455	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
456	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
457	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
458	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
459	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
460	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
461	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
462	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
463	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
464	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
465	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
466	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
467	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
468	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
469	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
470	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
471	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
472	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
473	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
474	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
475	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
476	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
477	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
478	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
479	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
480	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
481	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
482	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
483	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
484	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
485	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
486	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
487	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
488	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
489	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
490	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
491	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
492	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
493	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
494	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
495	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
496	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
497	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
498	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
499	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
500	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
501	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
502	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
503	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
504	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
505	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
506	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
507	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
508	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
509	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
510	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
511	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
512	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
513	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
514	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
515	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
516	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
517	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
518	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
519	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
520	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
521	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
522	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
523	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
524	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
525	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
526	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
527	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
528	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
529	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
530	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
531	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
532	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
533	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
534	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
535	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
536	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
537	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
538	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
539	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
540	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
541	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
542	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
543	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
544	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
545	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
546	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
547	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
548	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
549	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
550	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
551	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
552	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
553	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
554	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
555	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
556	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
557	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
558	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
559	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
560	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
561	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
562	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
563	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
564	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
565	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
566	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
567	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
568	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
569	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
570	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
571	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
572	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
573	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
574	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
575	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
576	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
577	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
578	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
579	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
580	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
581	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
582	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
583	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
584	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
585	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
586	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
587	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
588	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
589	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
590	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
591	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
592	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
593	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
594	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
595	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
596	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
597	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
598	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
599	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
600	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
601	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
602	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
603	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
604	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
605	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
606	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
607	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
608	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
609	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
610	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
611	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
612	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
613	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
614	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
615	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
616	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
617	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
618	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
619	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
620	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
621	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
622	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
623	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
624	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
625	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
626	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
627	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
628	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
629	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
630	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
631	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
632	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
633	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
634	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
635	3300053101	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere	Metagenome	Endosphere
636	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
637	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
638	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
639	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
640	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
641	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
642	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
643	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
644	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
645	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
646	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
647	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
648	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
649	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
650	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
651	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
652	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
653	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
654	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
655	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
656	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
657	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
658	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
659	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
660	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
661	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
662	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
663	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
664	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
665	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
666	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
667	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
668	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
669	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
670	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
671	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
672	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
673	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
674	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
675	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
676	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
677	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
678	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
679	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
680	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
681	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
682	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
683	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
684	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
685	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
686	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
687	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
688	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
689	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
690	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
691	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
692	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
693	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
694	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
695	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
696	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
697	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
698	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
699	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
700	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
701	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
702	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
703	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
704	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
705	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
706	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
707	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
708	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
709	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
710	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
711	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
712	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
713	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
714	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
715	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
716	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
717	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
718	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
719	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	86.67
Metatranscriptomes	0
Isolates	13.33

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.98
Nodule	10.33
Rhizoplane	6.09
Rhizosphere	60.26
Stem	0
Stem Tuber	0
Unclassified	10.33

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10013460	3300001979	Bacteria	3049
2	JGI24739J22299_10013235	3300001989	Bacteria	3016
3	JGI24737J22298_10020065	3300001990	Bacteria	2136
4	JGI24738J21930_10040683	3300002075	Bacteria	944
5	JGI24744J21845_10012388	3300002077	Bacteria	1731
6	JGI25406J46586_10000043	3300003203	Bacteria	55866
7	JGI25153J46596_10000584	3300003215	Bacteria	22421
8	JGI25153J46596_10013457	3300003215	Bacteria	3454
9	JGI25153J46596_10029857	3300003215	Bacteria	1864
10	JGI25160J50197_1009475	3300003354	Bacteria	3607
11	JGI25160J50197_1025725	3300003354	Bacteria	1639
12	JGI25404J52841_10000584	3300003659	Bacteria	5438
13	JGI25404J52841_10003812	3300003659	Bacteria	3013
14	Ga0055539_1003892	3300003752	Bacteria	2028
15	Ga0055539_1004871	3300003752	Bacteria	1770
16	Ga0055542_1009699	3300003762	Bacteria	1801
17	Ga0055531_10028485	3300003794	Bacteria	1925
18	Ga0055543_1013404	3300004625	Bacteria	1621
19	Ga0065165_1001267	3300005262	Bacteria	28574
20	Ga0065165_1004525	3300005262	Bacteria	8527
21	Ga0065165_1006799	3300005262	Bacteria	5841
22	Ga0065165_1059018	3300005262	Bacteria	1057
23	Ga0070658_10213804	3300005327	Bacteria	1629
24	Ga0070683_100330344	3300005329	Bacteria	1451
25	Ga0070690_100181224	3300005330	Bacteria	1456
26	Ga0070670_100090092	3300005331	Bacteria	2636
27	Ga0068869_100088818	3300005334	Bacteria	2320
28	Ga0070666_10140276	3300005335	Bacteria	1683
29	Ga0070680_100072883	3300005336	Bacteria	2823
30	Ga0070680_100108566	3300005336	Bacteria	2309
31	Ga0070682_100109008	3300005337	Bacteria	1842
32	Ga0070682_100235047	3300005337	Bacteria	1313
33	Ga0068868_100037777	3300005338	Bacteria	3745
34	Ga0068868_100172568	3300005338	Bacteria	1790
35	Ga0068868_100214344	3300005338	Bacteria	1610
36	Ga0068868_100674085	3300005338	Bacteria	923
37	Ga0070660_100002476	3300005339	Bacteria	12662
38	Ga0070660_100198389	3300005339	Bacteria	1627
39	Ga0070660_100463178	3300005339	Bacteria	1052
40	Ga0070689_100061722	3300005340	Bacteria	2916
41	Ga0070689_100398029	3300005340	Bacteria	1163
42	Ga0070691_10113795	3300005341	Bacteria	1356
43	Ga0070661_100330189	3300005344	Bacteria	1193
44	Ga0070661_100484152	3300005344	Bacteria	988
45	Ga0070692_10272411	3300005345	Bacteria	1023
46	Ga0070668_100048131	3300005347	Bacteria	3279
47	Ga0070669_100079970	3300005353	Bacteria	2432
48	Ga0070675_100129332	3300005354	Bacteria	2150
49	Ga0070671_100089161	3300005355	Bacteria	2582
50	Ga0070671_100393849	3300005355	Bacteria	1184
51	Ga0070674_100041788	3300005356	Bacteria	3110
52	Ga0070688_100506884	3300005365	Bacteria	911
53	Ga0070659_100070297	3300005366	Bacteria	2780
54	Ga0070667_100171547	3300005367	Bacteria	1915
55	Ga0070709_10010428	3300005434	Bacteria	5149
56	Ga0070709_10172390	3300005434	Bacteria	1513
57	Ga0070714_100047285	3300005435	Bacteria	3655
58	Ga0070714_100208590	3300005435	Bacteria	1790
59	Ga0070714_100237033	3300005435	Bacteria	1683
60	Ga0070713_100019995	3300005436	Bacteria	5125
61	Ga0070713_100030915	3300005436	Bacteria	4258
62	Ga0070713_100139429	3300005436	Bacteria	2146
63	Ga0070710_10000971	3300005437	Bacteria	13611
64	Ga0070701_10031761	3300005438	Bacteria	2623
65	Ga0070711_100002148	3300005439	Bacteria	11178
66	Ga0070705_100188194	3300005440	Bacteria	1404
67	Ga0070663_100003861	3300005455	Bacteria	8731
68	Ga0070663_100042900	3300005455	Bacteria	3180
69	Ga0070663_100168687	3300005455	Bacteria	1690
70	Ga0070663_100173188	3300005455	Bacteria	1669
71	Ga0070663_100293598	3300005455	Bacteria	1299
72	Ga0070663_100483539	3300005455	Bacteria	1025
73	Ga0070678_100009294	3300005456	Bacteria	5946
74	Ga0070678_100013992	3300005456	Bacteria	5045
75	Ga0070706_100107535	3300005467	Bacteria	2595
76	Ga0070706_100379580	3300005467	Bacteria	1316
77	Ga0070707_100599840	3300005468	Bacteria	1064
78	Ga0070698_100159311	3300005471	Bacteria	2202
79	Ga0070679_100048989	3300005530	Bacteria	4208
80	Ga0070679_100155446	3300005530	Bacteria	2262
81	Ga0070684_100086722	3300005535	Bacteria	2779
82	Ga0070697_100003566	3300005536	Bacteria	11961
83	Ga0070697_100153453	3300005536	Bacteria	1942
84	Ga0068853_100004362	3300005539	Bacteria	10947
85	Ga0068853_100009798	3300005539	Bacteria	7732
86	Ga0068853_100071100	3300005539	Bacteria	3029
87	Ga0068853_100099687	3300005539	Bacteria	2567
88	Ga0068853_100162295	3300005539	Bacteria	2018
89	Ga0068853_100168652	3300005539	Bacteria	1979
90	Ga0068853_100336583	3300005539	Bacteria	1401
91	Ga0068853_100557394	3300005539	Bacteria	1086
92	Ga0070672_100110745	3300005543	Bacteria	2237
93	Ga0070672_100196003	3300005543	Bacteria	1688
94	Ga0070695_100021585	3300005545	Bacteria	3943
95	Ga0070665_100014688	3300005548	Bacteria	7857
96	Ga0070665_100112639	3300005548	Bacteria	2723
97	Ga0070665_100229951	3300005548	Bacteria	1854
98	Ga0070704_100125092	3300005549	Bacteria	1982
99	Ga0068855_100015060	3300005563	Bacteria	9312
100	Ga0068855_100019571	3300005563	Bacteria	8130
101	Ga0068855_100071320	3300005563	Bacteria	4040
102	Ga0068855_100079813	3300005563	Bacteria	3794
103	Ga0068855_100167070	3300005563	Bacteria	2493
104	Ga0068855_100349358	3300005563	Bacteria	1629
105	Ga0068855_100549296	3300005563	Bacteria	1251
106	Ga0070664_100032584	3300005564	Bacteria	4359
107	Ga0070664_100077599	3300005564	Bacteria	2856
108	Ga0070664_100304854	3300005564	Bacteria	1440
109	Ga0068857_100007059	3300005577	Bacteria	9673
110	Ga0068857_100028351	3300005577	Bacteria	4941
111	Ga0068857_100070603	3300005577	Bacteria	3111
112	Ga0068857_100276969	3300005577	Bacteria	1542
113	Ga0068857_100510850	3300005577	Bacteria	1129
114	Ga0068854_100005211	3300005578	Bacteria	8198
115	Ga0068854_100042625	3300005578	Bacteria	3213
116	Ga0068854_100164844	3300005578	Bacteria	1720
117	Ga0068854_100356437	3300005578	Bacteria	1199
118	Ga0068856_100004253	3300005614	Bacteria	14297
