F494463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1510 | 719 | 1307 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10013460|JGI24740J21852_100134602 |
| Length | 255 |
| Sequence | MQATGIMIERTTEGNRVILAPTNRPPRRPADDAPHLLLVDDDRRIRDLLSRFLVGEGYRVTTALSAQDARGKLQGLHFDLLILDVMMPGESGFDLARFIRSSSSVPIIMLTARHEAESRIEGLQLGADDYVAKPFEPRELVLRIGNILKRTAPPPVETLEQVAFGPYLFHLERGELREGDGIIHLTDREREMLRLLALTPGETVSRSALTANGAVNERAVDVQINRLRRKIEHDPANPLFLQAVRGVGYRLVAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 23 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355199 | |||
| 28 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 29 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 30 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 31 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 32 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 33 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 34 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 35 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 36 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 37 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 46 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 47 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 48 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 49 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 50 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 51 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 52 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 53 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 54 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 55 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 56 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 57 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 58 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 59 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 60 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 61 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 62 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 63 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 64 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 65 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 66 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 67 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 68 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 69 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 70 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 71 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 72 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 73 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 74 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 75 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 76 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 77 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 78 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 79 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 80 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 81 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 82 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 83 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 84 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 85 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 86 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 87 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 88 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 89 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 90 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 91 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 92 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 93 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 94 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 95 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 96 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 97 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 98 | 2922368715 | |||
| 99 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 100 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 101 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 102 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 103 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 104 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 105 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 106 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 107 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 108 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 109 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 110 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 111 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 112 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 113 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 114 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 115 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 116 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 117 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 118 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 119 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 120 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 121 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 122 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 123 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 124 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 125 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 126 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 127 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 128 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 129 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 130 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 131 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 132 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 133 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 134 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 135 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 136 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 137 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 138 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 139 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 140 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 141 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 142 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 143 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 144 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 145 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 146 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 147 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 148 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 149 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 150 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 151 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 152 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 153 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 154 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 155 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 156 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 157 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 158 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 159 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 160 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 165 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 166 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 167 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 168 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 169 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 170 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 171 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 172 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 173 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 174 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 175 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 176 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 177 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 178 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 179 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 180 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 181 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 184 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 186 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 188 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 190 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 192 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 201 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 219 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 224 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 226 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 227 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 228 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 230 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 231 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 232 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 233 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 234 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 235 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 236 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 237 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 238 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 239 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 240 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 241 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 243 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 244 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 245 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 246 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 247 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 250 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 251 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 252 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 253 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 254 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 255 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 256 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 257 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 258 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 259 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 260 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 272 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 284 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 288 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 289 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 290 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 291 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 292 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 293 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 294 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 369 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 370 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 371 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 374 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 378 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 379 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 380 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 381 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 382 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 383 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 384 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 385 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 386 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 388 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 389 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 390 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 391 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 392 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 393 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 394 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 395 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 396 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 397 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 398 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 399 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 400 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 401 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 402 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 403 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 404 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 405 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 406 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 407 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 408 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 412 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 413 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 414 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 415 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 416 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 417 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 418 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 419 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 420 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 421 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 422 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 423 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 424 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 425 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 426 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 427 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 428 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 429 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 430 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 431 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 432 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 433 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 434 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 435 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 436 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 437 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 438 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 439 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 440 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 441 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 442 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 443 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 444 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 445 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 446 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 447 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 448 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 449 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 450 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 451 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 452 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 453 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 454 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 455 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 456 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 457 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 458 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 548 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 549 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 550 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 551 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 552 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 553 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 554 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 555 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 557 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 558 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 559 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 560 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 561 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 562 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 563 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 564 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 565 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 566 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 567 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 568 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 569 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 570 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 571 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 572 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 573 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 574 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 586 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 591 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 592 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 600 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 601 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 606 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 609 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 610 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 611 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 612 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 613 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 614 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 615 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 620 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 621 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 622 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 623 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 628 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 629 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 630 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 631 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 633 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 634 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 635 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 636 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 637 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 639 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 640 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 641 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 642 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 643 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 644 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 645 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 646 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 647 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 648 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 649 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 650 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 651 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 652 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 653 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 654 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 655 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 656 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 657 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 658 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 659 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 660 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 661 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 662 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 663 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 664 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 665 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 666 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 667 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 668 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 669 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 670 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 671 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 672 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 673 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 674 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 675 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 676 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 677 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 678 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 679 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 680 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 682 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 683 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 684 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 685 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 686 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 687 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 688 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 689 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 690 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 691 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 692 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 693 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 694 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 695 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 696 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 697 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 698 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 699 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 700 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 701 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 702 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 703 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 704 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 705 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 706 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 707 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 708 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 709 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 710 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 711 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 712 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 713 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 714 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 715 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 716 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 717 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 718 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 719 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.67 |
| Metatranscriptomes | 0 |
| Isolates | 13.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.98 |
| Nodule | 10.33 |
| Rhizoplane | 6.09 |
| Rhizosphere | 60.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013460 | 3300001979 | Bacteria | 3049 |
| 2 | JGI24739J22299_10013235 | 3300001989 | Bacteria | 3016 |
| 3 | JGI24737J22298_10020065 | 3300001990 | Bacteria | 2136 |
| 4 | JGI24738J21930_10040683 | 3300002075 | Bacteria | 944 |
| 5 | JGI24744J21845_10012388 | 3300002077 | Bacteria | 1731 |
| 6 | JGI25406J46586_10000043 | 3300003203 | Bacteria | 55866 |
| 7 | JGI25153J46596_10000584 | 3300003215 | Bacteria | 22421 |
| 8 | JGI25153J46596_10013457 | 3300003215 | Bacteria | 3454 |
| 9 | JGI25153J46596_10029857 | 3300003215 | Bacteria | 1864 |
| 10 | JGI25160J50197_1009475 | 3300003354 | Bacteria | 3607 |
| 11 | JGI25160J50197_1025725 | 3300003354 | Bacteria | 1639 |
| 12 | JGI25404J52841_10000584 | 3300003659 | Bacteria | 5438 |
| 13 | JGI25404J52841_10003812 | 3300003659 | Bacteria | 3013 |
| 14 | Ga0055539_1003892 | 3300003752 | Bacteria | 2028 |
| 15 | Ga0055539_1004871 | 3300003752 | Bacteria | 1770 |
| 16 | Ga0055542_1009699 | 3300003762 | Bacteria | 1801 |
| 17 | Ga0055531_10028485 | 3300003794 | Bacteria | 1925 |
| 18 | Ga0055543_1013404 | 3300004625 | Bacteria | 1621 |
| 19 | Ga0065165_1001267 | 3300005262 | Bacteria | 28574 |
| 20 | Ga0065165_1004525 | 3300005262 | Bacteria | 8527 |
| 21 | Ga0065165_1006799 | 3300005262 | Bacteria | 5841 |
| 22 | Ga0065165_1059018 | 3300005262 | Bacteria | 1057 |
| 23 | Ga0070658_10213804 | 3300005327 | Bacteria | 1629 |
| 24 | Ga0070683_100330344 | 3300005329 | Bacteria | 1451 |
| 25 | Ga0070690_100181224 | 3300005330 | Bacteria | 1456 |
| 26 | Ga0070670_100090092 | 3300005331 | Bacteria | 2636 |
| 27 | Ga0068869_100088818 | 3300005334 | Bacteria | 2320 |
| 28 | Ga0070666_10140276 | 3300005335 | Bacteria | 1683 |
| 29 | Ga0070680_100072883 | 3300005336 | Bacteria | 2823 |
| 30 | Ga0070680_100108566 | 3300005336 | Bacteria | 2309 |
| 31 | Ga0070682_100109008 | 3300005337 | Bacteria | 1842 |
| 32 | Ga0070682_100235047 | 3300005337 | Bacteria | 1313 |
| 33 | Ga0068868_100037777 | 3300005338 | Bacteria | 3745 |
| 34 | Ga0068868_100172568 | 3300005338 | Bacteria | 1790 |
| 35 | Ga0068868_100214344 | 3300005338 | Bacteria | 1610 |
| 36 | Ga0068868_100674085 | 3300005338 | Bacteria | 923 |
| 37 | Ga0070660_100002476 | 3300005339 | Bacteria | 12662 |
| 38 | Ga0070660_100198389 | 3300005339 | Bacteria | 1627 |
| 39 | Ga0070660_100463178 | 3300005339 | Bacteria | 1052 |
| 40 | Ga0070689_100061722 | 3300005340 | Bacteria | 2916 |
| 41 | Ga0070689_100398029 | 3300005340 | Bacteria | 1163 |
| 42 | Ga0070691_10113795 | 3300005341 | Bacteria | 1356 |
| 43 | Ga0070661_100330189 | 3300005344 | Bacteria | 1193 |
| 44 | Ga0070661_100484152 | 3300005344 | Bacteria | 988 |
| 45 | Ga0070692_10272411 | 3300005345 | Bacteria | 1023 |
| 46 | Ga0070668_100048131 | 3300005347 | Bacteria | 3279 |
| 47 | Ga0070669_100079970 | 3300005353 | Bacteria | 2432 |
| 48 | Ga0070675_100129332 | 3300005354 | Bacteria | 2150 |
| 49 | Ga0070671_100089161 | 3300005355 | Bacteria | 2582 |
| 50 | Ga0070671_100393849 | 3300005355 | Bacteria | 1184 |
| 51 | Ga0070674_100041788 | 3300005356 | Bacteria | 3110 |
| 52 | Ga0070688_100506884 | 3300005365 | Bacteria | 911 |
| 53 | Ga0070659_100070297 | 3300005366 | Bacteria | 2780 |
| 54 | Ga0070667_100171547 | 3300005367 | Bacteria | 1915 |
| 55 | Ga0070709_10010428 | 3300005434 | Bacteria | 5149 |
| 56 | Ga0070709_10172390 | 3300005434 | Bacteria | 1513 |
| 57 | Ga0070714_100047285 | 3300005435 | Bacteria | 3655 |
| 58 | Ga0070714_100208590 | 3300005435 | Bacteria | 1790 |
| 59 | Ga0070714_100237033 | 3300005435 | Bacteria | 1683 |
| 60 | Ga0070713_100019995 | 3300005436 | Bacteria | 5125 |
| 61 | Ga0070713_100030915 | 3300005436 | Bacteria | 4258 |
| 62 | Ga0070713_100139429 | 3300005436 | Bacteria | 2146 |
| 63 | Ga0070710_10000971 | 3300005437 | Bacteria | 13611 |
| 64 | Ga0070701_10031761 | 3300005438 | Bacteria | 2623 |
| 65 | Ga0070711_100002148 | 3300005439 | Bacteria | 11178 |
| 66 | Ga0070705_100188194 | 3300005440 | Bacteria | 1404 |
| 67 | Ga0070663_100003861 | 3300005455 | Bacteria | 8731 |
| 68 | Ga0070663_100042900 | 3300005455 | Bacteria | 3180 |
| 69 | Ga0070663_100168687 | 3300005455 | Bacteria | 1690 |
| 70 | Ga0070663_100173188 | 3300005455 | Bacteria | 1669 |
| 71 | Ga0070663_100293598 | 3300005455 | Bacteria | 1299 |
| 72 | Ga0070663_100483539 | 3300005455 | Bacteria | 1025 |
| 73 | Ga0070678_100009294 | 3300005456 | Bacteria | 5946 |
| 74 | Ga0070678_100013992 | 3300005456 | Bacteria | 5045 |
| 75 | Ga0070706_100107535 | 3300005467 | Bacteria | 2595 |
| 76 | Ga0070706_100379580 | 3300005467 | Bacteria | 1316 |
| 77 | Ga0070707_100599840 | 3300005468 | Bacteria | 1064 |
| 78 | Ga0070698_100159311 | 3300005471 | Bacteria | 2202 |
| 79 | Ga0070679_100048989 | 3300005530 | Bacteria | 4208 |
| 80 | Ga0070679_100155446 | 3300005530 | Bacteria | 2262 |
| 81 | Ga0070684_100086722 | 3300005535 | Bacteria | 2779 |
| 82 | Ga0070697_100003566 | 3300005536 | Bacteria | 11961 |
| 83 | Ga0070697_100153453 | 3300005536 | Bacteria | 1942 |
| 84 | Ga0068853_100004362 | 3300005539 | Bacteria | 10947 |
| 85 | Ga0068853_100009798 | 3300005539 | Bacteria | 7732 |
| 86 | Ga0068853_100071100 | 3300005539 | Bacteria | 3029 |
| 87 | Ga0068853_100099687 | 3300005539 | Bacteria | 2567 |
| 88 | Ga0068853_100162295 | 3300005539 | Bacteria | 2018 |
| 89 | Ga0068853_100168652 | 3300005539 | Bacteria | 1979 |
| 90 | Ga0068853_100336583 | 3300005539 | Bacteria | 1401 |
| 91 | Ga0068853_100557394 | 3300005539 | Bacteria | 1086 |
| 92 | Ga0070672_100110745 | 3300005543 | Bacteria | 2237 |
| 93 | Ga0070672_100196003 | 3300005543 | Bacteria | 1688 |
| 94 | Ga0070695_100021585 | 3300005545 | Bacteria | 3943 |
| 95 | Ga0070665_100014688 | 3300005548 | Bacteria | 7857 |
| 96 | Ga0070665_100112639 | 3300005548 | Bacteria | 2723 |
| 97 | Ga0070665_100229951 | 3300005548 | Bacteria | 1854 |
| 98 | Ga0070704_100125092 | 3300005549 | Bacteria | 1982 |
| 99 | Ga0068855_100015060 | 3300005563 | Bacteria | 9312 |
| 100 | Ga0068855_100019571 | 3300005563 | Bacteria | 8130 |
| 101 | Ga0068855_100071320 | 3300005563 | Bacteria | 4040 |
| 102 | Ga0068855_100079813 | 3300005563 | Bacteria | 3794 |
| 103 | Ga0068855_100167070 | 3300005563 | Bacteria | 2493 |
| 104 | Ga0068855_100349358 | 3300005563 | Bacteria | 1629 |
| 105 | Ga0068855_100549296 | 3300005563 | Bacteria | 1251 |
| 106 | Ga0070664_100032584 | 3300005564 | Bacteria | 4359 |
| 107 | Ga0070664_100077599 | 3300005564 | Bacteria | 2856 |
| 108 | Ga0070664_100304854 | 3300005564 | Bacteria | 1440 |
| 109 | Ga0068857_100007059 | 3300005577 | Bacteria | 9673 |
| 110 | Ga0068857_100028351 | 3300005577 | Bacteria | 4941 |
| 111 | Ga0068857_100070603 | 3300005577 | Bacteria | 3111 |
| 112 | Ga0068857_100276969 | 3300005577 | Bacteria | 1542 |
| 113 | Ga0068857_100510850 | 3300005577 | Bacteria | 1129 |
| 114 | Ga0068854_100005211 | 3300005578 | Bacteria | 8198 |
| 115 | Ga0068854_100042625 | 3300005578 | Bacteria | 3213 |
| 116 | Ga0068854_100164844 | 3300005578 | Bacteria | 1720 |
| 117 | Ga0068854_100356437 | 3300005578 | Bacteria | 1199 |
| 118 | Ga0068856_100004253 | 3300005614 | Bacteria | 14297 |
| 119 | Ga0068856_100010258 | 3300005614 | Bacteria | 9107 |
| 120 | Ga0068856_100039035 | 3300005614 | Bacteria | 4662 |
| 121 | Ga0068856_100126841 | 3300005614 | Bacteria | 2555 |
| 122 | Ga0068856_100176110 | 3300005614 | Bacteria | 2151 |
| 123 | Ga0070702_100381317 | 3300005615 | Bacteria | 1002 |
| 124 | Ga0068852_100026622 | 3300005616 | Bacteria | 4704 |
| 125 | Ga0068852_100039288 | 3300005616 | Bacteria | 3984 |
| 126 | Ga0068852_100164154 | 3300005616 | Bacteria | 2076 |
| 127 | Ga0068852_100199728 | 3300005616 | Bacteria | 1892 |
| 128 | Ga0068852_100328460 | 3300005616 | Bacteria | 1487 |
| 129 | Ga0068864_100075170 | 3300005618 | Bacteria | 2949 |
| 130 | Ga0068864_100078193 | 3300005618 | Bacteria | 2895 |
| 131 | Ga0068864_100266674 | 3300005618 | Bacteria | 1594 |
| 132 | Ga0068861_100029518 | 3300005719 | Bacteria | 4012 |
| 133 | Ga0068861_100252130 | 3300005719 | Bacteria | 1506 |
| 134 | Ga0068851_10000746 | 3300005834 | Bacteria | 13949 |
| 135 | Ga0068870_10073852 | 3300005840 | Bacteria | 1867 |
| 136 | Ga0068870_10152444 | 3300005840 | Bacteria | 1363 |
| 137 | Ga0068870_10271348 | 3300005840 | Bacteria | 1060 |
| 138 | Ga0068863_100256927 | 3300005841 | Bacteria | 1688 |
| 139 | Ga0068863_100515415 | 3300005841 | Bacteria | 1179 |
| 140 | Ga0068858_100123719 | 3300005842 | Bacteria | 2420 |
| 141 | Ga0068858_100136563 | 3300005842 | Bacteria | 2301 |
| 142 | Ga0068858_100639493 | 3300005842 | Bacteria | 1033 |
| 143 | Ga0068860_100176740 | 3300005843 | Bacteria | 2063 |
| 144 | Ga0068862_100695544 | 3300005844 | Bacteria | 984 |
| 145 | Ga0081455_10017805 | 3300005937 | Bacteria | 6792 |
| 146 | Ga0081455_10233267 | 3300005937 | Bacteria | 1357 |
| 147 | Ga0081540_1000300 | 3300005983 | Bacteria | 51023 |
| 148 | Ga0081540_1002655 | 3300005983 | Bacteria | 14544 |
| 149 | Ga0081540_1010381 | 3300005983 | Bacteria | 6314 |
| 150 | Ga0081540_1026389 | 3300005983 | Bacteria | 3317 |
| 151 | Ga0081540_1081149 | 3300005983 | Bacteria | 1460 |
| 152 | Ga0081539_10000324 | 3300005985 | Bacteria | 106549 |
| 153 | Ga0081539_10100514 | 3300005985 | Bacteria | 1475 |
| 154 | Ga0081539_10154855 | 3300005985 | Bacteria | 1099 |
| 155 | Ga0070717_10000361 | 3300006028 | Bacteria | 29296 |
| 156 | Ga0070717_10002247 | 3300006028 | Bacteria | 13537 |
| 157 | Ga0070717_10005073 | 3300006028 | Bacteria | 9602 |
| 158 | Ga0070717_10173918 | 3300006028 | Bacteria | 1874 |
| 159 | Ga0075365_10010597 | 3300006038 | Bacteria | 5378 |
| 160 | Ga0075365_10052809 | 3300006038 | Bacteria | 2690 |
| 161 | Ga0075365_10087258 | 3300006038 | Bacteria | 2121 |
| 162 | Ga0075365_10094262 | 3300006038 | Bacteria | 2043 |
| 163 | Ga0075365_10112344 | 3300006038 | Bacteria | 1873 |
| 164 | Ga0075365_10140637 | 3300006038 | Bacteria | 1675 |
| 165 | Ga0075368_10023518 | 3300006042 | Bacteria | 2354 |
| 166 | Ga0075368_10051708 | 3300006042 | Bacteria | 1633 |
| 167 | Ga0075368_10121131 | 3300006042 | Bacteria | 1083 |
| 168 | Ga0075363_100046557 | 3300006048 | Bacteria | 2302 |
| 169 | Ga0075363_100062746 | 3300006048 | Bacteria | 2004 |
| 170 | Ga0075364_10010357 | 3300006051 | Bacteria | 5629 |
| 171 | Ga0075364_10016329 | 3300006051 | Bacteria | 4616 |
| 172 | Ga0075364_10108934 | 3300006051 | Bacteria | 1848 |
| 173 | Ga0075364_10202487 | 3300006051 | Bacteria | 1346 |
| 174 | Ga0070715_10000519 | 3300006163 | Bacteria | 10085 |
| 175 | Ga0070716_100028904 | 3300006173 | Bacteria | 2991 |
| 176 | Ga0070716_100183515 | 3300006173 | Bacteria | 1376 |
| 177 | Ga0070716_100202404 | 3300006173 | Bacteria | 1321 |
| 178 | Ga0070712_100009293 | 3300006175 | Bacteria | 6194 |
| 179 | Ga0070712_100339908 | 3300006175 | Bacteria | 1225 |
| 180 | Ga0075367_10058758 | 3300006178 | Bacteria | 2289 |
| 181 | Ga0075369_10018672 | 3300006186 | Bacteria | 2825 |
| 182 | Ga0075369_10046187 | 3300006186 | Bacteria | 1874 |
| 183 | Ga0075369_10051215 | 3300006186 | Bacteria | 1787 |
| 184 | Ga0075369_10078534 | 3300006186 | Bacteria | 1461 |
| 185 | Ga0075369_10088830 | 3300006186 | Bacteria | 1377 |
| 186 | Ga0075366_10063909 | 3300006195 | Bacteria | 2188 |
| 187 | Ga0075366_10191008 | 3300006195 | Bacteria | 1244 |
| 188 | Ga0075370_10032675 | 3300006353 | Bacteria | 2910 |
| 189 | Ga0075370_10035526 | 3300006353 | Bacteria | 2797 |
| 190 | Ga0075370_10039242 | 3300006353 | Bacteria | 2667 |
| 191 | Ga0075431_100000905 | 3300006847 | Bacteria | 26143 |
| 192 | Ga0075434_100079368 | 3300006871 | Bacteria | 3278 |
| 193 | Ga0075434_100347803 | 3300006871 | Bacteria | 1503 |
| 194 | Ga0075429_100001332 | 3300006880 | Bacteria | 20163 |
| 195 | Ga0075436_100039630 | 3300006914 | Bacteria | 3251 |
| 196 | Ga0075436_100142287 | 3300006914 | Bacteria | 1686 |
| 197 | Ga0099824_1016547 | 3300006942 | Bacteria | 6652 |
| 198 | Ga0075435_100049538 | 3300007076 | Bacteria | 3379 |
| 199 | Ga0075435_100085144 | 3300007076 | Bacteria | 2602 |
| 200 | Ga0099794_10044446 | 3300007265 | Bacteria | 2123 |
| 201 | Ga0099794_10109680 | 3300007265 | Bacteria | 1382 |
| 202 | Ga0105240_10004255 | 3300009093 | Bacteria | 21889 |
| 203 | Ga0105240_10044757 | 3300009093 | Bacteria | 5620 |
| 204 | Ga0105240_10068721 | 3300009093 | Bacteria | 4387 |
| 205 | Ga0105240_10078563 | 3300009093 | Bacteria | 4063 |
| 206 | Ga0105240_10221690 | 3300009093 | Bacteria | 2203 |
| 207 | Ga0105240_10582051 | 3300009093 | Bacteria | 1235 |
| 208 | Ga0111539_10005385 | 3300009094 | Bacteria | 16547 |
| 209 | Ga0111539_10029699 | 3300009094 | Bacteria | 6654 |
| 210 | Ga0105245_10031108 | 3300009098 | Bacteria | 4721 |
| 211 | Ga0105245_10069332 | 3300009098 | Bacteria | 3197 |
| 212 | Ga0114129_10001764 | 3300009147 | Bacteria | 29487 |
| 213 | Ga0114129_10069645 | 3300009147 | Bacteria | 4903 |
| 214 | Ga0105243_10095111 | 3300009148 | Bacteria | 2461 |
| 215 | Ga0105241_10003365 | 3300009174 | Bacteria | 11909 |
| 216 | Ga0105241_10021437 | 3300009174 | Bacteria | 4775 |
| 217 | Ga0105242_10166958 | 3300009176 | Bacteria | 1931 |
| 218 | Ga0105248_10017355 | 3300009177 | Bacteria | 7934 |
| 219 | Ga0105248_10206580 | 3300009177 | Bacteria | 2213 |
| 220 | Ga0105248_10350292 | 3300009177 | Bacteria | 1663 |
| 221 | Ga0105237_10015525 | 3300009545 | Bacteria | 7923 |
| 222 | Ga0105237_10100724 | 3300009545 | Bacteria | 2880 |
| 223 | Ga0105238_10003808 | 3300009551 | Bacteria | 14985 |
| 224 | Ga0105238_10028380 | 3300009551 | Bacteria | 5703 |
| 225 | Ga0105238_10100766 | 3300009551 | Bacteria | 2871 |
| 226 | Ga0105238_10266937 | 3300009551 | Bacteria | 1692 |
| 227 | Ga0105249_10308221 | 3300009553 | Bacteria | 1590 |
| 228 | Ga0099796_10013237 | 3300010159 | Bacteria | 2351 |
| 229 | Ga0105239_10020156 | 3300010375 | Bacteria | 7356 |
| 230 | Ga0105239_10159619 | 3300010375 | Bacteria | 2518 |
| 231 | Ga0105239_10171228 | 3300010375 | Bacteria | 2428 |
| 232 | Ga0105239_10402060 | 3300010375 | Bacteria | 1550 |
| 233 | Ga0105239_10442038 | 3300010375 | Bacteria | 1475 |
| 234 | Ga0157373_10073299 | 3300013100 | Bacteria | 2416 |
| 235 | Ga0157371_10067083 | 3300013102 | Bacteria | 2540 |
| 236 | Ga0157370_10108059 | 3300013104 | Bacteria | 2602 |
| 237 | Ga0157370_10116079 | 3300013104 | Bacteria | 2501 |
| 238 | Ga0157369_10019439 | 3300013105 | Bacteria | 7599 |
| 239 | Ga0157369_10037267 | 3300013105 | Bacteria | 5323 |
| 240 | Ga0157369_10157732 | 3300013105 | Bacteria | 2396 |
| 241 | Ga0157374_10025891 | 3300013296 | Bacteria | 5273 |
| 242 | Ga0157378_10157077 | 3300013297 | Bacteria | 2124 |
| 243 | Ga0163162_10011477 | 3300013306 | Bacteria | 8639 |
| 244 | Ga0163162_10171798 | 3300013306 | Bacteria | 2292 |
| 245 | Ga0163162_10410990 | 3300013306 | Bacteria | 1486 |
| 246 | Ga0157375_10129123 | 3300013308 | Bacteria | 2646 |
| 247 | Ga0157375_10518484 | 3300013308 | Bacteria | 1355 |
| 248 | Ga0163163_10009818 | 3300014325 | Bacteria | 8576 |
| 249 | Ga0163163_10063378 | 3300014325 | Bacteria | 3665 |
| 250 | Ga0163163_10576572 | 3300014325 | Bacteria | 1188 |
| 251 | Ga0163163_10601784 | 3300014325 | Bacteria | 1162 |
| 252 | Ga0157380_10514719 | 3300014326 | Bacteria | 1166 |
| 253 | Ga0182008_10152970 | 3300014497 | Bacteria | 1158 |
| 254 | Ga0157377_10081149 | 3300014745 | Bacteria | 1896 |
| 255 | Ga0157377_10097753 | 3300014745 | Bacteria | 1744 |
| 256 | Ga0157379_10106356 | 3300014968 | Bacteria | 2519 |
| 257 | Ga0157376_10007833 | 3300014969 | Bacteria | 7658 |
| 258 | Ga0182006_1082003 | 3300015261 | Bacteria | 1175 |
| 259 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 260 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 261 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 262 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 263 | Ga0213876_10101072 | 3300021384 | Bacteria | 1529 |
| 264 | Ga0213876_10268985 | 3300021384 | Bacteria | 906 |
| 265 | Ga0213875_10007731 | 3300021388 | Bacteria | 5531 |
| 266 | Ga0213875_10054936 | 3300021388 | Bacteria | 1865 |
| 267 | Ga0209563_101359 | 3300025230 | Bacteria | 6635 |
| 268 | Ga0207425_1014810 | 3300025245 | Bacteria | 1765 |
| 269 | Ga0209677_100233 | 3300025253 | Bacteria | 39376 |
| 270 | Ga0209677_103592 | 3300025253 | Bacteria | 4916 |
| 271 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 272 | Ga0209233_1003521 | 3300025261 | Bacteria | 5502 |
| 273 | Ga0209233_1004158 | 3300025261 | Bacteria | 4979 |
| 274 | Ga0209455_1002812 | 3300025272 | Bacteria | 6477 |
| 275 | Ga0209455_1007018 | 3300025272 | Bacteria | 3243 |
| 276 | Ga0209455_1008185 | 3300025272 | Bacteria | 2868 |
| 277 | Ga0209455_1009485 | 3300025272 | Bacteria | 2553 |
| 278 | Ga0209673_1064359 | 3300025273 | Bacteria | 900 |
| 279 | Ga0209564_1000397 | 3300025295 | Bacteria | 77778 |
| 280 | Ga0209564_1028802 | 3300025295 | Bacteria | 1764 |
| 281 | Ga0209564_1036007 | 3300025295 | Bacteria | 1421 |
| 282 | Ga0209758_1000595 | 3300025297 | Bacteria | 56364 |
| 283 | Ga0209758_1000604 | 3300025297 | Bacteria | 55558 |
| 284 | Ga0209758_1000767 | 3300025297 | Bacteria | 46198 |
| 285 | Ga0209758_1001054 | 3300025297 | Bacteria | 36110 |
| 286 | Ga0209758_1004139 | 3300025297 | Bacteria | 12373 |
| 287 | Ga0209758_1004893 | 3300025297 | Bacteria | 10773 |
| 288 | Ga0209758_1010620 | 3300025297 | Bacteria | 5480 |
| 289 | Ga0209758_1012657 | 3300025297 | Bacteria | 4694 |
| 290 | Ga0209256_1004224 | 3300025299 | Bacteria | 9210 |
| 291 | Ga0207426_1000500 | 3300025302 | Bacteria | 58181 |
| 292 | Ga0207426_1004976 | 3300025302 | Bacteria | 6263 |
| 293 | Ga0207426_1034891 | 3300025302 | Bacteria | 1610 |
| 294 | Ga0207426_1043155 | 3300025302 | Bacteria | 1387 |
| 295 | Ga0209257_1009208 | 3300025304 | Bacteria | 5360 |
| 296 | Ga0209257_1045053 | 3300025304 | Bacteria | 1283 |
| 297 | Ga0207697_10065973 | 3300025315 | Bacteria | 1511 |
| 298 | Ga0207656_10029528 | 3300025321 | Bacteria | 2259 |
| 299 | Ga0207656_10128738 | 3300025321 | Bacteria | 1184 |
| 300 | Ga0207656_10138617 | 3300025321 | Bacteria | 1145 |
| 301 | Ga0207653_10074199 | 3300025885 | Bacteria | 1167 |
| 302 | Ga0207692_10001068 | 3300025898 | Bacteria | 10024 |
| 303 | Ga0207710_10039124 | 3300025900 | Bacteria | 2098 |
| 304 | Ga0207688_10050908 | 3300025901 | Bacteria | 2320 |
| 305 | Ga0207688_10253643 | 3300025901 | Bacteria | 1066 |
| 306 | Ga0207647_10012297 | 3300025904 | Bacteria | 5963 |
| 307 | Ga0207647_10059208 | 3300025904 | Bacteria | 2344 |
| 308 | Ga0207647_10079655 | 3300025904 | Bacteria | 1966 |
| 309 | Ga0207647_10155228 | 3300025904 | Bacteria | 1337 |
| 310 | Ga0207647_10232405 | 3300025904 | Bacteria | 1061 |
| 311 | Ga0207685_10017980 | 3300025905 | Bacteria | 2299 |
| 312 | Ga0207685_10061918 | 3300025905 | Bacteria | 1485 |
| 313 | Ga0207699_10005006 | 3300025906 | Bacteria | 6338 |
| 314 | Ga0207699_10350203 | 3300025906 | Bacteria | 1042 |
| 315 | Ga0207645_10060303 | 3300025907 | Bacteria | 2422 |
| 316 | Ga0207645_10177475 | 3300025907 | Bacteria | 1397 |
| 317 | Ga0207643_10046638 | 3300025908 | Bacteria | 2450 |
| 318 | Ga0207643_10066630 | 3300025908 | Bacteria | 2065 |
| 319 | Ga0207705_10083979 | 3300025909 | Bacteria | 2324 |
| 320 | Ga0207684_10086257 | 3300025910 | Bacteria | 2674 |
| 321 | Ga0207654_10002385 | 3300025911 | Bacteria | 9615 |
| 322 | Ga0207654_10280472 | 3300025911 | Bacteria | 1127 |
| 323 | Ga0207654_10331582 | 3300025911 | Bacteria | 1043 |
| 324 | Ga0207707_10003099 | 3300025912 | Bacteria | 14754 |
| 325 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 326 | Ga0207695_10000579 | 3300025913 | Bacteria | 74637 |
| 327 | Ga0207695_10194070 | 3300025913 | Bacteria | 1947 |
| 328 | Ga0207695_10214399 | 3300025913 | Bacteria | 1835 |
| 329 | Ga0207671_10023035 | 3300025914 | Bacteria | 4700 |
| 330 | Ga0207671_10073633 | 3300025914 | Bacteria | 2552 |
| 331 | Ga0207671_10204781 | 3300025914 | Bacteria | 1542 |
| 332 | Ga0207693_10020689 | 3300025915 | Bacteria | 5233 |
| 333 | Ga0207693_10021940 | 3300025915 | Bacteria | 5076 |
| 334 | Ga0207663_10000229 | 3300025916 | Bacteria | 24720 |
| 335 | Ga0207660_10006884 | 3300025917 | Bacteria | 7359 |
| 336 | Ga0207660_10030192 | 3300025917 | Bacteria | 3724 |
| 337 | Ga0207657_10014727 | 3300025919 | Bacteria | 7615 |
| 338 | Ga0207657_10018024 | 3300025919 | Bacteria | 6754 |
| 339 | Ga0207657_10089154 | 3300025919 | Bacteria | 2577 |
| 340 | Ga0207657_10207014 | 3300025919 | Bacteria | 1576 |
| 341 | Ga0207649_10184282 | 3300025920 | Bacteria | 1463 |
| 342 | Ga0207649_10313128 | 3300025920 | Bacteria | 1151 |
| 343 | Ga0207649_10353362 | 3300025920 | Bacteria | 1088 |
| 344 | Ga0207652_10002148 | 3300025921 | Bacteria | 16913 |
| 345 | Ga0207652_10087976 | 3300025921 | Bacteria | 2724 |
| 346 | Ga0207652_10144479 | 3300025921 | Bacteria | 2128 |
| 347 | Ga0207646_10119519 | 3300025922 | Bacteria | 2367 |
| 348 | Ga0207646_10587648 | 3300025922 | Bacteria | 1000 |
| 349 | Ga0207694_10001208 | 3300025924 | Bacteria | 22407 |
| 350 | Ga0207694_10007559 | 3300025924 | Bacteria | 8238 |
| 351 | Ga0207694_10045004 | 3300025924 | Bacteria | 3409 |
| 352 | Ga0207694_10123561 | 3300025924 | Bacteria | 2068 |
| 353 | Ga0207650_10068179 | 3300025925 | Bacteria | 2671 |
| 354 | Ga0207650_10118742 | 3300025925 | Bacteria | 2056 |
| 355 | Ga0207659_10067361 | 3300025926 | Bacteria | 2600 |
| 356 | Ga0207687_10062803 | 3300025927 | Bacteria | 2628 |
| 357 | Ga0207687_10143028 | 3300025927 | Bacteria | 1817 |
| 358 | Ga0207687_10459442 | 3300025927 | Bacteria | 1057 |
| 359 | Ga0207700_10021207 | 3300025928 | Bacteria | 4431 |
| 360 | Ga0207700_10062861 | 3300025928 | Bacteria | 2821 |
| 361 | Ga0207700_10250854 | 3300025928 | Bacteria | 1512 |
| 362 | Ga0207664_10048616 | 3300025929 | Bacteria | 3336 |
| 363 | Ga0207664_10054648 | 3300025929 | Bacteria | 3165 |
| 364 | Ga0207664_10090815 | 3300025929 | Bacteria | 2503 |
| 365 | Ga0207664_10144782 | 3300025929 | Bacteria | 2014 |
| 366 | Ga0207664_10186700 | 3300025929 | Bacteria | 1783 |
| 367 | Ga0207664_10189046 | 3300025929 | Bacteria | 1772 |
| 368 | Ga0207644_10070670 | 3300025931 | Bacteria | 2552 |
| 369 | Ga0207644_10133935 | 3300025931 | Bacteria | 1901 |
| 370 | Ga0207644_10575699 | 3300025931 | Bacteria | 933 |
| 371 | Ga0207690_10041632 | 3300025932 | Bacteria | 3011 |
| 372 | Ga0207690_10387413 | 3300025932 | Bacteria | 1112 |
| 373 | Ga0207706_10160637 | 3300025933 | Bacteria | 1975 |
| 374 | Ga0207706_10387338 | 3300025933 | Bacteria | 1213 |
| 375 | Ga0207686_10149700 | 3300025934 | Bacteria | 1623 |