119	Ga0068856_100010258	3300005614	Bacteria	9107
120	Ga0068856_100039035	3300005614	Bacteria	4662
121	Ga0068856_100126841	3300005614	Bacteria	2555
122	Ga0068856_100176110	3300005614	Bacteria	2151
123	Ga0070702_100381317	3300005615	Bacteria	1002
124	Ga0068852_100026622	3300005616	Bacteria	4704
125	Ga0068852_100039288	3300005616	Bacteria	3984
126	Ga0068852_100164154	3300005616	Bacteria	2076
127	Ga0068852_100199728	3300005616	Bacteria	1892
128	Ga0068852_100328460	3300005616	Bacteria	1487
129	Ga0068864_100075170	3300005618	Bacteria	2949
130	Ga0068864_100078193	3300005618	Bacteria	2895
131	Ga0068864_100266674	3300005618	Bacteria	1594
132	Ga0068861_100029518	3300005719	Bacteria	4012
133	Ga0068861_100252130	3300005719	Bacteria	1506
134	Ga0068851_10000746	3300005834	Bacteria	13949
135	Ga0068870_10073852	3300005840	Bacteria	1867
136	Ga0068870_10152444	3300005840	Bacteria	1363
137	Ga0068870_10271348	3300005840	Bacteria	1060
138	Ga0068863_100256927	3300005841	Bacteria	1688
139	Ga0068863_100515415	3300005841	Bacteria	1179
140	Ga0068858_100123719	3300005842	Bacteria	2420
141	Ga0068858_100136563	3300005842	Bacteria	2301
142	Ga0068858_100639493	3300005842	Bacteria	1033
143	Ga0068860_100176740	3300005843	Bacteria	2063
144	Ga0068862_100695544	3300005844	Bacteria	984
145	Ga0081455_10017805	3300005937	Bacteria	6792
146	Ga0081455_10233267	3300005937	Bacteria	1357
147	Ga0081540_1000300	3300005983	Bacteria	51023
148	Ga0081540_1002655	3300005983	Bacteria	14544
149	Ga0081540_1010381	3300005983	Bacteria	6314
150	Ga0081540_1026389	3300005983	Bacteria	3317
151	Ga0081540_1081149	3300005983	Bacteria	1460
152	Ga0081539_10000324	3300005985	Bacteria	106549
153	Ga0081539_10100514	3300005985	Bacteria	1475
154	Ga0081539_10154855	3300005985	Bacteria	1099
155	Ga0070717_10000361	3300006028	Bacteria	29296
156	Ga0070717_10002247	3300006028	Bacteria	13537
157	Ga0070717_10005073	3300006028	Bacteria	9602
158	Ga0070717_10173918	3300006028	Bacteria	1874
159	Ga0075365_10010597	3300006038	Bacteria	5378
160	Ga0075365_10052809	3300006038	Bacteria	2690
161	Ga0075365_10087258	3300006038	Bacteria	2121
162	Ga0075365_10094262	3300006038	Bacteria	2043
163	Ga0075365_10112344	3300006038	Bacteria	1873
164	Ga0075365_10140637	3300006038	Bacteria	1675
165	Ga0075368_10023518	3300006042	Bacteria	2354
166	Ga0075368_10051708	3300006042	Bacteria	1633
167	Ga0075368_10121131	3300006042	Bacteria	1083
168	Ga0075363_100046557	3300006048	Bacteria	2302
169	Ga0075363_100062746	3300006048	Bacteria	2004
170	Ga0075364_10010357	3300006051	Bacteria	5629
171	Ga0075364_10016329	3300006051	Bacteria	4616
172	Ga0075364_10108934	3300006051	Bacteria	1848
173	Ga0075364_10202487	3300006051	Bacteria	1346
174	Ga0070715_10000519	3300006163	Bacteria	10085
175	Ga0070716_100028904	3300006173	Bacteria	2991
176	Ga0070716_100183515	3300006173	Bacteria	1376
177	Ga0070716_100202404	3300006173	Bacteria	1321
178	Ga0070712_100009293	3300006175	Bacteria	6194
179	Ga0070712_100339908	3300006175	Bacteria	1225
180	Ga0075367_10058758	3300006178	Bacteria	2289
181	Ga0075369_10018672	3300006186	Bacteria	2825
182	Ga0075369_10046187	3300006186	Bacteria	1874
183	Ga0075369_10051215	3300006186	Bacteria	1787
184	Ga0075369_10078534	3300006186	Bacteria	1461
185	Ga0075369_10088830	3300006186	Bacteria	1377
186	Ga0075366_10063909	3300006195	Bacteria	2188
187	Ga0075366_10191008	3300006195	Bacteria	1244
188	Ga0075370_10032675	3300006353	Bacteria	2910
189	Ga0075370_10035526	3300006353	Bacteria	2797
190	Ga0075370_10039242	3300006353	Bacteria	2667
191	Ga0075431_100000905	3300006847	Bacteria	26143
192	Ga0075434_100079368	3300006871	Bacteria	3278
193	Ga0075434_100347803	3300006871	Bacteria	1503
194	Ga0075429_100001332	3300006880	Bacteria	20163
195	Ga0075436_100039630	3300006914	Bacteria	3251
196	Ga0075436_100142287	3300006914	Bacteria	1686
197	Ga0099824_1016547	3300006942	Bacteria	6652
198	Ga0075435_100049538	3300007076	Bacteria	3379
199	Ga0075435_100085144	3300007076	Bacteria	2602
200	Ga0099794_10044446	3300007265	Bacteria	2123
201	Ga0099794_10109680	3300007265	Bacteria	1382
202	Ga0105240_10004255	3300009093	Bacteria	21889
203	Ga0105240_10044757	3300009093	Bacteria	5620
204	Ga0105240_10068721	3300009093	Bacteria	4387
205	Ga0105240_10078563	3300009093	Bacteria	4063
206	Ga0105240_10221690	3300009093	Bacteria	2203
207	Ga0105240_10582051	3300009093	Bacteria	1235
208	Ga0111539_10005385	3300009094	Bacteria	16547
209	Ga0111539_10029699	3300009094	Bacteria	6654
210	Ga0105245_10031108	3300009098	Bacteria	4721
211	Ga0105245_10069332	3300009098	Bacteria	3197
212	Ga0114129_10001764	3300009147	Bacteria	29487
213	Ga0114129_10069645	3300009147	Bacteria	4903
214	Ga0105243_10095111	3300009148	Bacteria	2461
215	Ga0105241_10003365	3300009174	Bacteria	11909
216	Ga0105241_10021437	3300009174	Bacteria	4775
217	Ga0105242_10166958	3300009176	Bacteria	1931
218	Ga0105248_10017355	3300009177	Bacteria	7934
219	Ga0105248_10206580	3300009177	Bacteria	2213
220	Ga0105248_10350292	3300009177	Bacteria	1663
221	Ga0105237_10015525	3300009545	Bacteria	7923
222	Ga0105237_10100724	3300009545	Bacteria	2880
223	Ga0105238_10003808	3300009551	Bacteria	14985
224	Ga0105238_10028380	3300009551	Bacteria	5703
225	Ga0105238_10100766	3300009551	Bacteria	2871
226	Ga0105238_10266937	3300009551	Bacteria	1692
227	Ga0105249_10308221	3300009553	Bacteria	1590
228	Ga0099796_10013237	3300010159	Bacteria	2351
229	Ga0105239_10020156	3300010375	Bacteria	7356
230	Ga0105239_10159619	3300010375	Bacteria	2518
231	Ga0105239_10171228	3300010375	Bacteria	2428
232	Ga0105239_10402060	3300010375	Bacteria	1550
233	Ga0105239_10442038	3300010375	Bacteria	1475
234	Ga0157373_10073299	3300013100	Bacteria	2416
235	Ga0157371_10067083	3300013102	Bacteria	2540
236	Ga0157370_10108059	3300013104	Bacteria	2602
237	Ga0157370_10116079	3300013104	Bacteria	2501
238	Ga0157369_10019439	3300013105	Bacteria	7599
239	Ga0157369_10037267	3300013105	Bacteria	5323
240	Ga0157369_10157732	3300013105	Bacteria	2396
241	Ga0157374_10025891	3300013296	Bacteria	5273
242	Ga0157378_10157077	3300013297	Bacteria	2124
243	Ga0163162_10011477	3300013306	Bacteria	8639
244	Ga0163162_10171798	3300013306	Bacteria	2292
245	Ga0163162_10410990	3300013306	Bacteria	1486
246	Ga0157375_10129123	3300013308	Bacteria	2646
247	Ga0157375_10518484	3300013308	Bacteria	1355
248	Ga0163163_10009818	3300014325	Bacteria	8576
249	Ga0163163_10063378	3300014325	Bacteria	3665
250	Ga0163163_10576572	3300014325	Bacteria	1188
251	Ga0163163_10601784	3300014325	Bacteria	1162
252	Ga0157380_10514719	3300014326	Bacteria	1166
253	Ga0182008_10152970	3300014497	Bacteria	1158
254	Ga0157377_10081149	3300014745	Bacteria	1896
255	Ga0157377_10097753	3300014745	Bacteria	1744
256	Ga0157379_10106356	3300014968	Bacteria	2519
257	Ga0157376_10007833	3300014969	Bacteria	7658
258	Ga0182006_1082003	3300015261	Bacteria	1175
259	Ga0214544_1000007	3300021320	Bacteria	379989
260	Ga0214542_1000007	3300021321	Bacteria	291816
261	Ga0214545_1000006	3300021324	Bacteria	291693
262	Ga0214543_1000009	3300021327	Bacteria	384302
263	Ga0213876_10101072	3300021384	Bacteria	1529
264	Ga0213876_10268985	3300021384	Bacteria	906
265	Ga0213875_10007731	3300021388	Bacteria	5531
266	Ga0213875_10054936	3300021388	Bacteria	1865
267	Ga0209563_101359	3300025230	Bacteria	6635
268	Ga0207425_1014810	3300025245	Bacteria	1765
269	Ga0209677_100233	3300025253	Bacteria	39376
270	Ga0209677_103592	3300025253	Bacteria	4916
271	Ga0209148_1000232	3300025254	Bacteria	90923
272	Ga0209233_1003521	3300025261	Bacteria	5502
273	Ga0209233_1004158	3300025261	Bacteria	4979
274	Ga0209455_1002812	3300025272	Bacteria	6477
275	Ga0209455_1007018	3300025272	Bacteria	3243
276	Ga0209455_1008185	3300025272	Bacteria	2868
277	Ga0209455_1009485	3300025272	Bacteria	2553
278	Ga0209673_1064359	3300025273	Bacteria	900
279	Ga0209564_1000397	3300025295	Bacteria	77778
280	Ga0209564_1028802	3300025295	Bacteria	1764
281	Ga0209564_1036007	3300025295	Bacteria	1421
282	Ga0209758_1000595	3300025297	Bacteria	56364
283	Ga0209758_1000604	3300025297	Bacteria	55558
284	Ga0209758_1000767	3300025297	Bacteria	46198
285	Ga0209758_1001054	3300025297	Bacteria	36110
286	Ga0209758_1004139	3300025297	Bacteria	12373
287	Ga0209758_1004893	3300025297	Bacteria	10773
288	Ga0209758_1010620	3300025297	Bacteria	5480
289	Ga0209758_1012657	3300025297	Bacteria	4694
290	Ga0209256_1004224	3300025299	Bacteria	9210
291	Ga0207426_1000500	3300025302	Bacteria	58181
292	Ga0207426_1004976	3300025302	Bacteria	6263
293	Ga0207426_1034891	3300025302	Bacteria	1610
294	Ga0207426_1043155	3300025302	Bacteria	1387
295	Ga0209257_1009208	3300025304	Bacteria	5360
296	Ga0209257_1045053	3300025304	Bacteria	1283
297	Ga0207697_10065973	3300025315	Bacteria	1511
298	Ga0207656_10029528	3300025321	Bacteria	2259
299	Ga0207656_10128738	3300025321	Bacteria	1184
300	Ga0207656_10138617	3300025321	Bacteria	1145
301	Ga0207653_10074199	3300025885	Bacteria	1167
302	Ga0207692_10001068	3300025898	Bacteria	10024
303	Ga0207710_10039124	3300025900	Bacteria	2098
304	Ga0207688_10050908	3300025901	Bacteria	2320
305	Ga0207688_10253643	3300025901	Bacteria	1066
306	Ga0207647_10012297	3300025904	Bacteria	5963
307	Ga0207647_10059208	3300025904	Bacteria	2344
308	Ga0207647_10079655	3300025904	Bacteria	1966
309	Ga0207647_10155228	3300025904	Bacteria	1337
310	Ga0207647_10232405	3300025904	Bacteria	1061
311	Ga0207685_10017980	3300025905	Bacteria	2299
312	Ga0207685_10061918	3300025905	Bacteria	1485
313	Ga0207699_10005006	3300025906	Bacteria	6338
314	Ga0207699_10350203	3300025906	Bacteria	1042
315	Ga0207645_10060303	3300025907	Bacteria	2422
316	Ga0207645_10177475	3300025907	Bacteria	1397
317	Ga0207643_10046638	3300025908	Bacteria	2450
318	Ga0207643_10066630	3300025908	Bacteria	2065
319	Ga0207705_10083979	3300025909	Bacteria	2324
320	Ga0207684_10086257	3300025910	Bacteria	2674
321	Ga0207654_10002385	3300025911	Bacteria	9615
322	Ga0207654_10280472	3300025911	Bacteria	1127
323	Ga0207654_10331582	3300025911	Bacteria	1043
324	Ga0207707_10003099	3300025912	Bacteria	14754
325	Ga0207695_10000123	3300025913	Bacteria	232059
326	Ga0207695_10000579	3300025913	Bacteria	74637
327	Ga0207695_10194070	3300025913	Bacteria	1947
328	Ga0207695_10214399	3300025913	Bacteria	1835
329	Ga0207671_10023035	3300025914	Bacteria	4700
330	Ga0207671_10073633	3300025914	Bacteria	2552
331	Ga0207671_10204781	3300025914	Bacteria	1542
332	Ga0207693_10020689	3300025915	Bacteria	5233
333	Ga0207693_10021940	3300025915	Bacteria	5076
334	Ga0207663_10000229	3300025916	Bacteria	24720
335	Ga0207660_10006884	3300025917	Bacteria	7359
336	Ga0207660_10030192	3300025917	Bacteria	3724
337	Ga0207657_10014727	3300025919	Bacteria	7615
338	Ga0207657_10018024	3300025919	Bacteria	6754
339	Ga0207657_10089154	3300025919	Bacteria	2577
340	Ga0207657_10207014	3300025919	Bacteria	1576
341	Ga0207649_10184282	3300025920	Bacteria	1463
342	Ga0207649_10313128	3300025920	Bacteria	1151
343	Ga0207649_10353362	3300025920	Bacteria	1088
344	Ga0207652_10002148	3300025921	Bacteria	16913
345	Ga0207652_10087976	3300025921	Bacteria	2724
346	Ga0207652_10144479	3300025921	Bacteria	2128
347	Ga0207646_10119519	3300025922	Bacteria	2367
348	Ga0207646_10587648	3300025922	Bacteria	1000
349	Ga0207694_10001208	3300025924	Bacteria	22407
350	Ga0207694_10007559	3300025924	Bacteria	8238
351	Ga0207694_10045004	3300025924	Bacteria	3409
352	Ga0207694_10123561	3300025924	Bacteria	2068
353	Ga0207650_10068179	3300025925	Bacteria	2671
354	Ga0207650_10118742	3300025925	Bacteria	2056
355	Ga0207659_10067361	3300025926	Bacteria	2600
356	Ga0207687_10062803	3300025927	Bacteria	2628
357	Ga0207687_10143028	3300025927	Bacteria	1817
358	Ga0207687_10459442	3300025927	Bacteria	1057
359	Ga0207700_10021207	3300025928	Bacteria	4431
360	Ga0207700_10062861	3300025928	Bacteria	2821
361	Ga0207700_10250854	3300025928	Bacteria	1512
362	Ga0207664_10048616	3300025929	Bacteria	3336
363	Ga0207664_10054648	3300025929	Bacteria	3165
364	Ga0207664_10090815	3300025929	Bacteria	2503
365	Ga0207664_10144782	3300025929	Bacteria	2014
366	Ga0207664_10186700	3300025929	Bacteria	1783
367	Ga0207664_10189046	3300025929	Bacteria	1772
368	Ga0207644_10070670	3300025931	Bacteria	2552
369	Ga0207644_10133935	3300025931	Bacteria	1901
370	Ga0207644_10575699	3300025931	Bacteria	933
371	Ga0207690_10041632	3300025932	Bacteria	3011
372	Ga0207690_10387413	3300025932	Bacteria	1112
373	Ga0207706_10160637	3300025933	Bacteria	1975
374	Ga0207706_10387338	3300025933	Bacteria	1213
375	Ga0207686_10149700	3300025934	Bacteria	1623
376	Ga0207709_10036879	3300025935	Bacteria	2901
377	Ga0207709_10117907	3300025935	Bacteria	1787
378	Ga0207709_10229494	3300025935	Bacteria	1344
379	Ga0207669_10001419	3300025937	Bacteria	10207
380	Ga0207669_10037824	3300025937	Bacteria	2773
381	Ga0207704_10171336	3300025938	Bacteria	1557
382	Ga0207704_10530530	3300025938	Bacteria	954
383	Ga0207665_10016623	3300025939	Bacteria	4834
384	Ga0207665_10076188	3300025939	Bacteria	2299
385	Ga0207665_10185180	3300025939	Bacteria	1510
386	Ga0207665_10194915	3300025939	Bacteria	1474
387	Ga0207665_10293523	3300025939	Bacteria	1213
388	Ga0207691_10059792	3300025940	Bacteria	3464
389	Ga0207691_10174355	3300025940	Bacteria	1882
390	Ga0207711_10058323	3300025941	Bacteria	3322
391	Ga0207689_10128989	3300025942	Bacteria	2081
392	Ga0207661_10109127	3300025944	Bacteria	2337
393	Ga0207661_10179767	3300025944	Bacteria	1847
394	Ga0207679_10054782	3300025945	Bacteria	2937
395	Ga0207667_10001989	3300025949	Bacteria	25637
396	Ga0207667_10007912	3300025949	Bacteria	12694
397	Ga0207667_10018590	3300025949	Bacteria	7789
398	Ga0207667_10026463	3300025949	Bacteria	6337
399	Ga0207667_10066955	3300025949	Bacteria	3742
400	Ga0207667_10119112	3300025949	Bacteria	2721
401	Ga0207667_10388639	3300025949	Bacteria	1421
402	Ga0207667_10733389	3300025949	Bacteria	988
403	Ga0207651_10253449	3300025960	Bacteria	1441
404	Ga0207651_10255622	3300025960	Bacteria	1436
405	Ga0207651_10446024	3300025960	Bacteria	1109
406	Ga0207712_10113636	3300025961	Bacteria	2035
407	Ga0207668_10081235	3300025972	Bacteria	2350
408	Ga0207668_10357051	3300025972	Bacteria	1223
409	Ga0207640_10010676	3300025981	Bacteria	5180
410	Ga0207640_10321188	3300025981	Bacteria	1233
411	Ga0207640_10401963	3300025981	Bacteria	1116
412	Ga0207640_10408574	3300025981	Bacteria	1108
413	Ga0207677_10022070	3300026023	Bacteria	3904
414	Ga0207677_10166956	3300026023	Bacteria	1716
415	Ga0207677_10175047	3300026023	Bacteria	1682
416	Ga0207703_10037399	3300026035	Bacteria	3866
417	Ga0207703_10118694	3300026035	Bacteria	2268
418	Ga0207703_10369690	3300026035	Bacteria	1324
419	Ga0207703_10437086	3300026035	Bacteria	1220
420	Ga0207703_10503678	3300026035	Bacteria	1137
421	Ga0207703_10861325	3300026035	Bacteria	867
422	Ga0207639_10007424	3300026041	Bacteria	7476
423	Ga0207639_10011300	3300026041	Bacteria	6197
424	Ga0207639_10082192	3300026041	Bacteria	2553
425	Ga0207639_10132396	3300026041	Bacteria	2066
426	Ga0207639_10295170	3300026041	Bacteria	1431
427	Ga0207639_10306945	3300026041	Bacteria	1404
428	Ga0207678_10047069	3300026067	Bacteria	3730
429	Ga0207678_10048642	3300026067	Bacteria	3665
430	Ga0207678_10051786	3300026067	Bacteria	3543
431	Ga0207678_10081217	3300026067	Bacteria	2775
432	Ga0207678_10175431	3300026067	Bacteria	1830
433	Ga0207678_10230307	3300026067	Bacteria	1586
434	Ga0207678_10251447	3300026067	Bacteria	1514
435	Ga0207678_10436092	3300026067	Bacteria	1137
436	Ga0207708_10058337	3300026075	Bacteria	2945
437	Ga0207702_10000003	3300026078	Bacteria	434196
438	Ga0207702_10000014	3300026078	Bacteria	253304
439	Ga0207702_10033789	3300026078	Bacteria	4273
440	Ga0207702_10060371	3300026078	Bacteria	3232
441	Ga0207702_10231573	3300026078	Bacteria	1727
442	Ga0207641_10188063	3300026088	Bacteria	1896
443	Ga0207641_10278315	3300026088	Bacteria	1573
444	Ga0207648_10400720	3300026089	Bacteria	1243
445	Ga0207648_10400811	3300026089	Bacteria	1243
446	Ga0207676_10105287	3300026095	Bacteria	2348
447	Ga0207676_10157516	3300026095	Bacteria	1964
448	Ga0207676_10528037	3300026095	Bacteria	1124
449	Ga0207676_10541473	3300026095	Bacteria	1111
450	Ga0207674_10007573	3300026116	Bacteria	12652
451	Ga0207674_10022325	3300026116	Bacteria	6796
452	Ga0207674_10042067	3300026116	Bacteria	4722
453	Ga0207674_10095559	3300026116	Bacteria	2958
454	Ga0207674_10112822	3300026116	Bacteria	2692
455	Ga0207674_10474263	3300026116	Bacteria	1209
456	Ga0207674_10708123	3300026116	Bacteria	972
457	Ga0207675_100481199	3300026118	Bacteria	1234
458	Ga0207675_100505394	3300026118	Bacteria	1204
459	Ga0207683_10018157	3300026121	Bacteria	5999
460	Ga0207683_10107416	3300026121	Bacteria	2497
461	Ga0207683_10268995	3300026121	Bacteria	1557
462	Ga0207698_10013764	3300026142	Bacteria	5352
463	Ga0207698_10031103	3300026142	Bacteria	3849
464	Ga0207698_10104451	3300026142	Bacteria	2357
465	Ga0207698_10797528	3300026142	Bacteria	946
466	Ga0209389_1000019	3300027296	Bacteria	172067
467	Ga0209389_1000070	3300027296	Bacteria	97498
468	Ga0209589_1000420	3300027357	Bacteria	58471
469	Ga0209489_100033	3300027361	Bacteria	172166
470	Ga0209489_100196	3300027361	Bacteria	97498
471	Ga0209700_100012	3300027363	Bacteria	357892
472	Ga0209588_1029138	3300027671	Bacteria	1760
473	Ga0209813_10035175	3300027866	Bacteria	1498
474	Ga0209813_10039720	3300027866	Bacteria	1427
475	Ga0207428_10039711	3300027907	Bacteria	3821
476	Ga0207428_10193448	3300027907	Bacteria	1533
477	Ga0268266_10002343	3300028379	Bacteria	20488
478	Ga0268266_10006350	3300028379	Bacteria	10834
479	Ga0268266_10024634	3300028379	Bacteria	5119
480	Ga0268266_10062684	3300028379	Bacteria	3209
481	Ga0268266_10249547	3300028379	Bacteria	1641
482	Ga0268266_10461525	3300028379	Bacteria	1208
483	Ga0268266_10466119	3300028379	Bacteria	1202
484	Ga0268265_10039667	3300028380	Bacteria	3472
485	Ga0268265_10359950	3300028380	Bacteria	1331
486	Ga0268265_10921176	3300028380	Bacteria	859
487	Ga0268264_10104745	3300028381	Bacteria	2466
488	Ga0268264_10546741	3300028381	Bacteria	1135
489	Ga0265334_10008193	3300028573	Bacteria	4451
490	Ga0265323_10035465	3300028653	Bacteria	1838
491	Ga0265322_10027844	3300028654	Bacteria	1615
492	Ga0265336_10039885	3300028666	Bacteria	1438
493	Ga0307517_10007290	3300028786	Bacteria	16162
494	Ga0307517_10265496	3300028786	Bacteria	992
495	Ga0307517_10301404	3300028786	Bacteria	898
496	Ga0307515_10037579	3300028794	Bacteria	7781
497	Ga0265338_10000271	3300028800	Bacteria	94819
498	Ga0265330_10055583	3300031235	Bacteria	1728
499	Ga0265330_10082420	3300031235	Bacteria	1385
500	Ga0265332_10004083	3300031238	Bacteria	6926
501	Ga0265332_10011711	3300031238	Bacteria	3896
502	Ga0265340_10004004	3300031247	Bacteria	8281
503	Ga0265339_10030336	3300031249	Bacteria	3062
504	Ga0265331_10088418	3300031250	Bacteria	1433
505	Ga0265316_10141170	3300031344	Bacteria	1809
506	Ga0307513_10117127	3300031456	Bacteria	2642
507	Ga0307513_10231530	3300031456	Bacteria	1660
508	Ga0307509_10389308	3300031507	Bacteria	1104
509	Ga0307408_100260154	3300031548	Bacteria	1436
510	Ga0307508_10000019	3300031616	Bacteria	197575
511	Ga0265314_10002529	3300031711	Bacteria	18595
512	Ga0265314_10130938	3300031711	Bacteria	1565
513	Ga0265314_10134029	3300031711	Bacteria	1541
514	Ga0265342_10096814	3300031712	Bacteria	1686
515	Ga0265342_10126168	3300031712	Bacteria	1437
516	Ga0307516_10031409	3300031730	Bacteria	5352
517	Ga0307516_10232934	3300031730	Bacteria	1544
518	Ga0307413_10114291	3300031824	Bacteria	1814
519	Ga0307406_10138959	3300031901	Bacteria	1717
520	Ga0307412_10019954	3300031911	Bacteria	4070
521	Ga0307409_100395125	3300031995	Bacteria	1319
522	Ga0307411_10033487	3300032005	Bacteria	3187
523	Ga0307411_10551584	3300032005	Bacteria	983
524	Ga0307415_100049205	3300032126	Bacteria	2849
525	Ga0307415_100405779	3300032126	Bacteria	1165
526	Ga0307415_100577593	3300032126	Bacteria	996
527	Ga0307510_10015785	3300033180	Bacteria	8928
528	Ga0307510_10263892	3300033180	Bacteria	1202
529	Ga0316215_1001986	3300033544	Bacteria	1939
530	Ga0373934_0000917	3300035086	Bacteria	10657
531	Ga0373934_0032152	3300035086	Bacteria	2057
532	Ga0373952_0017543	3300035092	Bacteria	1470
533	Ga0373923_0022875	3300035111	Bacteria	2454
534	Ga0373923_0061944	3300035111	Bacteria	1591
535	Ga0373936_0014676	3300035113	Bacteria	2997
536	Ga0373941_0051377	3300035115	Bacteria	1311
537	Ga0373945_0007452	3300035116	Bacteria	3548
538	Ga0373953_0059246	3300035117	Bacteria	1563
539	Ga0373954_0024987	3300035118	Bacteria	2727
540	Ga0373954_0031917	3300035118	Bacteria	2433
541	Ga0373954_0036481	3300035118	Bacteria	2282
542	Ga0373956_0027948	3300035119	Bacteria	2452
543	Ga0373956_0131220	3300035119	Bacteria	1173
544	Ga0373957_0013357	3300035120	Bacteria	2785
545	Ga0373943_0001395	3300035170	Bacteria	10885
546	Ga0373943_0078315	3300035170	Bacteria	1690
547	Ga0373943_0112434	3300035170	Bacteria	1438
548	Ga0373946_0085040	3300035171	Bacteria	1392
549	Ga0373955_0070619	3300035172	Bacteria	1951
550	Ga0373924_0011735	3300035410	Bacteria	3259
551	Ga0373931_0129764	3300035691	Bacteria	1449
552	Ga0373931_0143771	3300035691	Bacteria	1384
553	Ga0373935_0001273	3300035692	Bacteria	13895
554	Ga0373935_0041463	3300035692	Bacteria	2892
555	Ga0373935_0043548	3300035692	Bacteria	2825
556	Ga0373927_0000792	3300035695	Bacteria	24123
557	Ga0373927_0011161	3300035695	Bacteria	5983
558	Ga0373927_0012663	3300035695	Bacteria	5611
559	Ga0373927_0038479	3300035695	Bacteria	3105
560	Ga0373927_0051353	3300035695	Bacteria	2666
561	Ga0373927_0116986	3300035695	Bacteria	1738
562	Ga0373927_0278256	3300035695	Bacteria	1101
563	Ga0373933_0000777	3300035724	Bacteria	19461