| 376 | Ga0207709_10036879 | 3300025935 | Bacteria | 2901 |
| 377 | Ga0207709_10117907 | 3300025935 | Bacteria | 1787 |
| 378 | Ga0207709_10229494 | 3300025935 | Bacteria | 1344 |
| 379 | Ga0207669_10001419 | 3300025937 | Bacteria | 10207 |
| 380 | Ga0207669_10037824 | 3300025937 | Bacteria | 2773 |
| 381 | Ga0207704_10171336 | 3300025938 | Bacteria | 1557 |
| 382 | Ga0207704_10530530 | 3300025938 | Bacteria | 954 |
| 383 | Ga0207665_10016623 | 3300025939 | Bacteria | 4834 |
| 384 | Ga0207665_10076188 | 3300025939 | Bacteria | 2299 |
| 385 | Ga0207665_10185180 | 3300025939 | Bacteria | 1510 |
| 386 | Ga0207665_10194915 | 3300025939 | Bacteria | 1474 |
| 387 | Ga0207665_10293523 | 3300025939 | Bacteria | 1213 |
| 388 | Ga0207691_10059792 | 3300025940 | Bacteria | 3464 |
| 389 | Ga0207691_10174355 | 3300025940 | Bacteria | 1882 |
| 390 | Ga0207711_10058323 | 3300025941 | Bacteria | 3322 |
| 391 | Ga0207689_10128989 | 3300025942 | Bacteria | 2081 |
| 392 | Ga0207661_10109127 | 3300025944 | Bacteria | 2337 |
| 393 | Ga0207661_10179767 | 3300025944 | Bacteria | 1847 |
| 394 | Ga0207679_10054782 | 3300025945 | Bacteria | 2937 |
| 395 | Ga0207667_10001989 | 3300025949 | Bacteria | 25637 |
| 396 | Ga0207667_10007912 | 3300025949 | Bacteria | 12694 |
| 397 | Ga0207667_10018590 | 3300025949 | Bacteria | 7789 |
| 398 | Ga0207667_10026463 | 3300025949 | Bacteria | 6337 |
| 399 | Ga0207667_10066955 | 3300025949 | Bacteria | 3742 |
| 400 | Ga0207667_10119112 | 3300025949 | Bacteria | 2721 |
| 401 | Ga0207667_10388639 | 3300025949 | Bacteria | 1421 |
| 402 | Ga0207667_10733389 | 3300025949 | Bacteria | 988 |
| 403 | Ga0207651_10253449 | 3300025960 | Bacteria | 1441 |
| 404 | Ga0207651_10255622 | 3300025960 | Bacteria | 1436 |
| 405 | Ga0207651_10446024 | 3300025960 | Bacteria | 1109 |
| 406 | Ga0207712_10113636 | 3300025961 | Bacteria | 2035 |
| 407 | Ga0207668_10081235 | 3300025972 | Bacteria | 2350 |
| 408 | Ga0207668_10357051 | 3300025972 | Bacteria | 1223 |
| 409 | Ga0207640_10010676 | 3300025981 | Bacteria | 5180 |
| 410 | Ga0207640_10321188 | 3300025981 | Bacteria | 1233 |
| 411 | Ga0207640_10401963 | 3300025981 | Bacteria | 1116 |
| 412 | Ga0207640_10408574 | 3300025981 | Bacteria | 1108 |
| 413 | Ga0207677_10022070 | 3300026023 | Bacteria | 3904 |
| 414 | Ga0207677_10166956 | 3300026023 | Bacteria | 1716 |
| 415 | Ga0207677_10175047 | 3300026023 | Bacteria | 1682 |
| 416 | Ga0207703_10037399 | 3300026035 | Bacteria | 3866 |
| 417 | Ga0207703_10118694 | 3300026035 | Bacteria | 2268 |
| 418 | Ga0207703_10369690 | 3300026035 | Bacteria | 1324 |
| 419 | Ga0207703_10437086 | 3300026035 | Bacteria | 1220 |
| 420 | Ga0207703_10503678 | 3300026035 | Bacteria | 1137 |
| 421 | Ga0207703_10861325 | 3300026035 | Bacteria | 867 |
| 422 | Ga0207639_10007424 | 3300026041 | Bacteria | 7476 |
| 423 | Ga0207639_10011300 | 3300026041 | Bacteria | 6197 |
| 424 | Ga0207639_10082192 | 3300026041 | Bacteria | 2553 |
| 425 | Ga0207639_10132396 | 3300026041 | Bacteria | 2066 |
| 426 | Ga0207639_10295170 | 3300026041 | Bacteria | 1431 |
| 427 | Ga0207639_10306945 | 3300026041 | Bacteria | 1404 |
| 428 | Ga0207678_10047069 | 3300026067 | Bacteria | 3730 |
| 429 | Ga0207678_10048642 | 3300026067 | Bacteria | 3665 |
| 430 | Ga0207678_10051786 | 3300026067 | Bacteria | 3543 |
| 431 | Ga0207678_10081217 | 3300026067 | Bacteria | 2775 |
| 432 | Ga0207678_10175431 | 3300026067 | Bacteria | 1830 |
| 433 | Ga0207678_10230307 | 3300026067 | Bacteria | 1586 |
| 434 | Ga0207678_10251447 | 3300026067 | Bacteria | 1514 |
| 435 | Ga0207678_10436092 | 3300026067 | Bacteria | 1137 |
| 436 | Ga0207708_10058337 | 3300026075 | Bacteria | 2945 |
| 437 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 438 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 439 | Ga0207702_10033789 | 3300026078 | Bacteria | 4273 |
| 440 | Ga0207702_10060371 | 3300026078 | Bacteria | 3232 |
| 441 | Ga0207702_10231573 | 3300026078 | Bacteria | 1727 |
| 442 | Ga0207641_10188063 | 3300026088 | Bacteria | 1896 |
| 443 | Ga0207641_10278315 | 3300026088 | Bacteria | 1573 |
| 444 | Ga0207648_10400720 | 3300026089 | Bacteria | 1243 |
| 445 | Ga0207648_10400811 | 3300026089 | Bacteria | 1243 |
| 446 | Ga0207676_10105287 | 3300026095 | Bacteria | 2348 |
| 447 | Ga0207676_10157516 | 3300026095 | Bacteria | 1964 |
| 448 | Ga0207676_10528037 | 3300026095 | Bacteria | 1124 |
| 449 | Ga0207676_10541473 | 3300026095 | Bacteria | 1111 |
| 450 | Ga0207674_10007573 | 3300026116 | Bacteria | 12652 |
| 451 | Ga0207674_10022325 | 3300026116 | Bacteria | 6796 |
| 452 | Ga0207674_10042067 | 3300026116 | Bacteria | 4722 |
| 453 | Ga0207674_10095559 | 3300026116 | Bacteria | 2958 |
| 454 | Ga0207674_10112822 | 3300026116 | Bacteria | 2692 |
| 455 | Ga0207674_10474263 | 3300026116 | Bacteria | 1209 |
| 456 | Ga0207674_10708123 | 3300026116 | Bacteria | 972 |
| 457 | Ga0207675_100481199 | 3300026118 | Bacteria | 1234 |
| 458 | Ga0207675_100505394 | 3300026118 | Bacteria | 1204 |
| 459 | Ga0207683_10018157 | 3300026121 | Bacteria | 5999 |
| 460 | Ga0207683_10107416 | 3300026121 | Bacteria | 2497 |
| 461 | Ga0207683_10268995 | 3300026121 | Bacteria | 1557 |
| 462 | Ga0207698_10013764 | 3300026142 | Bacteria | 5352 |
| 463 | Ga0207698_10031103 | 3300026142 | Bacteria | 3849 |
| 464 | Ga0207698_10104451 | 3300026142 | Bacteria | 2357 |
| 465 | Ga0207698_10797528 | 3300026142 | Bacteria | 946 |
| 466 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 467 | Ga0209389_1000070 | 3300027296 | Bacteria | 97498 |
| 468 | Ga0209589_1000420 | 3300027357 | Bacteria | 58471 |
| 469 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 470 | Ga0209489_100196 | 3300027361 | Bacteria | 97498 |
| 471 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 472 | Ga0209588_1029138 | 3300027671 | Bacteria | 1760 |
| 473 | Ga0209813_10035175 | 3300027866 | Bacteria | 1498 |
| 474 | Ga0209813_10039720 | 3300027866 | Bacteria | 1427 |
| 475 | Ga0207428_10039711 | 3300027907 | Bacteria | 3821 |
| 476 | Ga0207428_10193448 | 3300027907 | Bacteria | 1533 |
| 477 | Ga0268266_10002343 | 3300028379 | Bacteria | 20488 |
| 478 | Ga0268266_10006350 | 3300028379 | Bacteria | 10834 |
| 479 | Ga0268266_10024634 | 3300028379 | Bacteria | 5119 |
| 480 | Ga0268266_10062684 | 3300028379 | Bacteria | 3209 |
| 481 | Ga0268266_10249547 | 3300028379 | Bacteria | 1641 |
| 482 | Ga0268266_10461525 | 3300028379 | Bacteria | 1208 |
| 483 | Ga0268266_10466119 | 3300028379 | Bacteria | 1202 |
| 484 | Ga0268265_10039667 | 3300028380 | Bacteria | 3472 |
| 485 | Ga0268265_10359950 | 3300028380 | Bacteria | 1331 |
| 486 | Ga0268265_10921176 | 3300028380 | Bacteria | 859 |
| 487 | Ga0268264_10104745 | 3300028381 | Bacteria | 2466 |
| 488 | Ga0268264_10546741 | 3300028381 | Bacteria | 1135 |
| 489 | Ga0265334_10008193 | 3300028573 | Bacteria | 4451 |
| 490 | Ga0265323_10035465 | 3300028653 | Bacteria | 1838 |
| 491 | Ga0265322_10027844 | 3300028654 | Bacteria | 1615 |
| 492 | Ga0265336_10039885 | 3300028666 | Bacteria | 1438 |
| 493 | Ga0307517_10007290 | 3300028786 | Bacteria | 16162 |
| 494 | Ga0307517_10265496 | 3300028786 | Bacteria | 992 |
| 495 | Ga0307517_10301404 | 3300028786 | Bacteria | 898 |
| 496 | Ga0307515_10037579 | 3300028794 | Bacteria | 7781 |
| 497 | Ga0265338_10000271 | 3300028800 | Bacteria | 94819 |
| 498 | Ga0265330_10055583 | 3300031235 | Bacteria | 1728 |
| 499 | Ga0265330_10082420 | 3300031235 | Bacteria | 1385 |
| 500 | Ga0265332_10004083 | 3300031238 | Bacteria | 6926 |
| 501 | Ga0265332_10011711 | 3300031238 | Bacteria | 3896 |
| 502 | Ga0265340_10004004 | 3300031247 | Bacteria | 8281 |
| 503 | Ga0265339_10030336 | 3300031249 | Bacteria | 3062 |
| 504 | Ga0265331_10088418 | 3300031250 | Bacteria | 1433 |
| 505 | Ga0265316_10141170 | 3300031344 | Bacteria | 1809 |
| 506 | Ga0307513_10117127 | 3300031456 | Bacteria | 2642 |
| 507 | Ga0307513_10231530 | 3300031456 | Bacteria | 1660 |
| 508 | Ga0307509_10389308 | 3300031507 | Bacteria | 1104 |
| 509 | Ga0307408_100260154 | 3300031548 | Bacteria | 1436 |
| 510 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 511 | Ga0265314_10002529 | 3300031711 | Bacteria | 18595 |
| 512 | Ga0265314_10130938 | 3300031711 | Bacteria | 1565 |
| 513 | Ga0265314_10134029 | 3300031711 | Bacteria | 1541 |
| 514 | Ga0265342_10096814 | 3300031712 | Bacteria | 1686 |
| 515 | Ga0265342_10126168 | 3300031712 | Bacteria | 1437 |
| 516 | Ga0307516_10031409 | 3300031730 | Bacteria | 5352 |
| 517 | Ga0307516_10232934 | 3300031730 | Bacteria | 1544 |
| 518 | Ga0307413_10114291 | 3300031824 | Bacteria | 1814 |
| 519 | Ga0307406_10138959 | 3300031901 | Bacteria | 1717 |
| 520 | Ga0307412_10019954 | 3300031911 | Bacteria | 4070 |
| 521 | Ga0307409_100395125 | 3300031995 | Bacteria | 1319 |
| 522 | Ga0307411_10033487 | 3300032005 | Bacteria | 3187 |
| 523 | Ga0307411_10551584 | 3300032005 | Bacteria | 983 |
| 524 | Ga0307415_100049205 | 3300032126 | Bacteria | 2849 |
| 525 | Ga0307415_100405779 | 3300032126 | Bacteria | 1165 |
| 526 | Ga0307415_100577593 | 3300032126 | Bacteria | 996 |
| 527 | Ga0307510_10015785 | 3300033180 | Bacteria | 8928 |
| 528 | Ga0307510_10263892 | 3300033180 | Bacteria | 1202 |
| 529 | Ga0316215_1001986 | 3300033544 | Bacteria | 1939 |
| 530 | Ga0373934_0000917 | 3300035086 | Bacteria | 10657 |
| 531 | Ga0373934_0032152 | 3300035086 | Bacteria | 2057 |
| 532 | Ga0373952_0017543 | 3300035092 | Bacteria | 1470 |
| 533 | Ga0373923_0022875 | 3300035111 | Bacteria | 2454 |
| 534 | Ga0373923_0061944 | 3300035111 | Bacteria | 1591 |
| 535 | Ga0373936_0014676 | 3300035113 | Bacteria | 2997 |
| 536 | Ga0373941_0051377 | 3300035115 | Bacteria | 1311 |
| 537 | Ga0373945_0007452 | 3300035116 | Bacteria | 3548 |
| 538 | Ga0373953_0059246 | 3300035117 | Bacteria | 1563 |
| 539 | Ga0373954_0024987 | 3300035118 | Bacteria | 2727 |
| 540 | Ga0373954_0031917 | 3300035118 | Bacteria | 2433 |
| 541 | Ga0373954_0036481 | 3300035118 | Bacteria | 2282 |
| 542 | Ga0373956_0027948 | 3300035119 | Bacteria | 2452 |
| 543 | Ga0373956_0131220 | 3300035119 | Bacteria | 1173 |
| 544 | Ga0373957_0013357 | 3300035120 | Bacteria | 2785 |
| 545 | Ga0373943_0001395 | 3300035170 | Bacteria | 10885 |
| 546 | Ga0373943_0078315 | 3300035170 | Bacteria | 1690 |
| 547 | Ga0373943_0112434 | 3300035170 | Bacteria | 1438 |
| 548 | Ga0373946_0085040 | 3300035171 | Bacteria | 1392 |
| 549 | Ga0373955_0070619 | 3300035172 | Bacteria | 1951 |
| 550 | Ga0373924_0011735 | 3300035410 | Bacteria | 3259 |
| 551 | Ga0373931_0129764 | 3300035691 | Bacteria | 1449 |
| 552 | Ga0373931_0143771 | 3300035691 | Bacteria | 1384 |
| 553 | Ga0373935_0001273 | 3300035692 | Bacteria | 13895 |
| 554 | Ga0373935_0041463 | 3300035692 | Bacteria | 2892 |
| 555 | Ga0373935_0043548 | 3300035692 | Bacteria | 2825 |
| 556 | Ga0373927_0000792 | 3300035695 | Bacteria | 24123 |
| 557 | Ga0373927_0011161 | 3300035695 | Bacteria | 5983 |
| 558 | Ga0373927_0012663 | 3300035695 | Bacteria | 5611 |
| 559 | Ga0373927_0038479 | 3300035695 | Bacteria | 3105 |
| 560 | Ga0373927_0051353 | 3300035695 | Bacteria | 2666 |
| 561 | Ga0373927_0116986 | 3300035695 | Bacteria | 1738 |
| 562 | Ga0373927_0278256 | 3300035695 | Bacteria | 1101 |
| 563 | Ga0373933_0000777 | 3300035724 | Bacteria | 19461 |
| 564 | Ga0373933_0001270 | 3300035724 | Bacteria | 14897 |
| 565 | Ga0373933_0028392 | 3300035724 | Bacteria | 3227 |
| 566 | Ga0373933_0034488 | 3300035724 | Bacteria | 2950 |
| 567 | Ga0373933_0377967 | 3300035724 | Bacteria | 922 |
| 568 | Ga0373947_0002479 | 3300035725 | Bacteria | 11100 |
| 569 | Ga0373947_0048876 | 3300035725 | Bacteria | 2539 |
| 570 | Ga0373947_0098616 | 3300035725 | Bacteria | 1833 |
| 571 | Ga0373947_0120371 | 3300035725 | Bacteria | 1667 |
| 572 | Ga0373947_0145851 | 3300035725 | Bacteria | 1521 |
| 573 | Ga0373947_0300029 | 3300035725 | Bacteria | 1071 |
| 574 | Ga0373937_0002152 | 3300036401 | Bacteria | 16491 |
| 575 | Ga0373937_0288799 | 3300036401 | Bacteria | 1549 |
| 576 | Ga0373925_0025224 | 3300037068 | Bacteria | 4341 |
| 577 | Ga0373925_0033683 | 3300037068 | Bacteria | 3774 |
| 578 | Ga0373925_0103159 | 3300037068 | Bacteria | 2195 |
| 579 | Ga0373925_0424248 | 3300037068 | Bacteria | 1087 |
| 580 | Ga0395899_0016833 | 3300037312 | Bacteria | 5574 |
| 581 | Ga0395899_0062406 | 3300037312 | Bacteria | 2744 |
| 582 | Ga0395900_0001526 | 3300037418 | Bacteria | 27536 |
| 583 | Ga0395900_0005676 | 3300037418 | Bacteria | 13049 |
| 584 | Ga0395900_0303838 | 3300037418 | Bacteria | 1581 |
| 585 | Ga0395900_0536575 | 3300037418 | Bacteria | 1116 |
| 586 | Ga0395900_0716042 | 3300037418 | Bacteria | 933 |
| 587 | Ga0395898_0020602 | 3300037466 | Bacteria | 6698 |
| 588 | Ga0395898_0038432 | 3300037466 | Bacteria | 4744 |
| 589 | Ga0395898_0148304 | 3300037466 | Bacteria | 2245 |
| 590 | Ga0395898_0157428 | 3300037466 | Bacteria | 2172 |
| 591 | Ga0395898_0505367 | 3300037466 | Bacteria | 1149 |
| 592 | Ga0395905_0020395 | 3300037471 | Bacteria | 6280 |
| 593 | Ga0395905_0168777 | 3300037471 | Bacteria | 2056 |
| 594 | Ga0395905_0206719 | 3300037471 | Bacteria | 1840 |
| 595 | Ga0395905_0426158 | 3300037471 | Bacteria | 1223 |
| 596 | Ga0436364_0209995 | 3300037853 | Bacteria | 1521 |
| 597 | Ga0436364_0746919 | 3300037853 | Bacteria | 7051 |
| 598 | Ga0436364_0802399 | 3300037853 | Bacteria | 1892 |
| 599 | Ga0436364_1499429 | 3300037853 | Bacteria | 2173 |
| 600 | Ga0395901_0074399 | 3300038443 | Bacteria | 3544 |
| 601 | Ga0395901_0167652 | 3300038443 | Bacteria | 2305 |
| 602 | Ga0395901_0212623 | 3300038443 | Bacteria | 2024 |
| 603 | Ga0395901_0252899 | 3300038443 | Bacteria | 1835 |
| 604 | Ga0395901_0348137 | 3300038443 | Bacteria | 1529 |
| 605 | Ga0395901_0618847 | 3300038443 | Bacteria | 1090 |
| 606 | Ga0400489_18067 | 3300039093 | Bacteria | 4134 |
| 607 | Ga0436365_0085684 | 3300039437 | Bacteria | 1040 |
| 608 | Ga0436365_0414081 | 3300039437 | Bacteria | 2224 |
| 609 | Ga0436365_0693364 | 3300039437 | Bacteria | 1378 |
| 610 | Ga0436365_0838189 | 3300039437 | Bacteria | 1696 |
| 611 | Ga0436365_1703855 | 3300039437 | Bacteria | 2415 |
| 612 | Ga0436363_1076359 | 3300039450 | Bacteria | 2121 |
| 613 | Ga0436362_1231827 | 3300039453 | Bacteria | 7272 |
| 614 | Ga0439465_0048560 | 3300041413 | Bacteria | 1385 |
| 615 | Ga0451793_0924719 | 3300041452 | Bacteria | 1293 |
| 616 | Ga0451795_1297581 | 3300041456 | Bacteria | 2019 |
| 617 | Ga0451800_1299000 | 3300041459 | Bacteria | 1855 |
| 618 | Ga0451807_0007667 | 3300041486 | Bacteria | 2069 |
| 619 | Ga0451843_0556862 | 3300041509 | Bacteria | 807 |
| 620 | Ga0451853_3984790 | 3300041512 | Bacteria | 1400 |
| 621 | Ga0439445_0028170 | 3300042004 | Bacteria | 1447 |
| 622 | Ga0439464_0022423 | 3300042439 | Bacteria | 1739 |
| 623 | Ga0466969_0053098 | 3300044656 | Bacteria | 1990 |
| 624 | Ga0466972_0000203 | 3300044658 | Bacteria | 43529 |
| 625 | Ga0466972_0053365 | 3300044658 | Bacteria | 1946 |
| 626 | Ga0466965_0013246 | 3300044683 | Bacteria | 3888 |
| 627 | Ga0466966_0001755 | 3300044684 | Bacteria | 14042 |
| 628 | Ga0466966_0100010 | 3300044684 | Bacteria | 1794 |
| 629 | Ga0466961_0000095 | 3300044693 | Bacteria | 56814 |
| 630 | Ga0466963_0004305 | 3300044694 | Bacteria | 8258 |
| 631 | Ga0466963_0015395 | 3300044694 | Bacteria | 4735 |
| 632 | Ga0466964_0053133 | 3300044706 | Bacteria | 1667 |
| 633 | Ga0466968_0029483 | 3300044735 | Bacteria | 2269 |
| 634 | Ga0466970_0031601 | 3300044765 | Bacteria | 2797 |
| 635 | Ga0466970_0085030 | 3300044765 | Bacteria | 1713 |
| 636 | Ga0466970_0093115 | 3300044765 | Bacteria | 1637 |
| 637 | Ga0466957_0222147 | 3300044842 | Bacteria | 1248 |
| 638 | Ga0466960_0027321 | 3300044901 | Bacteria | 2601 |
| 639 | Ga0466959_0011974 | 3300045049 | Bacteria | 6255 |
| 640 | Ga0466959_0334709 | 3300045049 | Bacteria | 1033 |
| 641 | Ga0466967_0025660 | 3300045976 | Bacteria | 4862 |
| 642 | Ga0466967_0291543 | 3300045976 | Bacteria | 1568 |
| 643 | Ga0466967_0400970 | 3300045976 | Bacteria | 1335 |
| 644 | Ga0466967_0563760 | 3300045976 | Bacteria | 1122 |
| 645 | Ga0495617_094833 | 3300046452 | Bacteria | 972 |
| 646 | Ga0495627_018888 | 3300046453 | Bacteria | 2318 |
| 647 | Ga0495592_0002895 | 3300046454 | Bacteria | 12206 |
| 648 | Ga0495592_0056639 | 3300046454 | Bacteria | 2896 |
| 649 | Ga0495603_0001835 | 3300046455 | Bacteria | 12523 |
| 650 | Ga0495603_0019231 | 3300046455 | Bacteria | 4135 |
| 651 | Ga0495603_0030103 | 3300046455 | Bacteria | 3271 |
| 652 | Ga0495603_0045295 | 3300046455 | Bacteria | 2623 |
| 653 | Ga0495603_0172677 | 3300046455 | Bacteria | 1252 |
| 654 | Ga0495603_0176566 | 3300046455 | Bacteria | 1236 |
| 655 | Ga0495590_0151584 | 3300046457 | Bacteria | 840 |
| 656 | Ga0495591_032611 | 3300046458 | Bacteria | 1549 |
| 657 | Ga0495629_0001441 | 3300046459 | Bacteria | 18767 |
| 658 | Ga0495629_0007128 | 3300046459 | Bacteria | 8237 |
| 659 | Ga0495629_0013674 | 3300046459 | Bacteria | 5856 |
| 660 | Ga0495629_0037539 | 3300046459 | Bacteria | 3415 |
| 661 | Ga0495629_0120018 | 3300046459 | Bacteria | 1832 |
| 662 | Ga0495629_0246941 | 3300046459 | Bacteria | 1228 |
| 663 | Ga0495629_0353429 | 3300046459 | Bacteria | 1002 |
| 664 | Ga0495638_0004327 | 3300046460 | Bacteria | 10767 |
| 665 | Ga0495638_0030841 | 3300046460 | Bacteria | 3447 |
| 666 | Ga0495641_0003725 | 3300046461 | Bacteria | 11224 |
| 667 | Ga0495641_0134744 | 3300046461 | Bacteria | 1103 |
| 668 | Ga0495651_0019778 | 3300046462 | Bacteria | 5220 |
| 669 | Ga0495651_0032501 | 3300046462 | Bacteria | 4069 |
| 670 | Ga0495651_0107832 | 3300046462 | Bacteria | 2063 |
| 671 | Ga0495651_0124395 | 3300046462 | Bacteria | 1890 |
| 672 | Ga0495651_0149552 | 3300046462 | Bacteria | 1685 |
| 673 | Ga0495653_0039229 | 3300046463 | Bacteria | 3711 |
| 674 | Ga0495653_0096644 | 3300046463 | Bacteria | 2147 |
| 675 | Ga0495653_0153616 | 3300046463 | Bacteria | 1606 |
| 676 | Ga0495653_0168026 | 3300046463 | Bacteria | 1517 |
| 677 | Ga0495580_0012167 | 3300046472 | Bacteria | 6614 |
| 678 | Ga0495580_0015651 | 3300046472 | Bacteria | 5715 |
| 679 | Ga0495580_0335887 | 3300046472 | Bacteria | 1025 |
| 680 | Ga0495582_0000084 | 3300046473 | Bacteria | 47752 |
| 681 | Ga0495582_0042465 | 3300046473 | Bacteria | 2504 |
| 682 | Ga0495582_0156189 | 3300046473 | Bacteria | 1296 |
| 683 | Ga0495605_0042163 | 3300046474 | Bacteria | 2270 |
| 684 | Ga0495605_0119459 | 3300046474 | Bacteria | 1196 |
| 685 | Ga0495639_0001155 | 3300046475 | Bacteria | 11924 |
| 686 | Ga0495639_0052234 | 3300046475 | Bacteria | 1860 |
| 687 | Ga0495639_0155951 | 3300046475 | Bacteria | 1103 |
| 688 | Ga0495639_0184216 | 3300046475 | Bacteria | 1017 |
| 689 | Ga0495662_0000454 | 3300046476 | Bacteria | 18465 |
| 690 | Ga0495662_0046284 | 3300046476 | Bacteria | 2101 |
| 691 | Ga0495664_0006706 | 3300046477 | Bacteria | 6369 |
| 692 | Ga0495664_0012642 | 3300046477 | Bacteria | 4782 |
| 693 | Ga0495664_0114148 | 3300046477 | Bacteria | 1632 |
| 694 | Ga0495664_0268771 | 3300046477 | Bacteria | 1030 |
| 695 | Ga0495664_0335072 | 3300046477 | Bacteria | 912 |
| 696 | Ga0495584_0158263 | 3300046491 | Bacteria | 1151 |
| 697 | Ga0495585_0078612 | 3300046492 | Bacteria | 1789 |
| 698 | Ga0495594_0001840 | 3300046499 | Bacteria | 11034 |
| 699 | Ga0495594_0036768 | 3300046499 | Bacteria | 2671 |
| 700 | Ga0495594_0092697 | 3300046499 | Bacteria | 1694 |
| 701 | Ga0495607_0127200 | 3300046501 | Bacteria | 1331 |
| 702 | Ga0495583_0084423 | 3300046506 | Bacteria | 1376 |
| 703 | Ga0495606_0013747 | 3300046507 | Bacteria | 6371 |
| 704 | Ga0495606_0017331 | 3300046507 | Bacteria | 5451 |
| 705 | Ga0495606_0140641 | 3300046507 | Bacteria | 1426 |
| 706 | Ga0495606_0144822 | 3300046507 | Bacteria | 1400 |
| 707 | Ga0495606_0151987 | 3300046507 | Bacteria | 1358 |
| 708 | Ga0495606_0227559 | 3300046507 | Bacteria | 1047 |
| 709 | Ga0495608_0018798 | 3300046511 | Bacteria | 4761 |
| 710 | Ga0495608_0044124 | 3300046511 | Bacteria | 2976 |
| 711 | Ga0495610_0030666 | 3300046512 | Bacteria | 2814 |
| 712 | Ga0495610_0120983 | 3300046512 | Bacteria | 1147 |
| 713 | Ga0495610_0157698 | 3300046512 | Bacteria | 962 |
| 714 | Ga0495616_0113772 | 3300046513 | Bacteria | 1255 |
| 715 | Ga0495618_0061125 | 3300046514 | Bacteria | 2389 |
| 716 | Ga0495620_0027058 | 3300046515 | Bacteria | 2689 |
| 717 | Ga0495628_0007687 | 3300046516 | Bacteria | 9318 |
| 718 | Ga0495628_0008644 | 3300046516 | Bacteria | 8722 |
| 719 | Ga0495628_0148463 | 3300046516 | Bacteria | 1786 |
| 720 | Ga0495630_0116733 | 3300046517 | Bacteria | 2023 |
| 721 | Ga0495630_0290947 | 3300046517 | Bacteria | 1248 |
| 722 | Ga0495631_0120697 | 3300046518 | Bacteria | 1127 |
| 723 | Ga0495632_0073862 | 3300046519 | Bacteria | 1634 |
| 724 | Ga0495632_0086538 | 3300046519 | Bacteria | 1490 |
| 725 | Ga0495637_0028466 | 3300046520 | Bacteria | 2496 |
| 726 | Ga0495643_0014330 | 3300046522 | Bacteria | 4719 |
| 727 | Ga0495643_0042279 | 3300046522 | Bacteria | 2483 |
| 728 | Ga0495643_0101130 | 3300046522 | Bacteria | 1477 |
| 729 | Ga0495643_0193385 | 3300046522 | Bacteria | 981 |
| 730 | Ga0495643_0234999 | 3300046522 | Bacteria | 862 |
| 731 | Ga0495644_0091189 | 3300046523 | Bacteria | 1150 |
| 732 | Ga0495648_0018505 | 3300046524 | Bacteria | 4927 |
| 733 | Ga0495648_0055188 | 3300046524 | Bacteria | 2396 |
| 734 | Ga0495648_0102411 | 3300046524 | Bacteria | 1577 |
| 735 | Ga0495648_0157380 | 3300046524 | Bacteria | 1178 |
| 736 | Ga0495666_0050426 | 3300046526 | Bacteria | 2001 |
| 737 | Ga0495652_0036409 | 3300046529 | Bacteria | 4280 |
| 738 | Ga0495652_0120288 | 3300046529 | Bacteria | 2096 |
| 739 | Ga0495652_0232270 | 3300046529 | Bacteria | 1378 |
| 740 | Ga0495652_0249381 | 3300046529 | Bacteria | 1316 |
| 741 | Ga0495654_0057842 | 3300046530 | Bacteria | 1872 |
| 742 | Ga0495665_0001312 | 3300046531 | Bacteria | 13267 |
| 743 | Ga0495665_0036336 | 3300046531 | Bacteria | 2630 |
| 744 | Ga0495640_0065705 | 3300046533 | Bacteria | 2448 |
| 745 | Ga0495640_0071807 | 3300046533 | Bacteria | 2321 |
| 746 | Ga0495640_0115594 | 3300046533 | Bacteria | 1748 |
| 747 | Ga0495586_0048236 | 3300046535 | Bacteria | 2301 |
| 748 | Ga0495587_0007054 | 3300046536 | Bacteria | 7293 |
| 749 | Ga0495587_0059261 | 3300046536 | Bacteria | 2247 |
| 750 | Ga0495587_0087021 | 3300046536 | Bacteria | 1808 |
| 751 | Ga0495587_0449495 | 3300046536 | Bacteria | 714 |
| 752 | Ga0495598_0047126 | 3300046537 | Bacteria | 1283 |
| 753 | Ga0495609_0011033 | 3300046538 | Bacteria | 4315 |
| 754 | Ga0495621_0062883 | 3300046539 | Bacteria | 1351 |
| 755 | Ga0495645_0054907 | 3300046543 | Bacteria | 2893 |
| 756 | Ga0495645_0083555 | 3300046543 | Bacteria | 2288 |
| 757 | Ga0495622_0003118 | 3300046557 | Bacteria | 7857 |
| 758 | Ga0495622_0013816 | 3300046557 | Bacteria | 3745 |
| 759 | Ga0495622_0013824 | 3300046557 | Bacteria | 3745 |
| 760 | Ga0495622_0213779 | 3300046557 | Bacteria | 856 |
| 761 | Ga0495633_0029685 | 3300046558 | Bacteria | 2659 |
| 762 | Ga0495633_0131655 | 3300046558 | Bacteria | 1157 |
| 763 | Ga0495667_0020060 | 3300046559 | Bacteria | 4509 |
| 764 | Ga0495656_0003634 | 3300046615 | Bacteria | 5226 |
| 765 | Ga0495656_0061103 | 3300046615 | Bacteria | 1644 |
| 766 | Ga0495668_0033714 | 3300046616 | Bacteria | 2875 |
| 767 | Ga0495668_0063261 | 3300046616 | Bacteria | 2038 |