564	Ga0373933_0001270	3300035724	Bacteria	14897
565	Ga0373933_0028392	3300035724	Bacteria	3227
566	Ga0373933_0034488	3300035724	Bacteria	2950
567	Ga0373933_0377967	3300035724	Bacteria	922
568	Ga0373947_0002479	3300035725	Bacteria	11100
569	Ga0373947_0048876	3300035725	Bacteria	2539
570	Ga0373947_0098616	3300035725	Bacteria	1833
571	Ga0373947_0120371	3300035725	Bacteria	1667
572	Ga0373947_0145851	3300035725	Bacteria	1521
573	Ga0373947_0300029	3300035725	Bacteria	1071
574	Ga0373937_0002152	3300036401	Bacteria	16491
575	Ga0373937_0288799	3300036401	Bacteria	1549
576	Ga0373925_0025224	3300037068	Bacteria	4341
577	Ga0373925_0033683	3300037068	Bacteria	3774
578	Ga0373925_0103159	3300037068	Bacteria	2195
579	Ga0373925_0424248	3300037068	Bacteria	1087
580	Ga0395899_0016833	3300037312	Bacteria	5574
581	Ga0395899_0062406	3300037312	Bacteria	2744
582	Ga0395900_0001526	3300037418	Bacteria	27536
583	Ga0395900_0005676	3300037418	Bacteria	13049
584	Ga0395900_0303838	3300037418	Bacteria	1581
585	Ga0395900_0536575	3300037418	Bacteria	1116
586	Ga0395900_0716042	3300037418	Bacteria	933
587	Ga0395898_0020602	3300037466	Bacteria	6698
588	Ga0395898_0038432	3300037466	Bacteria	4744
589	Ga0395898_0148304	3300037466	Bacteria	2245
590	Ga0395898_0157428	3300037466	Bacteria	2172
591	Ga0395898_0505367	3300037466	Bacteria	1149
592	Ga0395905_0020395	3300037471	Bacteria	6280
593	Ga0395905_0168777	3300037471	Bacteria	2056
594	Ga0395905_0206719	3300037471	Bacteria	1840
595	Ga0395905_0426158	3300037471	Bacteria	1223
596	Ga0436364_0209995	3300037853	Bacteria	1521
597	Ga0436364_0746919	3300037853	Bacteria	7051
598	Ga0436364_0802399	3300037853	Bacteria	1892
599	Ga0436364_1499429	3300037853	Bacteria	2173
600	Ga0395901_0074399	3300038443	Bacteria	3544
601	Ga0395901_0167652	3300038443	Bacteria	2305
602	Ga0395901_0212623	3300038443	Bacteria	2024
603	Ga0395901_0252899	3300038443	Bacteria	1835
604	Ga0395901_0348137	3300038443	Bacteria	1529
605	Ga0395901_0618847	3300038443	Bacteria	1090
606	Ga0400489_18067	3300039093	Bacteria	4134
607	Ga0436365_0085684	3300039437	Bacteria	1040
608	Ga0436365_0414081	3300039437	Bacteria	2224
609	Ga0436365_0693364	3300039437	Bacteria	1378
610	Ga0436365_0838189	3300039437	Bacteria	1696
611	Ga0436365_1703855	3300039437	Bacteria	2415
612	Ga0436363_1076359	3300039450	Bacteria	2121
613	Ga0436362_1231827	3300039453	Bacteria	7272
614	Ga0439465_0048560	3300041413	Bacteria	1385
615	Ga0451793_0924719	3300041452	Bacteria	1293
616	Ga0451795_1297581	3300041456	Bacteria	2019
617	Ga0451800_1299000	3300041459	Bacteria	1855
618	Ga0451807_0007667	3300041486	Bacteria	2069
619	Ga0451843_0556862	3300041509	Bacteria	807
620	Ga0451853_3984790	3300041512	Bacteria	1400
621	Ga0439445_0028170	3300042004	Bacteria	1447
622	Ga0439464_0022423	3300042439	Bacteria	1739
623	Ga0466969_0053098	3300044656	Bacteria	1990
624	Ga0466972_0000203	3300044658	Bacteria	43529
625	Ga0466972_0053365	3300044658	Bacteria	1946
626	Ga0466965_0013246	3300044683	Bacteria	3888
627	Ga0466966_0001755	3300044684	Bacteria	14042
628	Ga0466966_0100010	3300044684	Bacteria	1794
629	Ga0466961_0000095	3300044693	Bacteria	56814
630	Ga0466963_0004305	3300044694	Bacteria	8258
631	Ga0466963_0015395	3300044694	Bacteria	4735
632	Ga0466964_0053133	3300044706	Bacteria	1667
633	Ga0466968_0029483	3300044735	Bacteria	2269
634	Ga0466970_0031601	3300044765	Bacteria	2797
635	Ga0466970_0085030	3300044765	Bacteria	1713
636	Ga0466970_0093115	3300044765	Bacteria	1637
637	Ga0466957_0222147	3300044842	Bacteria	1248
638	Ga0466960_0027321	3300044901	Bacteria	2601
639	Ga0466959_0011974	3300045049	Bacteria	6255
640	Ga0466959_0334709	3300045049	Bacteria	1033
641	Ga0466967_0025660	3300045976	Bacteria	4862
642	Ga0466967_0291543	3300045976	Bacteria	1568
643	Ga0466967_0400970	3300045976	Bacteria	1335
644	Ga0466967_0563760	3300045976	Bacteria	1122
645	Ga0495617_094833	3300046452	Bacteria	972
646	Ga0495627_018888	3300046453	Bacteria	2318
647	Ga0495592_0002895	3300046454	Bacteria	12206
648	Ga0495592_0056639	3300046454	Bacteria	2896
649	Ga0495603_0001835	3300046455	Bacteria	12523
650	Ga0495603_0019231	3300046455	Bacteria	4135
651	Ga0495603_0030103	3300046455	Bacteria	3271
652	Ga0495603_0045295	3300046455	Bacteria	2623
653	Ga0495603_0172677	3300046455	Bacteria	1252
654	Ga0495603_0176566	3300046455	Bacteria	1236
655	Ga0495590_0151584	3300046457	Bacteria	840
656	Ga0495591_032611	3300046458	Bacteria	1549
657	Ga0495629_0001441	3300046459	Bacteria	18767
658	Ga0495629_0007128	3300046459	Bacteria	8237
659	Ga0495629_0013674	3300046459	Bacteria	5856
660	Ga0495629_0037539	3300046459	Bacteria	3415
661	Ga0495629_0120018	3300046459	Bacteria	1832
662	Ga0495629_0246941	3300046459	Bacteria	1228
663	Ga0495629_0353429	3300046459	Bacteria	1002
664	Ga0495638_0004327	3300046460	Bacteria	10767
665	Ga0495638_0030841	3300046460	Bacteria	3447
666	Ga0495641_0003725	3300046461	Bacteria	11224
667	Ga0495641_0134744	3300046461	Bacteria	1103
668	Ga0495651_0019778	3300046462	Bacteria	5220
669	Ga0495651_0032501	3300046462	Bacteria	4069
670	Ga0495651_0107832	3300046462	Bacteria	2063
671	Ga0495651_0124395	3300046462	Bacteria	1890
672	Ga0495651_0149552	3300046462	Bacteria	1685
673	Ga0495653_0039229	3300046463	Bacteria	3711
674	Ga0495653_0096644	3300046463	Bacteria	2147
675	Ga0495653_0153616	3300046463	Bacteria	1606
676	Ga0495653_0168026	3300046463	Bacteria	1517
677	Ga0495580_0012167	3300046472	Bacteria	6614
678	Ga0495580_0015651	3300046472	Bacteria	5715
679	Ga0495580_0335887	3300046472	Bacteria	1025
680	Ga0495582_0000084	3300046473	Bacteria	47752
681	Ga0495582_0042465	3300046473	Bacteria	2504
682	Ga0495582_0156189	3300046473	Bacteria	1296
683	Ga0495605_0042163	3300046474	Bacteria	2270
684	Ga0495605_0119459	3300046474	Bacteria	1196
685	Ga0495639_0001155	3300046475	Bacteria	11924
686	Ga0495639_0052234	3300046475	Bacteria	1860
687	Ga0495639_0155951	3300046475	Bacteria	1103
688	Ga0495639_0184216	3300046475	Bacteria	1017
689	Ga0495662_0000454	3300046476	Bacteria	18465
690	Ga0495662_0046284	3300046476	Bacteria	2101
691	Ga0495664_0006706	3300046477	Bacteria	6369
692	Ga0495664_0012642	3300046477	Bacteria	4782
693	Ga0495664_0114148	3300046477	Bacteria	1632
694	Ga0495664_0268771	3300046477	Bacteria	1030
695	Ga0495664_0335072	3300046477	Bacteria	912
696	Ga0495584_0158263	3300046491	Bacteria	1151
697	Ga0495585_0078612	3300046492	Bacteria	1789
698	Ga0495594_0001840	3300046499	Bacteria	11034
699	Ga0495594_0036768	3300046499	Bacteria	2671
700	Ga0495594_0092697	3300046499	Bacteria	1694
701	Ga0495607_0127200	3300046501	Bacteria	1331
702	Ga0495583_0084423	3300046506	Bacteria	1376
703	Ga0495606_0013747	3300046507	Bacteria	6371
704	Ga0495606_0017331	3300046507	Bacteria	5451
705	Ga0495606_0140641	3300046507	Bacteria	1426
706	Ga0495606_0144822	3300046507	Bacteria	1400
707	Ga0495606_0151987	3300046507	Bacteria	1358
708	Ga0495606_0227559	3300046507	Bacteria	1047
709	Ga0495608_0018798	3300046511	Bacteria	4761
710	Ga0495608_0044124	3300046511	Bacteria	2976
711	Ga0495610_0030666	3300046512	Bacteria	2814
712	Ga0495610_0120983	3300046512	Bacteria	1147
713	Ga0495610_0157698	3300046512	Bacteria	962
714	Ga0495616_0113772	3300046513	Bacteria	1255
715	Ga0495618_0061125	3300046514	Bacteria	2389
716	Ga0495620_0027058	3300046515	Bacteria	2689
717	Ga0495628_0007687	3300046516	Bacteria	9318
718	Ga0495628_0008644	3300046516	Bacteria	8722
719	Ga0495628_0148463	3300046516	Bacteria	1786
720	Ga0495630_0116733	3300046517	Bacteria	2023
721	Ga0495630_0290947	3300046517	Bacteria	1248
722	Ga0495631_0120697	3300046518	Bacteria	1127
723	Ga0495632_0073862	3300046519	Bacteria	1634
724	Ga0495632_0086538	3300046519	Bacteria	1490
725	Ga0495637_0028466	3300046520	Bacteria	2496
726	Ga0495643_0014330	3300046522	Bacteria	4719
727	Ga0495643_0042279	3300046522	Bacteria	2483
728	Ga0495643_0101130	3300046522	Bacteria	1477
729	Ga0495643_0193385	3300046522	Bacteria	981
730	Ga0495643_0234999	3300046522	Bacteria	862
731	Ga0495644_0091189	3300046523	Bacteria	1150
732	Ga0495648_0018505	3300046524	Bacteria	4927
733	Ga0495648_0055188	3300046524	Bacteria	2396
734	Ga0495648_0102411	3300046524	Bacteria	1577
735	Ga0495648_0157380	3300046524	Bacteria	1178
736	Ga0495666_0050426	3300046526	Bacteria	2001
737	Ga0495652_0036409	3300046529	Bacteria	4280
738	Ga0495652_0120288	3300046529	Bacteria	2096
739	Ga0495652_0232270	3300046529	Bacteria	1378
740	Ga0495652_0249381	3300046529	Bacteria	1316
741	Ga0495654_0057842	3300046530	Bacteria	1872
742	Ga0495665_0001312	3300046531	Bacteria	13267
743	Ga0495665_0036336	3300046531	Bacteria	2630
744	Ga0495640_0065705	3300046533	Bacteria	2448
745	Ga0495640_0071807	3300046533	Bacteria	2321
746	Ga0495640_0115594	3300046533	Bacteria	1748
747	Ga0495586_0048236	3300046535	Bacteria	2301
748	Ga0495587_0007054	3300046536	Bacteria	7293
749	Ga0495587_0059261	3300046536	Bacteria	2247
750	Ga0495587_0087021	3300046536	Bacteria	1808
751	Ga0495587_0449495	3300046536	Bacteria	714
752	Ga0495598_0047126	3300046537	Bacteria	1283
753	Ga0495609_0011033	3300046538	Bacteria	4315
754	Ga0495621_0062883	3300046539	Bacteria	1351
755	Ga0495645_0054907	3300046543	Bacteria	2893
756	Ga0495645_0083555	3300046543	Bacteria	2288
757	Ga0495622_0003118	3300046557	Bacteria	7857
758	Ga0495622_0013816	3300046557	Bacteria	3745
759	Ga0495622_0013824	3300046557	Bacteria	3745
760	Ga0495622_0213779	3300046557	Bacteria	856
761	Ga0495633_0029685	3300046558	Bacteria	2659
762	Ga0495633_0131655	3300046558	Bacteria	1157
763	Ga0495667_0020060	3300046559	Bacteria	4509
764	Ga0495656_0003634	3300046615	Bacteria	5226
765	Ga0495656_0061103	3300046615	Bacteria	1644
766	Ga0495668_0033714	3300046616	Bacteria	2875
767	Ga0495668_0063261	3300046616	Bacteria	2038
768	Ga0495668_0109174	3300046616	Bacteria	1513
769	Ga0495668_0269517	3300046616	Bacteria	932
770	Ga0495634_0000321	3300046642	Bacteria	46387
771	Ga0495634_0041009	3300046642	Bacteria	3145
772	Ga0495634_0055720	3300046642	Bacteria	2643
773	Ga0495634_0070281	3300046642	Bacteria	2308
774	Ga0495611_0193081	3300046648	Bacteria	950
775	Ga0495611_0202128	3300046648	Bacteria	926
776	Ga0495625_0013320	3300046660	Bacteria	6612
777	Ga0495625_0324728	3300046660	Bacteria	979
778	Ga0495625_0343776	3300046660	Bacteria	945
779	Ga0495635_0001529	3300046663	Bacteria	15481
780	Ga0495635_0003585	3300046663	Bacteria	10744
781	Ga0495635_0023026	3300046663	Bacteria	4342
782	Ga0495635_0032708	3300046663	Bacteria	3607
783	Ga0495659_0066742	3300046664	Bacteria	1340
784	Ga0495661_0131339	3300046665	Bacteria	1372
785	Ga0495661_0221495	3300046665	Bacteria	980
786	Ga0495588_0012056	3300046674	Bacteria	4076
787	Ga0495588_0032571	3300046674	Bacteria	2627
788	Ga0495588_0160977	3300046674	Bacteria	1187
789	Ga0495657_0009859	3300046675	Bacteria	7207
790	Ga0495657_0009988	3300046675	Bacteria	7160
791	Ga0495599_0004258	3300046678	Bacteria	8453
792	Ga0495599_0060253	3300046678	Bacteria	2373
793	Ga0495599_0109522	3300046678	Bacteria	1721
794	Ga0495599_0343515	3300046678	Bacteria	896
795	Ga0495623_0025894	3300046679	Bacteria	3778
796	Ga0495623_0111367	3300046679	Bacteria	1659
797	Ga0495623_0226604	3300046679	Bacteria	1062
798	Ga0495646_0004744	3300046680	Bacteria	8579
799	Ga0495646_0025234	3300046680	Bacteria	3740
800	Ga0495646_0067143	3300046680	Bacteria	2120
801	Ga0495646_0070510	3300046680	Bacteria	2058
802	Ga0495646_0141296	3300046680	Bacteria	1346
803	Ga0495647_0008301	3300046681	Bacteria	3490
804	Ga0495658_0002077	3300046683	Bacteria	10151
805	Ga0495658_0008598	3300046683	Bacteria	5065
806	Ga0495658_0143151	3300046683	Bacteria	1464
807	Ga0495669_0025273	3300046684	Bacteria	2589
808	Ga0495613_0003547	3300046689	Bacteria	11700
809	Ga0495613_0059184	3300046689	Bacteria	2809
810	Ga0495613_0190121	3300046689	Bacteria	1451
811	Ga0495624_0001596	3300046690	Bacteria	17405
812	Ga0495670_0014176	3300046691	Bacteria	3922
813	Ga0495670_0029574	3300046691	Bacteria	2719
814	Ga0495670_0079354	3300046691	Bacteria	1670
815	Ga0495671_0050099	3300046692	Bacteria	2080
816	Ga0495671_0131801	3300046692	Bacteria	1219
817	Ga0495649_0118437	3300046694	Bacteria	1401
818	Ga0495649_0184315	3300046694	Bacteria	1088
819	Ga0495600_0039341	3300046809	Bacteria	3079
820	Ga0495600_0043141	3300046809	Bacteria	2940
821	Ga0495600_0122194	3300046809	Bacteria	1693
822	Ga0495600_0133252	3300046809	Bacteria	1615
823	Ga0495600_0181204	3300046809	Bacteria	1357
824	Ga0495600_0329236	3300046809	Bacteria	959
825	Ga0495600_0391125	3300046809	Bacteria	866
826	Ga0495660_0207249	3300046810	Bacteria	932
827	Ga0495581_0000174	3300047315	Bacteria	29174
828	Ga0495581_0013943	3300047315	Bacteria	4662
829	Ga0495581_0043881	3300047315	Bacteria	2586
830	Ga0495581_0400821	3300047315	Bacteria	800
831	Ga0495604_0006679	3300047317	Bacteria	9144
832	Ga0495604_0028908	3300047317	Bacteria	4410
833	Ga0495604_0178443	3300047317	Bacteria	1487
834	Ga0495636_0071930	3300047318	Bacteria	1477
835	Ga0495674_0012229	3300047319	Bacteria	8088
836	Ga0495674_0028660	3300047319	Bacteria	5072
837	Ga0495674_0032846	3300047319	Bacteria	4704
838	Ga0495674_0212023	3300047319	Bacteria	1604
839	Ga0495674_0252838	3300047319	Bacteria	1450
840	Ga0495674_0554644	3300047319	Bacteria	914
841	Ga0495672_0045971	3300047320	Bacteria	2607
842	Ga0495672_0069898	3300047320	Bacteria	1991
843	Ga0495676_0066360	3300047321	Bacteria	2797
844	Ga0495676_0241158	3300047321	Bacteria	1237
845	Ga0495676_0307413	3300047321	Bacteria	1068
846	Ga0495676_0351686	3300047321	Bacteria	985
847	Ga0495680_0029831	3300047322	Bacteria	4461
848	Ga0495680_0069062	3300047322	Bacteria	2697
849	Ga0495680_0103947	3300047322	Bacteria	2113
850	Ga0495680_0412212	3300047322	Bacteria	931
851	Ga0495687_031231	3300047443	Bacteria	2445
852	Ga0495675_0009683	3300047444	Bacteria	6006
853	Ga0495673_0018097	3300047469	Bacteria	3562
854	Ga0495673_0018848	3300047469	Bacteria	3470
855	Ga0495681_0048787	3300047470	Bacteria	2005
856	Ga0495684_0005264	3300047471	Bacteria	10071
857	Ga0495684_0007348	3300047471	Bacteria	8539
858	Ga0495684_0034547	3300047471	Bacteria	3879
859	Ga0495686_0056466	3300047472	Bacteria	2453
860	Ga0495686_0129207	3300047472	Bacteria	1499
861	Ga0495686_0205366	3300047472	Bacteria	1128
862	Ga0495686_0261572	3300047472	Bacteria	968
863	Ga0495593_0000321	3300047673	Bacteria	26527
864	Ga0495593_0008457	3300047673	Bacteria	5984
865	Ga0495593_0011366	3300047673	Bacteria	5115
866	Ga0495593_0066053	3300047673	Bacteria	1886
867	Ga0495602_0066912	3300048088	Bacteria	3093
868	Ga0495602_0073666	3300048088	Bacteria	2905
869	Ga0495602_0096401	3300048088	Bacteria	2439
870	Ga0495614_0018834	3300048089	Bacteria	2990
871	Ga0496100_0030986	3300048903	Bacteria	3321
872	Ga0496100_0267734	3300048903	Bacteria	1269
873	Ga0496100_0319795	3300048903	Bacteria	1165
874	Ga0496100_0454927	3300048903	Bacteria	982
875	Ga0496101_0001116	3300048904	Bacteria	15986
876	Ga0496101_0098562	3300048904	Bacteria	2184
877	Ga0496101_0349694	3300048904	Bacteria	1161
878	Ga0496101_0554453	3300048904	Bacteria	909
879	Ga0496102_0011710	3300048905	Bacteria	7570
880	Ga0496102_0050412	3300048905	Bacteria	3790
881	Ga0496102_0139532	3300048905	Bacteria	2272
882	Ga0496102_0385137	3300048905	Bacteria	1319
883	Ga0496102_0705933	3300048905	Bacteria	931
884	Ga0496103_0003589	3300048906	Bacteria	9466
885	Ga0496103_0017422	3300048906	Bacteria	4299
886	Ga0496103_0079695	3300048906	Bacteria	2058
887	Ga0496103_0380740	3300048906	Bacteria	907
888	Ga0496104_0012431	3300048907	Bacteria	7655
889	Ga0496104_0108079	3300048907	Bacteria	2665
890	Ga0496104_0205468	3300048907	Bacteria	1881
891	Ga0496104_0245151	3300048907	Bacteria	1704
892	Ga0496104_0349167	3300048907	Bacteria	1392
893	Ga0496104_0396945	3300048907	Bacteria	1291
894	Ga0496104_0487823	3300048907	Bacteria	1143
895	Ga0496104_0546430	3300048907	Bacteria	1069
896	Ga0496105_0003700	3300048908	Bacteria	11380
897	Ga0496105_0028196	3300048908	Bacteria	4591
898	Ga0496105_0050494	3300048908	Bacteria	3435
899	Ga0496105_0118831	3300048908	Bacteria	2180
900	Ga0496105_0140536	3300048908	Bacteria	1987
901	Ga0496105_0599884	3300048908	Bacteria	855
902	Ga0496106_0001417	3300048909	Bacteria	17974
903	Ga0496106_0008911	3300048909	Bacteria	7417
904	Ga0496106_0083302	3300048909	Bacteria	2459
905	Ga0496106_0575565	3300048909	Bacteria	903
906	Ga0496107_0002177	3300048910	Bacteria	12590
907	Ga0496107_0009363	3300048910	Bacteria	6789
908	Ga0496107_0063213	3300048910	Bacteria	2682
909	Ga0496107_0082738	3300048910	Bacteria	2341
910	Ga0496107_0117463	3300048910	Bacteria	1958
911	Ga0496107_0313582	3300048910	Bacteria	1167
912	Ga0496108_0000467	3300048911	Bacteria	32329
913	Ga0496108_0026157	3300048911	Bacteria	4813
914	Ga0496108_0047303	3300048911	Bacteria	3596
915	Ga0496108_0090140	3300048911	Bacteria	2607
916	Ga0496108_0590469	3300048911	Bacteria	968
917	Ga0496109_0000230	3300048912	Bacteria	54618
918	Ga0496109_0159458	3300048912	Bacteria	2113
919	Ga0496109_0203135	3300048912	Bacteria	1863
920	Ga0496109_0228922	3300048912	Bacteria	1748
921	Ga0496110_0024274	3300048913	Bacteria	5165
922	Ga0496110_0043024	3300048913	Bacteria	3943
923	Ga0496110_0065299	3300048913	Bacteria	3217
924	Ga0496110_0065839	3300048913	Bacteria	3203
925	Ga0496110_0544082	3300048913	Bacteria	1055
926	Ga0496110_0656727	3300048913	Bacteria	949
927	Ga0496111_0009582	3300048914	Bacteria	6470
928	Ga0496111_0035505	3300048914	Bacteria	3563
929	Ga0496111_0035597	3300048914	Bacteria	3559
930	Ga0496111_0052529	3300048914	Bacteria	2943
931	Ga0496111_0095289	3300048914	Bacteria	2184
932	Ga0496111_0538499	3300048914	Bacteria	858
933	Ga0496112_0000023	3300048915	Bacteria	156144
934	Ga0496112_0016541	3300048915	Bacteria	6915
935	Ga0496112_0019046	3300048915	Bacteria	6471
936	Ga0496112_0023823	3300048915	Bacteria	5856
937	Ga0496112_0026282	3300048915	Bacteria	5598
938	Ga0496112_0107087	3300048915	Bacteria	2765
939	Ga0496112_0110284	3300048915	Bacteria	2722
940	Ga0496112_0318223	3300048915	Bacteria	1500
941	Ga0496112_0716119	3300048915	Bacteria	928
942	Ga0496113_0026922	3300048916	Bacteria	4116
943	Ga0496113_0039367	3300048916	Bacteria	3480
944	Ga0496113_0278618	3300048916	Bacteria	1337
945	Ga0496113_0339197	3300048916	Bacteria	1205
946	Ga0496113_0339605	3300048916	Bacteria	1204
947	Ga0496113_0767275	3300048916	Bacteria	767
948	Ga0496114_0034331	3300048917	Bacteria	4184
949	Ga0496115_0001457	3300048918	Bacteria	16992
950	Ga0496115_0013523	3300048918	Bacteria	6174
951	Ga0496115_0043174	3300048918	Bacteria	3595
952	Ga0496115_0069249	3300048918	Bacteria	2858
953	Ga0496115_0160098	3300048918	Bacteria	1860
954	Ga0496115_0209890	3300048918	Bacteria	1608
955	Ga0496115_0301120	3300048918	Bacteria	1314
956	Ga0496115_0383584	3300048918	Bacteria	1142
957	Ga0496115_0517521	3300048918	Bacteria	957
958	Ga0496116_0001929	3300048919	Bacteria	22341
959	Ga0496116_0186142	3300048919	Bacteria	1105
960	Ga0496116_0272035	3300048919	Bacteria	827
961	Ga0496117_0046900	3300048920	Bacteria	3104
962	Ga0496117_0063075	3300048920	Bacteria	2535
963	Ga0496117_0192614	3300048920	Bacteria	1159
964	Ga0496117_0194830	3300048920	Bacteria	1150
965	Ga0496118_0009320	3300048921	Bacteria	9948
966	Ga0496118_0027902	3300048921	Bacteria	4768
967	Ga0496118_0048112	3300048921	Bacteria	3299
968	Ga0496118_0105501	3300048921	Bacteria	1889
969	Ga0496118_0116873	3300048921	Bacteria	1751
970	Ga0496119_0000934	3300048922	Bacteria	37665
971	Ga0496119_0044680	3300048922	Bacteria	2786
972	Ga0496119_0048915	3300048922	Bacteria	2618
973	Ga0496119_0056925	3300048922	Bacteria	2366
974	Ga0496119_0071005	3300048922	Bacteria	2040
975	Ga0496119_0093115	3300048922	Bacteria	1708
976	Ga0496120_0009108	3300048923	Bacteria	7083
977	Ga0496120_0019417	3300048923	Bacteria	4349
978	Ga0496120_0098975	3300048923	Bacteria	1545
979	Ga0496121_0001793	3300048924	Bacteria	34696
980	Ga0496121_0002081	3300048924	Bacteria	31581
981	Ga0496121_0002915	3300048924	Bacteria	25094
982	Ga0496121_0007192	3300048924	Bacteria	13480
983	Ga0496121_0016644	3300048924	Bacteria	7572
984	Ga0496121_0062068	3300048924	Bacteria	3063
985	Ga0496121_0068006	3300048924	Bacteria	2884
986	Ga0496121_0079020	3300048924	Bacteria	2613
987	Ga0496121_0224016	3300048924	Bacteria	1322
988	Ga0496122_0026757	3300048925	Bacteria	4959
989	Ga0496122_0168356	3300048925	Bacteria	1325
990	Ga0496122_0172358	3300048925	Bacteria	1302
991	Ga0496123_0024339	3300048926	Bacteria	4605
992	Ga0496123_0028199	3300048926	Bacteria	4162
993	Ga0496123_0056798	3300048926	Bacteria	2554
994	Ga0496123_0071310	3300048926	Bacteria	2168
995	Ga0496124_0038290	3300048927	Bacteria	4165
996	Ga0496124_0115301	3300048927	Bacteria	2156
997	Ga0496124_0156569	3300048927	Bacteria	1781
998	Ga0496124_0211212	3300048927	Bacteria	1468
999	Ga0496124_0410521	3300048927	Bacteria	937
1000	Ga0496125_0000158	3300048928	Bacteria	151273
1001	Ga0496125_0003566	3300048928	Bacteria	18742
1002	Ga0496125_0009065	3300048928	Bacteria	10299
1003	Ga0496125_0032195	3300048928	Bacteria	4661
1004	Ga0496125_0033804	3300048928	Bacteria	4518
1005	Ga0496125_0156922	3300048928	Bacteria	1553
1006	Ga0496125_0186242	3300048928	Bacteria	1376
1007	Ga0496125_0390935	3300048928	Bacteria	816
1008	Ga0496126_0001668	3300048929	Bacteria	33320
1009	Ga0496126_0005184	3300048929	Bacteria	15063
1010	Ga0496126_0012254	3300048929	Bacteria	8796
1011	Ga0496126_0014762	3300048929	Bacteria	7881
1012	Ga0496126_0031494	3300048929	Bacteria	5010
1013	Ga0496126_0036934	3300048929	Bacteria	4563
1014	Ga0496126_0049756	3300048929	Bacteria	3824
1015	Ga0496126_0095141	3300048929	Bacteria	2613
1016	Ga0496126_0124477	3300048929	Bacteria	2232
1017	Ga0496126_0142825	3300048929	Bacteria	2059
1018	Ga0496126_0181755	3300048929	Bacteria	1786
1019	Ga0496126_0190487	3300048929	Bacteria	1737
1020	Ga0496126_0196390	3300048929	Bacteria	1706
1021	Ga0496126_0198854	3300048929	Bacteria	1694
1022	Ga0496126_0203148	3300048929	Bacteria	1672
1023	Ga0496126_0238105	3300048929	Bacteria	1522
1024	Ga0496126_0358933	3300048929	Bacteria	1190
1025	Ga0496126_0461679	3300048929	Bacteria	1020
1026	Ga0496126_0474941	3300048929	Bacteria	1003
1027	Ga0496126_0554500	3300048929	Bacteria	911
1028	Ga0495678_133559	3300049459	Bacteria	820
1029	Ga0495682_0035539	3300049460	Bacteria	1835
1030	Ga0501031_0000946	3300049568	Bacteria	17557
1031	Ga0501031_0007375	3300049568	Bacteria	7169
1032	Ga0501031_0179153	3300049568	Bacteria	1384
1033	Ga0501032_0000503	3300049569	Bacteria	31656
1034	Ga0501032_0081543	3300049569	Bacteria	2152
1035	Ga0501032_0110562	3300049569	Bacteria	1818
1036	Ga0501033_0000140	3300049570	Bacteria	70162
1037	Ga0501033_0001234	3300049570	Bacteria	22939
1038	Ga0501033_0019665	3300049570	Bacteria	5103
1039	Ga0501033_0028461	3300049570	Bacteria	4198
1040	Ga0501033_0079879	3300049570	Bacteria	2400
1041	Ga0501033_0185603	3300049570	Bacteria	1490
1042	Ga0501034_0000072	3300049571	Bacteria	179824
1043	Ga0501034_0108610	3300049571	Bacteria	2765
1044	Ga0501034_0141805	3300049571	Bacteria	2382
1045	Ga0501034_0152435	3300049571	Bacteria	2287
1046	Ga0501034_0266963	3300049571	Bacteria	1653
1047	Ga0501034_0370071	3300049571	Bacteria	1359
1048	Ga0501036_0000050	3300049572	Bacteria	75340
1049	Ga0501036_0011109	3300049572	Bacteria	7447
1050	Ga0501036_0206702	3300049572	Bacteria	1650
1051	Ga0501037_0000030	3300049573	Bacteria	136148
1052	Ga0501037_0000580	3300049573	Bacteria	28773
1053	Ga0501037_0012101	3300049573	Bacteria	6355
1054	Ga0501037_0030562	3300049573	Bacteria	3980
1055	Ga0501037_0120281	3300049573	Bacteria	1888
1056	Ga0501037_0127934	3300049573	Bacteria	1823
1057	Ga0501037_0130658	3300049573	Bacteria	1801
1058	Ga0501038_0000039	3300049574	Bacteria	122904
1059	Ga0501038_0037416	3300049574	Bacteria	4254
1060	Ga0501038_0077914	3300049574	Bacteria	2797
1061	Ga0501038_0088413	3300049574	Bacteria	2600
1062	Ga0501038_0097617	3300049574	Bacteria	2451
1063	Ga0501038_0168710	3300049574	Bacteria	1773
1064	Ga0501038_0251239	3300049574	Bacteria	1401
1065	Ga0501038_0611637	3300049574	Bacteria	823
1066	Ga0501039_0000060	3300049575	Bacteria	85528
1067	Ga0501039_0015440	3300049575	Bacteria	5845
1068	Ga0501039_0033351	3300049575	Bacteria	3970
1069	Ga0501039_0200649	3300049575	Bacteria	1568
1070	Ga0501040_0191143	3300049576	Bacteria	1452
1071	Ga0501041_0337438	3300049577	Bacteria	952
1072	Ga0501042_0008737	3300049578	Bacteria	6719
1073	Ga0501042_0129773	3300049578	Bacteria	1816
1074	Ga0501042_0544366	3300049578	Bacteria	844
1075	Ga0501043_0002562	3300049579	Bacteria	15362
1076	Ga0501043_0010025	3300049579	Bacteria	7431
1077	Ga0501043_0034144	3300049579	Bacteria	4001
1078	Ga0501043_0047351	3300049579	Bacteria	3380
1079	Ga0501043_0089125	3300049579	Bacteria	2425
1080	Ga0501043_0115831	3300049579	Bacteria	2103
1081	Ga0501043_0239533	3300049579	Bacteria	1399
1082	Ga0501043_0589176	3300049579	Bacteria	822
1083	Ga0501046_0000522	3300049580	Bacteria	38028
1084	Ga0501046_0020020	3300049580	Bacteria	5540
1085	Ga0501046_0071000	3300049580	Bacteria	2706
1086	Ga0501046_0099953	3300049580	Bacteria	2226
1087	Ga0501046_0150188	3300049580	Bacteria	1758
1088	Ga0501046_0283733	3300049580	Bacteria	1212
1089	Ga0501047_0000174	3300049581	Bacteria	79021
1090	Ga0501047_0020075	3300049581	Bacteria	6417
1091	Ga0501047_0036854	3300049581	Bacteria	4727
1092	Ga0501047_0071113	3300049581	Bacteria	3349
1093	Ga0501047_0109032	3300049581	Bacteria	2651
1094	Ga0501047_0150972	3300049581	Bacteria	2199
1095	Ga0501047_0152493	3300049581	Bacteria	2186
1096	Ga0501047_0422591	3300049581	Bacteria	1164
1097	Ga0501047_0517272	3300049581	Bacteria	1019
1098	Ga0501048_0000704	3300049582	Bacteria	24375
1099	Ga0501048_0076181	3300049582	Bacteria	2367
1100	Ga0501048_0317888	3300049582	Bacteria	1109
1101	Ga0501067_0000239	3300049583	Bacteria	30445
1102	Ga0501067_0002890	3300049583	Bacteria	9451
1103	Ga0501067_0032572	3300049583	Bacteria	2893
1104	Ga0501067_0271461	3300049583	Bacteria	944
1105	Ga0501068_0000227	3300049584	Bacteria	27306
1106	Ga0501068_0057644	3300049584	Bacteria	2355
1107	Ga0501068_0285367	3300049584	Bacteria	1055
1108	Ga0501069_0011635	3300049585	Bacteria	4665
1109	Ga0501069_0015333	3300049585	Bacteria	4106
1110	Ga0501069_0270533	3300049585	Bacteria	993
1111	Ga0501070_0003314	3300049586	Bacteria	13986
1112	Ga0501070_0015499	3300049586	Bacteria	6412
1113	Ga0501070_0040767	3300049586	Bacteria	3872
1114	Ga0501070_0067438	3300049586	Bacteria	2963
1115	Ga0501070_0178131	3300049586	Bacteria	1750
1116	Ga0501070_0496035	3300049586	Bacteria	981
1117	Ga0501071_0024865	3300049587	Bacteria	4191
1118	Ga0501072_0001189	3300049588	Bacteria	19405
1119	Ga0501073_0000009	3300049589	Bacteria	195649
1120	Ga0501073_0089030	3300049589	Bacteria	2146
1121	Ga0501073_0110477	3300049589	Bacteria	1907
1122	Ga0501074_0000049	3300049590	Bacteria	56854
1123	Ga0501074_0006127	3300049590	Bacteria	8687
1124	Ga0501074_0128610	3300049590	Bacteria	1812
1125	Ga0501074_0179074	3300049590	Bacteria	1512
1126	Ga0501075_0197835	3300049591	Bacteria	1533
1127	Ga0501075_0361822	3300049591	Bacteria	1106
1128	Ga0501076_0119822	3300049592	Bacteria	2131
1129	Ga0501076_0279251	3300049592	Bacteria	1368
1130	Ga0501079_0014652	3300049741	Bacteria	5979
1131	Ga0501079_0048999	3300049741	Bacteria	3260
1132	Ga0501079_0202424	3300049741	Bacteria	1551
1133	Ga0501080_0005405	3300049742	Bacteria	11390
1134	Ga0501080_0018418	3300049742	Bacteria	6463
1135	Ga0501080_0286480	3300049742	Bacteria	1496
1136	Ga0501081_0136990	3300049743	Bacteria	1753
1137	Ga0501083_0000251	3300049744	Bacteria	34183
1138	Ga0501083_0040696	3300049744	Bacteria	3154
1139	Ga0501083_0085534	3300049744	Bacteria	2086
1140	Ga0501035_0000067	3300049822	Bacteria	129204
1141	Ga0501035_0013199	3300049822	Bacteria	7624
1142	Ga0501035_0028638	3300049822	Bacteria	5084
1143	Ga0501035_0083690	3300049822	Bacteria	2815
1144	Ga0501035_0184827	3300049822	Bacteria	1794
1145	Ga0501035_0285945	3300049822	Bacteria	1392
1146	Ga0501035_0484760	3300049822	Bacteria	1019
1147	Ga0501044_0000258	3300049823	Bacteria	67161
1148	Ga0501044_0036104	3300049823	Bacteria	5172
1149	Ga0501044_0059643	3300049823	Bacteria	3909
1150	Ga0501044_0132726	3300049823	Bacteria	2483
1151	Ga0501044_0143284	3300049823	Bacteria	2377
1152	Ga0501044_0198924	3300049823	Bacteria	1963
1153	Ga0501044_0611666	3300049823	Bacteria	982
1154	Ga0501045_0005432	3300049824	Bacteria	8825
1155	Ga0501045_0034526	3300049824	Bacteria	3671
1156	nmdc:mga03n38_66636_c1	3300050490	Bacteria	1654
1157	nmdc:mga03n38_91680_c1	3300050490	Bacteria	1448
1158	nmdc:mga00v17_116781_c1	3300050491	Bacteria	1696
1159	nmdc:mga00v17_135722_c1	3300050491	Bacteria	1575
1160	nmdc:mga00v17_226514_c1	3300050491	Bacteria	1211
1161	nmdc:mga00v17_74333_c1	3300050491	Bacteria	2112
1162	nmdc:mga0yw44_10820_c1	3300050492	Bacteria	4676
1163	nmdc:mga0yw44_1581_c1	3300050492	Bacteria	9141
1164	nmdc:mga0yw44_241651_c1	3300050492	Bacteria	1200
1165	nmdc:mga0yw44_48278_c1	3300050492	Bacteria	2567
1166	nmdc:mga0k408_183042_c1	3300050493	Bacteria	1250
1167	nmdc:mga06z11_29356_c1	3300050494	Bacteria	2649
1168	nmdc:mga04h51_124722_c1	3300050495	Bacteria	963
1169	nmdc:mga04h51_13109_c1	3300050495	Bacteria	2341
1170	nmdc:mga04h51_92482_c1	3300050495	Bacteria	1091
1171	nmdc:mga07m45_178273_c1	3300050496	Bacteria	1236
1172	nmdc:mga07m45_90376_c1	3300050496	Bacteria	1754
1173	nmdc:mga05p37_4482_c1	3300050507	Bacteria	16321
1174	nmdc:mga09592_21656_c1	3300050508	Bacteria	5299
1175	nmdc:mga09592_69360_c1	3300050508	Bacteria	2990
1176	nmdc:mga06r32_2521_c1	3300050510	Bacteria	16382
1177	nmdc:mga08y16_3491_c1	3300050511	Bacteria	16323
1178	nmdc:mga0n895_30287_c1	3300050512	Bacteria	5170
1179	nmdc:mga0rr50_240054_c1	3300050513	Bacteria	1502
1180	nmdc:mga0rr50_365675_c1	3300050513	Bacteria	1215
1181	nmdc:mga08x19_119583_c1	3300050514	Bacteria	1765
1182	nmdc:mga08x19_6_c1	3300050514	Bacteria	405679
1183	nmdc:mga0sz30_128200_c1	3300050516	Bacteria	1117
1184	nmdc:mga0sz30_3193_c1	3300050516	Bacteria	5877
1185	nmdc:mga0sz30_4096_c1	3300050516	Bacteria	5252
1186	Ga0495601_0282702	3300053077	Bacteria	1082
1187	Ga0495655_0008988	3300053083	Bacteria	1920
1188	Ga0495655_0023618	3300053083	Bacteria	1420
1189	Ga0495655_0033641	3300053083	Bacteria	1263
1190	Ga0495595_0014352	3300053084	Bacteria	3360
1191	Ga0495595_0203097	3300053084	Bacteria	987
1192	Ga0495595_0231811	3300053084	Bacteria	923
1193	Ga0495619_0039633	3300053085	Bacteria	3076
1194	Ga0495619_0065256	3300053085	Bacteria	2428
1195	Ga0495619_0138953	3300053085	Bacteria	1672
1196	Ga0495619_0296802	3300053085	Bacteria	1119
1197	Ga0500578_0253554	3300053086	Bacteria	1059
1198	Ga0500643_000013	3300053087	Bacteria	324296
1199	Ga0500643_008577	3300053087	Bacteria	4005
1200	Ga0500643_024773	3300053087	Bacteria	1900
1201	Ga0500644_0164556	3300053088	Bacteria	898
1202	Ga0500651_0001062	3300053093	Bacteria	13560
1203	Ga0500651_0212978	3300053093	Bacteria	1136
1204	Ga0500651_0294112	3300053093	Bacteria	933
1205	Ga0500566_0000588	3300053094	Bacteria	20372
1206	Ga0500566_0005320	3300053094	Bacteria	7656
1207	Ga0500566_0007385	3300053094	Bacteria	6507
1208	Ga0500566_0018131	3300053094	Bacteria	4134
1209	Ga0500566_0079196	3300053094	Bacteria	1832
1210	Ga0500640_007928	3300053095	Bacteria	4169
1211	Ga0500641_0015731	3300053096	Bacteria	2813
1212	Ga0500641_0052126	3300053096	Bacteria	1685
1213	Ga0500641_0056817	3300053096	Bacteria	1622
1214	Ga0500650_0048318	3300053098	Bacteria	1973
1215	Ga0500650_0253737	3300053098	Bacteria	788
1216	Ga0500553_085888	3300053101	Bacteria	1400
1217	Ga0500554_008721	3300053102	Bacteria	2396
1218	Ga0500556_0000029	3300053104	Bacteria	165326
1219	Ga0500557_000030	3300053105	Bacteria	76944
1220	Ga0500562_015039	3300053108	Bacteria	1984
1221	Ga0500562_068407	3300053108	Bacteria	957
1222	Ga0500569_009193	3300053109	Bacteria	2288
1223	Ga0500572_000174	3300053111	Bacteria	22807
1224	Ga0500572_000359	3300053111	Bacteria	16208
1225	Ga0500572_012915	3300053111	Bacteria	2056
1226	Ga0500592_012737	3300053116	Bacteria	1346
1227	Ga0500593_051003	3300053117	Bacteria	1837
1228	Ga0500594_0003802	3300053118	Bacteria	3322
1229	Ga0500595_000068	3300053119	Bacteria	73931
1230	Ga0500595_008896	3300053119	Bacteria	4080
1231	Ga0500595_012017	3300053119	Bacteria	3360
1232	Ga0500595_050611	3300053119	Bacteria	1289
1233	Ga0500607_019835	3300053121	Bacteria	3801
1234	Ga0500607_049221	3300053121	Bacteria	2250
1235	Ga0500608_018019	3300053122	Bacteria	3216
1236	Ga0500608_027194	3300053122	Bacteria	2694
1237	Ga0500608_206556	3300053122	Bacteria	807
1238	Ga0500614_017173	3300053123	Bacteria	1632
1239	Ga0500618_009109	3300053125	Bacteria	2728
1240	Ga0500642_0000020	3300053130	Bacteria	159498
1241	Ga0500642_0000148	3300053130	Bacteria	30505
1242	Ga0500642_0020557	3300053130	Bacteria	2597
1243	Ga0500652_000109	3300053131	Bacteria	32551
1244	Ga0500658_0049209	3300053134	Bacteria	1717
1245	Ga0500658_0051815	3300053134	Bacteria	1679
1246	Ga0500559_0000213	3300053136	Bacteria	46604
1247	Ga0500559_0000974	3300053136	Bacteria	17909
1248	Ga0500559_0045944	3300053136	Bacteria	1913
1249	Ga0500559_0094995	3300053136	Bacteria	1368
1250	Ga0500559_0116081	3300053136	Bacteria	1242
1251	Ga0500568_0002261	3300053139	Bacteria	11500
1252	Ga0500568_0008101	3300053139	Bacteria	5097
1253	Ga0500568_0010665	3300053139	Bacteria	4293
1254	Ga0500577_0014920	3300053142	Bacteria	2414
1255	Ga0500577_0136206	3300053142	Bacteria	1033
1256	Ga0500577_0223735	3300053142	Bacteria	815
1257	Ga0500588_0035192	3300053146	Bacteria	1472
1258	Ga0500589_056512	3300053147	Bacteria	1809
1259	Ga0500590_038022	3300053148	Bacteria	2485
1260	Ga0500590_103286	3300053148	Bacteria	1365
1261	Ga0500603_001054	3300053150	Bacteria	6485
1262	Ga0500604_0012985	3300053151	Bacteria	2254
1263	Ga0500616_0000048	3300053153	Bacteria	313108
1264	Ga0500616_0000112	3300053153	Bacteria	151210
1265	Ga0500616_0022040	3300053153	Bacteria	3562
1266	Ga0500619_039761	3300053154	Bacteria	1480
1267	Ga0500619_131351	3300053154	Bacteria	853
1268	Ga0500620_045449	3300053155	Bacteria	1456
1269	Ga0500622_0005391	3300053156	Bacteria	7695
1270	Ga0500622_0042066	3300053156	Bacteria	2376
1271	Ga0500627_0019805	3300053158	Bacteria	2687
1272	Ga0500627_0040890	3300053158	Bacteria	1990
1273	Ga0500630_001669	3300053159	Bacteria	10645
1274	Ga0500638_005706	3300053162	Bacteria	5000
1275	Ga0500638_016902	3300053162	Bacteria	3375
1276	Ga0500638_133356	3300053162	Bacteria	1123
1277	Ga0500638_153419	3300053162	Bacteria	1022
1278	Ga0500639_000006	3300053163	Bacteria	165068
1279	Ga0500636_0000701	3300053177	Bacteria	17989
1280	Ga0500636_0002976	3300053177	Bacteria	9486
1281	Ga0500636_0042426	3300053177	Bacteria	2689
1282	Ga0500636_0134790	3300053177	Bacteria	1372
1283	Ga0500637_0002593	3300053178	Bacteria	8079
1284	Ga0500637_0007374	3300053178	Bacteria	5494
1285	Ga0500637_0040724	3300053178	Bacteria	2625
1286	Ga0500637_0103308	3300053178	Bacteria	1653
1287	Ga0500649_080458	3300053722	Bacteria	1327
1288	Ga0500645_011367	3300053730	Bacteria	2910
1289	Ga0500645_069553	3300053730	Bacteria	1011
1290	Ga0500609_001437	3300053731	Bacteria	3486
1291	Ga0500656_007137	3300053732	Bacteria	1154
1292	Ga0500596_001921	3300053735	Bacteria	4166
1293	Ga0500596_003672	3300053735	Bacteria	2888
1294	Ga0500599_002836	3300053736	Bacteria	2098
1295	Ga0500601_000387	3300053737	Bacteria	7585
1296	Ga0500601_007366	3300053737	Bacteria	1218
1297	Ga0500601_013177	3300053737	Bacteria	935
1298	Ga0501084_0002907	3300054114	Bacteria	13869
1299	Ga0501084_0155011	3300054114	Bacteria	1931
1300	Ga0501084_0401359	3300054114	Bacteria	1159
1301	Ga0500661_008965	3300055283	Bacteria	1837
1302	Ga0500661_009319	3300055283	Bacteria	1799
1303	Ga0500661_013161	3300055283	Bacteria	1491
1304	Ga0501082_0010462	3300060353	Bacteria	7983
1305	Ga0501082_0068963	3300060353	Bacteria	3044
1306	Ga0466962_0027852	3300061719	Bacteria	2709
1307	Ga0530510_0173394	3300061734	Bacteria	1598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025885	Ga0207653_10074199	Ga0207653_100741992	207
2	3300046536	Ga0495587_0449495	Ga0495587_0449495_24_650	208
3	3300048924	Ga0496121_0224016	Ga0496121_0224016_394_1125	214
4	3300048929	Ga0496126_0095141	Ga0496126_0095141_1491_2222	214
5	3300005577	Ga0068857_100510850	Ga0068857_1005108502	215
6	3300009551	Ga0105238_10266937	Ga0105238_102669372	215
7	3300026041	Ga0207639_10295170	Ga0207639_102951702	215
8	3300026116	Ga0207674_10095559	Ga0207674_100955593	215
9	3300044694	Ga0466963_0015395	Ga0466963_0015395_1196_1927	215
10	3300044842	Ga0466957_0222147	Ga0466957_0222147_278_1009	215
11	3300045976	Ga0466967_0400970	Ga0466967_0400970_566_1297	215
12	3300048929	Ga0496126_0358933	Ga0496126_0358933_37_699	219
13	3300049579	Ga0501043_0589176	Ga0501043_0589176_16_678	219
14	3300053098	Ga0500650_0048318	Ga0500650_0048318_1301_1963	219
15	3300003659	JGI25404J52841_10000584	JGI25404J52841_100005842	224
16	3300005983	Ga0081540_1000300	Ga0081540_100030038	224
17	3300035113	Ga0373936_0014676	Ga0373936_0014676_1890_2582	224
18	3300035118	Ga0373954_0036481	Ga0373954_0036481_1241_1933	224
19	3300035119	Ga0373956_0027948	Ga0373956_0027948_310_1002	224
20	3300046463	Ga0495653_0168026	Ga0495653_0168026_664_1356	224
21	3300046535	Ga0495586_0048236	Ga0495586_0048236_460_1152	224
22	3300046543	Ga0495645_0083555	Ga0495645_0083555_224_916	224
23	3300047315	Ga0495581_0013943	Ga0495581_0013943_1919_2611	224
24	3300005985	Ga0081539_10100514	Ga0081539_101005142	225
25	3300046491	Ga0495584_0158263	Ga0495584_0158263_68_754	225
26	3300048907	Ga0496104_0349167	Ga0496104_0349167_64_804	226
27	iso_pu_bacteria	8016603502	8016607780	226
28	3300005548	Ga0070665_100014688	Ga0070665_1000146885	227
29	3300005842	Ga0068858_100639493	Ga0068858_1006394932	227
30	3300006038	Ga0075365_10010597	Ga0075365_100105972	227
31	3300006353	Ga0075370_10032675	Ga0075370_100326752	227
32	3300010375	Ga0105239_10442038	Ga0105239_104420382	227
33	3300025920	Ga0207649_10313128	Ga0207649_103131281	227
34	3300025933	Ga0207706_10160637	Ga0207706_101606372	227
35	3300025935	Ga0207709_10117907	Ga0207709_101179072	227
36	3300025938	Ga0207704_10530530	Ga0207704_105305301	227
37	3300026023	Ga0207677_10166956	Ga0207677_101669562	227
38	3300026067	Ga0207678_10051786	Ga0207678_100517862	227
39	3300026088	Ga0207641_10278315	Ga0207641_102783152	227
40	3300026089	Ga0207648_10400811	Ga0207648_104008112	227
41	3300028380	Ga0268265_10039667	Ga0268265_100396673	227
42	3300028381	Ga0268264_10104745	Ga0268264_101047452	227
43	3300046522	Ga0495643_0234999	Ga0495643_0234999_20_703	227
44	3300046648	Ga0495611_0202128	Ga0495611_0202128_134_817	227
45	3300048915	Ga0496112_0716119	Ga0496112_0716119_11_694	227
46	3300053096	Ga0500641_0052126	Ga0500641_0052126_400_1083	227
47	3300053118	Ga0500594_0003802	Ga0500594_0003802_786_1469	227
48	3300039437	Ga0436365_0085684	Ga0436365_0085684_120_827	228
49	3300005983	Ga0081540_1010381	Ga0081540_10103813	229
50	3300013100	Ga0157373_10073299	Ga0157373_100732993	229
51	3300039437	Ga0436365_1703855	Ga0436365_1703855_1027_1734	229
52	3300048908	Ga0496105_0599884	Ga0496105_0599884_146_835	229
53	3300048928	Ga0496125_0156922	Ga0496125_0156922_832_1524	229
54	3300049459	Ga0495678_133559	Ga0495678_133559_109_801	229
55	3300049569	Ga0501032_0081543	Ga0501032_0081543_525_1214	229
56	3300049570	Ga0501033_0019665	Ga0501033_0019665_2901_3590	229
57	3300049571	Ga0501034_0266963	Ga0501034_0266963_827_1540	229
58	3300049573	Ga0501037_0030562	Ga0501037_0030562_1294_1983	229
59	3300049574	Ga0501038_0168710	Ga0501038_0168710_166_855	229
60	3300049579	Ga0501043_0239533	Ga0501043_0239533_442_1131	229
61	3300049586	Ga0501070_0067438	Ga0501070_0067438_616_1305	229
62	3300049589	Ga0501073_0089030	Ga0501073_0089030_854_1543	229
63	3300049590	Ga0501074_0179074	Ga0501074_0179074_460_1149	229
64	3300049591	Ga0501075_0361822	Ga0501075_0361822_342_1058	229
65	3300053162	Ga0500638_153419	Ga0500638_153419_13_702	229
66	3300039093	Ga0400489_18067	Ga0400489_18067_29_742	230
67	3300005536	Ga0070697_100003566	Ga0070697_1000035667	231
68	3300005545	Ga0070695_100021585	Ga0070695_1000215852	231
69	3300006048	Ga0075363_100062746	Ga0075363_1000627463	231
70	3300006173	Ga0070716_100028904	Ga0070716_1000289043	231
71	3300006914	Ga0075436_100039630	Ga0075436_1000396302	231
72	3300007076	Ga0075435_100085144	Ga0075435_1000851442	231
73	3300025922	Ga0207646_10587648	Ga0207646_105876482	231
74	3300025929	Ga0207664_10189046	Ga0207664_101890462	231
75	3300025939	Ga0207665_10076188	Ga0207665_100761883	231
76	3300035170	Ga0373943_0078315	Ga0373943_0078315_949_1644	231
77	3300035725	Ga0373947_0120371	Ga0373947_0120371_815_1510	231
78	3300046455	Ga0495603_0172677	Ga0495603_0172677_180_875	231
79	3300046462	Ga0495651_0124395	Ga0495651_0124395_358_1053	231
80	3300046507	Ga0495606_0151987	Ga0495606_0151987_320_1018	231
81	3300046660	Ga0495625_0013320	Ga0495625_0013320_549_1247	231
82	3300046674	Ga0495588_0012056	Ga0495588_0012056_2183_2881	231
83	3300046691	Ga0495670_0014176	Ga0495670_0014176_2576_3274	231
84	3300048920	Ga0496117_0192614	Ga0496117_0192614_350_1048	231
85	3300048924	Ga0496121_0007192	Ga0496121_0007192_2439_3137	231
86	3300048929	Ga0496126_0012254	Ga0496126_0012254_7577_8272	231
87	3300050513	nmdc:mga0rr50_365675_c1	nmdc:mga0rr50_365675_c1_53_766	231
88	3300050514	nmdc:mga08x19_6_c1	nmdc:mga08x19_6_c1_67944_68657	231
89	3300053093	Ga0500651_0001062	Ga0500651_0001062_7994_8692	231
90	3300053096	Ga0500641_0056817	Ga0500641_0056817_370_1068	231
91	3300053098	Ga0500650_0253737	Ga0500650_0253737_37_735	231
92	3300053104	Ga0500556_0000029	Ga0500556_0000029_20672_21370	231
93	3300053117	Ga0500593_051003	Ga0500593_051003_834_1532	231
94	3300053130	Ga0500642_0020557	Ga0500642_0020557_1870_2568	231
95	3300053131	Ga0500652_000109	Ga0500652_000109_17015_17713	231
96	3300053153	Ga0500616_0000112	Ga0500616_0000112_20742_21440	231
97	3300053156	Ga0500622_0005391	Ga0500622_0005391_6342_7040	231
98	3300053156	Ga0500622_0042066	Ga0500622_0042066_535_1233	231
99	3300053158	Ga0500627_0040890	Ga0500627_0040890_1241_1939	231
100	3300005436	Ga0070713_100030915	Ga0070713_1000309153	232
101	3300006178	Ga0075367_10058758	Ga0075367_100587582	232
102	3300006847	Ga0075431_100000905	Ga0075431_10000090517	232
103	3300006880	Ga0075429_100001332	Ga0075429_10000133212	232
104	3300009093	Ga0105240_10221690	Ga0105240_102216903	232
105	3300009094	Ga0111539_10005385	Ga0111539_1000538511	232
106	3300009147	Ga0114129_10001764	Ga0114129_1000176418	232
107	3300013105	Ga0157369_10037267	Ga0157369_100372673	232
108	3300021384	Ga0213876_10101072	Ga0213876_101010721	232
109	3300021388	Ga0213875_10007731	Ga0213875_100077315	232
110	3300021388	Ga0213875_10054936	Ga0213875_100549363	232
111	3300025904	Ga0207647_10232405	Ga0207647_102324052	232
112	3300025906	Ga0207699_10350203	Ga0207699_103502032	232
113	3300025913	Ga0207695_10194070	Ga0207695_101940702	232
114	3300025928	Ga0207700_10021207	Ga0207700_100212074	232
115	3300025929	Ga0207664_10054648	Ga0207664_100546483	232
116	3300027907	Ga0207428_10039711	Ga0207428_100397115	232
117	3300037418	Ga0395900_0536575	Ga0395900_0536575_162_914	232
118	3300037466	Ga0395898_0038432	Ga0395898_0038432_3170_3901	232
119	3300037471	Ga0395905_0020395	Ga0395905_0020395_5123_5875	232