| 768 | Ga0495668_0109174 | 3300046616 | Bacteria | 1513 |
| 769 | Ga0495668_0269517 | 3300046616 | Bacteria | 932 |
| 770 | Ga0495634_0000321 | 3300046642 | Bacteria | 46387 |
| 771 | Ga0495634_0041009 | 3300046642 | Bacteria | 3145 |
| 772 | Ga0495634_0055720 | 3300046642 | Bacteria | 2643 |
| 773 | Ga0495634_0070281 | 3300046642 | Bacteria | 2308 |
| 774 | Ga0495611_0193081 | 3300046648 | Bacteria | 950 |
| 775 | Ga0495611_0202128 | 3300046648 | Bacteria | 926 |
| 776 | Ga0495625_0013320 | 3300046660 | Bacteria | 6612 |
| 777 | Ga0495625_0324728 | 3300046660 | Bacteria | 979 |
| 778 | Ga0495625_0343776 | 3300046660 | Bacteria | 945 |
| 779 | Ga0495635_0001529 | 3300046663 | Bacteria | 15481 |
| 780 | Ga0495635_0003585 | 3300046663 | Bacteria | 10744 |
| 781 | Ga0495635_0023026 | 3300046663 | Bacteria | 4342 |
| 782 | Ga0495635_0032708 | 3300046663 | Bacteria | 3607 |
| 783 | Ga0495659_0066742 | 3300046664 | Bacteria | 1340 |
| 784 | Ga0495661_0131339 | 3300046665 | Bacteria | 1372 |
| 785 | Ga0495661_0221495 | 3300046665 | Bacteria | 980 |
| 786 | Ga0495588_0012056 | 3300046674 | Bacteria | 4076 |
| 787 | Ga0495588_0032571 | 3300046674 | Bacteria | 2627 |
| 788 | Ga0495588_0160977 | 3300046674 | Bacteria | 1187 |
| 789 | Ga0495657_0009859 | 3300046675 | Bacteria | 7207 |
| 790 | Ga0495657_0009988 | 3300046675 | Bacteria | 7160 |
| 791 | Ga0495599_0004258 | 3300046678 | Bacteria | 8453 |
| 792 | Ga0495599_0060253 | 3300046678 | Bacteria | 2373 |
| 793 | Ga0495599_0109522 | 3300046678 | Bacteria | 1721 |
| 794 | Ga0495599_0343515 | 3300046678 | Bacteria | 896 |
| 795 | Ga0495623_0025894 | 3300046679 | Bacteria | 3778 |
| 796 | Ga0495623_0111367 | 3300046679 | Bacteria | 1659 |
| 797 | Ga0495623_0226604 | 3300046679 | Bacteria | 1062 |
| 798 | Ga0495646_0004744 | 3300046680 | Bacteria | 8579 |
| 799 | Ga0495646_0025234 | 3300046680 | Bacteria | 3740 |
| 800 | Ga0495646_0067143 | 3300046680 | Bacteria | 2120 |
| 801 | Ga0495646_0070510 | 3300046680 | Bacteria | 2058 |
| 802 | Ga0495646_0141296 | 3300046680 | Bacteria | 1346 |
| 803 | Ga0495647_0008301 | 3300046681 | Bacteria | 3490 |
| 804 | Ga0495658_0002077 | 3300046683 | Bacteria | 10151 |
| 805 | Ga0495658_0008598 | 3300046683 | Bacteria | 5065 |
| 806 | Ga0495658_0143151 | 3300046683 | Bacteria | 1464 |
| 807 | Ga0495669_0025273 | 3300046684 | Bacteria | 2589 |
| 808 | Ga0495613_0003547 | 3300046689 | Bacteria | 11700 |
| 809 | Ga0495613_0059184 | 3300046689 | Bacteria | 2809 |
| 810 | Ga0495613_0190121 | 3300046689 | Bacteria | 1451 |
| 811 | Ga0495624_0001596 | 3300046690 | Bacteria | 17405 |
| 812 | Ga0495670_0014176 | 3300046691 | Bacteria | 3922 |
| 813 | Ga0495670_0029574 | 3300046691 | Bacteria | 2719 |
| 814 | Ga0495670_0079354 | 3300046691 | Bacteria | 1670 |
| 815 | Ga0495671_0050099 | 3300046692 | Bacteria | 2080 |
| 816 | Ga0495671_0131801 | 3300046692 | Bacteria | 1219 |
| 817 | Ga0495649_0118437 | 3300046694 | Bacteria | 1401 |
| 818 | Ga0495649_0184315 | 3300046694 | Bacteria | 1088 |
| 819 | Ga0495600_0039341 | 3300046809 | Bacteria | 3079 |
| 820 | Ga0495600_0043141 | 3300046809 | Bacteria | 2940 |
| 821 | Ga0495600_0122194 | 3300046809 | Bacteria | 1693 |
| 822 | Ga0495600_0133252 | 3300046809 | Bacteria | 1615 |
| 823 | Ga0495600_0181204 | 3300046809 | Bacteria | 1357 |
| 824 | Ga0495600_0329236 | 3300046809 | Bacteria | 959 |
| 825 | Ga0495600_0391125 | 3300046809 | Bacteria | 866 |
| 826 | Ga0495660_0207249 | 3300046810 | Bacteria | 932 |
| 827 | Ga0495581_0000174 | 3300047315 | Bacteria | 29174 |
| 828 | Ga0495581_0013943 | 3300047315 | Bacteria | 4662 |
| 829 | Ga0495581_0043881 | 3300047315 | Bacteria | 2586 |
| 830 | Ga0495581_0400821 | 3300047315 | Bacteria | 800 |
| 831 | Ga0495604_0006679 | 3300047317 | Bacteria | 9144 |
| 832 | Ga0495604_0028908 | 3300047317 | Bacteria | 4410 |
| 833 | Ga0495604_0178443 | 3300047317 | Bacteria | 1487 |
| 834 | Ga0495636_0071930 | 3300047318 | Bacteria | 1477 |
| 835 | Ga0495674_0012229 | 3300047319 | Bacteria | 8088 |
| 836 | Ga0495674_0028660 | 3300047319 | Bacteria | 5072 |
| 837 | Ga0495674_0032846 | 3300047319 | Bacteria | 4704 |
| 838 | Ga0495674_0212023 | 3300047319 | Bacteria | 1604 |
| 839 | Ga0495674_0252838 | 3300047319 | Bacteria | 1450 |
| 840 | Ga0495674_0554644 | 3300047319 | Bacteria | 914 |
| 841 | Ga0495672_0045971 | 3300047320 | Bacteria | 2607 |
| 842 | Ga0495672_0069898 | 3300047320 | Bacteria | 1991 |
| 843 | Ga0495676_0066360 | 3300047321 | Bacteria | 2797 |
| 844 | Ga0495676_0241158 | 3300047321 | Bacteria | 1237 |
| 845 | Ga0495676_0307413 | 3300047321 | Bacteria | 1068 |
| 846 | Ga0495676_0351686 | 3300047321 | Bacteria | 985 |
| 847 | Ga0495680_0029831 | 3300047322 | Bacteria | 4461 |
| 848 | Ga0495680_0069062 | 3300047322 | Bacteria | 2697 |
| 849 | Ga0495680_0103947 | 3300047322 | Bacteria | 2113 |
| 850 | Ga0495680_0412212 | 3300047322 | Bacteria | 931 |
| 851 | Ga0495687_031231 | 3300047443 | Bacteria | 2445 |
| 852 | Ga0495675_0009683 | 3300047444 | Bacteria | 6006 |
| 853 | Ga0495673_0018097 | 3300047469 | Bacteria | 3562 |
| 854 | Ga0495673_0018848 | 3300047469 | Bacteria | 3470 |
| 855 | Ga0495681_0048787 | 3300047470 | Bacteria | 2005 |
| 856 | Ga0495684_0005264 | 3300047471 | Bacteria | 10071 |
| 857 | Ga0495684_0007348 | 3300047471 | Bacteria | 8539 |
| 858 | Ga0495684_0034547 | 3300047471 | Bacteria | 3879 |
| 859 | Ga0495686_0056466 | 3300047472 | Bacteria | 2453 |
| 860 | Ga0495686_0129207 | 3300047472 | Bacteria | 1499 |
| 861 | Ga0495686_0205366 | 3300047472 | Bacteria | 1128 |
| 862 | Ga0495686_0261572 | 3300047472 | Bacteria | 968 |
| 863 | Ga0495593_0000321 | 3300047673 | Bacteria | 26527 |
| 864 | Ga0495593_0008457 | 3300047673 | Bacteria | 5984 |
| 865 | Ga0495593_0011366 | 3300047673 | Bacteria | 5115 |
| 866 | Ga0495593_0066053 | 3300047673 | Bacteria | 1886 |
| 867 | Ga0495602_0066912 | 3300048088 | Bacteria | 3093 |
| 868 | Ga0495602_0073666 | 3300048088 | Bacteria | 2905 |
| 869 | Ga0495602_0096401 | 3300048088 | Bacteria | 2439 |
| 870 | Ga0495614_0018834 | 3300048089 | Bacteria | 2990 |
| 871 | Ga0496100_0030986 | 3300048903 | Bacteria | 3321 |
| 872 | Ga0496100_0267734 | 3300048903 | Bacteria | 1269 |
| 873 | Ga0496100_0319795 | 3300048903 | Bacteria | 1165 |
| 874 | Ga0496100_0454927 | 3300048903 | Bacteria | 982 |
| 875 | Ga0496101_0001116 | 3300048904 | Bacteria | 15986 |
| 876 | Ga0496101_0098562 | 3300048904 | Bacteria | 2184 |
| 877 | Ga0496101_0349694 | 3300048904 | Bacteria | 1161 |
| 878 | Ga0496101_0554453 | 3300048904 | Bacteria | 909 |
| 879 | Ga0496102_0011710 | 3300048905 | Bacteria | 7570 |
| 880 | Ga0496102_0050412 | 3300048905 | Bacteria | 3790 |
| 881 | Ga0496102_0139532 | 3300048905 | Bacteria | 2272 |
| 882 | Ga0496102_0385137 | 3300048905 | Bacteria | 1319 |
| 883 | Ga0496102_0705933 | 3300048905 | Bacteria | 931 |
| 884 | Ga0496103_0003589 | 3300048906 | Bacteria | 9466 |
| 885 | Ga0496103_0017422 | 3300048906 | Bacteria | 4299 |
| 886 | Ga0496103_0079695 | 3300048906 | Bacteria | 2058 |
| 887 | Ga0496103_0380740 | 3300048906 | Bacteria | 907 |
| 888 | Ga0496104_0012431 | 3300048907 | Bacteria | 7655 |
| 889 | Ga0496104_0108079 | 3300048907 | Bacteria | 2665 |
| 890 | Ga0496104_0205468 | 3300048907 | Bacteria | 1881 |
| 891 | Ga0496104_0245151 | 3300048907 | Bacteria | 1704 |
| 892 | Ga0496104_0349167 | 3300048907 | Bacteria | 1392 |
| 893 | Ga0496104_0396945 | 3300048907 | Bacteria | 1291 |
| 894 | Ga0496104_0487823 | 3300048907 | Bacteria | 1143 |
| 895 | Ga0496104_0546430 | 3300048907 | Bacteria | 1069 |
| 896 | Ga0496105_0003700 | 3300048908 | Bacteria | 11380 |
| 897 | Ga0496105_0028196 | 3300048908 | Bacteria | 4591 |
| 898 | Ga0496105_0050494 | 3300048908 | Bacteria | 3435 |
| 899 | Ga0496105_0118831 | 3300048908 | Bacteria | 2180 |
| 900 | Ga0496105_0140536 | 3300048908 | Bacteria | 1987 |
| 901 | Ga0496105_0599884 | 3300048908 | Bacteria | 855 |
| 902 | Ga0496106_0001417 | 3300048909 | Bacteria | 17974 |
| 903 | Ga0496106_0008911 | 3300048909 | Bacteria | 7417 |
| 904 | Ga0496106_0083302 | 3300048909 | Bacteria | 2459 |
| 905 | Ga0496106_0575565 | 3300048909 | Bacteria | 903 |
| 906 | Ga0496107_0002177 | 3300048910 | Bacteria | 12590 |
| 907 | Ga0496107_0009363 | 3300048910 | Bacteria | 6789 |
| 908 | Ga0496107_0063213 | 3300048910 | Bacteria | 2682 |
| 909 | Ga0496107_0082738 | 3300048910 | Bacteria | 2341 |
| 910 | Ga0496107_0117463 | 3300048910 | Bacteria | 1958 |
| 911 | Ga0496107_0313582 | 3300048910 | Bacteria | 1167 |
| 912 | Ga0496108_0000467 | 3300048911 | Bacteria | 32329 |
| 913 | Ga0496108_0026157 | 3300048911 | Bacteria | 4813 |
| 914 | Ga0496108_0047303 | 3300048911 | Bacteria | 3596 |
| 915 | Ga0496108_0090140 | 3300048911 | Bacteria | 2607 |
| 916 | Ga0496108_0590469 | 3300048911 | Bacteria | 968 |
| 917 | Ga0496109_0000230 | 3300048912 | Bacteria | 54618 |
| 918 | Ga0496109_0159458 | 3300048912 | Bacteria | 2113 |
| 919 | Ga0496109_0203135 | 3300048912 | Bacteria | 1863 |
| 920 | Ga0496109_0228922 | 3300048912 | Bacteria | 1748 |
| 921 | Ga0496110_0024274 | 3300048913 | Bacteria | 5165 |
| 922 | Ga0496110_0043024 | 3300048913 | Bacteria | 3943 |
| 923 | Ga0496110_0065299 | 3300048913 | Bacteria | 3217 |
| 924 | Ga0496110_0065839 | 3300048913 | Bacteria | 3203 |
| 925 | Ga0496110_0544082 | 3300048913 | Bacteria | 1055 |
| 926 | Ga0496110_0656727 | 3300048913 | Bacteria | 949 |
| 927 | Ga0496111_0009582 | 3300048914 | Bacteria | 6470 |
| 928 | Ga0496111_0035505 | 3300048914 | Bacteria | 3563 |
| 929 | Ga0496111_0035597 | 3300048914 | Bacteria | 3559 |
| 930 | Ga0496111_0052529 | 3300048914 | Bacteria | 2943 |
| 931 | Ga0496111_0095289 | 3300048914 | Bacteria | 2184 |
| 932 | Ga0496111_0538499 | 3300048914 | Bacteria | 858 |
| 933 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 934 | Ga0496112_0016541 | 3300048915 | Bacteria | 6915 |
| 935 | Ga0496112_0019046 | 3300048915 | Bacteria | 6471 |
| 936 | Ga0496112_0023823 | 3300048915 | Bacteria | 5856 |
| 937 | Ga0496112_0026282 | 3300048915 | Bacteria | 5598 |
| 938 | Ga0496112_0107087 | 3300048915 | Bacteria | 2765 |
| 939 | Ga0496112_0110284 | 3300048915 | Bacteria | 2722 |
| 940 | Ga0496112_0318223 | 3300048915 | Bacteria | 1500 |
| 941 | Ga0496112_0716119 | 3300048915 | Bacteria | 928 |
| 942 | Ga0496113_0026922 | 3300048916 | Bacteria | 4116 |
| 943 | Ga0496113_0039367 | 3300048916 | Bacteria | 3480 |
| 944 | Ga0496113_0278618 | 3300048916 | Bacteria | 1337 |
| 945 | Ga0496113_0339197 | 3300048916 | Bacteria | 1205 |
| 946 | Ga0496113_0339605 | 3300048916 | Bacteria | 1204 |
| 947 | Ga0496113_0767275 | 3300048916 | Bacteria | 767 |
| 948 | Ga0496114_0034331 | 3300048917 | Bacteria | 4184 |
| 949 | Ga0496115_0001457 | 3300048918 | Bacteria | 16992 |
| 950 | Ga0496115_0013523 | 3300048918 | Bacteria | 6174 |
| 951 | Ga0496115_0043174 | 3300048918 | Bacteria | 3595 |
| 952 | Ga0496115_0069249 | 3300048918 | Bacteria | 2858 |
| 953 | Ga0496115_0160098 | 3300048918 | Bacteria | 1860 |
| 954 | Ga0496115_0209890 | 3300048918 | Bacteria | 1608 |
| 955 | Ga0496115_0301120 | 3300048918 | Bacteria | 1314 |
| 956 | Ga0496115_0383584 | 3300048918 | Bacteria | 1142 |
| 957 | Ga0496115_0517521 | 3300048918 | Bacteria | 957 |
| 958 | Ga0496116_0001929 | 3300048919 | Bacteria | 22341 |
| 959 | Ga0496116_0186142 | 3300048919 | Bacteria | 1105 |
| 960 | Ga0496116_0272035 | 3300048919 | Bacteria | 827 |
| 961 | Ga0496117_0046900 | 3300048920 | Bacteria | 3104 |
| 962 | Ga0496117_0063075 | 3300048920 | Bacteria | 2535 |
| 963 | Ga0496117_0192614 | 3300048920 | Bacteria | 1159 |
| 964 | Ga0496117_0194830 | 3300048920 | Bacteria | 1150 |
| 965 | Ga0496118_0009320 | 3300048921 | Bacteria | 9948 |
| 966 | Ga0496118_0027902 | 3300048921 | Bacteria | 4768 |
| 967 | Ga0496118_0048112 | 3300048921 | Bacteria | 3299 |
| 968 | Ga0496118_0105501 | 3300048921 | Bacteria | 1889 |
| 969 | Ga0496118_0116873 | 3300048921 | Bacteria | 1751 |
| 970 | Ga0496119_0000934 | 3300048922 | Bacteria | 37665 |
| 971 | Ga0496119_0044680 | 3300048922 | Bacteria | 2786 |
| 972 | Ga0496119_0048915 | 3300048922 | Bacteria | 2618 |
| 973 | Ga0496119_0056925 | 3300048922 | Bacteria | 2366 |
| 974 | Ga0496119_0071005 | 3300048922 | Bacteria | 2040 |
| 975 | Ga0496119_0093115 | 3300048922 | Bacteria | 1708 |
| 976 | Ga0496120_0009108 | 3300048923 | Bacteria | 7083 |
| 977 | Ga0496120_0019417 | 3300048923 | Bacteria | 4349 |
| 978 | Ga0496120_0098975 | 3300048923 | Bacteria | 1545 |
| 979 | Ga0496121_0001793 | 3300048924 | Bacteria | 34696 |
| 980 | Ga0496121_0002081 | 3300048924 | Bacteria | 31581 |
| 981 | Ga0496121_0002915 | 3300048924 | Bacteria | 25094 |
| 982 | Ga0496121_0007192 | 3300048924 | Bacteria | 13480 |
| 983 | Ga0496121_0016644 | 3300048924 | Bacteria | 7572 |
| 984 | Ga0496121_0062068 | 3300048924 | Bacteria | 3063 |
| 985 | Ga0496121_0068006 | 3300048924 | Bacteria | 2884 |
| 986 | Ga0496121_0079020 | 3300048924 | Bacteria | 2613 |
| 987 | Ga0496121_0224016 | 3300048924 | Bacteria | 1322 |
| 988 | Ga0496122_0026757 | 3300048925 | Bacteria | 4959 |
| 989 | Ga0496122_0168356 | 3300048925 | Bacteria | 1325 |
| 990 | Ga0496122_0172358 | 3300048925 | Bacteria | 1302 |
| 991 | Ga0496123_0024339 | 3300048926 | Bacteria | 4605 |
| 992 | Ga0496123_0028199 | 3300048926 | Bacteria | 4162 |
| 993 | Ga0496123_0056798 | 3300048926 | Bacteria | 2554 |
| 994 | Ga0496123_0071310 | 3300048926 | Bacteria | 2168 |
| 995 | Ga0496124_0038290 | 3300048927 | Bacteria | 4165 |
| 996 | Ga0496124_0115301 | 3300048927 | Bacteria | 2156 |
| 997 | Ga0496124_0156569 | 3300048927 | Bacteria | 1781 |
| 998 | Ga0496124_0211212 | 3300048927 | Bacteria | 1468 |
| 999 | Ga0496124_0410521 | 3300048927 | Bacteria | 937 |
| 1000 | Ga0496125_0000158 | 3300048928 | Bacteria | 151273 |
| 1001 | Ga0496125_0003566 | 3300048928 | Bacteria | 18742 |
| 1002 | Ga0496125_0009065 | 3300048928 | Bacteria | 10299 |
| 1003 | Ga0496125_0032195 | 3300048928 | Bacteria | 4661 |
| 1004 | Ga0496125_0033804 | 3300048928 | Bacteria | 4518 |
| 1005 | Ga0496125_0156922 | 3300048928 | Bacteria | 1553 |
| 1006 | Ga0496125_0186242 | 3300048928 | Bacteria | 1376 |
| 1007 | Ga0496125_0390935 | 3300048928 | Bacteria | 816 |
| 1008 | Ga0496126_0001668 | 3300048929 | Bacteria | 33320 |
| 1009 | Ga0496126_0005184 | 3300048929 | Bacteria | 15063 |
| 1010 | Ga0496126_0012254 | 3300048929 | Bacteria | 8796 |
| 1011 | Ga0496126_0014762 | 3300048929 | Bacteria | 7881 |
| 1012 | Ga0496126_0031494 | 3300048929 | Bacteria | 5010 |
| 1013 | Ga0496126_0036934 | 3300048929 | Bacteria | 4563 |
| 1014 | Ga0496126_0049756 | 3300048929 | Bacteria | 3824 |
| 1015 | Ga0496126_0095141 | 3300048929 | Bacteria | 2613 |
| 1016 | Ga0496126_0124477 | 3300048929 | Bacteria | 2232 |
| 1017 | Ga0496126_0142825 | 3300048929 | Bacteria | 2059 |
| 1018 | Ga0496126_0181755 | 3300048929 | Bacteria | 1786 |
| 1019 | Ga0496126_0190487 | 3300048929 | Bacteria | 1737 |
| 1020 | Ga0496126_0196390 | 3300048929 | Bacteria | 1706 |
| 1021 | Ga0496126_0198854 | 3300048929 | Bacteria | 1694 |
| 1022 | Ga0496126_0203148 | 3300048929 | Bacteria | 1672 |
| 1023 | Ga0496126_0238105 | 3300048929 | Bacteria | 1522 |
| 1024 | Ga0496126_0358933 | 3300048929 | Bacteria | 1190 |
| 1025 | Ga0496126_0461679 | 3300048929 | Bacteria | 1020 |
| 1026 | Ga0496126_0474941 | 3300048929 | Bacteria | 1003 |
| 1027 | Ga0496126_0554500 | 3300048929 | Bacteria | 911 |
| 1028 | Ga0495678_133559 | 3300049459 | Bacteria | 820 |
| 1029 | Ga0495682_0035539 | 3300049460 | Bacteria | 1835 |
| 1030 | Ga0501031_0000946 | 3300049568 | Bacteria | 17557 |
| 1031 | Ga0501031_0007375 | 3300049568 | Bacteria | 7169 |
| 1032 | Ga0501031_0179153 | 3300049568 | Bacteria | 1384 |
| 1033 | Ga0501032_0000503 | 3300049569 | Bacteria | 31656 |
| 1034 | Ga0501032_0081543 | 3300049569 | Bacteria | 2152 |
| 1035 | Ga0501032_0110562 | 3300049569 | Bacteria | 1818 |
| 1036 | Ga0501033_0000140 | 3300049570 | Bacteria | 70162 |
| 1037 | Ga0501033_0001234 | 3300049570 | Bacteria | 22939 |
| 1038 | Ga0501033_0019665 | 3300049570 | Bacteria | 5103 |
| 1039 | Ga0501033_0028461 | 3300049570 | Bacteria | 4198 |
| 1040 | Ga0501033_0079879 | 3300049570 | Bacteria | 2400 |
| 1041 | Ga0501033_0185603 | 3300049570 | Bacteria | 1490 |
| 1042 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 1043 | Ga0501034_0108610 | 3300049571 | Bacteria | 2765 |
| 1044 | Ga0501034_0141805 | 3300049571 | Bacteria | 2382 |
| 1045 | Ga0501034_0152435 | 3300049571 | Bacteria | 2287 |
| 1046 | Ga0501034_0266963 | 3300049571 | Bacteria | 1653 |
| 1047 | Ga0501034_0370071 | 3300049571 | Bacteria | 1359 |
| 1048 | Ga0501036_0000050 | 3300049572 | Bacteria | 75340 |
| 1049 | Ga0501036_0011109 | 3300049572 | Bacteria | 7447 |
| 1050 | Ga0501036_0206702 | 3300049572 | Bacteria | 1650 |
| 1051 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 1052 | Ga0501037_0000580 | 3300049573 | Bacteria | 28773 |
| 1053 | Ga0501037_0012101 | 3300049573 | Bacteria | 6355 |
| 1054 | Ga0501037_0030562 | 3300049573 | Bacteria | 3980 |
| 1055 | Ga0501037_0120281 | 3300049573 | Bacteria | 1888 |
| 1056 | Ga0501037_0127934 | 3300049573 | Bacteria | 1823 |
| 1057 | Ga0501037_0130658 | 3300049573 | Bacteria | 1801 |
| 1058 | Ga0501038_0000039 | 3300049574 | Bacteria | 122904 |
| 1059 | Ga0501038_0037416 | 3300049574 | Bacteria | 4254 |
| 1060 | Ga0501038_0077914 | 3300049574 | Bacteria | 2797 |
| 1061 | Ga0501038_0088413 | 3300049574 | Bacteria | 2600 |
| 1062 | Ga0501038_0097617 | 3300049574 | Bacteria | 2451 |
| 1063 | Ga0501038_0168710 | 3300049574 | Bacteria | 1773 |
| 1064 | Ga0501038_0251239 | 3300049574 | Bacteria | 1401 |
| 1065 | Ga0501038_0611637 | 3300049574 | Bacteria | 823 |
| 1066 | Ga0501039_0000060 | 3300049575 | Bacteria | 85528 |
| 1067 | Ga0501039_0015440 | 3300049575 | Bacteria | 5845 |
| 1068 | Ga0501039_0033351 | 3300049575 | Bacteria | 3970 |
| 1069 | Ga0501039_0200649 | 3300049575 | Bacteria | 1568 |
| 1070 | Ga0501040_0191143 | 3300049576 | Bacteria | 1452 |
| 1071 | Ga0501041_0337438 | 3300049577 | Bacteria | 952 |
| 1072 | Ga0501042_0008737 | 3300049578 | Bacteria | 6719 |
| 1073 | Ga0501042_0129773 | 3300049578 | Bacteria | 1816 |
| 1074 | Ga0501042_0544366 | 3300049578 | Bacteria | 844 |
| 1075 | Ga0501043_0002562 | 3300049579 | Bacteria | 15362 |
| 1076 | Ga0501043_0010025 | 3300049579 | Bacteria | 7431 |
| 1077 | Ga0501043_0034144 | 3300049579 | Bacteria | 4001 |
| 1078 | Ga0501043_0047351 | 3300049579 | Bacteria | 3380 |
| 1079 | Ga0501043_0089125 | 3300049579 | Bacteria | 2425 |
| 1080 | Ga0501043_0115831 | 3300049579 | Bacteria | 2103 |
| 1081 | Ga0501043_0239533 | 3300049579 | Bacteria | 1399 |
| 1082 | Ga0501043_0589176 | 3300049579 | Bacteria | 822 |
| 1083 | Ga0501046_0000522 | 3300049580 | Bacteria | 38028 |
| 1084 | Ga0501046_0020020 | 3300049580 | Bacteria | 5540 |
| 1085 | Ga0501046_0071000 | 3300049580 | Bacteria | 2706 |
| 1086 | Ga0501046_0099953 | 3300049580 | Bacteria | 2226 |
| 1087 | Ga0501046_0150188 | 3300049580 | Bacteria | 1758 |
| 1088 | Ga0501046_0283733 | 3300049580 | Bacteria | 1212 |
| 1089 | Ga0501047_0000174 | 3300049581 | Bacteria | 79021 |
| 1090 | Ga0501047_0020075 | 3300049581 | Bacteria | 6417 |
| 1091 | Ga0501047_0036854 | 3300049581 | Bacteria | 4727 |
| 1092 | Ga0501047_0071113 | 3300049581 | Bacteria | 3349 |
| 1093 | Ga0501047_0109032 | 3300049581 | Bacteria | 2651 |
| 1094 | Ga0501047_0150972 | 3300049581 | Bacteria | 2199 |
| 1095 | Ga0501047_0152493 | 3300049581 | Bacteria | 2186 |
| 1096 | Ga0501047_0422591 | 3300049581 | Bacteria | 1164 |
| 1097 | Ga0501047_0517272 | 3300049581 | Bacteria | 1019 |
| 1098 | Ga0501048_0000704 | 3300049582 | Bacteria | 24375 |
| 1099 | Ga0501048_0076181 | 3300049582 | Bacteria | 2367 |
| 1100 | Ga0501048_0317888 | 3300049582 | Bacteria | 1109 |
| 1101 | Ga0501067_0000239 | 3300049583 | Bacteria | 30445 |
| 1102 | Ga0501067_0002890 | 3300049583 | Bacteria | 9451 |
| 1103 | Ga0501067_0032572 | 3300049583 | Bacteria | 2893 |
| 1104 | Ga0501067_0271461 | 3300049583 | Bacteria | 944 |
| 1105 | Ga0501068_0000227 | 3300049584 | Bacteria | 27306 |
| 1106 | Ga0501068_0057644 | 3300049584 | Bacteria | 2355 |
| 1107 | Ga0501068_0285367 | 3300049584 | Bacteria | 1055 |
| 1108 | Ga0501069_0011635 | 3300049585 | Bacteria | 4665 |
| 1109 | Ga0501069_0015333 | 3300049585 | Bacteria | 4106 |
| 1110 | Ga0501069_0270533 | 3300049585 | Bacteria | 993 |
| 1111 | Ga0501070_0003314 | 3300049586 | Bacteria | 13986 |
| 1112 | Ga0501070_0015499 | 3300049586 | Bacteria | 6412 |
| 1113 | Ga0501070_0040767 | 3300049586 | Bacteria | 3872 |
| 1114 | Ga0501070_0067438 | 3300049586 | Bacteria | 2963 |
| 1115 | Ga0501070_0178131 | 3300049586 | Bacteria | 1750 |
| 1116 | Ga0501070_0496035 | 3300049586 | Bacteria | 981 |
| 1117 | Ga0501071_0024865 | 3300049587 | Bacteria | 4191 |
| 1118 | Ga0501072_0001189 | 3300049588 | Bacteria | 19405 |
| 1119 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 1120 | Ga0501073_0089030 | 3300049589 | Bacteria | 2146 |
| 1121 | Ga0501073_0110477 | 3300049589 | Bacteria | 1907 |
| 1122 | Ga0501074_0000049 | 3300049590 | Bacteria | 56854 |
| 1123 | Ga0501074_0006127 | 3300049590 | Bacteria | 8687 |
| 1124 | Ga0501074_0128610 | 3300049590 | Bacteria | 1812 |
| 1125 | Ga0501074_0179074 | 3300049590 | Bacteria | 1512 |
| 1126 | Ga0501075_0197835 | 3300049591 | Bacteria | 1533 |
| 1127 | Ga0501075_0361822 | 3300049591 | Bacteria | 1106 |
| 1128 | Ga0501076_0119822 | 3300049592 | Bacteria | 2131 |
| 1129 | Ga0501076_0279251 | 3300049592 | Bacteria | 1368 |
| 1130 | Ga0501079_0014652 | 3300049741 | Bacteria | 5979 |
| 1131 | Ga0501079_0048999 | 3300049741 | Bacteria | 3260 |
| 1132 | Ga0501079_0202424 | 3300049741 | Bacteria | 1551 |
| 1133 | Ga0501080_0005405 | 3300049742 | Bacteria | 11390 |
| 1134 | Ga0501080_0018418 | 3300049742 | Bacteria | 6463 |
| 1135 | Ga0501080_0286480 | 3300049742 | Bacteria | 1496 |
| 1136 | Ga0501081_0136990 | 3300049743 | Bacteria | 1753 |
| 1137 | Ga0501083_0000251 | 3300049744 | Bacteria | 34183 |
| 1138 | Ga0501083_0040696 | 3300049744 | Bacteria | 3154 |
| 1139 | Ga0501083_0085534 | 3300049744 | Bacteria | 2086 |
| 1140 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 1141 | Ga0501035_0013199 | 3300049822 | Bacteria | 7624 |
| 1142 | Ga0501035_0028638 | 3300049822 | Bacteria | 5084 |
| 1143 | Ga0501035_0083690 | 3300049822 | Bacteria | 2815 |
| 1144 | Ga0501035_0184827 | 3300049822 | Bacteria | 1794 |
| 1145 | Ga0501035_0285945 | 3300049822 | Bacteria | 1392 |
| 1146 | Ga0501035_0484760 | 3300049822 | Bacteria | 1019 |
| 1147 | Ga0501044_0000258 | 3300049823 | Bacteria | 67161 |
| 1148 | Ga0501044_0036104 | 3300049823 | Bacteria | 5172 |
| 1149 | Ga0501044_0059643 | 3300049823 | Bacteria | 3909 |
| 1150 | Ga0501044_0132726 | 3300049823 | Bacteria | 2483 |
| 1151 | Ga0501044_0143284 | 3300049823 | Bacteria | 2377 |
| 1152 | Ga0501044_0198924 | 3300049823 | Bacteria | 1963 |
| 1153 | Ga0501044_0611666 | 3300049823 | Bacteria | 982 |
| 1154 | Ga0501045_0005432 | 3300049824 | Bacteria | 8825 |
| 1155 | Ga0501045_0034526 | 3300049824 | Bacteria | 3671 |
| 1156 | nmdc:mga03n38_66636_c1 | 3300050490 | Bacteria | 1654 |
| 1157 | nmdc:mga03n38_91680_c1 | 3300050490 | Bacteria | 1448 |
| 1158 | nmdc:mga00v17_116781_c1 | 3300050491 | Bacteria | 1696 |
| 1159 | nmdc:mga00v17_135722_c1 | 3300050491 | Bacteria | 1575 |