120	3300037853	Ga0436364_0209995	Ga0436364_0209995_293_1024	232
121	3300037853	Ga0436364_0746919	Ga0436364_0746919_2639_3370	232
122	3300037853	Ga0436364_1499429	Ga0436364_1499429_1091_1822	232
123	3300038443	Ga0395901_0074399	Ga0395901_0074399_249_980	232
124	3300039437	Ga0436365_0414081	Ga0436365_0414081_45_746	232
125	3300039437	Ga0436365_0693364	Ga0436365_0693364_575_1306	232
126	3300039450	Ga0436363_1076359	Ga0436363_1076359_1266_1967	232
127	3300042439	Ga0439464_0022423	Ga0439464_0022423_447_1154	232
128	3300049581	Ga0501047_0152493	Ga0501047_0152493_1104_1814	232
129	3300050507	nmdc:mga05p37_4482_c1	nmdc:mga05p37_4482_c1_8240_8947	232
130	3300050508	nmdc:mga09592_21656_c1	nmdc:mga09592_21656_c1_4432_5139	232
131	3300050510	nmdc:mga06r32_2521_c1	nmdc:mga06r32_2521_c1_7175_7882	232
132	3300050511	nmdc:mga08y16_3491_c1	nmdc:mga08y16_3491_c1_7285_7992	232
133	3300003354	JGI25160J50197_1009475	JGI25160J50197_10094753	233
134	3300005262	Ga0065165_1059018	Ga0065165_10590182	233
135	3300006051	Ga0075364_10108934	Ga0075364_101089343	233
136	3300025302	Ga0207426_1034891	Ga0207426_10348912	233
137	3300025941	Ga0207711_10058323	Ga0207711_100583232	233
138	3300027296	Ga0209389_1000019	Ga0209389_1000019116	233
139	3300027361	Ga0209489_100033	Ga0209489_100033115	233
140	3300027363	Ga0209700_100012	Ga0209700_100012253	233
141	3300041509	Ga0451843_0556862	Ga0451843_0556862_48_749	233
142	3300048904	Ga0496101_0554453	Ga0496101_0554453_20_721	233
143	3300048913	Ga0496110_0656727	Ga0496110_0656727_138_839	233
144	3300049580	Ga0501046_0071000	Ga0501046_0071000_1701_2432	233
145	3300049581	Ga0501047_0071113	Ga0501047_0071113_1406_2137	233
146	3300049582	Ga0501048_0317888	Ga0501048_0317888_365_1081	233
147	3300049586	Ga0501070_0015499	Ga0501070_0015499_2174_2905	233
148	3300049589	Ga0501073_0110477	Ga0501073_0110477_584_1315	233
149	3300049590	Ga0501074_0128610	Ga0501074_0128610_1024_1755	233
150	3300049742	Ga0501080_0018418	Ga0501080_0018418_2644_3375	233
151	3300049822	Ga0501035_0083690	Ga0501035_0083690_899_1630	233
152	3300006028	Ga0070717_10173918	Ga0070717_101739182	234
153	3300035171	Ga0373946_0085040	Ga0373946_0085040_516_1229	234
154	3300035695	Ga0373927_0116986	Ga0373927_0116986_969_1682	234
155	3300035725	Ga0373947_0098616	Ga0373947_0098616_334_1047	234
156	3300037312	Ga0395899_0062406	Ga0395899_0062406_80_787	234
157	3300037418	Ga0395900_0716042	Ga0395900_0716042_132_839	234
158	3300037466	Ga0395898_0505367	Ga0395898_0505367_21_728	234
159	3300038443	Ga0395901_0348137	Ga0395901_0348137_200_907	234
160	3300046476	Ga0495662_0046284	Ga0495662_0046284_1180_1893	234
161	3300046533	Ga0495640_0071807	Ga0495640_0071807_356_1069	234
162	3300049573	Ga0501037_0130658	Ga0501037_0130658_706_1413	234
163	3300049581	Ga0501047_0036854	Ga0501047_0036854_3224_3931	234
164	iso_pu_bacteria	2513237092	2513627392	234
165	iso_pu_bacteria	2513237104	2513717721	234
166	iso_pu_bacteria	2791355199	2793080374	234
167	iso_pu_bacteria	2874612657	2874617834	234
168	iso_pu_bacteria	2881665667	2881669145	234
169	iso_pu_bacteria	2889033259	2889033959	234
170	iso_pu_bacteria	3005483717	3005490247	234
171	iso_pu_bacteria	8006926726	8006929287	234
172	3300013105	Ga0157369_10157732	Ga0157369_101577322	235
173	3300041486	Ga0451807_0007667	Ga0451807_0007667_1280_2011	235
174	3300046515	Ga0495620_0027058	Ga0495620_0027058_1369_2100	235
175	3300046660	Ga0495625_0343776	Ga0495625_0343776_97_828	235
176	iso_pu_bacteria	2507262055	2507511935	235
177	iso_pu_bacteria	2508501009	2508545600	235
178	iso_pu_bacteria	2508501042	2508694416	235
179	iso_pu_bacteria	2511231028	2511398076	235
180	iso_pu_bacteria	2513237094	2513643251	235
181	iso_pu_bacteria	2513237095	2513651040	235
182	iso_pu_bacteria	2513237102	2513699472	235
183	iso_pu_bacteria	2513237139	2513874442	235
184	iso_pu_bacteria	2513237161	2514014458	235
185	iso_pu_bacteria	2515154112	2515624656	235
186	iso_pu_bacteria	2517093001	2517104413	235
187	iso_pu_bacteria	2528768022	2528854613	235
188	iso_pu_bacteria	2617270735	2617349689	235
189	iso_pu_bacteria	2617270741	2617376866	235
190	iso_pu_bacteria	2643221651	2644289818	235
191	iso_pu_bacteria	2744054633	2745078467	235
192	iso_pu_bacteria	2791355196	2793059574	235
193	iso_pu_bacteria	2802429603	2805921036	235
194	iso_pu_bacteria	2816332527	2818242244	235
195	iso_pu_bacteria	2824600985	2824607178	235
196	iso_pu_bacteria	2824609381	2824615122	235
197	iso_pu_bacteria	2824617872	2824625660	235
198	iso_pu_bacteria	2824626560	2824633339	235
199	iso_pu_bacteria	2824635225	2824641852	235
200	iso_pu_bacteria	2824644064	2824649118	235
201	iso_pu_bacteria	2824653114	2824659893	235
202	iso_pu_bacteria	2824661429	2824668442	235
203	iso_pu_bacteria	2824671348	2824674345	235
204	iso_pu_bacteria	2824679649	2824686448	235
205	iso_pu_bacteria	2824687955	2824690799	235
206	iso_pu_bacteria	2824696289	2824700231	235
207	iso_pu_bacteria	2824704595	2824711095	235
208	iso_pu_bacteria	2824714736	2824721349	235
209	iso_pu_bacteria	2824723954	2824729380	235
210	iso_pu_bacteria	2824732956	2824738885	235
211	iso_pu_bacteria	2824746037	2824751320	235
212	iso_pu_bacteria	2824753945	2824761423	235
213	iso_pu_bacteria	2824763712	2824771229	235
214	iso_pu_bacteria	2824773399	2824776936	235
215	iso_pu_bacteria	2838122688	2838128445	235
216	iso_pu_bacteria	2841941048	2841942305	235
217	iso_pu_bacteria	2841949485	2841955565	235
218	iso_pu_bacteria	2841957949	2841960903	235
219	iso_pu_bacteria	2841966195	2841971174	235
220	iso_pu_bacteria	2841974524	2841982292	235
221	iso_pu_bacteria	2841983080	2841984319	235
222	iso_pu_bacteria	2842038055	2842041946	235
223	iso_pu_bacteria	2842045827	2842049989	235
224	iso_pu_bacteria	2844315083	2844321161	235
225	iso_pu_bacteria	2847939898	2847943485	235
226	iso_pu_bacteria	2849076700	2849077206	235
227	iso_pu_bacteria	2857509624	2857515219	235
228	iso_pu_bacteria	2874590934	2874592176	235
229	iso_pu_bacteria	2874620515	2874624065	235
230	iso_pu_bacteria	2874628541	2874630920	235
231	iso_pu_bacteria	2874645413	2874647010	235
232	iso_pu_bacteria	2876771140	2876772387	235
233	iso_pu_bacteria	2876818435	2876819656	235
234	iso_pu_bacteria	2879074833	2879076231	235
235	iso_pu_bacteria	2879099564	2879106343	235
236	iso_pu_bacteria	2879127579	2879132589	235
237	iso_pu_bacteria	2879142872	2879144701	235
238	iso_pu_bacteria	2881364244	2881371080	235
239	iso_pu_bacteria	2885366525	2885374009	235
240	iso_pu_bacteria	2885409591	2885412436	235
241	iso_pu_bacteria	2888378607	2888387443	235
242	iso_pu_bacteria	2888388044	2888391747	235
243	iso_pu_bacteria	2888419890	2888426674	235
244	iso_pu_bacteria	2903727486	2903728585	235
245	iso_pu_bacteria	2904666416	2904670776	235
246	iso_pu_bacteria	2904711408	2904713737	235
247	iso_pu_bacteria	2906602504	2906607776	235
248	iso_pu_bacteria	2906626472	2906631761	235
249	iso_pu_bacteria	2906643746	2906649773	235
250	iso_pu_bacteria	2908775508	2908782764	235
251	iso_pu_bacteria	2922368715	2922370489	235
252	iso_pu_bacteria	2922393267	2922396494	235
253	iso_pu_bacteria	2929615660	2929620069	235
254	iso_pu_bacteria	2929624759	2929629382	235
255	iso_pu_bacteria	2932784394	2932791426	235
256	iso_pu_bacteria	2932794094	2932796835	235
257	iso_pu_bacteria	2932801729	2932802387	235
258	iso_pu_bacteria	2932809354	2932815005	235
259	iso_pu_bacteria	2932818245	2932824138	235
260	iso_pu_bacteria	2932828146	2932835328	235
261	iso_pu_bacteria	2933577622	2933581987	235
262	iso_pu_bacteria	2935608549	2935613422	235
263	iso_pu_bacteria	2935616580	2935621071	235
264	iso_pu_bacteria	2935638405	2935643622	235
265	iso_pu_bacteria	2935648319	2935656511	235
266	iso_pu_bacteria	2935656913	2935665304	235
267	iso_pu_bacteria	2935665750	2935671068	235
268	iso_pu_bacteria	2935675223	2935681326	235
269	iso_pu_bacteria	2935684952	2935689328	235
270	iso_pu_bacteria	2935694250	2935699906	235
271	iso_pu_bacteria	2935703347	2935712163	235
272	iso_pu_bacteria	2935713505	2935720274	235
273	iso_pu_bacteria	2935722832	2935728109	235
274	iso_pu_bacteria	2935732158	2935737294	235
275	iso_pu_bacteria	2935741537	2935746645	235
276	iso_pu_bacteria	2935750917	2935757612	235
277	iso_pu_bacteria	2935760218	2935763988	235
278	iso_pu_bacteria	2935769743	2935776483	235
279	iso_pu_bacteria	2935777560	2935784039	235
280	iso_pu_bacteria	2935785616	2935789911	235
281	iso_pu_bacteria	2935793552	2935798323	235
282	iso_pu_bacteria	2935801545	2935807963	235
283	iso_pu_bacteria	2935810662	2935818701	235
284	iso_pu_bacteria	2935827899	2935833139	235
285	iso_pu_bacteria	2935837841	2935844205	235
286	iso_pu_bacteria	2935855204	2935859736	235
287	iso_pu_bacteria	2935864058	2935872134	235
288	iso_pu_bacteria	2935873716	2935878942	235
289	iso_pu_bacteria	2935883170	2935887177	235
290	iso_pu_bacteria	2935908558	2935911292	235
291	iso_pu_bacteria	2935916978	2935920824	235
292	iso_pu_bacteria	2935926038	2935928321	235
293	iso_pu_bacteria	2935934488	2935937966	235
294	iso_pu_bacteria	2935942939	2935945248	235
295	iso_pu_bacteria	2935951376	2935954246	235
296	iso_pu_bacteria	2935959822	2935965682	235
297	iso_pu_bacteria	2935967501	2935971486	235
298	iso_pu_bacteria	2935975950	2935982105	235
299	iso_pu_bacteria	2935984226	2935990554	235
300	iso_pu_bacteria	2935992306	2936000289	235
301	iso_pu_bacteria	2936002035	2936008447	235
302	iso_pu_bacteria	2936011229	2936019402	235
303	iso_pu_bacteria	2936019824	2936027984	235
304	iso_pu_bacteria	2936028420	2936036767	235
305	iso_pu_bacteria	2936037263	2936045511	235
306	iso_pu_bacteria	2936046547	2936054806	235
307	iso_pu_bacteria	2936055302	2936063242	235
308	iso_pu_bacteria	2940556831	2940563566	235
309	iso_pu_bacteria	2941531003	2941537336	235
310	iso_pu_bacteria	2941538514	2941542537	235
311	iso_pu_bacteria	3005506211	3005506851	235
312	iso_pu_bacteria	3005587118	3005591660	235
313	iso_pu_bacteria	3005594810	3005601490	235
314	iso_pu_bacteria	3005710791	3005717221	235
315	iso_pu_bacteria	3005718088	3005724192	235
316	iso_pu_bacteria	8016511872	8016519422	235
317	iso_pu_bacteria	8016522445	8016524931	235
318	iso_pu_bacteria	8016530956	8016538506	235
319	iso_pu_bacteria	8016539877	8016542788	235
320	iso_pu_bacteria	8016548790	8016550497	235
321	iso_pu_bacteria	8016557553	8016558913	235
322	iso_pu_bacteria	8016566248	8016568176	235
323	iso_pu_bacteria	8016575299	8016580846	235
324	iso_pu_bacteria	8016583857	8016587923	235
325	iso_pu_bacteria	8016595262	8016596876	235
326	iso_pu_bacteria	8016613128	8016619565	235
327	iso_pu_bacteria	8016622563	8016630038	235
328	iso_pu_bacteria	8016630954	8016637125	235
329	iso_pu_bacteria	8017057580	8017066099	235
330	iso_pu_bacteria	8019530166	8019538172	235
331	iso_pu_bacteria	8019538911	8019541813	235
332	iso_pu_bacteria	8019547302	8019548984	235
333	iso_pu_bacteria	8019576017	8019578533	235
334	iso_pu_bacteria	8019586578	8019596582	235
335	iso_pu_bacteria	8019597564	8019605122	235
336	iso_pu_bacteria	8019608314	8019613414	235
337	iso_pu_bacteria	8019619141	8019624091	235
338	iso_pu_bacteria	8019629233	8019637939	235
339	iso_pu_bacteria	8019648815	8019653614	235
340	iso_pu_bacteria	8019659431	8019665867	235
341	iso_pu_bacteria	8019668869	8019675390	235
342	iso_pu_bacteria	8019678201	8019680715	235
343	iso_pu_bacteria	8019687851	8019695055	235
344	iso_pu_bacteria	8055742211	8055750178	235
345	iso_pu_bacteria	8056967851	8056975958	235
346	3300005367	Ga0070667_100171547	Ga0070667_1001715472	236
347	3300028380	Ga0268265_10359950	Ga0268265_103599502	236
348	3300028380	Ga0268265_10921176	Ga0268265_109211761	236
349	3300035692	Ga0373935_0043548	Ga0373935_0043548_190_924	236
350	3300035725	Ga0373947_0145851	Ga0373947_0145851_686_1420	236
351	3300036401	Ga0373937_0288799	Ga0373937_0288799_781_1515	236
352	3300046459	Ga0495629_0120018	Ga0495629_0120018_173_907	236
353	3300046472	Ga0495580_0015651	Ga0495580_0015651_3654_4388	236
354	3300046473	Ga0495582_0042465	Ga0495582_0042465_899_1633	236
355	3300046477	Ga0495664_0006706	Ga0495664_0006706_2226_2960	236
356	3300046529	Ga0495652_0120288	Ga0495652_0120288_1326_2060	236
357	3300046531	Ga0495665_0036336	Ga0495665_0036336_924_1658	236
358	3300046642	Ga0495634_0041009	Ga0495634_0041009_1110_1844	236
359	3300046683	Ga0495658_0008598	Ga0495658_0008598_3110_3844	236
360	3300046689	Ga0495613_0059184	Ga0495613_0059184_1563_2297	236
361	3300047319	Ga0495674_0028660	Ga0495674_0028660_2992_3726	236
362	3300047471	Ga0495684_0034547	Ga0495684_0034547_1708_2442	236
363	3300047673	Ga0495593_0008457	Ga0495593_0008457_787_1521	236
364	3300049579	Ga0501043_0047351	Ga0501043_0047351_480_1193	236
365	3300049581	Ga0501047_0150972	Ga0501047_0150972_877_1590	236
366	3300049583	Ga0501067_0271461	Ga0501067_0271461_55_768	236
367	3300049822	Ga0501035_0285945	Ga0501035_0285945_23_736	236
368	3300053087	Ga0500643_008577	Ga0500643_008577_140_859	236
369	3300053094	Ga0500566_0079196	Ga0500566_0079196_412_1143	236
370	3300053111	Ga0500572_000359	Ga0500572_000359_1777_2508	236
371	3300053111	Ga0500572_012915	Ga0500572_012915_691_1422	236
372	3300053121	Ga0500607_019835	Ga0500607_019835_1486_2217	236
373	3300053123	Ga0500614_017173	Ga0500614_017173_564_1295	236
374	3300053136	Ga0500559_0000213	Ga0500559_0000213_6142_6873	236
375	3300053136	Ga0500559_0116081	Ga0500559_0116081_48_779	236
376	3300053154	Ga0500619_131351	Ga0500619_131351_16_747	236
377	3300053177	Ga0500636_0000701	Ga0500636_0000701_12577_13308	236
378	3300053735	Ga0500596_003672	Ga0500596_003672_604_1335	236
379	iso_pu_bacteria	2602042107	2603857358	236
380	iso_pu_bacteria	2857524615	2857526738	236
381	iso_pu_bacteria	2893066018	2893069907	236
382	iso_pu_bacteria	2919073203	2919077755	236
383	3300005331	Ga0070670_100090092	Ga0070670_1000900924	237
384	3300005334	Ga0068869_100088818	Ga0068869_1000888182	237
385	3300005337	Ga0070682_100235047	Ga0070682_1002350472	237
386	3300005338	Ga0068868_100214344	Ga0068868_1002143442	237
387	3300005347	Ga0070668_100048131	Ga0070668_1000481314	237
388	3300005354	Ga0070675_100129332	Ga0070675_1001293322	237
389	3300005440	Ga0070705_100188194	Ga0070705_1001881941	237
390	3300005455	Ga0070663_100173188	Ga0070663_1001731881	237
391	3300005467	Ga0070706_100379580	Ga0070706_1003795802	237
392	3300005539	Ga0068853_100336583	Ga0068853_1003365832	237
393	3300005563	Ga0068855_100167070	Ga0068855_1001670704	237
394	3300005577	Ga0068857_100276969	Ga0068857_1002769692	237
395	3300005614	Ga0068856_100126841	Ga0068856_1001268412	237
396	3300005618	Ga0068864_100075170	Ga0068864_1000751702	237
397	3300005840	Ga0068870_10073852	Ga0068870_100738524	237
398	3300005841	Ga0068863_100515415	Ga0068863_1005154152	237
399	3300005843	Ga0068860_100176740	Ga0068860_1001767402	237
400	3300005844	Ga0068862_100695544	Ga0068862_1006955441	237
401	3300005937	Ga0081455_10017805	Ga0081455_100178056	237
402	3300005983	Ga0081540_1026389	Ga0081540_10263892	237
403	3300006042	Ga0075368_10023518	Ga0075368_100235182	237
404	3300006042	Ga0075368_10051708	Ga0075368_100517082	237
405	3300006353	Ga0075370_10039242	Ga0075370_100392422	237
406	3300006871	Ga0075434_100347803	Ga0075434_1003478032	237
407	3300007076	Ga0075435_100049538	Ga0075435_1000495383	237
408	3300025297	Ga0209758_1010620	Ga0209758_10106203	237
409	3300025901	Ga0207688_10253643	Ga0207688_102536431	237
410	3300025908	Ga0207643_10046638	Ga0207643_100466382	237
411	3300025914	Ga0207671_10023035	Ga0207671_100230354	237
412	3300025919	Ga0207657_10207014	Ga0207657_102070142	237
413	3300025926	Ga0207659_10067361	Ga0207659_100673613	237
414	3300025927	Ga0207687_10143028	Ga0207687_101430283	237
415	3300025949	Ga0207667_10388639	Ga0207667_103886392	237
416	3300026023	Ga0207677_10175047	Ga0207677_101750472	237
417	3300026035	Ga0207703_10037399	Ga0207703_100373992	237
418	3300026041	Ga0207639_10132396	Ga0207639_101323962	237
419	3300026041	Ga0207639_10306945	Ga0207639_103069452	237
420	3300026067	Ga0207678_10251447	Ga0207678_102514472	237
421	3300026116	Ga0207674_10112822	Ga0207674_101128222	237
422	3300026121	Ga0207683_10268995	Ga0207683_102689952	237
423	3300028379	Ga0268266_10062684	Ga0268266_100626842	237
424	3300028786	Ga0307517_10265496	Ga0307517_102654962	237
425	3300031456	Ga0307513_10231530	Ga0307513_102315302	237
426	3300031507	Ga0307509_10389308	Ga0307509_103893081	237
427	3300033180	Ga0307510_10015785	Ga0307510_100157856	237
428	3300033180	Ga0307510_10263892	Ga0307510_102638921	237
429	3300046452	Ga0495617_094833	Ga0495617_094833_141_857	237
430	3300046457	Ga0495590_0151584	Ga0495590_0151584_95_811	237
431	3300046499	Ga0495594_0036768	Ga0495594_0036768_1486_2202	237
432	3300046519	Ga0495632_0073862	Ga0495632_0073862_584_1300	237
433	3300046519	Ga0495632_0086538	Ga0495632_0086538_340_1056	237
434	3300046538	Ga0495609_0011033	Ga0495609_0011033_421_1137	237
435	3300046557	Ga0495622_0213779	Ga0495622_0213779_47_763	237
436	3300046616	Ga0495668_0109174	Ga0495668_0109174_553_1269	237
437	3300046648	Ga0495611_0193081	Ga0495611_0193081_11_727	237
438	3300048914	Ga0496111_0095289	Ga0496111_0095289_1430_2146	237
439	3300049570	Ga0501033_0028461	Ga0501033_0028461_3210_3935	237
440	3300049570	Ga0501033_0185603	Ga0501033_0185603_495_1220	237
441	3300049574	Ga0501038_0097617	Ga0501038_0097617_320_1045	237
442	3300049579	Ga0501043_0089125	Ga0501043_0089125_22_747	237
443	3300049580	Ga0501046_0150188	Ga0501046_0150188_50_775	237
444	3300049581	Ga0501047_0020075	Ga0501047_0020075_3086_3811	237
445	3300049586	Ga0501070_0040767	Ga0501070_0040767_390_1115	237
446	3300049822	Ga0501035_0484760	Ga0501035_0484760_262_987	237
447	3300049823	Ga0501044_0059643	Ga0501044_0059643_2632_3357	237
448	3300049823	Ga0501044_0198924	Ga0501044_0198924_319_1038	237
449	3300049823	Ga0501044_0611666	Ga0501044_0611666_215_940	237
450	3300050491	nmdc:mga00v17_74333_c1	nmdc:mga00v17_74333_c1_404_1120	237
451	3300050495	nmdc:mga04h51_13109_c1	nmdc:mga04h51_13109_c1_734_1450	237
452	3300050496	nmdc:mga07m45_178273_c1	nmdc:mga07m45_178273_c1_393_1109	237
453	3300050513	nmdc:mga0rr50_240054_c1	nmdc:mga0rr50_240054_c1_150_866	237
454	3300050516	nmdc:mga0sz30_128200_c1	nmdc:mga0sz30_128200_c1_222_938	237
455	3300053108	Ga0500562_068407	Ga0500562_068407_215_931	237
456	3300053142	Ga0500577_0136206	Ga0500577_0136206_141_857	237
457	3300053148	Ga0500590_103286	Ga0500590_103286_488_1204	237
458	3300053178	Ga0500637_0103308	Ga0500637_0103308_420_1136	237
459	iso_pu_bacteria	2508501128	2509146560	237
460	iso_pu_bacteria	2513237141	2513887804	237
461	iso_pu_bacteria	2935819856	2935824725	237
462	iso_pu_bacteria	2935847175	2935851945	237
463	3300003794	Ga0055531_10028485	Ga0055531_100284851	238
464	3300005262	Ga0065165_1006799	Ga0065165_10067992	238
465	3300005436	Ga0070713_100139429	Ga0070713_1001394292	238
466	3300006942	Ga0099824_1016547	Ga0099824_10165476	238
467	3300025245	Ga0207425_1014810	Ga0207425_10148102	238
468	3300025295	Ga0209564_1036007	Ga0209564_10360072	238
469	3300025297	Ga0209758_1000595	Ga0209758_100059548	238
470	3300025297	Ga0209758_1001054	Ga0209758_10010547	238
471	3300025299	Ga0209256_1004224	Ga0209256_10042247	238
472	3300025304	Ga0209257_1009208	Ga0209257_10092082	238
473	3300025928	Ga0207700_10062861	Ga0207700_100628612	238
474	3300026035	Ga0207703_10861325	Ga0207703_108613251	238
475	3300027296	Ga0209389_1000070	Ga0209389_100007076	238
476	3300027357	Ga0209589_1000420	Ga0209589_100042032	238
477	3300027361	Ga0209489_100196	Ga0209489_10019636	238
478	3300031824	Ga0307413_10114291	Ga0307413_101142912	238
479	3300046475	Ga0495639_0052234	Ga0495639_0052234_32_760	238
480	3300049568	Ga0501031_0179153	Ga0501031_0179153_469_1188	238
481	3300049569	Ga0501032_0110562	Ga0501032_0110562_14_733	238
482	3300049571	Ga0501034_0108610	Ga0501034_0108610_1848_2567	238
483	3300049571	Ga0501034_0141805	Ga0501034_0141805_1241_1960	238
484	3300049573	Ga0501037_0120281	Ga0501037_0120281_462_1181	238
485	3300049574	Ga0501038_0037416	Ga0501038_0037416_1371_2090	238
486	3300049574	Ga0501038_0077914	Ga0501038_0077914_1371_2090	238
487	3300049575	Ga0501039_0015440	Ga0501039_0015440_4041_4760	238
488	3300049576	Ga0501040_0191143	Ga0501040_0191143_13_732	238
489	3300049578	Ga0501042_0008737	Ga0501042_0008737_3389_4108	238
490	3300049579	Ga0501043_0115831	Ga0501043_0115831_25_744	238
491	3300049580	Ga0501046_0283733	Ga0501046_0283733_469_1188	238
492	3300049582	Ga0501048_0076181	Ga0501048_0076181_944_1663	238
493	3300049583	Ga0501067_0002890	Ga0501067_0002890_3553_4272	238
494	3300049584	Ga0501068_0057644	Ga0501068_0057644_525_1244	238
495	3300049585	Ga0501069_0011635	Ga0501069_0011635_1820_2539	238
496	3300049587	Ga0501071_0024865	Ga0501071_0024865_602_1321	238
497	3300049590	Ga0501074_0006127	Ga0501074_0006127_6922_7641	238
498	3300049591	Ga0501075_0197835	Ga0501075_0197835_435_1154	238
499	3300049592	Ga0501076_0119822	Ga0501076_0119822_1019_1738	238
500	3300049741	Ga0501079_0048999	Ga0501079_0048999_686_1405	238
501	3300049742	Ga0501080_0286480	Ga0501080_0286480_685_1404	238
502	3300049744	Ga0501083_0040696	Ga0501083_0040696_873_1592	238
503	3300049822	Ga0501035_0028638	Ga0501035_0028638_3679_4398	238
504	3300049824	Ga0501045_0034526	Ga0501045_0034526_225_944	238
505	3300050491	nmdc:mga00v17_116781_c1	nmdc:mga00v17_116781_c1_774_1493	238
506	3300053139	Ga0500568_0008101	Ga0500568_0008101_1967_2689	238
507	3300053153	Ga0500616_0000048	Ga0500616_0000048_267239_267961	238
508	3300054114	Ga0501084_0155011	Ga0501084_0155011_744_1463	238
509	3300060353	Ga0501082_0068963	Ga0501082_0068963_2096_2815	238
510	3300003215	JGI25153J46596_10013457	JGI25153J46596_100134573	239
511	3300003215	JGI25153J46596_10029857	JGI25153J46596_100298572	239
512	3300003354	JGI25160J50197_1025725	JGI25160J50197_10257251	239
513	3300003752	Ga0055539_1003892	Ga0055539_10038922	239
514	3300003752	Ga0055539_1004871	Ga0055539_10048712	239
515	3300003762	Ga0055542_1009699	Ga0055542_10096992	239
516	3300004625	Ga0055543_1013404	Ga0055543_10134042	239
517	3300005262	Ga0065165_1001267	Ga0065165_100126728	239
518	3300005262	Ga0065165_1004525	Ga0065165_100452510	239
519	3300005327	Ga0070658_10213804	Ga0070658_102138042	239
520	3300005329	Ga0070683_100330344	Ga0070683_1003303442	239
521	3300005336	Ga0070680_100072883	Ga0070680_1000728832	239
522	3300005337	Ga0070682_100109008	Ga0070682_1001090082	239
523	3300005338	Ga0068868_100172568	Ga0068868_1001725682	239
524	3300005338	Ga0068868_100674085	Ga0068868_1006740851	239
525	3300005339	Ga0070660_100002476	Ga0070660_10000247612	239
526	3300005339	Ga0070660_100463178	Ga0070660_1004631782	239
527	3300005344	Ga0070661_100484152	Ga0070661_1004841521	239
528	3300005353	Ga0070669_100079970	Ga0070669_1000799702	239
529	3300005366	Ga0070659_100070297	Ga0070659_1000702971	239
530	3300005435	Ga0070714_100237033	Ga0070714_1002370332	239
531	3300005455	Ga0070663_100483539	Ga0070663_1004835391	239
532	3300005467	Ga0070706_100107535	Ga0070706_1001075353	239
533	3300005535	Ga0070684_100086722	Ga0070684_1000867222	239
534	3300005539	Ga0068853_100004362	Ga0068853_10000436211	239
535	3300005539	Ga0068853_100168652	Ga0068853_1001686522	239
536	3300005563	Ga0068855_100079813	Ga0068855_1000798135	239
537	3300005563	Ga0068855_100349358	Ga0068855_1003493582	239
538	3300005577	Ga0068857_100070603	Ga0068857_1000706033	239
539	3300005578	Ga0068854_100356437	Ga0068854_1003564372	239
540	3300005614	Ga0068856_100176110	Ga0068856_1001761102	239
541	3300005616	Ga0068852_100026622	Ga0068852_1000266222	239
542	3300005616	Ga0068852_100199728	Ga0068852_1001997284	239
543	3300005842	Ga0068858_100123719	Ga0068858_1001237192	239
544	3300006038	Ga0075365_10052809	Ga0075365_100528092	239
545	3300006038	Ga0075365_10140637	Ga0075365_101406372	239
546	3300006042	Ga0075368_10121131	Ga0075368_101211312	239
547	3300006051	Ga0075364_10010357	Ga0075364_100103573	239
548	3300006051	Ga0075364_10202487	Ga0075364_102024872	239
549	3300006186	Ga0075369_10046187	Ga0075369_100461872	239
550	3300006186	Ga0075369_10051215	Ga0075369_100512152	239
551	3300006186	Ga0075369_10088830	Ga0075369_100888302	239
552	3300006195	Ga0075366_10063909	Ga0075366_100639092	239
553	3300006195	Ga0075366_10191008	Ga0075366_101910082	239
554	3300006353	Ga0075370_10035526	Ga0075370_100355262	239
555	3300006871	Ga0075434_100079368	Ga0075434_1000793685	239
556	3300009093	Ga0105240_10044757	Ga0105240_100447573	239
557	3300009545	Ga0105237_10015525	Ga0105237_100155259	239
558	3300009551	Ga0105238_10100766	Ga0105238_101007663	239
559	3300013104	Ga0157370_10108059	Ga0157370_101080592	239
560	3300013105	Ga0157369_10019439	Ga0157369_100194392	239
561	3300015261	Ga0182006_1082003	Ga0182006_10820032	239
562	3300021320	Ga0214544_1000007	Ga0214544_1000007370	239
563	3300021321	Ga0214542_1000007	Ga0214542_100000711	239
564	3300021324	Ga0214545_1000006	Ga0214545_1000006281	239
565	3300021327	Ga0214543_1000009	Ga0214543_1000009370	239
566	3300025230	Ga0209563_101359	Ga0209563_1013595	239
567	3300025253	Ga0209677_100233	Ga0209677_10023311	239
568	3300025253	Ga0209677_103592	Ga0209677_1035922	239
569	3300025254	Ga0209148_1000232	Ga0209148_100023281	239
570	3300025261	Ga0209233_1003521	Ga0209233_10035212	239
571	3300025261	Ga0209233_1004158	Ga0209233_10041585	239
572	3300025272	Ga0209455_1002812	Ga0209455_10028126	239
573	3300025272	Ga0209455_1007018	Ga0209455_10070181	239
574	3300025272	Ga0209455_1008185	Ga0209455_10081853	239
575	3300025272	Ga0209455_1009485	Ga0209455_10094851	239
576	3300025273	Ga0209673_1064359	Ga0209673_10643592	239
577	3300025295	Ga0209564_1000397	Ga0209564_100039778	239
578	3300025295	Ga0209564_1028802	Ga0209564_10288022	239
579	3300025297	Ga0209758_1000604	Ga0209758_100060411	239
580	3300025297	Ga0209758_1000767	Ga0209758_100076716	239
581	3300025297	Ga0209758_1004139	Ga0209758_10041398	239
582	3300025297	Ga0209758_1012657	Ga0209758_10126575	239
583	3300025302	Ga0207426_1000500	Ga0207426_100050057	239
584	3300025302	Ga0207426_1004976	Ga0207426_10049764	239
585	3300025302	Ga0207426_1043155	Ga0207426_10431552	239
586	3300025304	Ga0209257_1045053	Ga0209257_10450532	239
587	3300025321	Ga0207656_10128738	Ga0207656_101287382	239
588	3300025321	Ga0207656_10138617	Ga0207656_101386171	239
589	3300025900	Ga0207710_10039124	Ga0207710_100391243	239
590	3300025901	Ga0207688_10050908	Ga0207688_100509082	239
591	3300025904	Ga0207647_10059208	Ga0207647_100592083	239
592	3300025904	Ga0207647_10079655	Ga0207647_100796553	239
593	3300025904	Ga0207647_10155228	Ga0207647_101552282	239
594	3300025909	Ga0207705_10083979	Ga0207705_100839792	239
595	3300025910	Ga0207684_10086257	Ga0207684_100862573	239
596	3300025911	Ga0207654_10331582	Ga0207654_103315821	239
597	3300025912	Ga0207707_10003099	Ga0207707_1000309916	239
598	3300025913	Ga0207695_10000123	Ga0207695_1000012380	239
599	3300025914	Ga0207671_10073633	Ga0207671_100736333	239
600	3300025914	Ga0207671_10204781	Ga0207671_102047812	239
601	3300025917	Ga0207660_10006884	Ga0207660_100068847	239
602	3300025919	Ga0207657_10014727	Ga0207657_100147274	239
603	3300025919	Ga0207657_10089154	Ga0207657_100891542	239
604	3300025920	Ga0207649_10184282	Ga0207649_101842822	239
605	3300025920	Ga0207649_10353362	Ga0207649_103533622	239
606	3300025921	Ga0207652_10002148	Ga0207652_100021486	239
607	3300025924	Ga0207694_10007559	Ga0207694_100075599	239
608	3300025924	Ga0207694_10123561	Ga0207694_101235612	239
609	3300025925	Ga0207650_10118742	Ga0207650_101187422	239
610	3300025927	Ga0207687_10459442	Ga0207687_104594422	239
611	3300025929	Ga0207664_10186700	Ga0207664_101867002	239
612	3300025931	Ga0207644_10575699	Ga0207644_105756992	239
613	3300025932	Ga0207690_10387413	Ga0207690_103874132	239
614	3300025933	Ga0207706_10387338	Ga0207706_103873382	239
615	3300025942	Ga0207689_10128989	Ga0207689_101289893	239
616	3300025944	Ga0207661_10179767	Ga0207661_101797672	239
617	3300025949	Ga0207667_10001989	Ga0207667_1000198919	239
618	3300025949	Ga0207667_10066955	Ga0207667_100669552	239
619	3300025960	Ga0207651_10255622	Ga0207651_102556222	239
620	3300025961	Ga0207712_10113636	Ga0207712_101136363	239
621	3300025981	Ga0207640_10401963	Ga0207640_104019632	239
622	3300026035	Ga0207703_10437086	Ga0207703_104370862	239
623	3300026041	Ga0207639_10011300	Ga0207639_100113005	239
624	3300026067	Ga0207678_10081217	Ga0207678_100812172	239
625	3300026067	Ga0207678_10175431	Ga0207678_101754312	239
626	3300026078	Ga0207702_10060371	Ga0207702_100603713	239
627	3300026078	Ga0207702_10231573	Ga0207702_102315732	239
628	3300026088	Ga0207641_10188063	Ga0207641_101880632	239
629	3300026089	Ga0207648_10400720	Ga0207648_104007202	239
630	3300026095	Ga0207676_10541473	Ga0207676_105414732	239
631	3300026116	Ga0207674_10042067	Ga0207674_100420674	239
632	3300026116	Ga0207674_10474263	Ga0207674_104742632	239
633	3300026116	Ga0207674_10708123	Ga0207674_107081232	239
634	3300026118	Ga0207675_100481199	Ga0207675_1004811991	239
635	3300026142	Ga0207698_10104451	Ga0207698_101044512	239
636	3300026142	Ga0207698_10797528	Ga0207698_107975282	239
637	3300027671	Ga0209588_1029138	Ga0209588_10291382	239
638	3300027866	Ga0209813_10039720	Ga0209813_100397202	239
639	3300028379	Ga0268266_10024634	Ga0268266_100246346	239
640	3300028379	Ga0268266_10249547	Ga0268266_102495472	239
641	3300028381	Ga0268264_10546741	Ga0268264_105467412	239
642	3300028573	Ga0265334_10008193	Ga0265334_100081934	239
643	3300028653	Ga0265323_10035465	Ga0265323_100354651	239
644	3300028654	Ga0265322_10027844	Ga0265322_100278442	239
645	3300028666	Ga0265336_10039885	Ga0265336_100398852	239
646	3300028800	Ga0265338_10000271	Ga0265338_1000027164	239
647	3300031235	Ga0265330_10055583	Ga0265330_100555833	239
648	3300031235	Ga0265330_10082420	Ga0265330_100824201	239
649	3300031238	Ga0265332_10004083	Ga0265332_100040838	239
650	3300031238	Ga0265332_10011711	Ga0265332_100117113	239
651	3300031247	Ga0265340_10004004	Ga0265340_100040042	239
652	3300031249	Ga0265339_10030336	Ga0265339_100303362	239
653	3300031250	Ga0265331_10088418	Ga0265331_100884182	239
654	3300031344	Ga0265316_10141170	Ga0265316_101411702	239
655	3300031616	Ga0307508_10000019	Ga0307508_1000001914	239
656	3300031711	Ga0265314_10134029	Ga0265314_101340292	239
657	3300031712	Ga0265342_10096814	Ga0265342_100968141	239
658	3300031712	Ga0265342_10126168	Ga0265342_101261682	239
659	3300032126	Ga0307415_100049205	Ga0307415_1000492052	239
660	3300033544	Ga0316215_1001986	Ga0316215_10019862	239
661	3300035086	Ga0373934_0000917	Ga0373934_0000917_897_1619	239
662	3300035118	Ga0373954_0031917	Ga0373954_0031917_1506_2228	239
663	3300035170	Ga0373943_0112434	Ga0373943_0112434_149_871	239
664	3300035410	Ga0373924_0011735	Ga0373924_0011735_758_1480	239
665	3300035692	Ga0373935_0001273	Ga0373935_0001273_1602_2324	239
666	3300035695	Ga0373927_0038479	Ga0373927_0038479_1077_1799	239
667	3300035724	Ga0373933_0001270	Ga0373933_0001270_11577_12299	239
668	3300035724	Ga0373933_0377967	Ga0373933_0377967_49_771	239
669	3300035725	Ga0373947_0300029	Ga0373947_0300029_280_1002	239
670	3300037068	Ga0373925_0025224	Ga0373925_0025224_3089_3811	239
671	3300037312	Ga0395899_0016833	Ga0395899_0016833_2105_2830	239
672	3300037418	Ga0395900_0005676	Ga0395900_0005676_254_979	239
673	3300037466	Ga0395898_0148304	Ga0395898_0148304_114_839	239
674	3300037471	Ga0395905_0168777	Ga0395905_0168777_13_735	239
675	3300038443	Ga0395901_0252899	Ga0395901_0252899_237_962	239
676	3300044656	Ga0466969_0053098	Ga0466969_0053098_504_1226	239
677	3300046454	Ga0495592_0002895	Ga0495592_0002895_9325_10047	239
678	3300046459	Ga0495629_0013674	Ga0495629_0013674_2199_2921	239
679	3300046462	Ga0495651_0032501	Ga0495651_0032501_629_1351	239
680	3300046462	Ga0495651_0149552	Ga0495651_0149552_653_1375	239
681	3300046463	Ga0495653_0039229	Ga0495653_0039229_1506_2228	239
682	3300046463	Ga0495653_0153616	Ga0495653_0153616_801_1523	239
683	3300046477	Ga0495664_0335072	Ga0495664_0335072_92_814	239
684	3300046506	Ga0495583_0084423	Ga0495583_0084423_348_1070	239
685	3300046511	Ga0495608_0018798	Ga0495608_0018798_2197_2919	239
686	3300046512	Ga0495610_0120983	Ga0495610_0120983_100_822	239
687	3300046522	Ga0495643_0193385	Ga0495643_0193385_59_781	239
688	3300046524	Ga0495648_0102411	Ga0495648_0102411_23_745	239
689	3300046533	Ga0495640_0065705	Ga0495640_0065705_741_1463	239
690	3300046536	Ga0495587_0059261	Ga0495587_0059261_1506_2228	239
691	3300046616	Ga0495668_0063261	Ga0495668_0063261_1101_1823	239
692	3300046642	Ga0495634_0055720	Ga0495634_0055720_778_1500	239
693	3300046663	Ga0495635_0003585	Ga0495635_0003585_7095_7817	239
694	3300046678	Ga0495599_0343515	Ga0495599_0343515_84_806	239
695	3300046680	Ga0495646_0025234	Ga0495646_0025234_1676_2398	239
696	3300046692	Ga0495671_0050099	Ga0495671_0050099_454_1176	239
697	3300046809	Ga0495600_0043141	Ga0495600_0043141_2013_2735	239
698	3300047317	Ga0495604_0028908	Ga0495604_0028908_27_749	239
699	3300047319	Ga0495674_0032846	Ga0495674_0032846_2222_2944	239
700	3300047319	Ga0495674_0252838	Ga0495674_0252838_320_1042	239
701	3300047320	Ga0495672_0069898	Ga0495672_0069898_1105_1830	239
702	3300047321	Ga0495676_0307413	Ga0495676_0307413_252_992	239
703	3300047321	Ga0495676_0351686	Ga0495676_0351686_143_865	239
704	3300047322	Ga0495680_0029831	Ga0495680_0029831_3662_4384	239
705	3300047322	Ga0495680_0412212	Ga0495680_0412212_59_781	239
706	3300047444	Ga0495675_0009683	Ga0495675_0009683_3337_4059	239
707	3300047469	Ga0495673_0018097	Ga0495673_0018097_2041_2763	239
708	3300047471	Ga0495684_0005264	Ga0495684_0005264_2982_3704	239
709	3300047472	Ga0495686_0205366	Ga0495686_0205366_262_987	239
710	3300047673	Ga0495593_0011366	Ga0495593_0011366_2110_2832	239
711	3300048088	Ga0495602_0073666	Ga0495602_0073666_1978_2700	239
712	3300048904	Ga0496101_0098562	Ga0496101_0098562_810_1535	239
713	3300048907	Ga0496104_0245151	Ga0496104_0245151_674_1399	239
714	3300048909	Ga0496106_0001417	Ga0496106_0001417_1709_2434	239
715	3300048909	Ga0496106_0575565	Ga0496106_0575565_144_869	239
716	3300048910	Ga0496107_0002177	Ga0496107_0002177_5382_6107	239
717	3300048911	Ga0496108_0000467	Ga0496108_0000467_2367_3092	239
718	3300048911	Ga0496108_0590469	Ga0496108_0590469_131_853	239
719	3300048912	Ga0496109_0000230	Ga0496109_0000230_10205_10930	239
720	3300048914	Ga0496111_0052529	Ga0496111_0052529_641_1366	239
721	3300048915	Ga0496112_0019046	Ga0496112_0019046_2777_3502	239
722	3300048915	Ga0496112_0110284	Ga0496112_0110284_1946_2668	239
723	3300048916	Ga0496113_0278618	Ga0496113_0278618_441_1163	239
724	3300048918	Ga0496115_0043174	Ga0496115_0043174_2162_2884	239
725	3300048918	Ga0496115_0301120	Ga0496115_0301120_266_991	239
726	3300048918	Ga0496115_0383584	Ga0496115_0383584_73_795	239
727	3300048921	Ga0496118_0105501	Ga0496118_0105501_150_875	239
728	3300048922	Ga0496119_0071005	Ga0496119_0071005_1013_1735	239
729	3300048923	Ga0496120_0019417	Ga0496120_0019417_3376_4098	239
730	3300048923	Ga0496120_0098975	Ga0496120_0098975_61_786	239
731	3300048924	Ga0496121_0002081	Ga0496121_0002081_1853_2578	239
732	3300048925	Ga0496122_0172358	Ga0496122_0172358_428_1150	239
733	3300048926	Ga0496123_0028199	Ga0496123_0028199_2738_3460	239
734	3300048926	Ga0496123_0056798	Ga0496123_0056798_183_905	239
735	3300048927	Ga0496124_0211212	Ga0496124_0211212_123_845	239
736	3300048928	Ga0496125_0000158	Ga0496125_0000158_38862_39584	239
737	3300048928	Ga0496125_0033804	Ga0496125_0033804_96_818	239
738	3300048929	Ga0496126_0049756	Ga0496126_0049756_978_1703	239
739	3300048929	Ga0496126_0142825	Ga0496126_0142825_243_965	239
740	3300048929	Ga0496126_0190487	Ga0496126_0190487_110_832	239
741	3300048929	Ga0496126_0198854	Ga0496126_0198854_156_878	239
742	3300048929	Ga0496126_0238105	Ga0496126_0238105_700_1422	239
743	3300048929	Ga0496126_0461679	Ga0496126_0461679_279_1001	239
744	3300049570	Ga0501033_0079879	Ga0501033_0079879_1268_1993	239
745	3300049571	Ga0501034_0152435	Ga0501034_0152435_179_904	239
746	3300049571	Ga0501034_0370071	Ga0501034_0370071_158_883	239
747	3300049573	Ga0501037_0127934	Ga0501037_0127934_275_1003	239
748	3300049574	Ga0501038_0251239	Ga0501038_0251239_523_1248	239
749	3300049574	Ga0501038_0611637	Ga0501038_0611637_56_781	239
750	3300049579	Ga0501043_0034144	Ga0501043_0034144_1802_2527	239
751	3300049580	Ga0501046_0099953	Ga0501046_0099953_799_1524	239
752	3300049581	Ga0501047_0109032	Ga0501047_0109032_113_841	239
753	3300049581	Ga0501047_0517272	Ga0501047_0517272_254_979	239
754	3300049586	Ga0501070_0178131	Ga0501070_0178131_293_1018	239
755	3300049586	Ga0501070_0496035	Ga0501070_0496035_145_873	239
756	3300049744	Ga0501083_0085534	Ga0501083_0085534_426_1151	239
757	3300049822	Ga0501035_0184827	Ga0501035_0184827_1014_1739	239
758	3300049823	Ga0501044_0036104	Ga0501044_0036104_1701_2429	239
759	3300049823	Ga0501044_0143284	Ga0501044_0143284_1269_1994	239
760	3300050496	nmdc:mga07m45_90376_c1	nmdc:mga07m45_90376_c1_288_1013	239
761	3300050512	nmdc:mga0n895_30287_c1	nmdc:mga0n895_30287_c1_2290_3015	239
762	3300053077	Ga0495601_0282702	Ga0495601_0282702_210_932	239
763	3300053084	Ga0495595_0231811	Ga0495595_0231811_47_769	239
764	3300053087	Ga0500643_024773	Ga0500643_024773_375_1097	239
765	3300053093	Ga0500651_0212978	Ga0500651_0212978_349_1074	239
766	3300053109	Ga0500569_009193	Ga0500569_009193_65_790	239
767	3300053121	Ga0500607_049221	Ga0500607_049221_28_750	239
768	3300053130	Ga0500642_0000020	Ga0500642_0000020_20351_21073	239
769	3300053134	Ga0500658_0051815	Ga0500658_0051815_320_1042	239
770	3300053139	Ga0500568_0002261	Ga0500568_0002261_9456_10178	239
771	3300053142	Ga0500577_0223735	Ga0500577_0223735_44_769	239
772	3300053146	Ga0500588_0035192	Ga0500588_0035192_493_1218	239
773	3300053151	Ga0500604_0012985	Ga0500604_0012985_837_1559	239
774	3300053154	Ga0500619_039761	Ga0500619_039761_711_1433	239
775	3300053731	Ga0500609_001437	Ga0500609_001437_1964_2689	239
776	iso_pu_bacteria	2513237098	2513673548	239
777	iso_pu_bacteria	2513237101	2513697874	239
778	iso_pu_bacteria	2524023210	2524467576	239
779	iso_pu_bacteria	2721755755	2723842745	239
780	iso_pu_bacteria	2874604998	2874606587	239
781	iso_pu_bacteria	2876808645	2876811582	239
782	iso_pu_bacteria	2879110137	2879114204	239
783	iso_pu_bacteria	2885383462	2885391823	239
784	iso_pu_bacteria	2903768456	2903776099	239
785	iso_pu_bacteria	2922361189	2922367364	239
786	iso_pu_bacteria	2922386360	2922389937	239
787	iso_pu_bacteria	8006964411	8006966048	239
788	iso_pu_bacteria	8006984368	8006989807	239
789	iso_pu_bacteria	8006994254	8006998177	239
790	iso_pu_bacteria	8056673599	8056675193	239
791	3300005339	Ga0070660_100198389	Ga0070660_1001983891	240
792	3300005340	Ga0070689_100061722	Ga0070689_1000617223	240
793	3300005365	Ga0070688_100506884	Ga0070688_1005068841	240
794	3300005434	Ga0070709_10010428	Ga0070709_100104283	240
795	3300005434	Ga0070709_10172390	Ga0070709_101723901	240
796	3300005435	Ga0070714_100208590	Ga0070714_1002085902	240
797	3300005436	Ga0070713_100019995	Ga0070713_1000199952	240
798	3300005437	Ga0070710_10000971	Ga0070710_100009713	240
799	3300005439	Ga0070711_100002148	Ga0070711_1000021488	240
800	3300005455	Ga0070663_100168687	Ga0070663_1001686872	240
801	3300005530	Ga0070679_100155446	Ga0070679_1001554462	240
802	3300005539	Ga0068853_100071100	Ga0068853_1000711004	240
803	3300005564	Ga0070664_100304854	Ga0070664_1003048542	240
804	3300005578	Ga0068854_100164844	Ga0068854_1001648442	240
805	3300006028	Ga0070717_10005073	Ga0070717_100050735	240
806	3300006163	Ga0070715_10000519	Ga0070715_100005194	240
807	3300006175	Ga0070712_100339908	Ga0070712_1003399082	240
808	3300006186	Ga0075369_10018672	Ga0075369_100186723	240
809	3300013306	Ga0163162_10171798	Ga0163162_101717982	240
810	3300014325	Ga0163163_10063378	Ga0163163_100633783	240
811	3300014968	Ga0157379_10106356	Ga0157379_101063562	240
812	3300021384	Ga0213876_10268985	Ga0213876_102689851	240
813	3300025898	Ga0207692_10001068	Ga0207692_100010682	240
814	3300025905	Ga0207685_10017980	Ga0207685_100179802	240
815	3300025906	Ga0207699_10005006	Ga0207699_100050063	240
816	3300025915	Ga0207693_10021940	Ga0207693_100219402	240
817	3300025916	Ga0207663_10000229	Ga0207663_100002295	240
818	3300025919	Ga0207657_10018024	Ga0207657_100180246	240
819	3300025921	Ga0207652_10087976	Ga0207652_100879762	240
820	3300025929	Ga0207664_10090815	Ga0207664_100908152	240
821	3300025929	Ga0207664_10144782	Ga0207664_101447822	240
822	3300025932	Ga0207690_10041632	Ga0207690_100416323	240
823	3300025939	Ga0207665_10016623	Ga0207665_100166232	240
824	3300025949	Ga0207667_10733389	Ga0207667_107333892	240
825	3300026067	Ga0207678_10047069	Ga0207678_100470693	240
826	3300031911	Ga0307412_10019954	Ga0307412_100199542	240
827	3300035691	Ga0373931_0143771	Ga0373931_0143771_494_1219	240
828	3300037418	Ga0395900_0001526	Ga0395900_0001526_3428_4156	240
829	3300037466	Ga0395898_0020602	Ga0395898_0020602_3360_4088	240
830	3300037471	Ga0395905_0426158	Ga0395905_0426158_397_1125	240
831	3300038443	Ga0395901_0167652	Ga0395901_0167652_464_1192	240
832	3300046460	Ga0495638_0030841	Ga0495638_0030841_2289_3014	240
833	3300046474	Ga0495605_0119459	Ga0495605_0119459_16_741	240
834	3300046520	Ga0495637_0028466	Ga0495637_0028466_145_870	240
835	3300046557	Ga0495622_0013824	Ga0495622_0013824_2842_3567	240
836	3300046679	Ga0495623_0111367	Ga0495623_0111367_846_1571	240
837	3300047319	Ga0495674_0212023	Ga0495674_0212023_319_1044	240
838	3300047472	Ga0495686_0056466	Ga0495686_0056466_978_1703	240
839	3300048905	Ga0496102_0050412	Ga0496102_0050412_2389_3114	240
840	3300048907	Ga0496104_0012431	Ga0496104_0012431_3854_4579	240
841	3300048907	Ga0496104_0205468	Ga0496104_0205468_988_1713	240
842	3300048909	Ga0496106_0008911	Ga0496106_0008911_2454_3179	240
843	3300048910	Ga0496107_0082738	Ga0496107_0082738_745_1473	240
844	3300048911	Ga0496108_0026157	Ga0496108_0026157_3108_3833	240
845	3300048912	Ga0496109_0159458	Ga0496109_0159458_825_1550	240
846	3300048912	Ga0496109_0228922	Ga0496109_0228922_930_1655	240
847	3300048913	Ga0496110_0043024	Ga0496110_0043024_1111_1836	240
848	3300048913	Ga0496110_0065299	Ga0496110_0065299_1063_1788	240
849	3300048914	Ga0496111_0035597	Ga0496111_0035597_1564_2289	240
850	3300048915	Ga0496112_0016541	Ga0496112_0016541_2556_3281	240
851	3300048915	Ga0496112_0023823	Ga0496112_0023823_2411_3136	240
852	3300048915	Ga0496112_0026282	Ga0496112_0026282_3657_4382	240
853	3300048916	Ga0496113_0026922	Ga0496113_0026922_971_1696	240
854	3300048916	Ga0496113_0039367	Ga0496113_0039367_2391_3116	240
855	3300048918	Ga0496115_0160098	Ga0496115_0160098_260_985	240
856	3300048919	Ga0496116_0001929	Ga0496116_0001929_18664_19389	240
857	3300048920	Ga0496117_0046900	Ga0496117_0046900_1837_2562	240
858	3300048921	Ga0496118_0027902	Ga0496118_0027902_2058_2783	240
859	3300048924	Ga0496121_0001793	Ga0496121_0001793_27673_28401	240
860	3300048927	Ga0496124_0038290	Ga0496124_0038290_2187_2912	240
861	3300048928	Ga0496125_0003566	Ga0496125_0003566_429_1154	240
862	3300048928	Ga0496125_0009065	Ga0496125_0009065_9183_9908	240
863	3300048929	Ga0496126_0005184	Ga0496126_0005184_13596_14324	240
864	3300050490	nmdc:mga03n38_66636_c1	nmdc:mga03n38_66636_c1_655_1380	240