| 1160 | nmdc:mga00v17_226514_c1 | 3300050491 | Bacteria | 1211 |
| 1161 | nmdc:mga00v17_74333_c1 | 3300050491 | Bacteria | 2112 |
| 1162 | nmdc:mga0yw44_10820_c1 | 3300050492 | Bacteria | 4676 |
| 1163 | nmdc:mga0yw44_1581_c1 | 3300050492 | Bacteria | 9141 |
| 1164 | nmdc:mga0yw44_241651_c1 | 3300050492 | Bacteria | 1200 |
| 1165 | nmdc:mga0yw44_48278_c1 | 3300050492 | Bacteria | 2567 |
| 1166 | nmdc:mga0k408_183042_c1 | 3300050493 | Bacteria | 1250 |
| 1167 | nmdc:mga06z11_29356_c1 | 3300050494 | Bacteria | 2649 |
| 1168 | nmdc:mga04h51_124722_c1 | 3300050495 | Bacteria | 963 |
| 1169 | nmdc:mga04h51_13109_c1 | 3300050495 | Bacteria | 2341 |
| 1170 | nmdc:mga04h51_92482_c1 | 3300050495 | Bacteria | 1091 |
| 1171 | nmdc:mga07m45_178273_c1 | 3300050496 | Bacteria | 1236 |
| 1172 | nmdc:mga07m45_90376_c1 | 3300050496 | Bacteria | 1754 |
| 1173 | nmdc:mga05p37_4482_c1 | 3300050507 | Bacteria | 16321 |
| 1174 | nmdc:mga09592_21656_c1 | 3300050508 | Bacteria | 5299 |
| 1175 | nmdc:mga09592_69360_c1 | 3300050508 | Bacteria | 2990 |
| 1176 | nmdc:mga06r32_2521_c1 | 3300050510 | Bacteria | 16382 |
| 1177 | nmdc:mga08y16_3491_c1 | 3300050511 | Bacteria | 16323 |
| 1178 | nmdc:mga0n895_30287_c1 | 3300050512 | Bacteria | 5170 |
| 1179 | nmdc:mga0rr50_240054_c1 | 3300050513 | Bacteria | 1502 |
| 1180 | nmdc:mga0rr50_365675_c1 | 3300050513 | Bacteria | 1215 |
| 1181 | nmdc:mga08x19_119583_c1 | 3300050514 | Bacteria | 1765 |
| 1182 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 1183 | nmdc:mga0sz30_128200_c1 | 3300050516 | Bacteria | 1117 |
| 1184 | nmdc:mga0sz30_3193_c1 | 3300050516 | Bacteria | 5877 |
| 1185 | nmdc:mga0sz30_4096_c1 | 3300050516 | Bacteria | 5252 |
| 1186 | Ga0495601_0282702 | 3300053077 | Bacteria | 1082 |
| 1187 | Ga0495655_0008988 | 3300053083 | Bacteria | 1920 |
| 1188 | Ga0495655_0023618 | 3300053083 | Bacteria | 1420 |
| 1189 | Ga0495655_0033641 | 3300053083 | Bacteria | 1263 |
| 1190 | Ga0495595_0014352 | 3300053084 | Bacteria | 3360 |
| 1191 | Ga0495595_0203097 | 3300053084 | Bacteria | 987 |
| 1192 | Ga0495595_0231811 | 3300053084 | Bacteria | 923 |
| 1193 | Ga0495619_0039633 | 3300053085 | Bacteria | 3076 |
| 1194 | Ga0495619_0065256 | 3300053085 | Bacteria | 2428 |
| 1195 | Ga0495619_0138953 | 3300053085 | Bacteria | 1672 |
| 1196 | Ga0495619_0296802 | 3300053085 | Bacteria | 1119 |
| 1197 | Ga0500578_0253554 | 3300053086 | Bacteria | 1059 |
| 1198 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1199 | Ga0500643_008577 | 3300053087 | Bacteria | 4005 |
| 1200 | Ga0500643_024773 | 3300053087 | Bacteria | 1900 |
| 1201 | Ga0500644_0164556 | 3300053088 | Bacteria | 898 |
| 1202 | Ga0500651_0001062 | 3300053093 | Bacteria | 13560 |
| 1203 | Ga0500651_0212978 | 3300053093 | Bacteria | 1136 |
| 1204 | Ga0500651_0294112 | 3300053093 | Bacteria | 933 |
| 1205 | Ga0500566_0000588 | 3300053094 | Bacteria | 20372 |
| 1206 | Ga0500566_0005320 | 3300053094 | Bacteria | 7656 |
| 1207 | Ga0500566_0007385 | 3300053094 | Bacteria | 6507 |
| 1208 | Ga0500566_0018131 | 3300053094 | Bacteria | 4134 |
| 1209 | Ga0500566_0079196 | 3300053094 | Bacteria | 1832 |
| 1210 | Ga0500640_007928 | 3300053095 | Bacteria | 4169 |
| 1211 | Ga0500641_0015731 | 3300053096 | Bacteria | 2813 |
| 1212 | Ga0500641_0052126 | 3300053096 | Bacteria | 1685 |
| 1213 | Ga0500641_0056817 | 3300053096 | Bacteria | 1622 |
| 1214 | Ga0500650_0048318 | 3300053098 | Bacteria | 1973 |
| 1215 | Ga0500650_0253737 | 3300053098 | Bacteria | 788 |
| 1216 | Ga0500553_085888 | 3300053101 | Bacteria | 1400 |
| 1217 | Ga0500554_008721 | 3300053102 | Bacteria | 2396 |
| 1218 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 1219 | Ga0500557_000030 | 3300053105 | Bacteria | 76944 |
| 1220 | Ga0500562_015039 | 3300053108 | Bacteria | 1984 |
| 1221 | Ga0500562_068407 | 3300053108 | Bacteria | 957 |
| 1222 | Ga0500569_009193 | 3300053109 | Bacteria | 2288 |
| 1223 | Ga0500572_000174 | 3300053111 | Bacteria | 22807 |
| 1224 | Ga0500572_000359 | 3300053111 | Bacteria | 16208 |
| 1225 | Ga0500572_012915 | 3300053111 | Bacteria | 2056 |
| 1226 | Ga0500592_012737 | 3300053116 | Bacteria | 1346 |
| 1227 | Ga0500593_051003 | 3300053117 | Bacteria | 1837 |
| 1228 | Ga0500594_0003802 | 3300053118 | Bacteria | 3322 |
| 1229 | Ga0500595_000068 | 3300053119 | Bacteria | 73931 |
| 1230 | Ga0500595_008896 | 3300053119 | Bacteria | 4080 |
| 1231 | Ga0500595_012017 | 3300053119 | Bacteria | 3360 |
| 1232 | Ga0500595_050611 | 3300053119 | Bacteria | 1289 |
| 1233 | Ga0500607_019835 | 3300053121 | Bacteria | 3801 |
| 1234 | Ga0500607_049221 | 3300053121 | Bacteria | 2250 |
| 1235 | Ga0500608_018019 | 3300053122 | Bacteria | 3216 |
| 1236 | Ga0500608_027194 | 3300053122 | Bacteria | 2694 |
| 1237 | Ga0500608_206556 | 3300053122 | Bacteria | 807 |
| 1238 | Ga0500614_017173 | 3300053123 | Bacteria | 1632 |
| 1239 | Ga0500618_009109 | 3300053125 | Bacteria | 2728 |
| 1240 | Ga0500642_0000020 | 3300053130 | Bacteria | 159498 |
| 1241 | Ga0500642_0000148 | 3300053130 | Bacteria | 30505 |
| 1242 | Ga0500642_0020557 | 3300053130 | Bacteria | 2597 |
| 1243 | Ga0500652_000109 | 3300053131 | Bacteria | 32551 |
| 1244 | Ga0500658_0049209 | 3300053134 | Bacteria | 1717 |
| 1245 | Ga0500658_0051815 | 3300053134 | Bacteria | 1679 |
| 1246 | Ga0500559_0000213 | 3300053136 | Bacteria | 46604 |
| 1247 | Ga0500559_0000974 | 3300053136 | Bacteria | 17909 |
| 1248 | Ga0500559_0045944 | 3300053136 | Bacteria | 1913 |
| 1249 | Ga0500559_0094995 | 3300053136 | Bacteria | 1368 |
| 1250 | Ga0500559_0116081 | 3300053136 | Bacteria | 1242 |
| 1251 | Ga0500568_0002261 | 3300053139 | Bacteria | 11500 |
| 1252 | Ga0500568_0008101 | 3300053139 | Bacteria | 5097 |
| 1253 | Ga0500568_0010665 | 3300053139 | Bacteria | 4293 |
| 1254 | Ga0500577_0014920 | 3300053142 | Bacteria | 2414 |
| 1255 | Ga0500577_0136206 | 3300053142 | Bacteria | 1033 |
| 1256 | Ga0500577_0223735 | 3300053142 | Bacteria | 815 |
| 1257 | Ga0500588_0035192 | 3300053146 | Bacteria | 1472 |
| 1258 | Ga0500589_056512 | 3300053147 | Bacteria | 1809 |
| 1259 | Ga0500590_038022 | 3300053148 | Bacteria | 2485 |
| 1260 | Ga0500590_103286 | 3300053148 | Bacteria | 1365 |
| 1261 | Ga0500603_001054 | 3300053150 | Bacteria | 6485 |
| 1262 | Ga0500604_0012985 | 3300053151 | Bacteria | 2254 |
| 1263 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 1264 | Ga0500616_0000112 | 3300053153 | Bacteria | 151210 |
| 1265 | Ga0500616_0022040 | 3300053153 | Bacteria | 3562 |
| 1266 | Ga0500619_039761 | 3300053154 | Bacteria | 1480 |
| 1267 | Ga0500619_131351 | 3300053154 | Bacteria | 853 |
| 1268 | Ga0500620_045449 | 3300053155 | Bacteria | 1456 |
| 1269 | Ga0500622_0005391 | 3300053156 | Bacteria | 7695 |
| 1270 | Ga0500622_0042066 | 3300053156 | Bacteria | 2376 |
| 1271 | Ga0500627_0019805 | 3300053158 | Bacteria | 2687 |
| 1272 | Ga0500627_0040890 | 3300053158 | Bacteria | 1990 |
| 1273 | Ga0500630_001669 | 3300053159 | Bacteria | 10645 |
| 1274 | Ga0500638_005706 | 3300053162 | Bacteria | 5000 |
| 1275 | Ga0500638_016902 | 3300053162 | Bacteria | 3375 |
| 1276 | Ga0500638_133356 | 3300053162 | Bacteria | 1123 |
| 1277 | Ga0500638_153419 | 3300053162 | Bacteria | 1022 |
| 1278 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 1279 | Ga0500636_0000701 | 3300053177 | Bacteria | 17989 |
| 1280 | Ga0500636_0002976 | 3300053177 | Bacteria | 9486 |
| 1281 | Ga0500636_0042426 | 3300053177 | Bacteria | 2689 |
| 1282 | Ga0500636_0134790 | 3300053177 | Bacteria | 1372 |
| 1283 | Ga0500637_0002593 | 3300053178 | Bacteria | 8079 |
| 1284 | Ga0500637_0007374 | 3300053178 | Bacteria | 5494 |
| 1285 | Ga0500637_0040724 | 3300053178 | Bacteria | 2625 |
| 1286 | Ga0500637_0103308 | 3300053178 | Bacteria | 1653 |
| 1287 | Ga0500649_080458 | 3300053722 | Bacteria | 1327 |
| 1288 | Ga0500645_011367 | 3300053730 | Bacteria | 2910 |
| 1289 | Ga0500645_069553 | 3300053730 | Bacteria | 1011 |
| 1290 | Ga0500609_001437 | 3300053731 | Bacteria | 3486 |
| 1291 | Ga0500656_007137 | 3300053732 | Bacteria | 1154 |
| 1292 | Ga0500596_001921 | 3300053735 | Bacteria | 4166 |
| 1293 | Ga0500596_003672 | 3300053735 | Bacteria | 2888 |
| 1294 | Ga0500599_002836 | 3300053736 | Bacteria | 2098 |
| 1295 | Ga0500601_000387 | 3300053737 | Bacteria | 7585 |
| 1296 | Ga0500601_007366 | 3300053737 | Bacteria | 1218 |
| 1297 | Ga0500601_013177 | 3300053737 | Bacteria | 935 |
| 1298 | Ga0501084_0002907 | 3300054114 | Bacteria | 13869 |
| 1299 | Ga0501084_0155011 | 3300054114 | Bacteria | 1931 |
| 1300 | Ga0501084_0401359 | 3300054114 | Bacteria | 1159 |
| 1301 | Ga0500661_008965 | 3300055283 | Bacteria | 1837 |
| 1302 | Ga0500661_009319 | 3300055283 | Bacteria | 1799 |
| 1303 | Ga0500661_013161 | 3300055283 | Bacteria | 1491 |
| 1304 | Ga0501082_0010462 | 3300060353 | Bacteria | 7983 |
| 1305 | Ga0501082_0068963 | 3300060353 | Bacteria | 3044 |
| 1306 | Ga0466962_0027852 | 3300061719 | Bacteria | 2709 |
| 1307 | Ga0530510_0173394 | 3300061734 | Bacteria | 1598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025885 | Ga0207653_10074199 | Ga0207653_100741992 | 207 |
| 2 | 3300046536 | Ga0495587_0449495 | Ga0495587_0449495_24_650 | 208 |
| 3 | 3300048924 | Ga0496121_0224016 | Ga0496121_0224016_394_1125 | 214 |
| 4 | 3300048929 | Ga0496126_0095141 | Ga0496126_0095141_1491_2222 | 214 |
| 5 | 3300005577 | Ga0068857_100510850 | Ga0068857_1005108502 | 215 |
| 6 | 3300009551 | Ga0105238_10266937 | Ga0105238_102669372 | 215 |
| 7 | 3300026041 | Ga0207639_10295170 | Ga0207639_102951702 | 215 |
| 8 | 3300026116 | Ga0207674_10095559 | Ga0207674_100955593 | 215 |
| 9 | 3300044694 | Ga0466963_0015395 | Ga0466963_0015395_1196_1927 | 215 |
| 10 | 3300044842 | Ga0466957_0222147 | Ga0466957_0222147_278_1009 | 215 |
| 11 | 3300045976 | Ga0466967_0400970 | Ga0466967_0400970_566_1297 | 215 |
| 12 | 3300048929 | Ga0496126_0358933 | Ga0496126_0358933_37_699 | 219 |
| 13 | 3300049579 | Ga0501043_0589176 | Ga0501043_0589176_16_678 | 219 |
| 14 | 3300053098 | Ga0500650_0048318 | Ga0500650_0048318_1301_1963 | 219 |
| 15 | 3300003659 | JGI25404J52841_10000584 | JGI25404J52841_100005842 | 224 |
| 16 | 3300005983 | Ga0081540_1000300 | Ga0081540_100030038 | 224 |
| 17 | 3300035113 | Ga0373936_0014676 | Ga0373936_0014676_1890_2582 | 224 |
| 18 | 3300035118 | Ga0373954_0036481 | Ga0373954_0036481_1241_1933 | 224 |
| 19 | 3300035119 | Ga0373956_0027948 | Ga0373956_0027948_310_1002 | 224 |
| 20 | 3300046463 | Ga0495653_0168026 | Ga0495653_0168026_664_1356 | 224 |
| 21 | 3300046535 | Ga0495586_0048236 | Ga0495586_0048236_460_1152 | 224 |
| 22 | 3300046543 | Ga0495645_0083555 | Ga0495645_0083555_224_916 | 224 |
| 23 | 3300047315 | Ga0495581_0013943 | Ga0495581_0013943_1919_2611 | 224 |
| 24 | 3300005985 | Ga0081539_10100514 | Ga0081539_101005142 | 225 |
| 25 | 3300046491 | Ga0495584_0158263 | Ga0495584_0158263_68_754 | 225 |
| 26 | 3300048907 | Ga0496104_0349167 | Ga0496104_0349167_64_804 | 226 |
| 27 | iso_pu_bacteria | 8016603502 | 8016607780 | 226 |
| 28 | 3300005548 | Ga0070665_100014688 | Ga0070665_1000146885 | 227 |
| 29 | 3300005842 | Ga0068858_100639493 | Ga0068858_1006394932 | 227 |
| 30 | 3300006038 | Ga0075365_10010597 | Ga0075365_100105972 | 227 |
| 31 | 3300006353 | Ga0075370_10032675 | Ga0075370_100326752 | 227 |
| 32 | 3300010375 | Ga0105239_10442038 | Ga0105239_104420382 | 227 |
| 33 | 3300025920 | Ga0207649_10313128 | Ga0207649_103131281 | 227 |
| 34 | 3300025933 | Ga0207706_10160637 | Ga0207706_101606372 | 227 |
| 35 | 3300025935 | Ga0207709_10117907 | Ga0207709_101179072 | 227 |
| 36 | 3300025938 | Ga0207704_10530530 | Ga0207704_105305301 | 227 |
| 37 | 3300026023 | Ga0207677_10166956 | Ga0207677_101669562 | 227 |
| 38 | 3300026067 | Ga0207678_10051786 | Ga0207678_100517862 | 227 |
| 39 | 3300026088 | Ga0207641_10278315 | Ga0207641_102783152 | 227 |
| 40 | 3300026089 | Ga0207648_10400811 | Ga0207648_104008112 | 227 |
| 41 | 3300028380 | Ga0268265_10039667 | Ga0268265_100396673 | 227 |
| 42 | 3300028381 | Ga0268264_10104745 | Ga0268264_101047452 | 227 |
| 43 | 3300046522 | Ga0495643_0234999 | Ga0495643_0234999_20_703 | 227 |
| 44 | 3300046648 | Ga0495611_0202128 | Ga0495611_0202128_134_817 | 227 |
| 45 | 3300048915 | Ga0496112_0716119 | Ga0496112_0716119_11_694 | 227 |
| 46 | 3300053096 | Ga0500641_0052126 | Ga0500641_0052126_400_1083 | 227 |
| 47 | 3300053118 | Ga0500594_0003802 | Ga0500594_0003802_786_1469 | 227 |
| 48 | 3300039437 | Ga0436365_0085684 | Ga0436365_0085684_120_827 | 228 |
| 49 | 3300005983 | Ga0081540_1010381 | Ga0081540_10103813 | 229 |
| 50 | 3300013100 | Ga0157373_10073299 | Ga0157373_100732993 | 229 |
| 51 | 3300039437 | Ga0436365_1703855 | Ga0436365_1703855_1027_1734 | 229 |
| 52 | 3300048908 | Ga0496105_0599884 | Ga0496105_0599884_146_835 | 229 |
| 53 | 3300048928 | Ga0496125_0156922 | Ga0496125_0156922_832_1524 | 229 |
| 54 | 3300049459 | Ga0495678_133559 | Ga0495678_133559_109_801 | 229 |
| 55 | 3300049569 | Ga0501032_0081543 | Ga0501032_0081543_525_1214 | 229 |
| 56 | 3300049570 | Ga0501033_0019665 | Ga0501033_0019665_2901_3590 | 229 |
| 57 | 3300049571 | Ga0501034_0266963 | Ga0501034_0266963_827_1540 | 229 |
| 58 | 3300049573 | Ga0501037_0030562 | Ga0501037_0030562_1294_1983 | 229 |
| 59 | 3300049574 | Ga0501038_0168710 | Ga0501038_0168710_166_855 | 229 |
| 60 | 3300049579 | Ga0501043_0239533 | Ga0501043_0239533_442_1131 | 229 |
| 61 | 3300049586 | Ga0501070_0067438 | Ga0501070_0067438_616_1305 | 229 |
| 62 | 3300049589 | Ga0501073_0089030 | Ga0501073_0089030_854_1543 | 229 |
| 63 | 3300049590 | Ga0501074_0179074 | Ga0501074_0179074_460_1149 | 229 |
| 64 | 3300049591 | Ga0501075_0361822 | Ga0501075_0361822_342_1058 | 229 |
| 65 | 3300053162 | Ga0500638_153419 | Ga0500638_153419_13_702 | 229 |
| 66 | 3300039093 | Ga0400489_18067 | Ga0400489_18067_29_742 | 230 |
| 67 | 3300005536 | Ga0070697_100003566 | Ga0070697_1000035667 | 231 |
| 68 | 3300005545 | Ga0070695_100021585 | Ga0070695_1000215852 | 231 |
| 69 | 3300006048 | Ga0075363_100062746 | Ga0075363_1000627463 | 231 |
| 70 | 3300006173 | Ga0070716_100028904 | Ga0070716_1000289043 | 231 |
| 71 | 3300006914 | Ga0075436_100039630 | Ga0075436_1000396302 | 231 |
| 72 | 3300007076 | Ga0075435_100085144 | Ga0075435_1000851442 | 231 |
| 73 | 3300025922 | Ga0207646_10587648 | Ga0207646_105876482 | 231 |
| 74 | 3300025929 | Ga0207664_10189046 | Ga0207664_101890462 | 231 |
| 75 | 3300025939 | Ga0207665_10076188 | Ga0207665_100761883 | 231 |
| 76 | 3300035170 | Ga0373943_0078315 | Ga0373943_0078315_949_1644 | 231 |
| 77 | 3300035725 | Ga0373947_0120371 | Ga0373947_0120371_815_1510 | 231 |
| 78 | 3300046455 | Ga0495603_0172677 | Ga0495603_0172677_180_875 | 231 |
| 79 | 3300046462 | Ga0495651_0124395 | Ga0495651_0124395_358_1053 | 231 |
| 80 | 3300046507 | Ga0495606_0151987 | Ga0495606_0151987_320_1018 | 231 |
| 81 | 3300046660 | Ga0495625_0013320 | Ga0495625_0013320_549_1247 | 231 |
| 82 | 3300046674 | Ga0495588_0012056 | Ga0495588_0012056_2183_2881 | 231 |
| 83 | 3300046691 | Ga0495670_0014176 | Ga0495670_0014176_2576_3274 | 231 |
| 84 | 3300048920 | Ga0496117_0192614 | Ga0496117_0192614_350_1048 | 231 |
| 85 | 3300048924 | Ga0496121_0007192 | Ga0496121_0007192_2439_3137 | 231 |
| 86 | 3300048929 | Ga0496126_0012254 | Ga0496126_0012254_7577_8272 | 231 |
| 87 | 3300050513 | nmdc:mga0rr50_365675_c1 | nmdc:mga0rr50_365675_c1_53_766 | 231 |
| 88 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_67944_68657 | 231 |
| 89 | 3300053093 | Ga0500651_0001062 | Ga0500651_0001062_7994_8692 | 231 |
| 90 | 3300053096 | Ga0500641_0056817 | Ga0500641_0056817_370_1068 | 231 |
| 91 | 3300053098 | Ga0500650_0253737 | Ga0500650_0253737_37_735 | 231 |
| 92 | 3300053104 | Ga0500556_0000029 | Ga0500556_0000029_20672_21370 | 231 |
| 93 | 3300053117 | Ga0500593_051003 | Ga0500593_051003_834_1532 | 231 |
| 94 | 3300053130 | Ga0500642_0020557 | Ga0500642_0020557_1870_2568 | 231 |
| 95 | 3300053131 | Ga0500652_000109 | Ga0500652_000109_17015_17713 | 231 |
| 96 | 3300053153 | Ga0500616_0000112 | Ga0500616_0000112_20742_21440 | 231 |
| 97 | 3300053156 | Ga0500622_0005391 | Ga0500622_0005391_6342_7040 | 231 |
| 98 | 3300053156 | Ga0500622_0042066 | Ga0500622_0042066_535_1233 | 231 |
| 99 | 3300053158 | Ga0500627_0040890 | Ga0500627_0040890_1241_1939 | 231 |
| 100 | 3300005436 | Ga0070713_100030915 | Ga0070713_1000309153 | 232 |
| 101 | 3300006178 | Ga0075367_10058758 | Ga0075367_100587582 | 232 |
| 102 | 3300006847 | Ga0075431_100000905 | Ga0075431_10000090517 | 232 |
| 103 | 3300006880 | Ga0075429_100001332 | Ga0075429_10000133212 | 232 |
| 104 | 3300009093 | Ga0105240_10221690 | Ga0105240_102216903 | 232 |
| 105 | 3300009094 | Ga0111539_10005385 | Ga0111539_1000538511 | 232 |
| 106 | 3300009147 | Ga0114129_10001764 | Ga0114129_1000176418 | 232 |
| 107 | 3300013105 | Ga0157369_10037267 | Ga0157369_100372673 | 232 |
| 108 | 3300021384 | Ga0213876_10101072 | Ga0213876_101010721 | 232 |
| 109 | 3300021388 | Ga0213875_10007731 | Ga0213875_100077315 | 232 |
| 110 | 3300021388 | Ga0213875_10054936 | Ga0213875_100549363 | 232 |
| 111 | 3300025904 | Ga0207647_10232405 | Ga0207647_102324052 | 232 |
| 112 | 3300025906 | Ga0207699_10350203 | Ga0207699_103502032 | 232 |
| 113 | 3300025913 | Ga0207695_10194070 | Ga0207695_101940702 | 232 |
| 114 | 3300025928 | Ga0207700_10021207 | Ga0207700_100212074 | 232 |
| 115 | 3300025929 | Ga0207664_10054648 | Ga0207664_100546483 | 232 |
| 116 | 3300027907 | Ga0207428_10039711 | Ga0207428_100397115 | 232 |
| 117 | 3300037418 | Ga0395900_0536575 | Ga0395900_0536575_162_914 | 232 |
| 118 | 3300037466 | Ga0395898_0038432 | Ga0395898_0038432_3170_3901 | 232 |
| 119 | 3300037471 | Ga0395905_0020395 | Ga0395905_0020395_5123_5875 | 232 |
| 120 | 3300037853 | Ga0436364_0209995 | Ga0436364_0209995_293_1024 | 232 |
| 121 | 3300037853 | Ga0436364_0746919 | Ga0436364_0746919_2639_3370 | 232 |
| 122 | 3300037853 | Ga0436364_1499429 | Ga0436364_1499429_1091_1822 | 232 |
| 123 | 3300038443 | Ga0395901_0074399 | Ga0395901_0074399_249_980 | 232 |
| 124 | 3300039437 | Ga0436365_0414081 | Ga0436365_0414081_45_746 | 232 |
| 125 | 3300039437 | Ga0436365_0693364 | Ga0436365_0693364_575_1306 | 232 |
| 126 | 3300039450 | Ga0436363_1076359 | Ga0436363_1076359_1266_1967 | 232 |
| 127 | 3300042439 | Ga0439464_0022423 | Ga0439464_0022423_447_1154 | 232 |
| 128 | 3300049581 | Ga0501047_0152493 | Ga0501047_0152493_1104_1814 | 232 |
| 129 | 3300050507 | nmdc:mga05p37_4482_c1 | nmdc:mga05p37_4482_c1_8240_8947 | 232 |
| 130 | 3300050508 | nmdc:mga09592_21656_c1 | nmdc:mga09592_21656_c1_4432_5139 | 232 |
| 131 | 3300050510 | nmdc:mga06r32_2521_c1 | nmdc:mga06r32_2521_c1_7175_7882 | 232 |
| 132 | 3300050511 | nmdc:mga08y16_3491_c1 | nmdc:mga08y16_3491_c1_7285_7992 | 232 |
| 133 | 3300003354 | JGI25160J50197_1009475 | JGI25160J50197_10094753 | 233 |
| 134 | 3300005262 | Ga0065165_1059018 | Ga0065165_10590182 | 233 |
| 135 | 3300006051 | Ga0075364_10108934 | Ga0075364_101089343 | 233 |
| 136 | 3300025302 | Ga0207426_1034891 | Ga0207426_10348912 | 233 |
| 137 | 3300025941 | Ga0207711_10058323 | Ga0207711_100583232 | 233 |
| 138 | 3300027296 | Ga0209389_1000019 | Ga0209389_1000019116 | 233 |
| 139 | 3300027361 | Ga0209489_100033 | Ga0209489_100033115 | 233 |
| 140 | 3300027363 | Ga0209700_100012 | Ga0209700_100012253 | 233 |
| 141 | 3300041509 | Ga0451843_0556862 | Ga0451843_0556862_48_749 | 233 |
| 142 | 3300048904 | Ga0496101_0554453 | Ga0496101_0554453_20_721 | 233 |
| 143 | 3300048913 | Ga0496110_0656727 | Ga0496110_0656727_138_839 | 233 |
| 144 | 3300049580 | Ga0501046_0071000 | Ga0501046_0071000_1701_2432 | 233 |
| 145 | 3300049581 | Ga0501047_0071113 | Ga0501047_0071113_1406_2137 | 233 |
| 146 | 3300049582 | Ga0501048_0317888 | Ga0501048_0317888_365_1081 | 233 |
| 147 | 3300049586 | Ga0501070_0015499 | Ga0501070_0015499_2174_2905 | 233 |
| 148 | 3300049589 | Ga0501073_0110477 | Ga0501073_0110477_584_1315 | 233 |
| 149 | 3300049590 | Ga0501074_0128610 | Ga0501074_0128610_1024_1755 | 233 |
| 150 | 3300049742 | Ga0501080_0018418 | Ga0501080_0018418_2644_3375 | 233 |
| 151 | 3300049822 | Ga0501035_0083690 | Ga0501035_0083690_899_1630 | 233 |
| 152 | 3300006028 | Ga0070717_10173918 | Ga0070717_101739182 | 234 |
| 153 | 3300035171 | Ga0373946_0085040 | Ga0373946_0085040_516_1229 | 234 |
| 154 | 3300035695 | Ga0373927_0116986 | Ga0373927_0116986_969_1682 | 234 |
| 155 | 3300035725 | Ga0373947_0098616 | Ga0373947_0098616_334_1047 | 234 |
| 156 | 3300037312 | Ga0395899_0062406 | Ga0395899_0062406_80_787 | 234 |
| 157 | 3300037418 | Ga0395900_0716042 | Ga0395900_0716042_132_839 | 234 |
| 158 | 3300037466 | Ga0395898_0505367 | Ga0395898_0505367_21_728 | 234 |
| 159 | 3300038443 | Ga0395901_0348137 | Ga0395901_0348137_200_907 | 234 |
| 160 | 3300046476 | Ga0495662_0046284 | Ga0495662_0046284_1180_1893 | 234 |
| 161 | 3300046533 | Ga0495640_0071807 | Ga0495640_0071807_356_1069 | 234 |
| 162 | 3300049573 | Ga0501037_0130658 | Ga0501037_0130658_706_1413 | 234 |
| 163 | 3300049581 | Ga0501047_0036854 | Ga0501047_0036854_3224_3931 | 234 |
| 164 | iso_pu_bacteria | 2513237092 | 2513627392 | 234 |
| 165 | iso_pu_bacteria | 2513237104 | 2513717721 | 234 |
| 166 | iso_pu_bacteria | 2791355199 | 2793080374 | 234 |
| 167 | iso_pu_bacteria | 2874612657 | 2874617834 | 234 |
| 168 | iso_pu_bacteria | 2881665667 | 2881669145 | 234 |
| 169 | iso_pu_bacteria | 2889033259 | 2889033959 | 234 |
| 170 | iso_pu_bacteria | 3005483717 | 3005490247 | 234 |
| 171 | iso_pu_bacteria | 8006926726 | 8006929287 | 234 |
| 172 | 3300013105 | Ga0157369_10157732 | Ga0157369_101577322 | 235 |
| 173 | 3300041486 | Ga0451807_0007667 | Ga0451807_0007667_1280_2011 | 235 |
| 174 | 3300046515 | Ga0495620_0027058 | Ga0495620_0027058_1369_2100 | 235 |
| 175 | 3300046660 | Ga0495625_0343776 | Ga0495625_0343776_97_828 | 235 |
| 176 | iso_pu_bacteria | 2507262055 | 2507511935 | 235 |
| 177 | iso_pu_bacteria | 2508501009 | 2508545600 | 235 |
| 178 | iso_pu_bacteria | 2508501042 | 2508694416 | 235 |
| 179 | iso_pu_bacteria | 2511231028 | 2511398076 | 235 |
| 180 | iso_pu_bacteria | 2513237094 | 2513643251 | 235 |
| 181 | iso_pu_bacteria | 2513237095 | 2513651040 | 235 |
| 182 | iso_pu_bacteria | 2513237102 | 2513699472 | 235 |
| 183 | iso_pu_bacteria | 2513237139 | 2513874442 | 235 |
| 184 | iso_pu_bacteria | 2513237161 | 2514014458 | 235 |
| 185 | iso_pu_bacteria | 2515154112 | 2515624656 | 235 |
| 186 | iso_pu_bacteria | 2517093001 | 2517104413 | 235 |
| 187 | iso_pu_bacteria | 2528768022 | 2528854613 | 235 |
| 188 | iso_pu_bacteria | 2617270735 | 2617349689 | 235 |
| 189 | iso_pu_bacteria | 2617270741 | 2617376866 | 235 |
| 190 | iso_pu_bacteria | 2643221651 | 2644289818 | 235 |
| 191 | iso_pu_bacteria | 2744054633 | 2745078467 | 235 |
| 192 | iso_pu_bacteria | 2791355196 | 2793059574 | 235 |
| 193 | iso_pu_bacteria | 2802429603 | 2805921036 | 235 |
| 194 | iso_pu_bacteria | 2816332527 | 2818242244 | 235 |
| 195 | iso_pu_bacteria | 2824600985 | 2824607178 | 235 |
| 196 | iso_pu_bacteria | 2824609381 | 2824615122 | 235 |
| 197 | iso_pu_bacteria | 2824617872 | 2824625660 | 235 |
| 198 | iso_pu_bacteria | 2824626560 | 2824633339 | 235 |
| 199 | iso_pu_bacteria | 2824635225 | 2824641852 | 235 |
| 200 | iso_pu_bacteria | 2824644064 | 2824649118 | 235 |
| 201 | iso_pu_bacteria | 2824653114 | 2824659893 | 235 |
| 202 | iso_pu_bacteria | 2824661429 | 2824668442 | 235 |