865	3300050491	nmdc:mga00v17_135722_c1	nmdc:mga00v17_135722_c1_682_1407	240
866	3300050492	nmdc:mga0yw44_1581_c1	nmdc:mga0yw44_1581_c1_2261_2986	240
867	3300050516	nmdc:mga0sz30_4096_c1	nmdc:mga0sz30_4096_c1_2086_2811	240
868	3300053088	Ga0500644_0164556	Ga0500644_0164556_94_819	240
869	3300053093	Ga0500651_0294112	Ga0500651_0294112_151_876	240
870	3300053094	Ga0500566_0018131	Ga0500566_0018131_2665_3390	240
871	3300053122	Ga0500608_027194	Ga0500608_027194_647_1372	240
872	3300053125	Ga0500618_009109	Ga0500618_009109_319_1044	240
873	3300053136	Ga0500559_0000974	Ga0500559_0000974_13252_13977	240
874	3300053142	Ga0500577_0014920	Ga0500577_0014920_103_828	240
875	3300053177	Ga0500636_0002976	Ga0500636_0002976_8382_9107	240
876	3300053178	Ga0500637_0040724	Ga0500637_0040724_1475_2200	240
877	3300005435	Ga0070714_100047285	Ga0070714_1000472853	241
878	3300005468	Ga0070707_100599840	Ga0070707_1005998401	241
879	3300005471	Ga0070698_100159311	Ga0070698_1001593111	241
880	3300005536	Ga0070697_100153453	Ga0070697_1001534532	241
881	3300005539	Ga0068853_100557394	Ga0068853_1005573942	241
882	3300005548	Ga0070665_100112639	Ga0070665_1001126393	241
883	3300005563	Ga0068855_100549296	Ga0068855_1005492962	241
884	3300006028	Ga0070717_10000361	Ga0070717_1000036111	241
885	3300006028	Ga0070717_10002247	Ga0070717_1000224715	241
886	3300006173	Ga0070716_100183515	Ga0070716_1001835152	241
887	3300006914	Ga0075436_100142287	Ga0075436_1001422872	241
888	3300007265	Ga0099794_10044446	Ga0099794_100444462	241
889	3300007265	Ga0099794_10109680	Ga0099794_101096801	241
890	3300009093	Ga0105240_10004255	Ga0105240_1000425515	241
891	3300009093	Ga0105240_10582051	Ga0105240_105820512	241
892	3300009148	Ga0105243_10095111	Ga0105243_100951113	241
893	3300009553	Ga0105249_10308221	Ga0105249_103082212	241
894	3300010159	Ga0099796_10013237	Ga0099796_100132372	241
895	3300010375	Ga0105239_10020156	Ga0105239_100201568	241
896	3300013102	Ga0157371_10067083	Ga0157371_100670832	241
897	3300013104	Ga0157370_10116079	Ga0157370_101160792	241
898	3300014325	Ga0163163_10576572	Ga0163163_105765722	241
899	3300014497	Ga0182008_10152970	Ga0182008_101529702	241
900	3300014745	Ga0157377_10097753	Ga0157377_100977532	241
901	3300025922	Ga0207646_10119519	Ga0207646_101195192	241
902	3300025928	Ga0207700_10250854	Ga0207700_102508541	241
903	3300025929	Ga0207664_10048616	Ga0207664_100486163	241
904	3300025939	Ga0207665_10185180	Ga0207665_101851802	241
905	3300025939	Ga0207665_10194915	Ga0207665_101949152	241
906	3300025949	Ga0207667_10119112	Ga0207667_101191122	241
907	3300025981	Ga0207640_10321188	Ga0207640_103211881	241
908	3300026035	Ga0207703_10118694	Ga0207703_101186942	241
909	3300028379	Ga0268266_10461525	Ga0268266_104615252	241
910	3300035086	Ga0373934_0032152	Ga0373934_0032152_154_882	241
911	3300035111	Ga0373923_0022875	Ga0373923_0022875_281_1009	241
912	3300035111	Ga0373923_0061944	Ga0373923_0061944_752_1480	241
913	3300035116	Ga0373945_0007452	Ga0373945_0007452_1779_2507	241
914	3300035117	Ga0373953_0059246	Ga0373953_0059246_714_1442	241
915	3300035118	Ga0373954_0024987	Ga0373954_0024987_1805_2533	241
916	3300035119	Ga0373956_0131220	Ga0373956_0131220_280_1008	241
917	3300035120	Ga0373957_0013357	Ga0373957_0013357_1535_2263	241
918	3300035170	Ga0373943_0001395	Ga0373943_0001395_7409_8137	241
919	3300035172	Ga0373955_0070619	Ga0373955_0070619_147_875	241
920	3300035692	Ga0373935_0041463	Ga0373935_0041463_942_1670	241
921	3300035695	Ga0373927_0000792	Ga0373927_0000792_15347_16075	241
922	3300035695	Ga0373927_0011161	Ga0373927_0011161_2544_3272	241
923	3300035724	Ga0373933_0000777	Ga0373933_0000777_15505_16233	241
924	3300035724	Ga0373933_0028392	Ga0373933_0028392_543_1271	241
925	3300035724	Ga0373933_0034488	Ga0373933_0034488_981_1709	241
926	3300035725	Ga0373947_0002479	Ga0373947_0002479_957_1685	241
927	3300035725	Ga0373947_0048876	Ga0373947_0048876_269_997	241
928	3300036401	Ga0373937_0002152	Ga0373937_0002152_10618_11346	241
929	3300037068	Ga0373925_0033683	Ga0373925_0033683_2778_3506	241
930	3300037418	Ga0395900_0303838	Ga0395900_0303838_826_1554	241
931	3300037466	Ga0395898_0157428	Ga0395898_0157428_715_1443	241
932	3300037853	Ga0436364_0802399	Ga0436364_0802399_144_875	241
933	3300038443	Ga0395901_0212623	Ga0395901_0212623_153_884	241
934	3300038443	Ga0395901_0618847	Ga0395901_0618847_271_999	241
935	3300039437	Ga0436365_0838189	Ga0436365_0838189_296_1027	241
936	3300039453	Ga0436362_1231827	Ga0436362_1231827_1700_2428	241
937	3300041413	Ga0439465_0048560	Ga0439465_0048560_226_957	241
938	3300041452	Ga0451793_0924719	Ga0451793_0924719_114_845	241
939	3300041456	Ga0451795_1297581	Ga0451795_1297581_146_877	241
940	3300044658	Ga0466972_0000203	Ga0466972_0000203_40012_40743	241
941	3300044658	Ga0466972_0053365	Ga0466972_0053365_190_921	241
942	3300044683	Ga0466965_0013246	Ga0466965_0013246_546_1277	241
943	3300044684	Ga0466966_0001755	Ga0466966_0001755_11582_12313	241
944	3300044684	Ga0466966_0100010	Ga0466966_0100010_181_912	241
945	3300044693	Ga0466961_0000095	Ga0466961_0000095_16769_17500	241
946	3300044694	Ga0466963_0004305	Ga0466963_0004305_2877_3608	241
947	3300044706	Ga0466964_0053133	Ga0466964_0053133_146_877	241
948	3300044735	Ga0466968_0029483	Ga0466968_0029483_458_1189	241
949	3300044765	Ga0466970_0031601	Ga0466970_0031601_450_1181	241
950	3300044765	Ga0466970_0085030	Ga0466970_0085030_836_1567	241
951	3300044765	Ga0466970_0093115	Ga0466970_0093115_666_1394	241
952	3300044901	Ga0466960_0027321	Ga0466960_0027321_948_1679	241
953	3300045049	Ga0466959_0011974	Ga0466959_0011974_1440_2171	241
954	3300045049	Ga0466959_0334709	Ga0466959_0334709_195_923	241
955	3300045976	Ga0466967_0025660	Ga0466967_0025660_1185_1916	241
956	3300045976	Ga0466967_0291543	Ga0466967_0291543_639_1370	241
957	3300045976	Ga0466967_0563760	Ga0466967_0563760_266_997	241
958	3300046454	Ga0495592_0056639	Ga0495592_0056639_599_1327	241
959	3300046455	Ga0495603_0001835	Ga0495603_0001835_4960_5688	241
960	3300046455	Ga0495603_0019231	Ga0495603_0019231_700_1428	241
961	3300046455	Ga0495603_0030103	Ga0495603_0030103_2333_3061	241
962	3300046459	Ga0495629_0001441	Ga0495629_0001441_15449_16177	241
963	3300046459	Ga0495629_0007128	Ga0495629_0007128_531_1262	241
964	3300046459	Ga0495629_0246941	Ga0495629_0246941_58_786	241
965	3300046460	Ga0495638_0004327	Ga0495638_0004327_436_1167	241
966	3300046461	Ga0495641_0003725	Ga0495641_0003725_8561_9289	241
967	3300046462	Ga0495651_0019778	Ga0495651_0019778_2679_3410	241
968	3300046462	Ga0495651_0107832	Ga0495651_0107832_357_1088	241
969	3300046463	Ga0495653_0096644	Ga0495653_0096644_166_894	241
970	3300046472	Ga0495580_0012167	Ga0495580_0012167_5785_6513	241
971	3300046473	Ga0495582_0000084	Ga0495582_0000084_40732_41460	241
972	3300046473	Ga0495582_0156189	Ga0495582_0156189_58_786	241
973	3300046474	Ga0495605_0042163	Ga0495605_0042163_1368_2099	241
974	3300046475	Ga0495639_0001155	Ga0495639_0001155_975_1703	241
975	3300046476	Ga0495662_0000454	Ga0495662_0000454_11461_12189	241
976	3300046477	Ga0495664_0012642	Ga0495664_0012642_1265_1993	241
977	3300046477	Ga0495664_0114148	Ga0495664_0114148_261_992	241
978	3300046477	Ga0495664_0268771	Ga0495664_0268771_269_1000	241
979	3300046499	Ga0495594_0001840	Ga0495594_0001840_8081_8809	241
980	3300046499	Ga0495594_0092697	Ga0495594_0092697_228_959	241
981	3300046501	Ga0495607_0127200	Ga0495607_0127200_453_1184	241
982	3300046507	Ga0495606_0017331	Ga0495606_0017331_2202_2933	241
983	3300046507	Ga0495606_0144822	Ga0495606_0144822_344_1075	241
984	3300046507	Ga0495606_0227559	Ga0495606_0227559_189_920	241
985	3300046511	Ga0495608_0044124	Ga0495608_0044124_334_1062	241
986	3300046512	Ga0495610_0030666	Ga0495610_0030666_1491_2222	241
987	3300046512	Ga0495610_0157698	Ga0495610_0157698_217_948	241
988	3300046513	Ga0495616_0113772	Ga0495616_0113772_306_1037	241
989	3300046514	Ga0495618_0061125	Ga0495618_0061125_1295_2023	241
990	3300046516	Ga0495628_0007687	Ga0495628_0007687_2023_2751	241
991	3300046516	Ga0495628_0008644	Ga0495628_0008644_4377_5105	241
992	3300046516	Ga0495628_0148463	Ga0495628_0148463_414_1145	241
993	3300046517	Ga0495630_0290947	Ga0495630_0290947_202_933	241
994	3300046522	Ga0495643_0014330	Ga0495643_0014330_1755_2486	241
995	3300046522	Ga0495643_0042279	Ga0495643_0042279_630_1361	241
996	3300046522	Ga0495643_0101130	Ga0495643_0101130_378_1109	241
997	3300046524	Ga0495648_0018505	Ga0495648_0018505_608_1336	241
998	3300046524	Ga0495648_0055188	Ga0495648_0055188_556_1287	241
999	3300046524	Ga0495648_0157380	Ga0495648_0157380_25_756	241
1000	3300046529	Ga0495652_0036409	Ga0495652_0036409_828_1556	241
1001	3300046529	Ga0495652_0232270	Ga0495652_0232270_404_1132	241
1002	3300046529	Ga0495652_0249381	Ga0495652_0249381_452_1183	241
1003	3300046530	Ga0495654_0057842	Ga0495654_0057842_521_1252	241
1004	3300046531	Ga0495665_0001312	Ga0495665_0001312_2899_3627	241
1005	3300046533	Ga0495640_0115594	Ga0495640_0115594_806_1537	241
1006	3300046536	Ga0495587_0007054	Ga0495587_0007054_4371_5102	241
1007	3300046536	Ga0495587_0087021	Ga0495587_0087021_361_1092	241
1008	3300046543	Ga0495645_0054907	Ga0495645_0054907_2081_2809	241
1009	3300046557	Ga0495622_0003118	Ga0495622_0003118_6868_7596	241
1010	3300046557	Ga0495622_0013816	Ga0495622_0013816_710_1441	241
1011	3300046559	Ga0495667_0020060	Ga0495667_0020060_1833_2564	241
1012	3300046616	Ga0495668_0033714	Ga0495668_0033714_1490_2221	241
1013	3300046642	Ga0495634_0000321	Ga0495634_0000321_39874_40602	241
1014	3300046642	Ga0495634_0070281	Ga0495634_0070281_458_1189	241
1015	3300046660	Ga0495625_0324728	Ga0495625_0324728_158_889	241
1016	3300046663	Ga0495635_0001529	Ga0495635_0001529_12757_13485	241
1017	3300046663	Ga0495635_0023026	Ga0495635_0023026_2679_3410	241
1018	3300046663	Ga0495635_0032708	Ga0495635_0032708_1076_1807	241
1019	3300046665	Ga0495661_0131339	Ga0495661_0131339_444_1175	241
1020	3300046675	Ga0495657_0009859	Ga0495657_0009859_5292_6023	241
1021	3300046675	Ga0495657_0009988	Ga0495657_0009988_1342_2073	241
1022	3300046678	Ga0495599_0004258	Ga0495599_0004258_4243_4974	241
1023	3300046678	Ga0495599_0060253	Ga0495599_0060253_1357_2085	241
1024	3300046678	Ga0495599_0109522	Ga0495599_0109522_498_1229	241
1025	3300046679	Ga0495623_0025894	Ga0495623_0025894_76_807	241
1026	3300046679	Ga0495623_0226604	Ga0495623_0226604_170_898	241
1027	3300046680	Ga0495646_0004744	Ga0495646_0004744_4447_5175	241
1028	3300046680	Ga0495646_0067143	Ga0495646_0067143_1354_2082	241
1029	3300046680	Ga0495646_0070510	Ga0495646_0070510_1025_1756	241
1030	3300046680	Ga0495646_0141296	Ga0495646_0141296_146_877	241
1031	3300046681	Ga0495647_0008301	Ga0495647_0008301_1598_2326	241
1032	3300046683	Ga0495658_0002077	Ga0495658_0002077_1462_2190	241
1033	3300046689	Ga0495613_0003547	Ga0495613_0003547_5748_6476	241
1034	3300046689	Ga0495613_0190121	Ga0495613_0190121_568_1299	241
1035	3300046690	Ga0495624_0001596	Ga0495624_0001596_8408_9136	241
1036	3300046692	Ga0495671_0131801	Ga0495671_0131801_53_784	241
1037	3300046694	Ga0495649_0118437	Ga0495649_0118437_409_1140	241
1038	3300046694	Ga0495649_0184315	Ga0495649_0184315_182_913	241
1039	3300046809	Ga0495600_0039341	Ga0495600_0039341_360_1091	241
1040	3300046809	Ga0495600_0122194	Ga0495600_0122194_226_957	241
1041	3300046809	Ga0495600_0133252	Ga0495600_0133252_432_1160	241
1042	3300046809	Ga0495600_0181204	Ga0495600_0181204_460_1188	241
1043	3300046809	Ga0495600_0329236	Ga0495600_0329236_116_844	241
1044	3300046809	Ga0495600_0391125	Ga0495600_0391125_119_850	241
1045	3300046810	Ga0495660_0207249	Ga0495660_0207249_74_805	241
1046	3300047315	Ga0495581_0000174	Ga0495581_0000174_15452_16180	241
1047	3300047315	Ga0495581_0043881	Ga0495581_0043881_1641_2369	241
1048	3300047317	Ga0495604_0006679	Ga0495604_0006679_4703_5434	241
1049	3300047317	Ga0495604_0178443	Ga0495604_0178443_174_902	241
1050	3300047319	Ga0495674_0012229	Ga0495674_0012229_888_1616	241
1051	3300047321	Ga0495676_0066360	Ga0495676_0066360_1011_1739	241
1052	3300047321	Ga0495676_0241158	Ga0495676_0241158_220_951	241
1053	3300047322	Ga0495680_0069062	Ga0495680_0069062_1928_2659	241
1054	3300047322	Ga0495680_0103947	Ga0495680_0103947_1062_1790	241
1055	3300047443	Ga0495687_031231	Ga0495687_031231_1658_2389	241
1056	3300047469	Ga0495673_0018848	Ga0495673_0018848_2664_3395	241
1057	3300047470	Ga0495681_0048787	Ga0495681_0048787_1160_1888	241
1058	3300047471	Ga0495684_0007348	Ga0495684_0007348_712_1440	241
1059	3300047472	Ga0495686_0129207	Ga0495686_0129207_420_1151	241
1060	3300047472	Ga0495686_0261572	Ga0495686_0261572_89_820	241
1061	3300047673	Ga0495593_0000321	Ga0495593_0000321_18661_19389	241
1062	3300047673	Ga0495593_0066053	Ga0495593_0066053_85_816	241
1063	3300048088	Ga0495602_0066912	Ga0495602_0066912_1873_2604	241
1064	3300048088	Ga0495602_0096401	Ga0495602_0096401_10_738	241
1065	3300048089	Ga0495614_0018834	Ga0495614_0018834_268_999	241
1066	3300048903	Ga0496100_0267734	Ga0496100_0267734_235_966	241
1067	3300048903	Ga0496100_0454927	Ga0496100_0454927_177_908	241
1068	3300048905	Ga0496102_0385137	Ga0496102_0385137_23_754	241
1069	3300048906	Ga0496103_0003589	Ga0496103_0003589_7062_7793	241
1070	3300048906	Ga0496103_0380740	Ga0496103_0380740_24_752	241
1071	3300048907	Ga0496104_0487823	Ga0496104_0487823_170_901	241
1072	3300048908	Ga0496105_0003700	Ga0496105_0003700_699_1430	241
1073	3300048908	Ga0496105_0050494	Ga0496105_0050494_2518_3249	241
1074	3300048908	Ga0496105_0118831	Ga0496105_0118831_162_893	241
1075	3300048910	Ga0496107_0117463	Ga0496107_0117463_681_1412	241
1076	3300048911	Ga0496108_0047303	Ga0496108_0047303_2734_3465	241
1077	3300048911	Ga0496108_0090140	Ga0496108_0090140_485_1213	241
1078	3300048913	Ga0496110_0544082	Ga0496110_0544082_19_750	241
1079	3300048914	Ga0496111_0538499	Ga0496111_0538499_43_771	241
1080	3300048915	Ga0496112_0107087	Ga0496112_0107087_13_744	241
1081	3300048916	Ga0496113_0339197	Ga0496113_0339197_23_754	241
1082	3300048916	Ga0496113_0767275	Ga0496113_0767275_19_750	241
1083	3300048918	Ga0496115_0209890	Ga0496115_0209890_567_1295	241
1084	3300048919	Ga0496116_0186142	Ga0496116_0186142_96_827	241
1085	3300048919	Ga0496116_0272035	Ga0496116_0272035_10_741	241
1086	3300048920	Ga0496117_0063075	Ga0496117_0063075_652_1383	241
1087	3300048920	Ga0496117_0194830	Ga0496117_0194830_132_863	241
1088	3300048921	Ga0496118_0009320	Ga0496118_0009320_7796_8527	241
1089	3300048921	Ga0496118_0048112	Ga0496118_0048112_655_1386	241
1090	3300048921	Ga0496118_0116873	Ga0496118_0116873_648_1379	241
1091	3300048922	Ga0496119_0000934	Ga0496119_0000934_10079_10810	241
1092	3300048922	Ga0496119_0044680	Ga0496119_0044680_1120_1851	241
1093	3300048922	Ga0496119_0048915	Ga0496119_0048915_1845_2576	241
1094	3300048923	Ga0496120_0009108	Ga0496120_0009108_6065_6796	241
1095	3300048924	Ga0496121_0016644	Ga0496121_0016644_2546_3277	241
1096	3300048924	Ga0496121_0062068	Ga0496121_0062068_2259_2990	241
1097	3300048924	Ga0496121_0079020	Ga0496121_0079020_1868_2599	241
1098	3300048925	Ga0496122_0168356	Ga0496122_0168356_498_1229	241
1099	3300048926	Ga0496123_0071310	Ga0496123_0071310_115_846	241
1100	3300048927	Ga0496124_0156569	Ga0496124_0156569_188_919	241
1101	3300048927	Ga0496124_0410521	Ga0496124_0410521_139_870	241
1102	3300048928	Ga0496125_0032195	Ga0496125_0032195_436_1167	241
1103	3300048928	Ga0496125_0186242	Ga0496125_0186242_327_1058	241
1104	3300048929	Ga0496126_0014762	Ga0496126_0014762_946_1677	241
1105	3300048929	Ga0496126_0031494	Ga0496126_0031494_2032_2763	241
1106	3300048929	Ga0496126_0124477	Ga0496126_0124477_1203_1934	241
1107	3300048929	Ga0496126_0181755	Ga0496126_0181755_10_741	241
1108	3300048929	Ga0496126_0196390	Ga0496126_0196390_93_824	241
1109	3300048929	Ga0496126_0203148	Ga0496126_0203148_636_1367	241
1110	3300048929	Ga0496126_0474941	Ga0496126_0474941_160_891	241
1111	3300048929	Ga0496126_0554500	Ga0496126_0554500_23_754	241
1112	3300049460	Ga0495682_0035539	Ga0495682_0035539_644_1375	241
1113	3300049568	Ga0501031_0000946	Ga0501031_0000946_16342_17070	241
1114	3300049568	Ga0501031_0007375	Ga0501031_0007375_2878_3606	241
1115	3300049569	Ga0501032_0000503	Ga0501032_0000503_26762_27490	241
1116	3300049570	Ga0501033_0000140	Ga0501033_0000140_42610_43338	241
1117	3300049570	Ga0501033_0001234	Ga0501033_0001234_19630_20358	241
1118	3300049571	Ga0501034_0000072	Ga0501034_0000072_10921_11649	241
1119	3300049572	Ga0501036_0000050	Ga0501036_0000050_47811_48539	241
1120	3300049572	Ga0501036_0011109	Ga0501036_0011109_933_1661	241
1121	3300049573	Ga0501037_0000030	Ga0501037_0000030_16404_17132	241
1122	3300049573	Ga0501037_0000580	Ga0501037_0000580_887_1615	241
1123	3300049573	Ga0501037_0012101	Ga0501037_0012101_1740_2468	241
1124	3300049574	Ga0501038_0000039	Ga0501038_0000039_67952_68680	241
1125	3300049574	Ga0501038_0088413	Ga0501038_0088413_1107_1835	241
1126	3300049575	Ga0501039_0000060	Ga0501039_0000060_58025_58753	241
1127	3300049575	Ga0501039_0033351	Ga0501039_0033351_2437_3165	241
1128	3300049575	Ga0501039_0200649	Ga0501039_0200649_463_1191	241
1129	3300049578	Ga0501042_0129773	Ga0501042_0129773_975_1703	241
1130	3300049579	Ga0501043_0002562	Ga0501043_0002562_12459_13187	241
1131	3300049579	Ga0501043_0010025	Ga0501043_0010025_5759_6487	241
1132	3300049580	Ga0501046_0000522	Ga0501046_0000522_10479_11207	241
1133	3300049580	Ga0501046_0020020	Ga0501046_0020020_3535_4263	241
1134	3300049581	Ga0501047_0000174	Ga0501047_0000174_3616_4344	241
1135	3300049581	Ga0501047_0422591	Ga0501047_0422591_166_897	241
1136	3300049582	Ga0501048_0000704	Ga0501048_0000704_19862_20590	241
1137	3300049583	Ga0501067_0000239	Ga0501067_0000239_14247_14975	241
1138	3300049584	Ga0501068_0000227	Ga0501068_0000227_9594_10322	241
1139	3300049584	Ga0501068_0285367	Ga0501068_0285367_151_879	241
1140	3300049585	Ga0501069_0015333	Ga0501069_0015333_3331_4059	241
1141	3300049585	Ga0501069_0270533	Ga0501069_0270533_175_903	241
1142	3300049586	Ga0501070_0003314	Ga0501070_0003314_2780_3508	241
1143	3300049588	Ga0501072_0001189	Ga0501072_0001189_8123_8851	241
1144	3300049589	Ga0501073_0000009	Ga0501073_0000009_26746_27474	241
1145	3300049590	Ga0501074_0000049	Ga0501074_0000049_42084_42812	241
1146	3300049741	Ga0501079_0014652	Ga0501079_0014652_4406_5134	241
1147	3300049742	Ga0501080_0005405	Ga0501080_0005405_5535_6263	241
1148	3300049743	Ga0501081_0136990	Ga0501081_0136990_699_1427	241
1149	3300049744	Ga0501083_0000251	Ga0501083_0000251_11361_12089	241
1150	3300049822	Ga0501035_0000067	Ga0501035_0000067_101674_102402	241
1151	3300049822	Ga0501035_0013199	Ga0501035_0013199_1606_2334	241
1152	3300049823	Ga0501044_0000258	Ga0501044_0000258_17336_18064	241
1153	3300049823	Ga0501044_0132726	Ga0501044_0132726_945_1673	241
1154	3300049824	Ga0501045_0005432	Ga0501045_0005432_3443_4171	241
1155	3300050490	nmdc:mga03n38_91680_c1	nmdc:mga03n38_91680_c1_270_1001	241
1156	3300050491	nmdc:mga00v17_226514_c1	nmdc:mga00v17_226514_c1_216_947	241
1157	3300050492	nmdc:mga0yw44_48278_c1	nmdc:mga0yw44_48278_c1_1690_2421	241
1158	3300050493	nmdc:mga0k408_183042_c1	nmdc:mga0k408_183042_c1_250_981	241
1159	3300050494	nmdc:mga06z11_29356_c1	nmdc:mga06z11_29356_c1_1556_2287	241
1160	3300050495	nmdc:mga04h51_92482_c1	nmdc:mga04h51_92482_c1_91_822	241
1161	3300050514	nmdc:mga08x19_119583_c1	nmdc:mga08x19_119583_c1_742_1470	241
1162	3300050516	nmdc:mga0sz30_3193_c1	nmdc:mga0sz30_3193_c1_1300_2031	241
1163	3300053083	Ga0495655_0023618	Ga0495655_0023618_97_828	241
1164	3300053084	Ga0495595_0203097	Ga0495595_0203097_187_915	241
1165	3300053085	Ga0495619_0039633	Ga0495619_0039633_938_1666	241
1166	3300053085	Ga0495619_0138953	Ga0495619_0138953_917_1648	241
1167	3300053085	Ga0495619_0296802	Ga0495619_0296802_263_991	241
1168	3300053086	Ga0500578_0253554	Ga0500578_0253554_133_864	241
1169	3300053087	Ga0500643_000013	Ga0500643_000013_259671_260402	241
1170	3300053094	Ga0500566_0000588	Ga0500566_0000588_18060_18788	241
1171	3300053094	Ga0500566_0007385	Ga0500566_0007385_842_1573	241
1172	3300053095	Ga0500640_007928	Ga0500640_007928_304_1032	241
1173	3300053101	Ga0500553_085888	Ga0500553_085888_613_1344	241
1174	3300053105	Ga0500557_000030	Ga0500557_000030_65348_66079	241
1175	3300053108	Ga0500562_015039	Ga0500562_015039_499_1230	241
1176	3300053111	Ga0500572_000174	Ga0500572_000174_2609_3337	241
1177	3300053116	Ga0500592_012737	Ga0500592_012737_578_1309	241
1178	3300053119	Ga0500595_012017	Ga0500595_012017_714_1445	241
1179	3300053119	Ga0500595_050611	Ga0500595_050611_504_1235	241
1180	3300053122	Ga0500608_018019	Ga0500608_018019_1499_2227	241
1181	3300053122	Ga0500608_206556	Ga0500608_206556_22_753	241
1182	3300053130	Ga0500642_0000148	Ga0500642_0000148_20092_20823	241
1183	3300053134	Ga0500658_0049209	Ga0500658_0049209_41_772	241
1184	3300053136	Ga0500559_0045944	Ga0500559_0045944_315_1043	241
1185	3300053136	Ga0500559_0094995	Ga0500559_0094995_118_849	241
1186	3300053147	Ga0500589_056512	Ga0500589_056512_111_842	241
1187	3300053148	Ga0500590_038022	Ga0500590_038022_301_1029	241
1188	3300053150	Ga0500603_001054	Ga0500603_001054_5436_6164	241
1189	3300053153	Ga0500616_0022040	Ga0500616_0022040_135_866	241
1190	3300053158	Ga0500627_0019805	Ga0500627_0019805_262_993	241
1191	3300053159	Ga0500630_001669	Ga0500630_001669_1493_2221	241
1192	3300053162	Ga0500638_016902	Ga0500638_016902_1229_1957	241
1193	3300053162	Ga0500638_133356	Ga0500638_133356_328_1059	241
1194	3300053163	Ga0500639_000006	Ga0500639_000006_66547_67275	241
1195	3300053177	Ga0500636_0042426	Ga0500636_0042426_1634_2362	241
1196	3300053177	Ga0500636_0134790	Ga0500636_0134790_43_774	241
1197	3300053178	Ga0500637_0007374	Ga0500637_0007374_3207_3935	241
1198	3300053722	Ga0500649_080458	Ga0500649_080458_289_1020	241
1199	3300053730	Ga0500645_069553	Ga0500645_069553_178_909	241
1200	3300053732	Ga0500656_007137	Ga0500656_007137_367_1098	241
1201	3300053735	Ga0500596_001921	Ga0500596_001921_1488_2216	241
1202	3300053736	Ga0500599_002836	Ga0500599_002836_227_958	241
1203	3300053737	Ga0500601_000387	Ga0500601_000387_1500_2231	241
1204	3300053737	Ga0500601_007366	Ga0500601_007366_136_864	241
1205	3300053737	Ga0500601_013177	Ga0500601_013177_72_803	241
1206	3300054114	Ga0501084_0002907	Ga0501084_0002907_12685_13413	241
1207	3300055283	Ga0500661_008965	Ga0500661_008965_970_1701	241
1208	3300055283	Ga0500661_013161	Ga0500661_013161_426_1157	241
1209	3300060353	Ga0501082_0010462	Ga0501082_0010462_3927_4655	241
1210	3300061719	Ga0466962_0027852	Ga0466962_0027852_1405_2136	241
1211	3300061734	Ga0530510_0173394	Ga0530510_0173394_160_888	241
1212	iso_pu_bacteria	8056681323	8056684564	241
1213	3300046507	Ga0495606_0013747	Ga0495606_0013747_190_921	242
1214	3300002077	JGI24744J21845_10012388	JGI24744J21845_100123883	243
1215	3300003215	JGI25153J46596_10000584	JGI25153J46596_1000058421	243
1216	3300003659	JGI25404J52841_10003812	JGI25404J52841_100038122	243
1217	3300005330	Ga0070690_100181224	Ga0070690_1001812242	243
1218	3300005335	Ga0070666_10140276	Ga0070666_101402762	243
1219	3300005336	Ga0070680_100108566	Ga0070680_1001085662	243
1220	3300005338	Ga0068868_100037777	Ga0068868_1000377773	243
1221	3300005340	Ga0070689_100398029	Ga0070689_1003980292	243
1222	3300005341	Ga0070691_10113795	Ga0070691_101137952	243
1223	3300005344	Ga0070661_100330189	Ga0070661_1003301892	243
1224	3300005345	Ga0070692_10272411	Ga0070692_102724111	243
1225	3300005355	Ga0070671_100089161	Ga0070671_1000891613	243
1226	3300005355	Ga0070671_100393849	Ga0070671_1003938491	243
1227	3300005356	Ga0070674_100041788	Ga0070674_1000417882	243
1228	3300005438	Ga0070701_10031761	Ga0070701_100317613	243
1229	3300005455	Ga0070663_100003861	Ga0070663_10000386110	243
1230	3300005456	Ga0070678_100009294	Ga0070678_1000092943	243
1231	3300005456	Ga0070678_100013992	Ga0070678_1000139925	243
1232	3300005530	Ga0070679_100048989	Ga0070679_1000489893	243
1233	3300005539	Ga0068853_100162295	Ga0068853_1001622952	243
1234	3300005543	Ga0070672_100110745	Ga0070672_1001107452	243
1235	3300005543	Ga0070672_100196003	Ga0070672_1001960032	243
1236	3300005548	Ga0070665_100229951	Ga0070665_1002299511	243
1237	3300005549	Ga0070704_100125092	Ga0070704_1001250922	243
1238	3300005563	Ga0068855_100015060	Ga0068855_1000150609	243
1239	3300005564	Ga0070664_100032584	Ga0070664_1000325846	243
1240	3300005564	Ga0070664_100077599	Ga0070664_1000775993	243
1241	3300005614	Ga0068856_100004253	Ga0068856_1000042538	243
1242	3300005615	Ga0070702_100381317	Ga0070702_1003813171	243
1243	3300005616	Ga0068852_100039288	Ga0068852_1000392883	243
1244	3300005616	Ga0068852_100164154	Ga0068852_1001641542	243
1245	3300005618	Ga0068864_100078193	Ga0068864_1000781932	243
1246	3300005618	Ga0068864_100266674	Ga0068864_1002666742	243
1247	3300005719	Ga0068861_100029518	Ga0068861_1000295184	243
1248	3300005719	Ga0068861_100252130	Ga0068861_1002521302	243
1249	3300005840	Ga0068870_10271348	Ga0068870_102713482	243
1250	3300005841	Ga0068863_100256927	Ga0068863_1002569272	243
1251	3300005937	Ga0081455_10233267	Ga0081455_102332672	243
1252	3300005983	Ga0081540_1002655	Ga0081540_100265514	243
1253	3300005983	Ga0081540_1081149	Ga0081540_10811492	243
1254	3300005985	Ga0081539_10154855	Ga0081539_101548551	243
1255	3300006038	Ga0075365_10094262	Ga0075365_100942622	243
1256	3300006038	Ga0075365_10112344	Ga0075365_101123442	243
1257	3300006048	Ga0075363_100046557	Ga0075363_1000465573	243
1258	3300006051	Ga0075364_10016329	Ga0075364_100163293	243
1259	3300006173	Ga0070716_100202404	Ga0070716_1002024042	243
1260	3300006175	Ga0070712_100009293	Ga0070712_1000092935	243
1261	3300006186	Ga0075369_10078534	Ga0075369_100785342	243
1262	3300013297	Ga0157378_10157077	Ga0157378_101570772	243
1263	3300025297	Ga0209758_1004893	Ga0209758_100489311	243
1264	3300025905	Ga0207685_10061918	Ga0207685_100619182	243
1265	3300025907	Ga0207645_10060303	Ga0207645_100603032	243
1266	3300025907	Ga0207645_10177475	Ga0207645_101774752	243
1267	3300025908	Ga0207643_10066630	Ga0207643_100666302	243
1268	3300025913	Ga0207695_10214399	Ga0207695_102143992	243
1269	3300025915	Ga0207693_10020689	Ga0207693_100206893	243
1270	3300025917	Ga0207660_10030192	Ga0207660_100301922	243
1271	3300025921	Ga0207652_10144479	Ga0207652_101444792	243
1272	3300025925	Ga0207650_10068179	Ga0207650_100681793	243
1273	3300025927	Ga0207687_10062803	Ga0207687_100628032	243
1274	3300025931	Ga0207644_10070670	Ga0207644_100706702	243
1275	3300025931	Ga0207644_10133935	Ga0207644_101339352	243
1276	3300025935	Ga0207709_10036879	Ga0207709_100368792	243
1277	3300025937	Ga0207669_10001419	Ga0207669_100014198	243
1278	3300025937	Ga0207669_10037824	Ga0207669_100378242	243
1279	3300025938	Ga0207704_10171336	Ga0207704_101713362	243
1280	3300025939	Ga0207665_10293523	Ga0207665_102935232	243
1281	3300025940	Ga0207691_10059792	Ga0207691_100597922	243
1282	3300025940	Ga0207691_10174355	Ga0207691_101743552	243
1283	3300025944	Ga0207661_10109127	Ga0207661_101091271	243
1284	3300025945	Ga0207679_10054782	Ga0207679_100547823	243
1285	3300025949	Ga0207667_10018590	Ga0207667_100185904	243
1286	3300025960	Ga0207651_10253449	Ga0207651_102534492	243
1287	3300025960	Ga0207651_10446024	Ga0207651_104460242	243
1288	3300025972	Ga0207668_10081235	Ga0207668_100812353	243
1289	3300025972	Ga0207668_10357051	Ga0207668_103570512	243
1290	3300025981	Ga0207640_10408574	Ga0207640_104085742	243
1291	3300026023	Ga0207677_10022070	Ga0207677_100220703	243
1292	3300026035	Ga0207703_10369690	Ga0207703_103696902	243
1293	3300026067	Ga0207678_10436092	Ga0207678_104360922	243
1294	3300026075	Ga0207708_10058337	Ga0207708_100583372	243
1295	3300026078	Ga0207702_10000014	Ga0207702_1000001445	243
1296	3300026095	Ga0207676_10105287	Ga0207676_101052873	243
1297	3300026095	Ga0207676_10528037	Ga0207676_105280372	243
1298	3300026118	Ga0207675_100505394	Ga0207675_1005053942	243
1299	3300026121	Ga0207683_10018157	Ga0207683_100181578	243
1300	3300026121	Ga0207683_10107416	Ga0207683_101074162	243
1301	3300026142	Ga0207698_10031103	Ga0207698_100311032	243
1302	3300027866	Ga0209813_10035175	Ga0209813_100351751	243
1303	3300028379	Ga0268266_10002343	Ga0268266_100023434	243
1304	3300028379	Ga0268266_10006350	Ga0268266_100063502	243
1305	3300028379	Ga0268266_10466119	Ga0268266_104661191	243
1306	3300028786	Ga0307517_10007290	Ga0307517_1000729010	243
1307	3300028786	Ga0307517_10301404	Ga0307517_103014041	243
1308	3300028794	Ga0307515_10037579	Ga0307515_100375795	243
1309	3300031456	Ga0307513_10117127	Ga0307513_101171273	243
1310	3300031548	Ga0307408_100260154	Ga0307408_1002601542	243
1311	3300031711	Ga0265314_10130938	Ga0265314_101309382	243
1312	3300031901	Ga0307406_10138959	Ga0307406_101389592	243
1313	3300032005	Ga0307411_10033487	Ga0307411_100334872	243
1314	3300032126	Ga0307415_100405779	Ga0307415_1004057792	243
1315	3300032126	Ga0307415_100577593	Ga0307415_1005775931	243
1316	3300035092	Ga0373952_0017543	Ga0373952_0017543_150_884	243
1317	3300037068	Ga0373925_0103159	Ga0373925_0103159_477_1211	243
1318	3300037471	Ga0395905_0206719	Ga0395905_0206719_220_972	243
1319	3300046459	Ga0495629_0037539	Ga0495629_0037539_2168_2902	243
1320	3300048922	Ga0496119_0093115	Ga0496119_0093115_232_966	243
1321	3300048928	Ga0496125_0390935	Ga0496125_0390935_22_756	243
1322	3300049577	Ga0501041_0337438	Ga0501041_0337438_14_748	243
1323	3300049583	Ga0501067_0032572	Ga0501067_0032572_1700_2434	243
1324	3300049741	Ga0501079_0202424	Ga0501079_0202424_586_1320	243
1325	3300046461	Ga0495641_0134744	Ga0495641_0134744_309_1046	244
1326	3300048918	Ga0496115_0069249	Ga0496115_0069249_1507_2244	244
1327	3300003203	JGI25406J46586_10000043	JGI25406J46586_1000004335	245
1328	3300005840	Ga0068870_10152444	Ga0068870_101524442	245
1329	3300005985	Ga0081539_10000324	Ga0081539_1000032485	245
1330	3300006038	Ga0075365_10087258	Ga0075365_100872582	245
1331	3300009093	Ga0105240_10068721	Ga0105240_100687215	245
1332	3300009094	Ga0111539_10029699	Ga0111539_100296997	245
1333	3300009098	Ga0105245_10031108	Ga0105245_100311086	245
1334	3300009098	Ga0105245_10069332	Ga0105245_100693323	245
1335	3300009147	Ga0114129_10069645	Ga0114129_100696453	245
1336	3300009174	Ga0105241_10021437	Ga0105241_100214376	245
1337	3300009177	Ga0105248_10017355	Ga0105248_100173556	245
1338	3300009177	Ga0105248_10350292	Ga0105248_103502922	245
1339	3300010375	Ga0105239_10171228	Ga0105239_101712283	245
1340	3300013296	Ga0157374_10025891	Ga0157374_100258913	245
1341	3300013306	Ga0163162_10011477	Ga0163162_1001147710	245
1342	3300013306	Ga0163162_10410990	Ga0163162_104109902	245
1343	3300013308	Ga0157375_10129123	Ga0157375_101291233	245
1344	3300013308	Ga0157375_10518484	Ga0157375_105184842	245
1345	3300014325	Ga0163163_10009818	Ga0163163_100098186	245
1346	3300014325	Ga0163163_10601784	Ga0163163_106017842	245
1347	3300014326	Ga0157380_10514719	Ga0157380_105147192	245
1348	3300014745	Ga0157377_10081149	Ga0157377_100811492	245
1349	3300014969	Ga0157376_10007833	Ga0157376_100078337	245
1350	3300027907	Ga0207428_10193448	Ga0207428_101934482	245
1351	3300031711	Ga0265314_10002529	Ga0265314_1000252911	245
1352	3300031730	Ga0307516_10031409	Ga0307516_100314093	245
1353	3300031730	Ga0307516_10232934	Ga0307516_102329342	245
1354	3300031995	Ga0307409_100395125	Ga0307409_1003951252	245
1355	3300032005	Ga0307411_10551584	Ga0307411_105515842	245
1356	3300035695	Ga0373927_0278256	Ga0373927_0278256_213_953	245
1357	3300041459	Ga0451800_1299000	Ga0451800_1299000_974_1714	245
1358	3300041512	Ga0451853_3984790	Ga0451853_3984790_302_1042	245
1359	3300042004	Ga0439445_0028170	Ga0439445_0028170_548_1288	245
1360	3300046453	Ga0495627_018888	Ga0495627_018888_883_1623	245
1361	3300046455	Ga0495603_0045295	Ga0495603_0045295_491_1231	245
1362	3300046455	Ga0495603_0176566	Ga0495603_0176566_335_1075	245
1363	3300046458	Ga0495591_032611	Ga0495591_032611_381_1121	245
1364	3300046459	Ga0495629_0353429	Ga0495629_0353429_72_812	245
1365	3300046472	Ga0495580_0335887	Ga0495580_0335887_33_773	245
1366	3300046475	Ga0495639_0184216	Ga0495639_0184216_142_882	245
1367	3300046492	Ga0495585_0078612	Ga0495585_0078612_396_1136	245
1368	3300046507	Ga0495606_0140641	Ga0495606_0140641_597_1337	245
1369	3300046518	Ga0495631_0120697	Ga0495631_0120697_327_1067	245
1370	3300046523	Ga0495644_0091189	Ga0495644_0091189_275_1015	245
1371	3300046526	Ga0495666_0050426	Ga0495666_0050426_398_1138	245
1372	3300046537	Ga0495598_0047126	Ga0495598_0047126_309_1049	245
1373	3300046539	Ga0495621_0062883	Ga0495621_0062883_357_1097	245
1374	3300046558	Ga0495633_0029685	Ga0495633_0029685_97_837	245
1375	3300046558	Ga0495633_0131655	Ga0495633_0131655_326_1066	245
1376	3300046615	Ga0495656_0003634	Ga0495656_0003634_161_901	245
1377	3300046615	Ga0495656_0061103	Ga0495656_0061103_650_1390	245
1378	3300046616	Ga0495668_0269517	Ga0495668_0269517_140_880	245
1379	3300046664	Ga0495659_0066742	Ga0495659_0066742_346_1086	245
1380	3300046665	Ga0495661_0221495	Ga0495661_0221495_182_922	245
1381	3300046674	Ga0495588_0032571	Ga0495588_0032571_1630_2370	245
1382	3300046674	Ga0495588_0160977	Ga0495588_0160977_254_994	245
1383	3300046684	Ga0495669_0025273	Ga0495669_0025273_43_783	245
1384	3300046691	Ga0495670_0029574	Ga0495670_0029574_528_1268	245
1385	3300046691	Ga0495670_0079354	Ga0495670_0079354_419_1159	245
1386	3300047315	Ga0495581_0400821	Ga0495581_0400821_16_756	245
1387	3300047318	Ga0495636_0071930	Ga0495636_0071930_652_1392	245
1388	3300047320	Ga0495672_0045971	Ga0495672_0045971_856_1596	245
1389	3300048903	Ga0496100_0030986	Ga0496100_0030986_2130_2870	245
1390	3300048904	Ga0496101_0001116	Ga0496101_0001116_9593_10333	245
1391	3300048905	Ga0496102_0011710	Ga0496102_0011710_5428_6168	245
1392	3300048905	Ga0496102_0705933	Ga0496102_0705933_106_846	245
1393	3300048906	Ga0496103_0017422	Ga0496103_0017422_2138_2878	245
1394	3300048907	Ga0496104_0108079	Ga0496104_0108079_1612_2352	245
1395	3300048907	Ga0496104_0546430	Ga0496104_0546430_55_795	245
1396	3300048908	Ga0496105_0028196	Ga0496105_0028196_2167_2907	245
1397	3300048910	Ga0496107_0063213	Ga0496107_0063213_875_1615	245
1398	3300048910	Ga0496107_0313582	Ga0496107_0313582_165_905	245
1399	3300048913	Ga0496110_0024274	Ga0496110_0024274_546_1286	245
1400	3300048914	Ga0496111_0035505	Ga0496111_0035505_1437_2177	245
1401	3300048915	Ga0496112_0000023	Ga0496112_0000023_91080_91820	245
1402	3300048917	Ga0496114_0034331	Ga0496114_0034331_223_963	245
1403	3300048918	Ga0496115_0001457	Ga0496115_0001457_6503_7243	245
1404	3300048918	Ga0496115_0517521	Ga0496115_0517521_147_887	245
1405	3300048922	Ga0496119_0056925	Ga0496119_0056925_1269_2009	245
1406	3300048924	Ga0496121_0002915	Ga0496121_0002915_16708_17451	245
1407	3300048924	Ga0496121_0068006	Ga0496121_0068006_1939_2679	245
1408	3300048925	Ga0496122_0026757	Ga0496122_0026757_1257_1997	245
1409	3300048926	Ga0496123_0024339	Ga0496123_0024339_2696_3436	245
1410	3300048927	Ga0496124_0115301	Ga0496124_0115301_593_1333	245
1411	3300048929	Ga0496126_0001668	Ga0496126_0001668_25674_26414	245
1412	3300048929	Ga0496126_0036934	Ga0496126_0036934_3410_4150	245
1413	3300049578	Ga0501042_0544366	Ga0501042_0544366_88_828	245
1414	3300049592	Ga0501076_0279251	Ga0501076_0279251_451_1191	245
1415	3300050492	nmdc:mga0yw44_10820_c1	nmdc:mga0yw44_10820_c1_3692_4432	245
1416	3300050492	nmdc:mga0yw44_241651_c1	nmdc:mga0yw44_241651_c1_84_824	245
1417	3300050495	nmdc:mga04h51_124722_c1	nmdc:mga04h51_124722_c1_155_895	245
1418	3300050508	nmdc:mga09592_69360_c1	nmdc:mga09592_69360_c1_1853_2593	245
1419	3300053083	Ga0495655_0008988	Ga0495655_0008988_304_1044	245
1420	3300053083	Ga0495655_0033641	Ga0495655_0033641_392_1132	245
1421	3300053094	Ga0500566_0005320	Ga0500566_0005320_4419_5159	245
1422	3300053096	Ga0500641_0015731	Ga0500641_0015731_2008_2748	245
1423	3300053102	Ga0500554_008721	Ga0500554_008721_1474_2214	245
1424	3300053119	Ga0500595_000068	Ga0500595_000068_16633_17373	245
1425	3300053119	Ga0500595_008896	Ga0500595_008896_3234_3977	245
1426	3300053139	Ga0500568_0010665	Ga0500568_0010665_908_1651	245
1427	3300053155	Ga0500620_045449	Ga0500620_045449_198_938	245
1428	3300053162	Ga0500638_005706	Ga0500638_005706_2857_3597	245
1429	3300053178	Ga0500637_0002593	Ga0500637_0002593_4893_5633	245
1430	3300053730	Ga0500645_011367	Ga0500645_011367_871_1611	245
1431	3300054114	Ga0501084_0401359	Ga0501084_0401359_373_1113	245
1432	3300055283	Ga0500661_009319	Ga0500661_009319_831_1571	245
1433	3300049572	Ga0501036_0206702	Ga0501036_0206702_29_775	246
1434	3300005842	Ga0068858_100136563	Ga0068858_1001365632	247
1435	3300025315	Ga0207697_10065973	Ga0207697_100659732	247
1436	3300025934	Ga0207686_10149700	Ga0207686_101497002	247
1437	3300025935	Ga0207709_10229494	Ga0207709_102294942	247
1438	3300026035	Ga0207703_10503678	Ga0207703_105036782	247
1439	3300026095	Ga0207676_10157516	Ga0207676_101575163	247
1440	3300001989	JGI24739J22299_10013235	JGI24739J22299_100132354	249
1441	3300001990	JGI24737J22298_10020065	JGI24737J22298_100200652	249
1442	3300002075	JGI24738J21930_10040683	JGI24738J21930_100406832	249
1443	3300005455	Ga0070663_100042900	Ga0070663_1000429002	249
1444	3300005539	Ga0068853_100099687	Ga0068853_1000996872	249
1445	3300005563	Ga0068855_100071320	Ga0068855_1000713205	249
1446	3300005577	Ga0068857_100007059	Ga0068857_1000070594	249
1447	3300005578	Ga0068854_100042625	Ga0068854_1000426252	249
1448	3300005614	Ga0068856_100039035	Ga0068856_1000390352	249
1449	3300009093	Ga0105240_10078563	Ga0105240_100785633	249
1450	3300009174	Ga0105241_10003365	Ga0105241_100033655	249
1451	3300009176	Ga0105242_10166958	Ga0105242_101669582	249
1452	3300009177	Ga0105248_10206580	Ga0105248_102065803	249
1453	3300009545	Ga0105237_10100724	Ga0105237_101007243	249
1454	3300009551	Ga0105238_10003808	Ga0105238_100038083	249
1455	3300009551	Ga0105238_10028380	Ga0105238_100283803	249
1456	3300010375	Ga0105239_10159619	Ga0105239_101596192	249
1457	3300010375	Ga0105239_10402060	Ga0105239_104020602	249
1458	3300025321	Ga0207656_10029528	Ga0207656_100295282	249
1459	3300025904	Ga0207647_10012297	Ga0207647_100122976	249
1460	3300025911	Ga0207654_10280472	Ga0207654_102804722	249
1461	3300025924	Ga0207694_10045004	Ga0207694_100450043	249
1462	3300025949	Ga0207667_10026463	Ga0207667_100264635	249
1463	3300025981	Ga0207640_10010676	Ga0207640_100106762	249
1464	3300026041	Ga0207639_10082192	Ga0207639_100821922	249
1465	3300026067	Ga0207678_10048642	Ga0207678_100486423	249
1466	3300026078	Ga0207702_10033789	Ga0207702_100337892	249
1467	3300026116	Ga0207674_10022325	Ga0207674_100223257	249
1468	3300035115	Ga0373941_0051377	Ga0373941_0051377_281_1033	249
1469	3300035691	Ga0373931_0129764	Ga0373931_0129764_614_1366	249
1470	3300035695	Ga0373927_0012663	Ga0373927_0012663_3778_4530	249
1471	3300035695	Ga0373927_0051353	Ga0373927_0051353_261_1013	249
1472	3300037068	Ga0373925_0424248	Ga0373925_0424248_24_776	249
1473	3300046475	Ga0495639_0155951	Ga0495639_0155951_25_777	249
1474	3300046517	Ga0495630_0116733	Ga0495630_0116733_335_1087	249
1475	3300046683	Ga0495658_0143151	Ga0495658_0143151_295_1047	249
1476	3300047319	Ga0495674_0554644	Ga0495674_0554644_112_864	249
1477	3300048903	Ga0496100_0319795	Ga0496100_0319795_138_890	249
1478	3300048904	Ga0496101_0349694	Ga0496101_0349694_307_1059	249
1479	3300048905	Ga0496102_0139532	Ga0496102_0139532_245_997	249
1480	3300048906	Ga0496103_0079695	Ga0496103_0079695_1272_2024	249
1481	3300048907	Ga0496104_0396945	Ga0496104_0396945_377_1129	249
1482	3300048908	Ga0496105_0140536	Ga0496105_0140536_368_1120	249
1483	3300048909	Ga0496106_0083302	Ga0496106_0083302_368_1120	249
1484	3300048910	Ga0496107_0009363	Ga0496107_0009363_5321_6073	249
1485	3300048912	Ga0496109_0203135	Ga0496109_0203135_286_1038	249
1486	3300048913	Ga0496110_0065839	Ga0496110_0065839_418_1170	249
1487	3300048914	Ga0496111_0009582	Ga0496111_0009582_5404_6156	249
1488	3300048915	Ga0496112_0318223	Ga0496112_0318223_419_1171	249
1489	3300048916	Ga0496113_0339605	Ga0496113_0339605_84_836	249
1490	3300048918	Ga0496115_0013523	Ga0496115_0013523_5290_6042	249
1491	3300053084	Ga0495595_0014352	Ga0495595_0014352_1118_1870	249
1492	3300053085	Ga0495619_0065256	Ga0495619_0065256_852_1604	249
1493	3300001979	JGI24740J21852_10013460	JGI24740J21852_100134602	255
1494	3300005455	Ga0070663_100293598	Ga0070663_1002935982	255
1495	3300005539	Ga0068853_100009798	Ga0068853_1000097986	255
1496	3300005563	Ga0068855_100019571	Ga0068855_1000195717	255
1497	3300005577	Ga0068857_100028351	Ga0068857_1000283512	255
1498	3300005578	Ga0068854_100005211	Ga0068854_1000052112	255
1499	3300005614	Ga0068856_100010258	Ga0068856_1000102585	255
1500	3300005616	Ga0068852_100328460	Ga0068852_1003284602	255
1501	3300005834	Ga0068851_10000746	Ga0068851_100007468	255
1502	3300025911	Ga0207654_10002385	Ga0207654_100023859	255
1503	3300025913	Ga0207695_10000579	Ga0207695_1000057946	255
1504	3300025924	Ga0207694_10001208	Ga0207694_1000120821	255
1505	3300025949	Ga0207667_10007912	Ga0207667_1000791212	255
1506	3300026041	Ga0207639_10007424	Ga0207639_100074242	255
1507	3300026067	Ga0207678_10230307	Ga0207678_102303072	255
1508	3300026078	Ga0207702_10000003	Ga0207702_10000003165	255
1509	3300026116	Ga0207674_10007573	Ga0207674_100075737	255
1510	3300026142	Ga0207698_10013764	Ga0207698_100137642	255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

36

145

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7m0s-assembly1.cif.gz_B	n-terminal domain of pmra from acinetobacter baumannii	0.9822	34	151
1nxt-assembly1.cif.gz_A-2	micarec ph 4.0	0.9819	35	151
2a9r-assembly1.cif.gz_A-2	rr02-rec phosphate in the active site	0.9791	35	151
1nxx-assembly1.cif.gz_A-2	micarec ph 5.5	0.9764	35	151
8fk2-assembly1.cif.gz_B	the n-terminal vicr from streptococcus mutans	0.9734	34	153

ID	Description	Score	Start	End	Superfamily
af_P9WGM1_5_87_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.98	32	109	3.40.50.2300
af_Q06065_2_134_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9753	33	152	3.40.50.2300
1nxoA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9732	35	151	3.40.50.2300
af_P23836_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9731	35	112	3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9715	35	112	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A350Y6D3-F1-model_v4	Histidine kinase	0.9822	34	134	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0016301 GO:0032993
AF-A0A1Z4LL58-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.9814	33	150	GO:0000155
AF-A0A7C9PZV4-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.98	34	150	GO:0000155
AF-A0A6I5QSI8-F1-model_v4	Response regulator	0.9797	34	150	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A3N5EU33-F1-model_v4	Response regulator	0.9792	33	150	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993

Feature Viewer

pLDDT	pTM	Quality
84.41	0.55	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494463

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

36

145

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map