| 203 | iso_pu_bacteria | 2824671348 | 2824674345 | 235 |
| 204 | iso_pu_bacteria | 2824679649 | 2824686448 | 235 |
| 205 | iso_pu_bacteria | 2824687955 | 2824690799 | 235 |
| 206 | iso_pu_bacteria | 2824696289 | 2824700231 | 235 |
| 207 | iso_pu_bacteria | 2824704595 | 2824711095 | 235 |
| 208 | iso_pu_bacteria | 2824714736 | 2824721349 | 235 |
| 209 | iso_pu_bacteria | 2824723954 | 2824729380 | 235 |
| 210 | iso_pu_bacteria | 2824732956 | 2824738885 | 235 |
| 211 | iso_pu_bacteria | 2824746037 | 2824751320 | 235 |
| 212 | iso_pu_bacteria | 2824753945 | 2824761423 | 235 |
| 213 | iso_pu_bacteria | 2824763712 | 2824771229 | 235 |
| 214 | iso_pu_bacteria | 2824773399 | 2824776936 | 235 |
| 215 | iso_pu_bacteria | 2838122688 | 2838128445 | 235 |
| 216 | iso_pu_bacteria | 2841941048 | 2841942305 | 235 |
| 217 | iso_pu_bacteria | 2841949485 | 2841955565 | 235 |
| 218 | iso_pu_bacteria | 2841957949 | 2841960903 | 235 |
| 219 | iso_pu_bacteria | 2841966195 | 2841971174 | 235 |
| 220 | iso_pu_bacteria | 2841974524 | 2841982292 | 235 |
| 221 | iso_pu_bacteria | 2841983080 | 2841984319 | 235 |
| 222 | iso_pu_bacteria | 2842038055 | 2842041946 | 235 |
| 223 | iso_pu_bacteria | 2842045827 | 2842049989 | 235 |
| 224 | iso_pu_bacteria | 2844315083 | 2844321161 | 235 |
| 225 | iso_pu_bacteria | 2847939898 | 2847943485 | 235 |
| 226 | iso_pu_bacteria | 2849076700 | 2849077206 | 235 |
| 227 | iso_pu_bacteria | 2857509624 | 2857515219 | 235 |
| 228 | iso_pu_bacteria | 2874590934 | 2874592176 | 235 |
| 229 | iso_pu_bacteria | 2874620515 | 2874624065 | 235 |
| 230 | iso_pu_bacteria | 2874628541 | 2874630920 | 235 |
| 231 | iso_pu_bacteria | 2874645413 | 2874647010 | 235 |
| 232 | iso_pu_bacteria | 2876771140 | 2876772387 | 235 |
| 233 | iso_pu_bacteria | 2876818435 | 2876819656 | 235 |
| 234 | iso_pu_bacteria | 2879074833 | 2879076231 | 235 |
| 235 | iso_pu_bacteria | 2879099564 | 2879106343 | 235 |
| 236 | iso_pu_bacteria | 2879127579 | 2879132589 | 235 |
| 237 | iso_pu_bacteria | 2879142872 | 2879144701 | 235 |
| 238 | iso_pu_bacteria | 2881364244 | 2881371080 | 235 |
| 239 | iso_pu_bacteria | 2885366525 | 2885374009 | 235 |
| 240 | iso_pu_bacteria | 2885409591 | 2885412436 | 235 |
| 241 | iso_pu_bacteria | 2888378607 | 2888387443 | 235 |
| 242 | iso_pu_bacteria | 2888388044 | 2888391747 | 235 |
| 243 | iso_pu_bacteria | 2888419890 | 2888426674 | 235 |
| 244 | iso_pu_bacteria | 2903727486 | 2903728585 | 235 |
| 245 | iso_pu_bacteria | 2904666416 | 2904670776 | 235 |
| 246 | iso_pu_bacteria | 2904711408 | 2904713737 | 235 |
| 247 | iso_pu_bacteria | 2906602504 | 2906607776 | 235 |
| 248 | iso_pu_bacteria | 2906626472 | 2906631761 | 235 |
| 249 | iso_pu_bacteria | 2906643746 | 2906649773 | 235 |
| 250 | iso_pu_bacteria | 2908775508 | 2908782764 | 235 |
| 251 | iso_pu_bacteria | 2922368715 | 2922370489 | 235 |
| 252 | iso_pu_bacteria | 2922393267 | 2922396494 | 235 |
| 253 | iso_pu_bacteria | 2929615660 | 2929620069 | 235 |
| 254 | iso_pu_bacteria | 2929624759 | 2929629382 | 235 |
| 255 | iso_pu_bacteria | 2932784394 | 2932791426 | 235 |
| 256 | iso_pu_bacteria | 2932794094 | 2932796835 | 235 |
| 257 | iso_pu_bacteria | 2932801729 | 2932802387 | 235 |
| 258 | iso_pu_bacteria | 2932809354 | 2932815005 | 235 |
| 259 | iso_pu_bacteria | 2932818245 | 2932824138 | 235 |
| 260 | iso_pu_bacteria | 2932828146 | 2932835328 | 235 |
| 261 | iso_pu_bacteria | 2933577622 | 2933581987 | 235 |
| 262 | iso_pu_bacteria | 2935608549 | 2935613422 | 235 |
| 263 | iso_pu_bacteria | 2935616580 | 2935621071 | 235 |
| 264 | iso_pu_bacteria | 2935638405 | 2935643622 | 235 |
| 265 | iso_pu_bacteria | 2935648319 | 2935656511 | 235 |
| 266 | iso_pu_bacteria | 2935656913 | 2935665304 | 235 |
| 267 | iso_pu_bacteria | 2935665750 | 2935671068 | 235 |
| 268 | iso_pu_bacteria | 2935675223 | 2935681326 | 235 |
| 269 | iso_pu_bacteria | 2935684952 | 2935689328 | 235 |
| 270 | iso_pu_bacteria | 2935694250 | 2935699906 | 235 |
| 271 | iso_pu_bacteria | 2935703347 | 2935712163 | 235 |
| 272 | iso_pu_bacteria | 2935713505 | 2935720274 | 235 |
| 273 | iso_pu_bacteria | 2935722832 | 2935728109 | 235 |
| 274 | iso_pu_bacteria | 2935732158 | 2935737294 | 235 |
| 275 | iso_pu_bacteria | 2935741537 | 2935746645 | 235 |
| 276 | iso_pu_bacteria | 2935750917 | 2935757612 | 235 |
| 277 | iso_pu_bacteria | 2935760218 | 2935763988 | 235 |
| 278 | iso_pu_bacteria | 2935769743 | 2935776483 | 235 |
| 279 | iso_pu_bacteria | 2935777560 | 2935784039 | 235 |
| 280 | iso_pu_bacteria | 2935785616 | 2935789911 | 235 |
| 281 | iso_pu_bacteria | 2935793552 | 2935798323 | 235 |
| 282 | iso_pu_bacteria | 2935801545 | 2935807963 | 235 |
| 283 | iso_pu_bacteria | 2935810662 | 2935818701 | 235 |
| 284 | iso_pu_bacteria | 2935827899 | 2935833139 | 235 |
| 285 | iso_pu_bacteria | 2935837841 | 2935844205 | 235 |
| 286 | iso_pu_bacteria | 2935855204 | 2935859736 | 235 |
| 287 | iso_pu_bacteria | 2935864058 | 2935872134 | 235 |
| 288 | iso_pu_bacteria | 2935873716 | 2935878942 | 235 |
| 289 | iso_pu_bacteria | 2935883170 | 2935887177 | 235 |
| 290 | iso_pu_bacteria | 2935908558 | 2935911292 | 235 |
| 291 | iso_pu_bacteria | 2935916978 | 2935920824 | 235 |
| 292 | iso_pu_bacteria | 2935926038 | 2935928321 | 235 |
| 293 | iso_pu_bacteria | 2935934488 | 2935937966 | 235 |
| 294 | iso_pu_bacteria | 2935942939 | 2935945248 | 235 |
| 295 | iso_pu_bacteria | 2935951376 | 2935954246 | 235 |
| 296 | iso_pu_bacteria | 2935959822 | 2935965682 | 235 |
| 297 | iso_pu_bacteria | 2935967501 | 2935971486 | 235 |
| 298 | iso_pu_bacteria | 2935975950 | 2935982105 | 235 |
| 299 | iso_pu_bacteria | 2935984226 | 2935990554 | 235 |
| 300 | iso_pu_bacteria | 2935992306 | 2936000289 | 235 |
| 301 | iso_pu_bacteria | 2936002035 | 2936008447 | 235 |
| 302 | iso_pu_bacteria | 2936011229 | 2936019402 | 235 |
| 303 | iso_pu_bacteria | 2936019824 | 2936027984 | 235 |
| 304 | iso_pu_bacteria | 2936028420 | 2936036767 | 235 |
| 305 | iso_pu_bacteria | 2936037263 | 2936045511 | 235 |
| 306 | iso_pu_bacteria | 2936046547 | 2936054806 | 235 |
| 307 | iso_pu_bacteria | 2936055302 | 2936063242 | 235 |
| 308 | iso_pu_bacteria | 2940556831 | 2940563566 | 235 |
| 309 | iso_pu_bacteria | 2941531003 | 2941537336 | 235 |
| 310 | iso_pu_bacteria | 2941538514 | 2941542537 | 235 |
| 311 | iso_pu_bacteria | 3005506211 | 3005506851 | 235 |
| 312 | iso_pu_bacteria | 3005587118 | 3005591660 | 235 |
| 313 | iso_pu_bacteria | 3005594810 | 3005601490 | 235 |
| 314 | iso_pu_bacteria | 3005710791 | 3005717221 | 235 |
| 315 | iso_pu_bacteria | 3005718088 | 3005724192 | 235 |
| 316 | iso_pu_bacteria | 8016511872 | 8016519422 | 235 |
| 317 | iso_pu_bacteria | 8016522445 | 8016524931 | 235 |
| 318 | iso_pu_bacteria | 8016530956 | 8016538506 | 235 |
| 319 | iso_pu_bacteria | 8016539877 | 8016542788 | 235 |
| 320 | iso_pu_bacteria | 8016548790 | 8016550497 | 235 |
| 321 | iso_pu_bacteria | 8016557553 | 8016558913 | 235 |
| 322 | iso_pu_bacteria | 8016566248 | 8016568176 | 235 |
| 323 | iso_pu_bacteria | 8016575299 | 8016580846 | 235 |
| 324 | iso_pu_bacteria | 8016583857 | 8016587923 | 235 |
| 325 | iso_pu_bacteria | 8016595262 | 8016596876 | 235 |
| 326 | iso_pu_bacteria | 8016613128 | 8016619565 | 235 |
| 327 | iso_pu_bacteria | 8016622563 | 8016630038 | 235 |
| 328 | iso_pu_bacteria | 8016630954 | 8016637125 | 235 |
| 329 | iso_pu_bacteria | 8017057580 | 8017066099 | 235 |
| 330 | iso_pu_bacteria | 8019530166 | 8019538172 | 235 |
| 331 | iso_pu_bacteria | 8019538911 | 8019541813 | 235 |
| 332 | iso_pu_bacteria | 8019547302 | 8019548984 | 235 |
| 333 | iso_pu_bacteria | 8019576017 | 8019578533 | 235 |
| 334 | iso_pu_bacteria | 8019586578 | 8019596582 | 235 |
| 335 | iso_pu_bacteria | 8019597564 | 8019605122 | 235 |
| 336 | iso_pu_bacteria | 8019608314 | 8019613414 | 235 |
| 337 | iso_pu_bacteria | 8019619141 | 8019624091 | 235 |
| 338 | iso_pu_bacteria | 8019629233 | 8019637939 | 235 |
| 339 | iso_pu_bacteria | 8019648815 | 8019653614 | 235 |
| 340 | iso_pu_bacteria | 8019659431 | 8019665867 | 235 |
| 341 | iso_pu_bacteria | 8019668869 | 8019675390 | 235 |
| 342 | iso_pu_bacteria | 8019678201 | 8019680715 | 235 |
| 343 | iso_pu_bacteria | 8019687851 | 8019695055 | 235 |
| 344 | iso_pu_bacteria | 8055742211 | 8055750178 | 235 |
| 345 | iso_pu_bacteria | 8056967851 | 8056975958 | 235 |
| 346 | 3300005367 | Ga0070667_100171547 | Ga0070667_1001715472 | 236 |
| 347 | 3300028380 | Ga0268265_10359950 | Ga0268265_103599502 | 236 |
| 348 | 3300028380 | Ga0268265_10921176 | Ga0268265_109211761 | 236 |
| 349 | 3300035692 | Ga0373935_0043548 | Ga0373935_0043548_190_924 | 236 |
| 350 | 3300035725 | Ga0373947_0145851 | Ga0373947_0145851_686_1420 | 236 |
| 351 | 3300036401 | Ga0373937_0288799 | Ga0373937_0288799_781_1515 | 236 |
| 352 | 3300046459 | Ga0495629_0120018 | Ga0495629_0120018_173_907 | 236 |
| 353 | 3300046472 | Ga0495580_0015651 | Ga0495580_0015651_3654_4388 | 236 |
| 354 | 3300046473 | Ga0495582_0042465 | Ga0495582_0042465_899_1633 | 236 |
| 355 | 3300046477 | Ga0495664_0006706 | Ga0495664_0006706_2226_2960 | 236 |
| 356 | 3300046529 | Ga0495652_0120288 | Ga0495652_0120288_1326_2060 | 236 |
| 357 | 3300046531 | Ga0495665_0036336 | Ga0495665_0036336_924_1658 | 236 |
| 358 | 3300046642 | Ga0495634_0041009 | Ga0495634_0041009_1110_1844 | 236 |
| 359 | 3300046683 | Ga0495658_0008598 | Ga0495658_0008598_3110_3844 | 236 |
| 360 | 3300046689 | Ga0495613_0059184 | Ga0495613_0059184_1563_2297 | 236 |
| 361 | 3300047319 | Ga0495674_0028660 | Ga0495674_0028660_2992_3726 | 236 |
| 362 | 3300047471 | Ga0495684_0034547 | Ga0495684_0034547_1708_2442 | 236 |
| 363 | 3300047673 | Ga0495593_0008457 | Ga0495593_0008457_787_1521 | 236 |
| 364 | 3300049579 | Ga0501043_0047351 | Ga0501043_0047351_480_1193 | 236 |
| 365 | 3300049581 | Ga0501047_0150972 | Ga0501047_0150972_877_1590 | 236 |
| 366 | 3300049583 | Ga0501067_0271461 | Ga0501067_0271461_55_768 | 236 |
| 367 | 3300049822 | Ga0501035_0285945 | Ga0501035_0285945_23_736 | 236 |
| 368 | 3300053087 | Ga0500643_008577 | Ga0500643_008577_140_859 | 236 |
| 369 | 3300053094 | Ga0500566_0079196 | Ga0500566_0079196_412_1143 | 236 |
| 370 | 3300053111 | Ga0500572_000359 | Ga0500572_000359_1777_2508 | 236 |
| 371 | 3300053111 | Ga0500572_012915 | Ga0500572_012915_691_1422 | 236 |
| 372 | 3300053121 | Ga0500607_019835 | Ga0500607_019835_1486_2217 | 236 |
| 373 | 3300053123 | Ga0500614_017173 | Ga0500614_017173_564_1295 | 236 |
| 374 | 3300053136 | Ga0500559_0000213 | Ga0500559_0000213_6142_6873 | 236 |
| 375 | 3300053136 | Ga0500559_0116081 | Ga0500559_0116081_48_779 | 236 |
| 376 | 3300053154 | Ga0500619_131351 | Ga0500619_131351_16_747 | 236 |
| 377 | 3300053177 | Ga0500636_0000701 | Ga0500636_0000701_12577_13308 | 236 |
| 378 | 3300053735 | Ga0500596_003672 | Ga0500596_003672_604_1335 | 236 |
| 379 | iso_pu_bacteria | 2602042107 | 2603857358 | 236 |
| 380 | iso_pu_bacteria | 2857524615 | 2857526738 | 236 |
| 381 | iso_pu_bacteria | 2893066018 | 2893069907 | 236 |
| 382 | iso_pu_bacteria | 2919073203 | 2919077755 | 236 |
| 383 | 3300005331 | Ga0070670_100090092 | Ga0070670_1000900924 | 237 |
| 384 | 3300005334 | Ga0068869_100088818 | Ga0068869_1000888182 | 237 |
| 385 | 3300005337 | Ga0070682_100235047 | Ga0070682_1002350472 | 237 |
| 386 | 3300005338 | Ga0068868_100214344 | Ga0068868_1002143442 | 237 |
| 387 | 3300005347 | Ga0070668_100048131 | Ga0070668_1000481314 | 237 |
| 388 | 3300005354 | Ga0070675_100129332 | Ga0070675_1001293322 | 237 |
| 389 | 3300005440 | Ga0070705_100188194 | Ga0070705_1001881941 | 237 |
| 390 | 3300005455 | Ga0070663_100173188 | Ga0070663_1001731881 | 237 |
| 391 | 3300005467 | Ga0070706_100379580 | Ga0070706_1003795802 | 237 |
| 392 | 3300005539 | Ga0068853_100336583 | Ga0068853_1003365832 | 237 |
| 393 | 3300005563 | Ga0068855_100167070 | Ga0068855_1001670704 | 237 |
| 394 | 3300005577 | Ga0068857_100276969 | Ga0068857_1002769692 | 237 |
| 395 | 3300005614 | Ga0068856_100126841 | Ga0068856_1001268412 | 237 |
| 396 | 3300005618 | Ga0068864_100075170 | Ga0068864_1000751702 | 237 |
| 397 | 3300005840 | Ga0068870_10073852 | Ga0068870_100738524 | 237 |
| 398 | 3300005841 | Ga0068863_100515415 | Ga0068863_1005154152 | 237 |
| 399 | 3300005843 | Ga0068860_100176740 | Ga0068860_1001767402 | 237 |
| 400 | 3300005844 | Ga0068862_100695544 | Ga0068862_1006955441 | 237 |
| 401 | 3300005937 | Ga0081455_10017805 | Ga0081455_100178056 | 237 |
| 402 | 3300005983 | Ga0081540_1026389 | Ga0081540_10263892 | 237 |
| 403 | 3300006042 | Ga0075368_10023518 | Ga0075368_100235182 | 237 |
| 404 | 3300006042 | Ga0075368_10051708 | Ga0075368_100517082 | 237 |
| 405 | 3300006353 | Ga0075370_10039242 | Ga0075370_100392422 | 237 |
| 406 | 3300006871 | Ga0075434_100347803 | Ga0075434_1003478032 | 237 |
| 407 | 3300007076 | Ga0075435_100049538 | Ga0075435_1000495383 | 237 |
| 408 | 3300025297 | Ga0209758_1010620 | Ga0209758_10106203 | 237 |
| 409 | 3300025901 | Ga0207688_10253643 | Ga0207688_102536431 | 237 |
| 410 | 3300025908 | Ga0207643_10046638 | Ga0207643_100466382 | 237 |
| 411 | 3300025914 | Ga0207671_10023035 | Ga0207671_100230354 | 237 |
| 412 | 3300025919 | Ga0207657_10207014 | Ga0207657_102070142 | 237 |
| 413 | 3300025926 | Ga0207659_10067361 | Ga0207659_100673613 | 237 |
| 414 | 3300025927 | Ga0207687_10143028 | Ga0207687_101430283 | 237 |
| 415 | 3300025949 | Ga0207667_10388639 | Ga0207667_103886392 | 237 |
| 416 | 3300026023 | Ga0207677_10175047 | Ga0207677_101750472 | 237 |
| 417 | 3300026035 | Ga0207703_10037399 | Ga0207703_100373992 | 237 |
| 418 | 3300026041 | Ga0207639_10132396 | Ga0207639_101323962 | 237 |
| 419 | 3300026041 | Ga0207639_10306945 | Ga0207639_103069452 | 237 |
| 420 | 3300026067 | Ga0207678_10251447 | Ga0207678_102514472 | 237 |
| 421 | 3300026116 | Ga0207674_10112822 | Ga0207674_101128222 | 237 |
| 422 | 3300026121 | Ga0207683_10268995 | Ga0207683_102689952 | 237 |
| 423 | 3300028379 | Ga0268266_10062684 | Ga0268266_100626842 | 237 |
| 424 | 3300028786 | Ga0307517_10265496 | Ga0307517_102654962 | 237 |
| 425 | 3300031456 | Ga0307513_10231530 | Ga0307513_102315302 | 237 |
| 426 | 3300031507 | Ga0307509_10389308 | Ga0307509_103893081 | 237 |
| 427 | 3300033180 | Ga0307510_10015785 | Ga0307510_100157856 | 237 |
| 428 | 3300033180 | Ga0307510_10263892 | Ga0307510_102638921 | 237 |
| 429 | 3300046452 | Ga0495617_094833 | Ga0495617_094833_141_857 | 237 |
| 430 | 3300046457 | Ga0495590_0151584 | Ga0495590_0151584_95_811 | 237 |
| 431 | 3300046499 | Ga0495594_0036768 | Ga0495594_0036768_1486_2202 | 237 |
| 432 | 3300046519 | Ga0495632_0073862 | Ga0495632_0073862_584_1300 | 237 |
| 433 | 3300046519 | Ga0495632_0086538 | Ga0495632_0086538_340_1056 | 237 |
| 434 | 3300046538 | Ga0495609_0011033 | Ga0495609_0011033_421_1137 | 237 |
| 435 | 3300046557 | Ga0495622_0213779 | Ga0495622_0213779_47_763 | 237 |
| 436 | 3300046616 | Ga0495668_0109174 | Ga0495668_0109174_553_1269 | 237 |
| 437 | 3300046648 | Ga0495611_0193081 | Ga0495611_0193081_11_727 | 237 |
| 438 | 3300048914 | Ga0496111_0095289 | Ga0496111_0095289_1430_2146 | 237 |
| 439 | 3300049570 | Ga0501033_0028461 | Ga0501033_0028461_3210_3935 | 237 |
| 440 | 3300049570 | Ga0501033_0185603 | Ga0501033_0185603_495_1220 | 237 |
| 441 | 3300049574 | Ga0501038_0097617 | Ga0501038_0097617_320_1045 | 237 |
| 442 | 3300049579 | Ga0501043_0089125 | Ga0501043_0089125_22_747 | 237 |
| 443 | 3300049580 | Ga0501046_0150188 | Ga0501046_0150188_50_775 | 237 |
| 444 | 3300049581 | Ga0501047_0020075 | Ga0501047_0020075_3086_3811 | 237 |
| 445 | 3300049586 | Ga0501070_0040767 | Ga0501070_0040767_390_1115 | 237 |
| 446 | 3300049822 | Ga0501035_0484760 | Ga0501035_0484760_262_987 | 237 |
| 447 | 3300049823 | Ga0501044_0059643 | Ga0501044_0059643_2632_3357 | 237 |
| 448 | 3300049823 | Ga0501044_0198924 | Ga0501044_0198924_319_1038 | 237 |
| 449 | 3300049823 | Ga0501044_0611666 | Ga0501044_0611666_215_940 | 237 |
| 450 | 3300050491 | nmdc:mga00v17_74333_c1 | nmdc:mga00v17_74333_c1_404_1120 | 237 |
| 451 | 3300050495 | nmdc:mga04h51_13109_c1 | nmdc:mga04h51_13109_c1_734_1450 | 237 |
| 452 | 3300050496 | nmdc:mga07m45_178273_c1 | nmdc:mga07m45_178273_c1_393_1109 | 237 |
| 453 | 3300050513 | nmdc:mga0rr50_240054_c1 | nmdc:mga0rr50_240054_c1_150_866 | 237 |
| 454 | 3300050516 | nmdc:mga0sz30_128200_c1 | nmdc:mga0sz30_128200_c1_222_938 | 237 |
| 455 | 3300053108 | Ga0500562_068407 | Ga0500562_068407_215_931 | 237 |
| 456 | 3300053142 | Ga0500577_0136206 | Ga0500577_0136206_141_857 | 237 |
| 457 | 3300053148 | Ga0500590_103286 | Ga0500590_103286_488_1204 | 237 |
| 458 | 3300053178 | Ga0500637_0103308 | Ga0500637_0103308_420_1136 | 237 |
| 459 | iso_pu_bacteria | 2508501128 | 2509146560 | 237 |
| 460 | iso_pu_bacteria | 2513237141 | 2513887804 | 237 |
| 461 | iso_pu_bacteria | 2935819856 | 2935824725 | 237 |
| 462 | iso_pu_bacteria | 2935847175 | 2935851945 | 237 |
| 463 | 3300003794 | Ga0055531_10028485 | Ga0055531_100284851 | 238 |
| 464 | 3300005262 | Ga0065165_1006799 | Ga0065165_10067992 | 238 |
| 465 | 3300005436 | Ga0070713_100139429 | Ga0070713_1001394292 | 238 |
| 466 | 3300006942 | Ga0099824_1016547 | Ga0099824_10165476 | 238 |
| 467 | 3300025245 | Ga0207425_1014810 | Ga0207425_10148102 | 238 |
| 468 | 3300025295 | Ga0209564_1036007 | Ga0209564_10360072 | 238 |
| 469 | 3300025297 | Ga0209758_1000595 | Ga0209758_100059548 | 238 |
| 470 | 3300025297 | Ga0209758_1001054 | Ga0209758_10010547 | 238 |
| 471 | 3300025299 | Ga0209256_1004224 | Ga0209256_10042247 | 238 |
| 472 | 3300025304 | Ga0209257_1009208 | Ga0209257_10092082 | 238 |
| 473 | 3300025928 | Ga0207700_10062861 | Ga0207700_100628612 | 238 |
| 474 | 3300026035 | Ga0207703_10861325 | Ga0207703_108613251 | 238 |
| 475 | 3300027296 | Ga0209389_1000070 | Ga0209389_100007076 | 238 |
| 476 | 3300027357 | Ga0209589_1000420 | Ga0209589_100042032 | 238 |
| 477 | 3300027361 | Ga0209489_100196 | Ga0209489_10019636 | 238 |
| 478 | 3300031824 | Ga0307413_10114291 | Ga0307413_101142912 | 238 |
| 479 | 3300046475 | Ga0495639_0052234 | Ga0495639_0052234_32_760 | 238 |
| 480 | 3300049568 | Ga0501031_0179153 | Ga0501031_0179153_469_1188 | 238 |
| 481 | 3300049569 | Ga0501032_0110562 | Ga0501032_0110562_14_733 | 238 |
| 482 | 3300049571 | Ga0501034_0108610 | Ga0501034_0108610_1848_2567 | 238 |
| 483 | 3300049571 | Ga0501034_0141805 | Ga0501034_0141805_1241_1960 | 238 |
| 484 | 3300049573 | Ga0501037_0120281 | Ga0501037_0120281_462_1181 | 238 |
| 485 | 3300049574 | Ga0501038_0037416 | Ga0501038_0037416_1371_2090 | 238 |
| 486 | 3300049574 | Ga0501038_0077914 | Ga0501038_0077914_1371_2090 | 238 |
| 487 | 3300049575 | Ga0501039_0015440 | Ga0501039_0015440_4041_4760 | 238 |
| 488 | 3300049576 | Ga0501040_0191143 | Ga0501040_0191143_13_732 | 238 |
| 489 | 3300049578 | Ga0501042_0008737 | Ga0501042_0008737_3389_4108 | 238 |
| 490 | 3300049579 | Ga0501043_0115831 | Ga0501043_0115831_25_744 | 238 |
| 491 | 3300049580 | Ga0501046_0283733 | Ga0501046_0283733_469_1188 | 238 |
| 492 | 3300049582 | Ga0501048_0076181 | Ga0501048_0076181_944_1663 | 238 |
| 493 | 3300049583 | Ga0501067_0002890 | Ga0501067_0002890_3553_4272 | 238 |
| 494 | 3300049584 | Ga0501068_0057644 | Ga0501068_0057644_525_1244 | 238 |
| 495 | 3300049585 | Ga0501069_0011635 | Ga0501069_0011635_1820_2539 | 238 |
| 496 | 3300049587 | Ga0501071_0024865 | Ga0501071_0024865_602_1321 | 238 |
| 497 | 3300049590 | Ga0501074_0006127 | Ga0501074_0006127_6922_7641 | 238 |
| 498 | 3300049591 | Ga0501075_0197835 | Ga0501075_0197835_435_1154 | 238 |
| 499 | 3300049592 | Ga0501076_0119822 | Ga0501076_0119822_1019_1738 | 238 |
| 500 | 3300049741 | Ga0501079_0048999 | Ga0501079_0048999_686_1405 | 238 |
| 501 | 3300049742 | Ga0501080_0286480 | Ga0501080_0286480_685_1404 | 238 |
| 502 | 3300049744 | Ga0501083_0040696 | Ga0501083_0040696_873_1592 | 238 |
| 503 | 3300049822 | Ga0501035_0028638 | Ga0501035_0028638_3679_4398 | 238 |
| 504 | 3300049824 | Ga0501045_0034526 | Ga0501045_0034526_225_944 | 238 |
| 505 | 3300050491 | nmdc:mga00v17_116781_c1 | nmdc:mga00v17_116781_c1_774_1493 | 238 |
| 506 | 3300053139 | Ga0500568_0008101 | Ga0500568_0008101_1967_2689 | 238 |
| 507 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_267239_267961 | 238 |
| 508 | 3300054114 | Ga0501084_0155011 | Ga0501084_0155011_744_1463 | 238 |
| 509 | 3300060353 | Ga0501082_0068963 | Ga0501082_0068963_2096_2815 | 238 |
| 510 | 3300003215 | JGI25153J46596_10013457 | JGI25153J46596_100134573 | 239 |
| 511 | 3300003215 | JGI25153J46596_10029857 | JGI25153J46596_100298572 | 239 |
| 512 | 3300003354 | JGI25160J50197_1025725 | JGI25160J50197_10257251 | 239 |
| 513 | 3300003752 | Ga0055539_1003892 | Ga0055539_10038922 | 239 |
| 514 | 3300003752 | Ga0055539_1004871 | Ga0055539_10048712 | 239 |
| 515 | 3300003762 | Ga0055542_1009699 | Ga0055542_10096992 | 239 |
| 516 | 3300004625 | Ga0055543_1013404 | Ga0055543_10134042 | 239 |
| 517 | 3300005262 | Ga0065165_1001267 | Ga0065165_100126728 | 239 |
| 518 | 3300005262 | Ga0065165_1004525 | Ga0065165_100452510 | 239 |
| 519 | 3300005327 | Ga0070658_10213804 | Ga0070658_102138042 | 239 |
| 520 | 3300005329 | Ga0070683_100330344 | Ga0070683_1003303442 | 239 |
| 521 | 3300005336 | Ga0070680_100072883 | Ga0070680_1000728832 | 239 |
| 522 | 3300005337 | Ga0070682_100109008 | Ga0070682_1001090082 | 239 |
| 523 | 3300005338 | Ga0068868_100172568 | Ga0068868_1001725682 | 239 |
| 524 | 3300005338 | Ga0068868_100674085 | Ga0068868_1006740851 | 239 |
| 525 | 3300005339 | Ga0070660_100002476 | Ga0070660_10000247612 | 239 |
| 526 | 3300005339 | Ga0070660_100463178 | Ga0070660_1004631782 | 239 |
| 527 | 3300005344 | Ga0070661_100484152 | Ga0070661_1004841521 | 239 |
| 528 | 3300005353 | Ga0070669_100079970 | Ga0070669_1000799702 | 239 |
| 529 | 3300005366 | Ga0070659_100070297 | Ga0070659_1000702971 | 239 |
| 530 | 3300005435 | Ga0070714_100237033 | Ga0070714_1002370332 | 239 |
| 531 | 3300005455 | Ga0070663_100483539 | Ga0070663_1004835391 | 239 |
| 532 | 3300005467 | Ga0070706_100107535 | Ga0070706_1001075353 | 239 |
| 533 | 3300005535 | Ga0070684_100086722 | Ga0070684_1000867222 | 239 |
| 534 | 3300005539 | Ga0068853_100004362 | Ga0068853_10000436211 | 239 |
| 535 | 3300005539 | Ga0068853_100168652 | Ga0068853_1001686522 | 239 |
| 536 | 3300005563 | Ga0068855_100079813 | Ga0068855_1000798135 | 239 |
| 537 | 3300005563 | Ga0068855_100349358 | Ga0068855_1003493582 | 239 |
| 538 | 3300005577 | Ga0068857_100070603 | Ga0068857_1000706033 | 239 |
| 539 | 3300005578 | Ga0068854_100356437 | Ga0068854_1003564372 | 239 |
| 540 | 3300005614 | Ga0068856_100176110 | Ga0068856_1001761102 | 239 |
| 541 | 3300005616 | Ga0068852_100026622 | Ga0068852_1000266222 | 239 |
| 542 | 3300005616 | Ga0068852_100199728 | Ga0068852_1001997284 | 239 |
| 543 | 3300005842 | Ga0068858_100123719 | Ga0068858_1001237192 | 239 |
| 544 | 3300006038 | Ga0075365_10052809 | Ga0075365_100528092 | 239 |
| 545 | 3300006038 | Ga0075365_10140637 | Ga0075365_101406372 | 239 |
| 546 | 3300006042 | Ga0075368_10121131 | Ga0075368_101211312 | 239 |
| 547 | 3300006051 | Ga0075364_10010357 | Ga0075364_100103573 | 239 |
| 548 | 3300006051 | Ga0075364_10202487 | Ga0075364_102024872 | 239 |
| 549 | 3300006186 | Ga0075369_10046187 | Ga0075369_100461872 | 239 |
| 550 | 3300006186 | Ga0075369_10051215 | Ga0075369_100512152 | 239 |
| 551 | 3300006186 | Ga0075369_10088830 | Ga0075369_100888302 | 239 |
| 552 | 3300006195 | Ga0075366_10063909 | Ga0075366_100639092 | 239 |
| 553 | 3300006195 | Ga0075366_10191008 | Ga0075366_101910082 | 239 |
| 554 | 3300006353 | Ga0075370_10035526 | Ga0075370_100355262 | 239 |
| 555 | 3300006871 | Ga0075434_100079368 | Ga0075434_1000793685 | 239 |
| 556 | 3300009093 | Ga0105240_10044757 | Ga0105240_100447573 | 239 |
| 557 | 3300009545 | Ga0105237_10015525 | Ga0105237_100155259 | 239 |
| 558 | 3300009551 | Ga0105238_10100766 | Ga0105238_101007663 | 239 |
| 559 | 3300013104 | Ga0157370_10108059 | Ga0157370_101080592 | 239 |
| 560 | 3300013105 | Ga0157369_10019439 | Ga0157369_100194392 | 239 |
| 561 | 3300015261 | Ga0182006_1082003 | Ga0182006_10820032 | 239 |
| 562 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007370 | 239 |
| 563 | 3300021321 | Ga0214542_1000007 | Ga0214542_100000711 | 239 |
| 564 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006281 | 239 |
| 565 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009370 | 239 |
| 566 | 3300025230 | Ga0209563_101359 | Ga0209563_1013595 | 239 |
| 567 | 3300025253 | Ga0209677_100233 | Ga0209677_10023311 | 239 |
| 568 | 3300025253 | Ga0209677_103592 | Ga0209677_1035922 | 239 |
| 569 | 3300025254 | Ga0209148_1000232 | Ga0209148_100023281 | 239 |
| 570 | 3300025261 | Ga0209233_1003521 | Ga0209233_10035212 | 239 |
| 571 | 3300025261 | Ga0209233_1004158 | Ga0209233_10041585 | 239 |
| 572 | 3300025272 | Ga0209455_1002812 | Ga0209455_10028126 | 239 |
| 573 | 3300025272 | Ga0209455_1007018 | Ga0209455_10070181 | 239 |
| 574 | 3300025272 | Ga0209455_1008185 | Ga0209455_10081853 | 239 |
| 575 | 3300025272 | Ga0209455_1009485 | Ga0209455_10094851 | 239 |
| 576 | 3300025273 | Ga0209673_1064359 | Ga0209673_10643592 | 239 |
| 577 | 3300025295 | Ga0209564_1000397 | Ga0209564_100039778 | 239 |
| 578 | 3300025295 | Ga0209564_1028802 | Ga0209564_10288022 | 239 |
| 579 | 3300025297 | Ga0209758_1000604 | Ga0209758_100060411 | 239 |
| 580 | 3300025297 | Ga0209758_1000767 | Ga0209758_100076716 | 239 |
| 581 | 3300025297 | Ga0209758_1004139 | Ga0209758_10041398 | 239 |
| 582 | 3300025297 | Ga0209758_1012657 | Ga0209758_10126575 | 239 |
| 583 | 3300025302 | Ga0207426_1000500 | Ga0207426_100050057 | 239 |
| 584 | 3300025302 | Ga0207426_1004976 | Ga0207426_10049764 | 239 |
| 585 | 3300025302 | Ga0207426_1043155 | Ga0207426_10431552 | 239 |
| 586 | 3300025304 | Ga0209257_1045053 | Ga0209257_10450532 | 239 |
| 587 | 3300025321 | Ga0207656_10128738 | Ga0207656_101287382 | 239 |
| 588 | 3300025321 | Ga0207656_10138617 | Ga0207656_101386171 | 239 |
| 589 | 3300025900 | Ga0207710_10039124 | Ga0207710_100391243 | 239 |
| 590 | 3300025901 | Ga0207688_10050908 | Ga0207688_100509082 | 239 |
| 591 | 3300025904 | Ga0207647_10059208 | Ga0207647_100592083 | 239 |
| 592 | 3300025904 | Ga0207647_10079655 | Ga0207647_100796553 | 239 |
| 593 | 3300025904 | Ga0207647_10155228 | Ga0207647_101552282 | 239 |
| 594 | 3300025909 | Ga0207705_10083979 | Ga0207705_100839792 | 239 |
| 595 | 3300025910 | Ga0207684_10086257 | Ga0207684_100862573 | 239 |
| 596 | 3300025911 | Ga0207654_10331582 | Ga0207654_103315821 | 239 |
| 597 | 3300025912 | Ga0207707_10003099 | Ga0207707_1000309916 | 239 |
| 598 | 3300025913 | Ga0207695_10000123 | Ga0207695_1000012380 | 239 |
| 599 | 3300025914 | Ga0207671_10073633 | Ga0207671_100736333 | 239 |
| 600 | 3300025914 | Ga0207671_10204781 | Ga0207671_102047812 | 239 |
| 601 | 3300025917 | Ga0207660_10006884 | Ga0207660_100068847 | 239 |
| 602 | 3300025919 | Ga0207657_10014727 | Ga0207657_100147274 | 239 |
| 603 | 3300025919 | Ga0207657_10089154 | Ga0207657_100891542 | 239 |
| 604 | 3300025920 | Ga0207649_10184282 | Ga0207649_101842822 | 239 |
| 605 | 3300025920 | Ga0207649_10353362 | Ga0207649_103533622 | 239 |
| 606 | 3300025921 | Ga0207652_10002148 | Ga0207652_100021486 | 239 |
| 607 | 3300025924 | Ga0207694_10007559 | Ga0207694_100075599 | 239 |
| 608 | 3300025924 | Ga0207694_10123561 | Ga0207694_101235612 | 239 |
| 609 | 3300025925 | Ga0207650_10118742 | Ga0207650_101187422 | 239 |
| 610 | 3300025927 | Ga0207687_10459442 | Ga0207687_104594422 | 239 |
| 611 | 3300025929 | Ga0207664_10186700 | Ga0207664_101867002 | 239 |
| 612 | 3300025931 | Ga0207644_10575699 | Ga0207644_105756992 | 239 |
| 613 | 3300025932 | Ga0207690_10387413 | Ga0207690_103874132 | 239 |
| 614 | 3300025933 | Ga0207706_10387338 | Ga0207706_103873382 | 239 |
| 615 | 3300025942 | Ga0207689_10128989 | Ga0207689_101289893 | 239 |
| 616 | 3300025944 | Ga0207661_10179767 | Ga0207661_101797672 | 239 |
| 617 | 3300025949 | Ga0207667_10001989 | Ga0207667_1000198919 | 239 |
| 618 | 3300025949 | Ga0207667_10066955 | Ga0207667_100669552 | 239 |
| 619 | 3300025960 | Ga0207651_10255622 | Ga0207651_102556222 | 239 |
| 620 | 3300025961 | Ga0207712_10113636 | Ga0207712_101136363 | 239 |
| 621 | 3300025981 | Ga0207640_10401963 | Ga0207640_104019632 | 239 |
| 622 | 3300026035 | Ga0207703_10437086 | Ga0207703_104370862 | 239 |
| 623 | 3300026041 | Ga0207639_10011300 | Ga0207639_100113005 | 239 |
| 624 | 3300026067 | Ga0207678_10081217 | Ga0207678_100812172 | 239 |
| 625 | 3300026067 | Ga0207678_10175431 | Ga0207678_101754312 | 239 |
| 626 | 3300026078 | Ga0207702_10060371 | Ga0207702_100603713 | 239 |
| 627 | 3300026078 | Ga0207702_10231573 | Ga0207702_102315732 | 239 |
| 628 | 3300026088 | Ga0207641_10188063 | Ga0207641_101880632 | 239 |
| 629 | 3300026089 | Ga0207648_10400720 | Ga0207648_104007202 | 239 |
| 630 | 3300026095 | Ga0207676_10541473 | Ga0207676_105414732 | 239 |
| 631 | 3300026116 | Ga0207674_10042067 | Ga0207674_100420674 | 239 |
| 632 | 3300026116 | Ga0207674_10474263 | Ga0207674_104742632 | 239 |
| 633 | 3300026116 | Ga0207674_10708123 | Ga0207674_107081232 | 239 |
| 634 | 3300026118 | Ga0207675_100481199 | Ga0207675_1004811991 | 239 |
| 635 | 3300026142 | Ga0207698_10104451 | Ga0207698_101044512 | 239 |
| 636 | 3300026142 | Ga0207698_10797528 | Ga0207698_107975282 | 239 |
| 637 | 3300027671 | Ga0209588_1029138 | Ga0209588_10291382 | 239 |
| 638 | 3300027866 | Ga0209813_10039720 | Ga0209813_100397202 | 239 |
| 639 | 3300028379 | Ga0268266_10024634 | Ga0268266_100246346 | 239 |
| 640 | 3300028379 | Ga0268266_10249547 | Ga0268266_102495472 | 239 |
| 641 | 3300028381 | Ga0268264_10546741 | Ga0268264_105467412 | 239 |
| 642 | 3300028573 | Ga0265334_10008193 | Ga0265334_100081934 | 239 |
| 643 | 3300028653 | Ga0265323_10035465 | Ga0265323_100354651 | 239 |
| 644 | 3300028654 | Ga0265322_10027844 | Ga0265322_100278442 | 239 |
| 645 | 3300028666 | Ga0265336_10039885 | Ga0265336_100398852 | 239 |
| 646 | 3300028800 | Ga0265338_10000271 | Ga0265338_1000027164 | 239 |
| 647 | 3300031235 | Ga0265330_10055583 | Ga0265330_100555833 | 239 |
| 648 | 3300031235 | Ga0265330_10082420 | Ga0265330_100824201 | 239 |
| 649 | 3300031238 | Ga0265332_10004083 | Ga0265332_100040838 | 239 |
| 650 | 3300031238 | Ga0265332_10011711 | Ga0265332_100117113 | 239 |
| 651 | 3300031247 | Ga0265340_10004004 | Ga0265340_100040042 | 239 |
| 652 | 3300031249 | Ga0265339_10030336 | Ga0265339_100303362 | 239 |
| 653 | 3300031250 | Ga0265331_10088418 | Ga0265331_100884182 | 239 |
| 654 | 3300031344 | Ga0265316_10141170 | Ga0265316_101411702 | 239 |
| 655 | 3300031616 | Ga0307508_10000019 | Ga0307508_1000001914 | 239 |
| 656 | 3300031711 | Ga0265314_10134029 | Ga0265314_101340292 | 239 |
| 657 | 3300031712 | Ga0265342_10096814 | Ga0265342_100968141 | 239 |
| 658 | 3300031712 | Ga0265342_10126168 | Ga0265342_101261682 | 239 |
| 659 | 3300032126 | Ga0307415_100049205 | Ga0307415_1000492052 | 239 |
| 660 | 3300033544 | Ga0316215_1001986 | Ga0316215_10019862 | 239 |
| 661 | 3300035086 | Ga0373934_0000917 | Ga0373934_0000917_897_1619 | 239 |
| 662 | 3300035118 | Ga0373954_0031917 | Ga0373954_0031917_1506_2228 | 239 |
| 663 | 3300035170 | Ga0373943_0112434 | Ga0373943_0112434_149_871 | 239 |
| 664 | 3300035410 | Ga0373924_0011735 | Ga0373924_0011735_758_1480 | 239 |
| 665 | 3300035692 | Ga0373935_0001273 | Ga0373935_0001273_1602_2324 | 239 |
| 666 | 3300035695 | Ga0373927_0038479 | Ga0373927_0038479_1077_1799 | 239 |
| 667 | 3300035724 | Ga0373933_0001270 | Ga0373933_0001270_11577_12299 | 239 |
| 668 | 3300035724 | Ga0373933_0377967 | Ga0373933_0377967_49_771 | 239 |
| 669 | 3300035725 | Ga0373947_0300029 | Ga0373947_0300029_280_1002 | 239 |
| 670 | 3300037068 | Ga0373925_0025224 | Ga0373925_0025224_3089_3811 | 239 |
| 671 | 3300037312 | Ga0395899_0016833 | Ga0395899_0016833_2105_2830 | 239 |
| 672 | 3300037418 | Ga0395900_0005676 | Ga0395900_0005676_254_979 | 239 |
| 673 | 3300037466 | Ga0395898_0148304 | Ga0395898_0148304_114_839 | 239 |
| 674 | 3300037471 | Ga0395905_0168777 | Ga0395905_0168777_13_735 | 239 |
| 675 | 3300038443 | Ga0395901_0252899 | Ga0395901_0252899_237_962 | 239 |
| 676 | 3300044656 | Ga0466969_0053098 | Ga0466969_0053098_504_1226 | 239 |
| 677 | 3300046454 | Ga0495592_0002895 | Ga0495592_0002895_9325_10047 | 239 |
| 678 | 3300046459 | Ga0495629_0013674 | Ga0495629_0013674_2199_2921 | 239 |
| 679 | 3300046462 | Ga0495651_0032501 | Ga0495651_0032501_629_1351 | 239 |
| 680 | 3300046462 | Ga0495651_0149552 | Ga0495651_0149552_653_1375 | 239 |
| 681 | 3300046463 | Ga0495653_0039229 | Ga0495653_0039229_1506_2228 | 239 |
| 682 | 3300046463 | Ga0495653_0153616 | Ga0495653_0153616_801_1523 | 239 |
| 683 | 3300046477 | Ga0495664_0335072 | Ga0495664_0335072_92_814 | 239 |
| 684 | 3300046506 | Ga0495583_0084423 | Ga0495583_0084423_348_1070 | 239 |
| 685 | 3300046511 | Ga0495608_0018798 | Ga0495608_0018798_2197_2919 | 239 |
| 686 | 3300046512 | Ga0495610_0120983 | Ga0495610_0120983_100_822 | 239 |
| 687 | 3300046522 | Ga0495643_0193385 | Ga0495643_0193385_59_781 | 239 |
| 688 | 3300046524 | Ga0495648_0102411 | Ga0495648_0102411_23_745 | 239 |
| 689 | 3300046533 | Ga0495640_0065705 | Ga0495640_0065705_741_1463 | 239 |
| 690 | 3300046536 | Ga0495587_0059261 | Ga0495587_0059261_1506_2228 | 239 |
| 691 | 3300046616 | Ga0495668_0063261 | Ga0495668_0063261_1101_1823 | 239 |
| 692 | 3300046642 | Ga0495634_0055720 | Ga0495634_0055720_778_1500 | 239 |
| 693 | 3300046663 | Ga0495635_0003585 | Ga0495635_0003585_7095_7817 | 239 |
| 694 | 3300046678 | Ga0495599_0343515 | Ga0495599_0343515_84_806 | 239 |
| 695 | 3300046680 | Ga0495646_0025234 | Ga0495646_0025234_1676_2398 | 239 |
| 696 | 3300046692 | Ga0495671_0050099 | Ga0495671_0050099_454_1176 | 239 |
| 697 | 3300046809 | Ga0495600_0043141 | Ga0495600_0043141_2013_2735 | 239 |
| 698 | 3300047317 | Ga0495604_0028908 | Ga0495604_0028908_27_749 | 239 |
| 699 | 3300047319 | Ga0495674_0032846 | Ga0495674_0032846_2222_2944 | 239 |
| 700 | 3300047319 | Ga0495674_0252838 | Ga0495674_0252838_320_1042 | 239 |
| 701 | 3300047320 | Ga0495672_0069898 | Ga0495672_0069898_1105_1830 | 239 |
| 702 | 3300047321 | Ga0495676_0307413 | Ga0495676_0307413_252_992 | 239 |
| 703 | 3300047321 | Ga0495676_0351686 | Ga0495676_0351686_143_865 | 239 |
| 704 | 3300047322 | Ga0495680_0029831 | Ga0495680_0029831_3662_4384 | 239 |
| 705 | 3300047322 | Ga0495680_0412212 | Ga0495680_0412212_59_781 | 239 |
| 706 | 3300047444 | Ga0495675_0009683 | Ga0495675_0009683_3337_4059 | 239 |
| 707 | 3300047469 | Ga0495673_0018097 | Ga0495673_0018097_2041_2763 | 239 |
| 708 | 3300047471 | Ga0495684_0005264 | Ga0495684_0005264_2982_3704 | 239 |
| 709 | 3300047472 | Ga0495686_0205366 | Ga0495686_0205366_262_987 | 239 |
| 710 | 3300047673 | Ga0495593_0011366 | Ga0495593_0011366_2110_2832 | 239 |
| 711 | 3300048088 | Ga0495602_0073666 | Ga0495602_0073666_1978_2700 | 239 |
| 712 | 3300048904 | Ga0496101_0098562 | Ga0496101_0098562_810_1535 | 239 |
| 713 | 3300048907 | Ga0496104_0245151 | Ga0496104_0245151_674_1399 | 239 |
| 714 | 3300048909 | Ga0496106_0001417 | Ga0496106_0001417_1709_2434 | 239 |
| 715 | 3300048909 | Ga0496106_0575565 | Ga0496106_0575565_144_869 | 239 |
| 716 | 3300048910 | Ga0496107_0002177 | Ga0496107_0002177_5382_6107 | 239 |
| 717 | 3300048911 | Ga0496108_0000467 | Ga0496108_0000467_2367_3092 | 239 |
| 718 | 3300048911 | Ga0496108_0590469 | Ga0496108_0590469_131_853 | 239 |
| 719 | 3300048912 | Ga0496109_0000230 | Ga0496109_0000230_10205_10930 | 239 |
| 720 | 3300048914 | Ga0496111_0052529 | Ga0496111_0052529_641_1366 | 239 |
| 721 | 3300048915 | Ga0496112_0019046 | Ga0496112_0019046_2777_3502 | 239 |
| 722 | 3300048915 | Ga0496112_0110284 | Ga0496112_0110284_1946_2668 | 239 |
| 723 | 3300048916 | Ga0496113_0278618 | Ga0496113_0278618_441_1163 | 239 |
| 724 | 3300048918 | Ga0496115_0043174 | Ga0496115_0043174_2162_2884 | 239 |
| 725 | 3300048918 | Ga0496115_0301120 | Ga0496115_0301120_266_991 | 239 |
| 726 | 3300048918 | Ga0496115_0383584 | Ga0496115_0383584_73_795 | 239 |
| 727 | 3300048921 | Ga0496118_0105501 | Ga0496118_0105501_150_875 | 239 |
| 728 | 3300048922 | Ga0496119_0071005 | Ga0496119_0071005_1013_1735 | 239 |
| 729 | 3300048923 | Ga0496120_0019417 | Ga0496120_0019417_3376_4098 | 239 |
| 730 | 3300048923 | Ga0496120_0098975 | Ga0496120_0098975_61_786 | 239 |
| 731 | 3300048924 | Ga0496121_0002081 | Ga0496121_0002081_1853_2578 | 239 |
| 732 | 3300048925 | Ga0496122_0172358 | Ga0496122_0172358_428_1150 | 239 |
| 733 | 3300048926 | Ga0496123_0028199 | Ga0496123_0028199_2738_3460 | 239 |
| 734 | 3300048926 | Ga0496123_0056798 | Ga0496123_0056798_183_905 | 239 |
| 735 | 3300048927 | Ga0496124_0211212 | Ga0496124_0211212_123_845 | 239 |
| 736 | 3300048928 | Ga0496125_0000158 | Ga0496125_0000158_38862_39584 | 239 |
| 737 | 3300048928 | Ga0496125_0033804 | Ga0496125_0033804_96_818 | 239 |
| 738 | 3300048929 | Ga0496126_0049756 | Ga0496126_0049756_978_1703 | 239 |
| 739 | 3300048929 | Ga0496126_0142825 | Ga0496126_0142825_243_965 | 239 |
| 740 | 3300048929 | Ga0496126_0190487 | Ga0496126_0190487_110_832 | 239 |
| 741 | 3300048929 | Ga0496126_0198854 | Ga0496126_0198854_156_878 | 239 |
| 742 | 3300048929 | Ga0496126_0238105 | Ga0496126_0238105_700_1422 | 239 |
| 743 | 3300048929 | Ga0496126_0461679 | Ga0496126_0461679_279_1001 | 239 |
| 744 | 3300049570 | Ga0501033_0079879 | Ga0501033_0079879_1268_1993 | 239 |
| 745 | 3300049571 | Ga0501034_0152435 | Ga0501034_0152435_179_904 | 239 |
| 746 | 3300049571 | Ga0501034_0370071 | Ga0501034_0370071_158_883 | 239 |
| 747 | 3300049573 | Ga0501037_0127934 | Ga0501037_0127934_275_1003 | 239 |
| 748 | 3300049574 | Ga0501038_0251239 | Ga0501038_0251239_523_1248 | 239 |
| 749 | 3300049574 | Ga0501038_0611637 | Ga0501038_0611637_56_781 | 239 |
| 750 | 3300049579 | Ga0501043_0034144 | Ga0501043_0034144_1802_2527 | 239 |
| 751 | 3300049580 | Ga0501046_0099953 | Ga0501046_0099953_799_1524 | 239 |
| 752 | 3300049581 | Ga0501047_0109032 | Ga0501047_0109032_113_841 | 239 |
| 753 | 3300049581 | Ga0501047_0517272 | Ga0501047_0517272_254_979 | 239 |
| 754 | 3300049586 | Ga0501070_0178131 | Ga0501070_0178131_293_1018 | 239 |
| 755 | 3300049586 | Ga0501070_0496035 | Ga0501070_0496035_145_873 | 239 |
| 756 | 3300049744 | Ga0501083_0085534 | Ga0501083_0085534_426_1151 | 239 |
| 757 | 3300049822 | Ga0501035_0184827 | Ga0501035_0184827_1014_1739 | 239 |
| 758 | 3300049823 | Ga0501044_0036104 | Ga0501044_0036104_1701_2429 | 239 |
| 759 | 3300049823 | Ga0501044_0143284 | Ga0501044_0143284_1269_1994 | 239 |
| 760 | 3300050496 | nmdc:mga07m45_90376_c1 | nmdc:mga07m45_90376_c1_288_1013 | 239 |
| 761 | 3300050512 | nmdc:mga0n895_30287_c1 | nmdc:mga0n895_30287_c1_2290_3015 | 239 |
| 762 | 3300053077 | Ga0495601_0282702 | Ga0495601_0282702_210_932 | 239 |
| 763 | 3300053084 | Ga0495595_0231811 | Ga0495595_0231811_47_769 | 239 |
| 764 | 3300053087 | Ga0500643_024773 | Ga0500643_024773_375_1097 | 239 |
| 765 | 3300053093 | Ga0500651_0212978 | Ga0500651_0212978_349_1074 | 239 |
| 766 | 3300053109 | Ga0500569_009193 | Ga0500569_009193_65_790 | 239 |
| 767 | 3300053121 | Ga0500607_049221 | Ga0500607_049221_28_750 | 239 |
| 768 | 3300053130 | Ga0500642_0000020 | Ga0500642_0000020_20351_21073 | 239 |
| 769 | 3300053134 | Ga0500658_0051815 | Ga0500658_0051815_320_1042 | 239 |
| 770 | 3300053139 | Ga0500568_0002261 | Ga0500568_0002261_9456_10178 | 239 |
| 771 | 3300053142 | Ga0500577_0223735 | Ga0500577_0223735_44_769 | 239 |
| 772 | 3300053146 | Ga0500588_0035192 | Ga0500588_0035192_493_1218 | 239 |
| 773 | 3300053151 | Ga0500604_0012985 | Ga0500604_0012985_837_1559 | 239 |
| 774 | 3300053154 | Ga0500619_039761 | Ga0500619_039761_711_1433 | 239 |
| 775 | 3300053731 | Ga0500609_001437 | Ga0500609_001437_1964_2689 | 239 |
| 776 | iso_pu_bacteria | 2513237098 | 2513673548 | 239 |
| 777 | iso_pu_bacteria | 2513237101 | 2513697874 | 239 |
| 778 | iso_pu_bacteria | 2524023210 | 2524467576 | 239 |
| 779 | iso_pu_bacteria | 2721755755 | 2723842745 | 239 |
| 780 | iso_pu_bacteria | 2874604998 | 2874606587 | 239 |
| 781 | iso_pu_bacteria | 2876808645 | 2876811582 | 239 |
| 782 | iso_pu_bacteria | 2879110137 | 2879114204 | 239 |
| 783 | iso_pu_bacteria | 2885383462 | 2885391823 | 239 |
| 784 | iso_pu_bacteria | 2903768456 | 2903776099 | 239 |
| 785 | iso_pu_bacteria | 2922361189 | 2922367364 | 239 |
| 786 | iso_pu_bacteria | 2922386360 | 2922389937 | 239 |
| 787 | iso_pu_bacteria | 8006964411 | 8006966048 | 239 |
| 788 | iso_pu_bacteria | 8006984368 | 8006989807 | 239 |
| 789 | iso_pu_bacteria | 8006994254 | 8006998177 | 239 |
| 790 | iso_pu_bacteria | 8056673599 | 8056675193 | 239 |
| 791 | 3300005339 | Ga0070660_100198389 | Ga0070660_1001983891 | 240 |
| 792 | 3300005340 | Ga0070689_100061722 | Ga0070689_1000617223 | 240 |
| 793 | 3300005365 | Ga0070688_100506884 | Ga0070688_1005068841 | 240 |
| 794 | 3300005434 | Ga0070709_10010428 | Ga0070709_100104283 | 240 |
| 795 | 3300005434 | Ga0070709_10172390 | Ga0070709_101723901 | 240 |
| 796 | 3300005435 | Ga0070714_100208590 | Ga0070714_1002085902 | 240 |
| 797 | 3300005436 | Ga0070713_100019995 | Ga0070713_1000199952 | 240 |
| 798 | 3300005437 | Ga0070710_10000971 | Ga0070710_100009713 | 240 |
| 799 | 3300005439 | Ga0070711_100002148 | Ga0070711_1000021488 | 240 |
| 800 | 3300005455 | Ga0070663_100168687 | Ga0070663_1001686872 | 240 |
| 801 | 3300005530 | Ga0070679_100155446 | Ga0070679_1001554462 | 240 |
| 802 | 3300005539 | Ga0068853_100071100 | Ga0068853_1000711004 | 240 |
| 803 | 3300005564 | Ga0070664_100304854 | Ga0070664_1003048542 | 240 |
| 804 | 3300005578 | Ga0068854_100164844 | Ga0068854_1001648442 | 240 |
| 805 | 3300006028 | Ga0070717_10005073 | Ga0070717_100050735 | 240 |
| 806 | 3300006163 | Ga0070715_10000519 | Ga0070715_100005194 | 240 |
| 807 | 3300006175 | Ga0070712_100339908 | Ga0070712_1003399082 | 240 |
| 808 | 3300006186 | Ga0075369_10018672 | Ga0075369_100186723 | 240 |
| 809 | 3300013306 | Ga0163162_10171798 | Ga0163162_101717982 | 240 |
| 810 | 3300014325 | Ga0163163_10063378 | Ga0163163_100633783 | 240 |
| 811 | 3300014968 | Ga0157379_10106356 | Ga0157379_101063562 | 240 |
| 812 | 3300021384 | Ga0213876_10268985 | Ga0213876_102689851 | 240 |
| 813 | 3300025898 | Ga0207692_10001068 | Ga0207692_100010682 | 240 |
| 814 | 3300025905 | Ga0207685_10017980 | Ga0207685_100179802 | 240 |
| 815 | 3300025906 | Ga0207699_10005006 | Ga0207699_100050063 | 240 |
| 816 | 3300025915 | Ga0207693_10021940 | Ga0207693_100219402 | 240 |
| 817 | 3300025916 | Ga0207663_10000229 | Ga0207663_100002295 | 240 |
| 818 | 3300025919 | Ga0207657_10018024 | Ga0207657_100180246 | 240 |
| 819 | 3300025921 | Ga0207652_10087976 | Ga0207652_100879762 | 240 |
| 820 | 3300025929 | Ga0207664_10090815 | Ga0207664_100908152 | 240 |
| 821 | 3300025929 | Ga0207664_10144782 | Ga0207664_101447822 | 240 |
| 822 | 3300025932 | Ga0207690_10041632 | Ga0207690_100416323 | 240 |
| 823 | 3300025939 | Ga0207665_10016623 | Ga0207665_100166232 | 240 |
| 824 | 3300025949 | Ga0207667_10733389 | Ga0207667_107333892 | 240 |
| 825 | 3300026067 | Ga0207678_10047069 | Ga0207678_100470693 | 240 |
| 826 | 3300031911 | Ga0307412_10019954 | Ga0307412_100199542 | 240 |
| 827 | 3300035691 | Ga0373931_0143771 | Ga0373931_0143771_494_1219 | 240 |
| 828 | 3300037418 | Ga0395900_0001526 | Ga0395900_0001526_3428_4156 | 240 |
| 829 | 3300037466 | Ga0395898_0020602 | Ga0395898_0020602_3360_4088 | 240 |
| 830 | 3300037471 | Ga0395905_0426158 | Ga0395905_0426158_397_1125 | 240 |
| 831 | 3300038443 | Ga0395901_0167652 | Ga0395901_0167652_464_1192 | 240 |
| 832 | 3300046460 | Ga0495638_0030841 | Ga0495638_0030841_2289_3014 | 240 |
| 833 | 3300046474 | Ga0495605_0119459 | Ga0495605_0119459_16_741 | 240 |
| 834 | 3300046520 | Ga0495637_0028466 | Ga0495637_0028466_145_870 | 240 |
| 835 | 3300046557 | Ga0495622_0013824 | Ga0495622_0013824_2842_3567 | 240 |
| 836 | 3300046679 | Ga0495623_0111367 | Ga0495623_0111367_846_1571 | 240 |
| 837 | 3300047319 | Ga0495674_0212023 | Ga0495674_0212023_319_1044 | 240 |
| 838 | 3300047472 | Ga0495686_0056466 | Ga0495686_0056466_978_1703 | 240 |
| 839 | 3300048905 | Ga0496102_0050412 | Ga0496102_0050412_2389_3114 | 240 |
| 840 | 3300048907 | Ga0496104_0012431 | Ga0496104_0012431_3854_4579 | 240 |
| 841 | 3300048907 | Ga0496104_0205468 | Ga0496104_0205468_988_1713 | 240 |
| 842 | 3300048909 | Ga0496106_0008911 | Ga0496106_0008911_2454_3179 | 240 |
| 843 | 3300048910 | Ga0496107_0082738 | Ga0496107_0082738_745_1473 | 240 |
| 844 | 3300048911 | Ga0496108_0026157 | Ga0496108_0026157_3108_3833 | 240 |
| 845 | 3300048912 | Ga0496109_0159458 | Ga0496109_0159458_825_1550 | 240 |
| 846 | 3300048912 | Ga0496109_0228922 | Ga0496109_0228922_930_1655 | 240 |
| 847 | 3300048913 | Ga0496110_0043024 | Ga0496110_0043024_1111_1836 | 240 |
| 848 | 3300048913 | Ga0496110_0065299 | Ga0496110_0065299_1063_1788 | 240 |
| 849 | 3300048914 | Ga0496111_0035597 | Ga0496111_0035597_1564_2289 | 240 |
| 850 | 3300048915 | Ga0496112_0016541 | Ga0496112_0016541_2556_3281 | 240 |
| 851 | 3300048915 | Ga0496112_0023823 | Ga0496112_0023823_2411_3136 | 240 |
| 852 | 3300048915 | Ga0496112_0026282 | Ga0496112_0026282_3657_4382 | 240 |
| 853 | 3300048916 | Ga0496113_0026922 | Ga0496113_0026922_971_1696 | 240 |
| 854 | 3300048916 | Ga0496113_0039367 | Ga0496113_0039367_2391_3116 | 240 |
| 855 | 3300048918 | Ga0496115_0160098 | Ga0496115_0160098_260_985 | 240 |
| 856 | 3300048919 | Ga0496116_0001929 | Ga0496116_0001929_18664_19389 | 240 |
| 857 | 3300048920 | Ga0496117_0046900 | Ga0496117_0046900_1837_2562 | 240 |
| 858 | 3300048921 | Ga0496118_0027902 | Ga0496118_0027902_2058_2783 | 240 |
| 859 | 3300048924 | Ga0496121_0001793 | Ga0496121_0001793_27673_28401 | 240 |
| 860 | 3300048927 | Ga0496124_0038290 | Ga0496124_0038290_2187_2912 | 240 |
| 861 | 3300048928 | Ga0496125_0003566 | Ga0496125_0003566_429_1154 | 240 |
| 862 | 3300048928 | Ga0496125_0009065 | Ga0496125_0009065_9183_9908 | 240 |
| 863 | 3300048929 | Ga0496126_0005184 | Ga0496126_0005184_13596_14324 | 240 |
| 864 | 3300050490 | nmdc:mga03n38_66636_c1 | nmdc:mga03n38_66636_c1_655_1380 | 240 |
| 865 | 3300050491 | nmdc:mga00v17_135722_c1 | nmdc:mga00v17_135722_c1_682_1407 | 240 |
| 866 | 3300050492 | nmdc:mga0yw44_1581_c1 | nmdc:mga0yw44_1581_c1_2261_2986 | 240 |
| 867 | 3300050516 | nmdc:mga0sz30_4096_c1 | nmdc:mga0sz30_4096_c1_2086_2811 | 240 |
| 868 | 3300053088 | Ga0500644_0164556 | Ga0500644_0164556_94_819 | 240 |
| 869 | 3300053093 | Ga0500651_0294112 | Ga0500651_0294112_151_876 | 240 |
| 870 | 3300053094 | Ga0500566_0018131 | Ga0500566_0018131_2665_3390 | 240 |
| 871 | 3300053122 | Ga0500608_027194 | Ga0500608_027194_647_1372 | 240 |
| 872 | 3300053125 | Ga0500618_009109 | Ga0500618_009109_319_1044 | 240 |
| 873 | 3300053136 | Ga0500559_0000974 | Ga0500559_0000974_13252_13977 | 240 |
| 874 | 3300053142 | Ga0500577_0014920 | Ga0500577_0014920_103_828 | 240 |
| 875 | 3300053177 | Ga0500636_0002976 | Ga0500636_0002976_8382_9107 | 240 |
| 876 | 3300053178 | Ga0500637_0040724 | Ga0500637_0040724_1475_2200 | 240 |
| 877 | 3300005435 | Ga0070714_100047285 | Ga0070714_1000472853 | 241 |
| 878 | 3300005468 | Ga0070707_100599840 | Ga0070707_1005998401 | 241 |
| 879 | 3300005471 | Ga0070698_100159311 | Ga0070698_1001593111 | 241 |
| 880 | 3300005536 | Ga0070697_100153453 | Ga0070697_1001534532 | 241 |
| 881 | 3300005539 | Ga0068853_100557394 | Ga0068853_1005573942 | 241 |
| 882 | 3300005548 | Ga0070665_100112639 | Ga0070665_1001126393 | 241 |
| 883 | 3300005563 | Ga0068855_100549296 | Ga0068855_1005492962 | 241 |
| 884 | 3300006028 | Ga0070717_10000361 | Ga0070717_1000036111 | 241 |
| 885 | 3300006028 | Ga0070717_10002247 | Ga0070717_1000224715 | 241 |
| 886 | 3300006173 | Ga0070716_100183515 | Ga0070716_1001835152 | 241 |
| 887 | 3300006914 | Ga0075436_100142287 | Ga0075436_1001422872 | 241 |
| 888 | 3300007265 | Ga0099794_10044446 | Ga0099794_100444462 | 241 |
| 889 | 3300007265 | Ga0099794_10109680 | Ga0099794_101096801 | 241 |
| 890 | 3300009093 | Ga0105240_10004255 | Ga0105240_1000425515 | 241 |
| 891 | 3300009093 | Ga0105240_10582051 | Ga0105240_105820512 | 241 |
| 892 | 3300009148 | Ga0105243_10095111 | Ga0105243_100951113 | 241 |
| 893 | 3300009553 | Ga0105249_10308221 | Ga0105249_103082212 | 241 |
| 894 | 3300010159 | Ga0099796_10013237 | Ga0099796_100132372 | 241 |
| 895 | 3300010375 | Ga0105239_10020156 | Ga0105239_100201568 | 241 |
| 896 | 3300013102 | Ga0157371_10067083 | Ga0157371_100670832 | 241 |
| 897 | 3300013104 | Ga0157370_10116079 | Ga0157370_101160792 | 241 |
| 898 | 3300014325 | Ga0163163_10576572 | Ga0163163_105765722 | 241 |
| 899 | 3300014497 | Ga0182008_10152970 | Ga0182008_101529702 | 241 |
| 900 | 3300014745 | Ga0157377_10097753 | Ga0157377_100977532 | 241 |
| 901 | 3300025922 | Ga0207646_10119519 | Ga0207646_101195192 | 241 |
| 902 | 3300025928 | Ga0207700_10250854 | Ga0207700_102508541 | 241 |
| 903 | 3300025929 | Ga0207664_10048616 | Ga0207664_100486163 | 241 |
| 904 | 3300025939 | Ga0207665_10185180 | Ga0207665_101851802 | 241 |
| 905 | 3300025939 | Ga0207665_10194915 | Ga0207665_101949152 | 241 |
| 906 | 3300025949 | Ga0207667_10119112 | Ga0207667_101191122 | 241 |
| 907 | 3300025981 | Ga0207640_10321188 | Ga0207640_103211881 | 241 |
| 908 | 3300026035 | Ga0207703_10118694 | Ga0207703_101186942 | 241 |
| 909 | 3300028379 | Ga0268266_10461525 | Ga0268266_104615252 | 241 |
| 910 | 3300035086 | Ga0373934_0032152 | Ga0373934_0032152_154_882 | 241 |
| 911 | 3300035111 | Ga0373923_0022875 | Ga0373923_0022875_281_1009 | 241 |
| 912 | 3300035111 | Ga0373923_0061944 | Ga0373923_0061944_752_1480 | 241 |
| 913 | 3300035116 | Ga0373945_0007452 | Ga0373945_0007452_1779_2507 | 241 |
| 914 | 3300035117 | Ga0373953_0059246 | Ga0373953_0059246_714_1442 | 241 |
| 915 | 3300035118 | Ga0373954_0024987 | Ga0373954_0024987_1805_2533 | 241 |
| 916 | 3300035119 | Ga0373956_0131220 | Ga0373956_0131220_280_1008 | 241 |
| 917 | 3300035120 | Ga0373957_0013357 | Ga0373957_0013357_1535_2263 | 241 |
| 918 | 3300035170 | Ga0373943_0001395 | Ga0373943_0001395_7409_8137 | 241 |
| 919 | 3300035172 | Ga0373955_0070619 | Ga0373955_0070619_147_875 | 241 |
| 920 | 3300035692 | Ga0373935_0041463 | Ga0373935_0041463_942_1670 | 241 |
| 921 | 3300035695 | Ga0373927_0000792 | Ga0373927_0000792_15347_16075 | 241 |
| 922 | 3300035695 | Ga0373927_0011161 | Ga0373927_0011161_2544_3272 | 241 |
| 923 | 3300035724 | Ga0373933_0000777 | Ga0373933_0000777_15505_16233 | 241 |
| 924 | 3300035724 | Ga0373933_0028392 | Ga0373933_0028392_543_1271 | 241 |
| 925 | 3300035724 | Ga0373933_0034488 | Ga0373933_0034488_981_1709 | 241 |
| 926 | 3300035725 | Ga0373947_0002479 | Ga0373947_0002479_957_1685 | 241 |
| 927 | 3300035725 | Ga0373947_0048876 | Ga0373947_0048876_269_997 | 241 |
| 928 | 3300036401 | Ga0373937_0002152 | Ga0373937_0002152_10618_11346 | 241 |
| 929 | 3300037068 | Ga0373925_0033683 | Ga0373925_0033683_2778_3506 | 241 |
| 930 | 3300037418 | Ga0395900_0303838 | Ga0395900_0303838_826_1554 | 241 |
| 931 | 3300037466 | Ga0395898_0157428 | Ga0395898_0157428_715_1443 | 241 |
| 932 | 3300037853 | Ga0436364_0802399 | Ga0436364_0802399_144_875 | 241 |
| 933 | 3300038443 | Ga0395901_0212623 | Ga0395901_0212623_153_884 | 241 |
| 934 | 3300038443 | Ga0395901_0618847 | Ga0395901_0618847_271_999 | 241 |
| 935 | 3300039437 | Ga0436365_0838189 | Ga0436365_0838189_296_1027 | 241 |
| 936 | 3300039453 | Ga0436362_1231827 | Ga0436362_1231827_1700_2428 | 241 |
| 937 | 3300041413 | Ga0439465_0048560 | Ga0439465_0048560_226_957 | 241 |
| 938 | 3300041452 | Ga0451793_0924719 | Ga0451793_0924719_114_845 | 241 |
| 939 | 3300041456 | Ga0451795_1297581 | Ga0451795_1297581_146_877 | 241 |
| 940 | 3300044658 | Ga0466972_0000203 | Ga0466972_0000203_40012_40743 | 241 |
| 941 | 3300044658 | Ga0466972_0053365 | Ga0466972_0053365_190_921 | 241 |
| 942 | 3300044683 | Ga0466965_0013246 | Ga0466965_0013246_546_1277 | 241 |
| 943 | 3300044684 | Ga0466966_0001755 | Ga0466966_0001755_11582_12313 | 241 |
| 944 | 3300044684 | Ga0466966_0100010 | Ga0466966_0100010_181_912 | 241 |
| 945 | 3300044693 | Ga0466961_0000095 | Ga0466961_0000095_16769_17500 | 241 |
| 946 | 3300044694 | Ga0466963_0004305 | Ga0466963_0004305_2877_3608 | 241 |
| 947 | 3300044706 | Ga0466964_0053133 | Ga0466964_0053133_146_877 | 241 |
| 948 | 3300044735 | Ga0466968_0029483 | Ga0466968_0029483_458_1189 | 241 |
| 949 | 3300044765 | Ga0466970_0031601 | Ga0466970_0031601_450_1181 | 241 |
| 950 | 3300044765 | Ga0466970_0085030 | Ga0466970_0085030_836_1567 | 241 |
| 951 | 3300044765 | Ga0466970_0093115 | Ga0466970_0093115_666_1394 | 241 |
| 952 | 3300044901 | Ga0466960_0027321 | Ga0466960_0027321_948_1679 | 241 |
| 953 | 3300045049 | Ga0466959_0011974 | Ga0466959_0011974_1440_2171 | 241 |
| 954 | 3300045049 | Ga0466959_0334709 | Ga0466959_0334709_195_923 | 241 |
| 955 | 3300045976 | Ga0466967_0025660 | Ga0466967_0025660_1185_1916 | 241 |
| 956 | 3300045976 | Ga0466967_0291543 | Ga0466967_0291543_639_1370 | 241 |
| 957 | 3300045976 | Ga0466967_0563760 | Ga0466967_0563760_266_997 | 241 |
| 958 | 3300046454 | Ga0495592_0056639 | Ga0495592_0056639_599_1327 | 241 |
| 959 | 3300046455 | Ga0495603_0001835 | Ga0495603_0001835_4960_5688 | 241 |
| 960 | 3300046455 | Ga0495603_0019231 | Ga0495603_0019231_700_1428 | 241 |
| 961 | 3300046455 | Ga0495603_0030103 | Ga0495603_0030103_2333_3061 | 241 |
| 962 | 3300046459 | Ga0495629_0001441 | Ga0495629_0001441_15449_16177 | 241 |
| 963 | 3300046459 | Ga0495629_0007128 | Ga0495629_0007128_531_1262 | 241 |
| 964 | 3300046459 | Ga0495629_0246941 | Ga0495629_0246941_58_786 | 241 |
| 965 | 3300046460 | Ga0495638_0004327 | Ga0495638_0004327_436_1167 | 241 |
| 966 | 3300046461 | Ga0495641_0003725 | Ga0495641_0003725_8561_9289 | 241 |
| 967 | 3300046462 | Ga0495651_0019778 | Ga0495651_0019778_2679_3410 | 241 |
| 968 | 3300046462 | Ga0495651_0107832 | Ga0495651_0107832_357_1088 | 241 |
| 969 | 3300046463 | Ga0495653_0096644 | Ga0495653_0096644_166_894 | 241 |
| 970 | 3300046472 | Ga0495580_0012167 | Ga0495580_0012167_5785_6513 | 241 |
| 971 | 3300046473 | Ga0495582_0000084 | Ga0495582_0000084_40732_41460 | 241 |
| 972 | 3300046473 | Ga0495582_0156189 | Ga0495582_0156189_58_786 | 241 |
| 973 | 3300046474 | Ga0495605_0042163 | Ga0495605_0042163_1368_2099 | 241 |
| 974 | 3300046475 | Ga0495639_0001155 | Ga0495639_0001155_975_1703 | 241 |
| 975 | 3300046476 | Ga0495662_0000454 | Ga0495662_0000454_11461_12189 | 241 |
| 976 | 3300046477 | Ga0495664_0012642 | Ga0495664_0012642_1265_1993 | 241 |
| 977 | 3300046477 | Ga0495664_0114148 | Ga0495664_0114148_261_992 | 241 |
| 978 | 3300046477 | Ga0495664_0268771 | Ga0495664_0268771_269_1000 | 241 |
| 979 | 3300046499 | Ga0495594_0001840 | Ga0495594_0001840_8081_8809 | 241 |
| 980 | 3300046499 | Ga0495594_0092697 | Ga0495594_0092697_228_959 | 241 |
| 981 | 3300046501 | Ga0495607_0127200 | Ga0495607_0127200_453_1184 | 241 |
| 982 | 3300046507 | Ga0495606_0017331 | Ga0495606_0017331_2202_2933 | 241 |
| 983 | 3300046507 | Ga0495606_0144822 | Ga0495606_0144822_344_1075 | 241 |
| 984 | 3300046507 | Ga0495606_0227559 | Ga0495606_0227559_189_920 | 241 |
| 985 | 3300046511 | Ga0495608_0044124 | Ga0495608_0044124_334_1062 | 241 |
| 986 | 3300046512 | Ga0495610_0030666 | Ga0495610_0030666_1491_2222 | 241 |
| 987 | 3300046512 | Ga0495610_0157698 | Ga0495610_0157698_217_948 | 241 |
| 988 | 3300046513 | Ga0495616_0113772 | Ga0495616_0113772_306_1037 | 241 |
| 989 | 3300046514 | Ga0495618_0061125 | Ga0495618_0061125_1295_2023 | 241 |
| 990 | 3300046516 | Ga0495628_0007687 | Ga0495628_0007687_2023_2751 | 241 |
| 991 | 3300046516 | Ga0495628_0008644 | Ga0495628_0008644_4377_5105 | 241 |
| 992 | 3300046516 | Ga0495628_0148463 | Ga0495628_0148463_414_1145 | 241 |
| 993 | 3300046517 | Ga0495630_0290947 | Ga0495630_0290947_202_933 | 241 |
| 994 | 3300046522 | Ga0495643_0014330 | Ga0495643_0014330_1755_2486 | 241 |
| 995 | 3300046522 | Ga0495643_0042279 | Ga0495643_0042279_630_1361 | 241 |
| 996 | 3300046522 | Ga0495643_0101130 | Ga0495643_0101130_378_1109 | 241 |
| 997 | 3300046524 | Ga0495648_0018505 | Ga0495648_0018505_608_1336 | 241 |
| 998 | 3300046524 | Ga0495648_0055188 | Ga0495648_0055188_556_1287 | 241 |
| 999 | 3300046524 | Ga0495648_0157380 | Ga0495648_0157380_25_756 | 241 |
| 1000 | 3300046529 | Ga0495652_0036409 | Ga0495652_0036409_828_1556 | 241 |
| 1001 | 3300046529 | Ga0495652_0232270 | Ga0495652_0232270_404_1132 | 241 |
| 1002 | 3300046529 | Ga0495652_0249381 | Ga0495652_0249381_452_1183 | 241 |
| 1003 | 3300046530 | Ga0495654_0057842 | Ga0495654_0057842_521_1252 | 241 |
| 1004 | 3300046531 | Ga0495665_0001312 | Ga0495665_0001312_2899_3627 | 241 |
| 1005 | 3300046533 | Ga0495640_0115594 | Ga0495640_0115594_806_1537 | 241 |
| 1006 | 3300046536 | Ga0495587_0007054 | Ga0495587_0007054_4371_5102 | 241 |
| 1007 | 3300046536 | Ga0495587_0087021 | Ga0495587_0087021_361_1092 | 241 |
| 1008 | 3300046543 | Ga0495645_0054907 | Ga0495645_0054907_2081_2809 | 241 |
| 1009 | 3300046557 | Ga0495622_0003118 | Ga0495622_0003118_6868_7596 | 241 |
| 1010 | 3300046557 | Ga0495622_0013816 | Ga0495622_0013816_710_1441 | 241 |
| 1011 | 3300046559 | Ga0495667_0020060 | Ga0495667_0020060_1833_2564 | 241 |
| 1012 | 3300046616 | Ga0495668_0033714 | Ga0495668_0033714_1490_2221 | 241 |
| 1013 | 3300046642 | Ga0495634_0000321 | Ga0495634_0000321_39874_40602 | 241 |
| 1014 | 3300046642 | Ga0495634_0070281 | Ga0495634_0070281_458_1189 | 241 |
| 1015 | 3300046660 | Ga0495625_0324728 | Ga0495625_0324728_158_889 | 241 |
| 1016 | 3300046663 | Ga0495635_0001529 | Ga0495635_0001529_12757_13485 | 241 |
| 1017 | 3300046663 | Ga0495635_0023026 | Ga0495635_0023026_2679_3410 | 241 |
| 1018 | 3300046663 | Ga0495635_0032708 | Ga0495635_0032708_1076_1807 | 241 |
| 1019 | 3300046665 | Ga0495661_0131339 | Ga0495661_0131339_444_1175 | 241 |
| 1020 | 3300046675 | Ga0495657_0009859 | Ga0495657_0009859_5292_6023 | 241 |
| 1021 | 3300046675 | Ga0495657_0009988 | Ga0495657_0009988_1342_2073 | 241 |
| 1022 | 3300046678 | Ga0495599_0004258 | Ga0495599_0004258_4243_4974 | 241 |
| 1023 | 3300046678 | Ga0495599_0060253 | Ga0495599_0060253_1357_2085 | 241 |
| 1024 | 3300046678 | Ga0495599_0109522 | Ga0495599_0109522_498_1229 | 241 |
| 1025 | 3300046679 | Ga0495623_0025894 | Ga0495623_0025894_76_807 | 241 |
| 1026 | 3300046679 | Ga0495623_0226604 | Ga0495623_0226604_170_898 | 241 |
| 1027 | 3300046680 | Ga0495646_0004744 | Ga0495646_0004744_4447_5175 | 241 |
| 1028 | 3300046680 | Ga0495646_0067143 | Ga0495646_0067143_1354_2082 | 241 |
| 1029 | 3300046680 | Ga0495646_0070510 | Ga0495646_0070510_1025_1756 | 241 |
| 1030 | 3300046680 | Ga0495646_0141296 | Ga0495646_0141296_146_877 | 241 |
| 1031 | 3300046681 | Ga0495647_0008301 | Ga0495647_0008301_1598_2326 | 241 |
| 1032 | 3300046683 | Ga0495658_0002077 | Ga0495658_0002077_1462_2190 | 241 |
| 1033 | 3300046689 | Ga0495613_0003547 | Ga0495613_0003547_5748_6476 | 241 |
| 1034 | 3300046689 | Ga0495613_0190121 | Ga0495613_0190121_568_1299 | 241 |
| 1035 | 3300046690 | Ga0495624_0001596 | Ga0495624_0001596_8408_9136 | 241 |
| 1036 | 3300046692 | Ga0495671_0131801 | Ga0495671_0131801_53_784 | 241 |
| 1037 | 3300046694 | Ga0495649_0118437 | Ga0495649_0118437_409_1140 | 241 |
| 1038 | 3300046694 | Ga0495649_0184315 | Ga0495649_0184315_182_913 | 241 |
| 1039 | 3300046809 | Ga0495600_0039341 | Ga0495600_0039341_360_1091 | 241 |
| 1040 | 3300046809 | Ga0495600_0122194 | Ga0495600_0122194_226_957 | 241 |
| 1041 | 3300046809 | Ga0495600_0133252 | Ga0495600_0133252_432_1160 | 241 |
| 1042 | 3300046809 | Ga0495600_0181204 | Ga0495600_0181204_460_1188 | 241 |
| 1043 | 3300046809 | Ga0495600_0329236 | Ga0495600_0329236_116_844 | 241 |
| 1044 | 3300046809 | Ga0495600_0391125 | Ga0495600_0391125_119_850 | 241 |
| 1045 | 3300046810 | Ga0495660_0207249 | Ga0495660_0207249_74_805 | 241 |
| 1046 | 3300047315 | Ga0495581_0000174 | Ga0495581_0000174_15452_16180 | 241 |
| 1047 | 3300047315 | Ga0495581_0043881 | Ga0495581_0043881_1641_2369 | 241 |
| 1048 | 3300047317 | Ga0495604_0006679 | Ga0495604_0006679_4703_5434 | 241 |
| 1049 | 3300047317 | Ga0495604_0178443 | Ga0495604_0178443_174_902 | 241 |
| 1050 | 3300047319 | Ga0495674_0012229 | Ga0495674_0012229_888_1616 | 241 |
| 1051 | 3300047321 | Ga0495676_0066360 | Ga0495676_0066360_1011_1739 | 241 |
| 1052 | 3300047321 | Ga0495676_0241158 | Ga0495676_0241158_220_951 | 241 |
| 1053 | 3300047322 | Ga0495680_0069062 | Ga0495680_0069062_1928_2659 | 241 |
| 1054 | 3300047322 | Ga0495680_0103947 | Ga0495680_0103947_1062_1790 | 241 |
| 1055 | 3300047443 | Ga0495687_031231 | Ga0495687_031231_1658_2389 | 241 |
| 1056 | 3300047469 | Ga0495673_0018848 | Ga0495673_0018848_2664_3395 | 241 |
| 1057 | 3300047470 | Ga0495681_0048787 | Ga0495681_0048787_1160_1888 | 241 |
| 1058 | 3300047471 | Ga0495684_0007348 | Ga0495684_0007348_712_1440 | 241 |
| 1059 | 3300047472 | Ga0495686_0129207 | Ga0495686_0129207_420_1151 | 241 |
| 1060 | 3300047472 | Ga0495686_0261572 | Ga0495686_0261572_89_820 | 241 |
| 1061 | 3300047673 | Ga0495593_0000321 | Ga0495593_0000321_18661_19389 | 241 |
| 1062 | 3300047673 | Ga0495593_0066053 | Ga0495593_0066053_85_816 | 241 |
| 1063 | 3300048088 | Ga0495602_0066912 | Ga0495602_0066912_1873_2604 | 241 |
| 1064 | 3300048088 | Ga0495602_0096401 | Ga0495602_0096401_10_738 | 241 |
| 1065 | 3300048089 | Ga0495614_0018834 | Ga0495614_0018834_268_999 | 241 |
| 1066 | 3300048903 | Ga0496100_0267734 | Ga0496100_0267734_235_966 | 241 |
| 1067 | 3300048903 | Ga0496100_0454927 | Ga0496100_0454927_177_908 | 241 |
| 1068 | 3300048905 | Ga0496102_0385137 | Ga0496102_0385137_23_754 | 241 |
| 1069 | 3300048906 | Ga0496103_0003589 | Ga0496103_0003589_7062_7793 | 241 |
| 1070 | 3300048906 | Ga0496103_0380740 | Ga0496103_0380740_24_752 | 241 |
| 1071 | 3300048907 | Ga0496104_0487823 | Ga0496104_0487823_170_901 | 241 |
| 1072 | 3300048908 | Ga0496105_0003700 | Ga0496105_0003700_699_1430 | 241 |
| 1073 | 3300048908 | Ga0496105_0050494 | Ga0496105_0050494_2518_3249 | 241 |
| 1074 | 3300048908 | Ga0496105_0118831 | Ga0496105_0118831_162_893 | 241 |
| 1075 | 3300048910 | Ga0496107_0117463 | Ga0496107_0117463_681_1412 | 241 |
| 1076 | 3300048911 | Ga0496108_0047303 | Ga0496108_0047303_2734_3465 | 241 |
| 1077 | 3300048911 | Ga0496108_0090140 | Ga0496108_0090140_485_1213 | 241 |
| 1078 | 3300048913 | Ga0496110_0544082 | Ga0496110_0544082_19_750 | 241 |
| 1079 | 3300048914 | Ga0496111_0538499 | Ga0496111_0538499_43_771 | 241 |
| 1080 | 3300048915 | Ga0496112_0107087 | Ga0496112_0107087_13_744 | 241 |
| 1081 | 3300048916 | Ga0496113_0339197 | Ga0496113_0339197_23_754 | 241 |
| 1082 | 3300048916 | Ga0496113_0767275 | Ga0496113_0767275_19_750 | 241 |
| 1083 | 3300048918 | Ga0496115_0209890 | Ga0496115_0209890_567_1295 | 241 |
| 1084 | 3300048919 | Ga0496116_0186142 | Ga0496116_0186142_96_827 | 241 |
| 1085 | 3300048919 | Ga0496116_0272035 | Ga0496116_0272035_10_741 | 241 |
| 1086 | 3300048920 | Ga0496117_0063075 | Ga0496117_0063075_652_1383 | 241 |
| 1087 | 3300048920 | Ga0496117_0194830 | Ga0496117_0194830_132_863 | 241 |
| 1088 | 3300048921 | Ga0496118_0009320 | Ga0496118_0009320_7796_8527 | 241 |
| 1089 | 3300048921 | Ga0496118_0048112 | Ga0496118_0048112_655_1386 | 241 |
| 1090 | 3300048921 | Ga0496118_0116873 | Ga0496118_0116873_648_1379 | 241 |
| 1091 | 3300048922 | Ga0496119_0000934 | Ga0496119_0000934_10079_10810 | 241 |
| 1092 | 3300048922 | Ga0496119_0044680 | Ga0496119_0044680_1120_1851 | 241 |
| 1093 | 3300048922 | Ga0496119_0048915 | Ga0496119_0048915_1845_2576 | 241 |
| 1094 | 3300048923 | Ga0496120_0009108 | Ga0496120_0009108_6065_6796 | 241 |
| 1095 | 3300048924 | Ga0496121_0016644 | Ga0496121_0016644_2546_3277 | 241 |
| 1096 | 3300048924 | Ga0496121_0062068 | Ga0496121_0062068_2259_2990 | 241 |
| 1097 | 3300048924 | Ga0496121_0079020 | Ga0496121_0079020_1868_2599 | 241 |
| 1098 | 3300048925 | Ga0496122_0168356 | Ga0496122_0168356_498_1229 | 241 |
| 1099 | 3300048926 | Ga0496123_0071310 | Ga0496123_0071310_115_846 | 241 |
| 1100 | 3300048927 | Ga0496124_0156569 | Ga0496124_0156569_188_919 | 241 |
| 1101 | 3300048927 | Ga0496124_0410521 | Ga0496124_0410521_139_870 | 241 |
| 1102 | 3300048928 | Ga0496125_0032195 | Ga0496125_0032195_436_1167 | 241 |
| 1103 | 3300048928 | Ga0496125_0186242 | Ga0496125_0186242_327_1058 | 241 |
| 1104 | 3300048929 | Ga0496126_0014762 | Ga0496126_0014762_946_1677 | 241 |
| 1105 | 3300048929 | Ga0496126_0031494 | Ga0496126_0031494_2032_2763 | 241 |
| 1106 | 3300048929 | Ga0496126_0124477 | Ga0496126_0124477_1203_1934 | 241 |
| 1107 | 3300048929 | Ga0496126_0181755 | Ga0496126_0181755_10_741 | 241 |
| 1108 | 3300048929 | Ga0496126_0196390 | Ga0496126_0196390_93_824 | 241 |
| 1109 | 3300048929 | Ga0496126_0203148 | Ga0496126_0203148_636_1367 | 241 |
| 1110 | 3300048929 | Ga0496126_0474941 | Ga0496126_0474941_160_891 | 241 |
| 1111 | 3300048929 | Ga0496126_0554500 | Ga0496126_0554500_23_754 | 241 |
| 1112 | 3300049460 | Ga0495682_0035539 | Ga0495682_0035539_644_1375 | 241 |
| 1113 | 3300049568 | Ga0501031_0000946 | Ga0501031_0000946_16342_17070 | 241 |
| 1114 | 3300049568 | Ga0501031_0007375 | Ga0501031_0007375_2878_3606 | 241 |
| 1115 | 3300049569 | Ga0501032_0000503 | Ga0501032_0000503_26762_27490 | 241 |
| 1116 | 3300049570 | Ga0501033_0000140 | Ga0501033_0000140_42610_43338 | 241 |
| 1117 | 3300049570 | Ga0501033_0001234 | Ga0501033_0001234_19630_20358 | 241 |
| 1118 | 3300049571 | Ga0501034_0000072 | Ga0501034_0000072_10921_11649 | 241 |
| 1119 | 3300049572 | Ga0501036_0000050 | Ga0501036_0000050_47811_48539 | 241 |
| 1120 | 3300049572 | Ga0501036_0011109 | Ga0501036_0011109_933_1661 | 241 |
| 1121 | 3300049573 | Ga0501037_0000030 | Ga0501037_0000030_16404_17132 | 241 |
| 1122 | 3300049573 | Ga0501037_0000580 | Ga0501037_0000580_887_1615 | 241 |
| 1123 | 3300049573 | Ga0501037_0012101 | Ga0501037_0012101_1740_2468 | 241 |
| 1124 | 3300049574 | Ga0501038_0000039 | Ga0501038_0000039_67952_68680 | 241 |
| 1125 | 3300049574 | Ga0501038_0088413 | Ga0501038_0088413_1107_1835 | 241 |
| 1126 | 3300049575 | Ga0501039_0000060 | Ga0501039_0000060_58025_58753 | 241 |
| 1127 | 3300049575 | Ga0501039_0033351 | Ga0501039_0033351_2437_3165 | 241 |
| 1128 | 3300049575 | Ga0501039_0200649 | Ga0501039_0200649_463_1191 | 241 |
| 1129 | 3300049578 | Ga0501042_0129773 | Ga0501042_0129773_975_1703 | 241 |
| 1130 | 3300049579 | Ga0501043_0002562 | Ga0501043_0002562_12459_13187 | 241 |
| 1131 | 3300049579 | Ga0501043_0010025 | Ga0501043_0010025_5759_6487 | 241 |
| 1132 | 3300049580 | Ga0501046_0000522 | Ga0501046_0000522_10479_11207 | 241 |
| 1133 | 3300049580 | Ga0501046_0020020 | Ga0501046_0020020_3535_4263 | 241 |
| 1134 | 3300049581 | Ga0501047_0000174 | Ga0501047_0000174_3616_4344 | 241 |
| 1135 | 3300049581 | Ga0501047_0422591 | Ga0501047_0422591_166_897 | 241 |
| 1136 | 3300049582 | Ga0501048_0000704 | Ga0501048_0000704_19862_20590 | 241 |
| 1137 | 3300049583 | Ga0501067_0000239 | Ga0501067_0000239_14247_14975 | 241 |
| 1138 | 3300049584 | Ga0501068_0000227 | Ga0501068_0000227_9594_10322 | 241 |
| 1139 | 3300049584 | Ga0501068_0285367 | Ga0501068_0285367_151_879 | 241 |
| 1140 | 3300049585 | Ga0501069_0015333 | Ga0501069_0015333_3331_4059 | 241 |
| 1141 | 3300049585 | Ga0501069_0270533 | Ga0501069_0270533_175_903 | 241 |
| 1142 | 3300049586 | Ga0501070_0003314 | Ga0501070_0003314_2780_3508 | 241 |
| 1143 | 3300049588 | Ga0501072_0001189 | Ga0501072_0001189_8123_8851 | 241 |
| 1144 | 3300049589 | Ga0501073_0000009 | Ga0501073_0000009_26746_27474 | 241 |
| 1145 | 3300049590 | Ga0501074_0000049 | Ga0501074_0000049_42084_42812 | 241 |
| 1146 | 3300049741 | Ga0501079_0014652 | Ga0501079_0014652_4406_5134 | 241 |
| 1147 | 3300049742 | Ga0501080_0005405 | Ga0501080_0005405_5535_6263 | 241 |
| 1148 | 3300049743 | Ga0501081_0136990 | Ga0501081_0136990_699_1427 | 241 |
| 1149 | 3300049744 | Ga0501083_0000251 | Ga0501083_0000251_11361_12089 | 241 |
| 1150 | 3300049822 | Ga0501035_0000067 | Ga0501035_0000067_101674_102402 | 241 |
| 1151 | 3300049822 | Ga0501035_0013199 | Ga0501035_0013199_1606_2334 | 241 |
| 1152 | 3300049823 | Ga0501044_0000258 | Ga0501044_0000258_17336_18064 | 241 |
| 1153 | 3300049823 | Ga0501044_0132726 | Ga0501044_0132726_945_1673 | 241 |
| 1154 | 3300049824 | Ga0501045_0005432 | Ga0501045_0005432_3443_4171 | 241 |
| 1155 | 3300050490 | nmdc:mga03n38_91680_c1 | nmdc:mga03n38_91680_c1_270_1001 | 241 |
| 1156 | 3300050491 | nmdc:mga00v17_226514_c1 | nmdc:mga00v17_226514_c1_216_947 | 241 |
| 1157 | 3300050492 | nmdc:mga0yw44_48278_c1 | nmdc:mga0yw44_48278_c1_1690_2421 | 241 |
| 1158 | 3300050493 | nmdc:mga0k408_183042_c1 | nmdc:mga0k408_183042_c1_250_981 | 241 |
| 1159 | 3300050494 | nmdc:mga06z11_29356_c1 | nmdc:mga06z11_29356_c1_1556_2287 | 241 |
| 1160 | 3300050495 | nmdc:mga04h51_92482_c1 | nmdc:mga04h51_92482_c1_91_822 | 241 |
| 1161 | 3300050514 | nmdc:mga08x19_119583_c1 | nmdc:mga08x19_119583_c1_742_1470 | 241 |
| 1162 | 3300050516 | nmdc:mga0sz30_3193_c1 | nmdc:mga0sz30_3193_c1_1300_2031 | 241 |
| 1163 | 3300053083 | Ga0495655_0023618 | Ga0495655_0023618_97_828 | 241 |
| 1164 | 3300053084 | Ga0495595_0203097 | Ga0495595_0203097_187_915 | 241 |
| 1165 | 3300053085 | Ga0495619_0039633 | Ga0495619_0039633_938_1666 | 241 |
| 1166 | 3300053085 | Ga0495619_0138953 | Ga0495619_0138953_917_1648 | 241 |
| 1167 | 3300053085 | Ga0495619_0296802 | Ga0495619_0296802_263_991 | 241 |
| 1168 | 3300053086 | Ga0500578_0253554 | Ga0500578_0253554_133_864 | 241 |
| 1169 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_259671_260402 | 241 |
| 1170 | 3300053094 | Ga0500566_0000588 | Ga0500566_0000588_18060_18788 | 241 |
| 1171 | 3300053094 | Ga0500566_0007385 | Ga0500566_0007385_842_1573 | 241 |
| 1172 | 3300053095 | Ga0500640_007928 | Ga0500640_007928_304_1032 | 241 |
| 1173 | 3300053101 | Ga0500553_085888 | Ga0500553_085888_613_1344 | 241 |
| 1174 | 3300053105 | Ga0500557_000030 | Ga0500557_000030_65348_66079 | 241 |
| 1175 | 3300053108 | Ga0500562_015039 | Ga0500562_015039_499_1230 | 241 |
| 1176 | 3300053111 | Ga0500572_000174 | Ga0500572_000174_2609_3337 | 241 |
| 1177 | 3300053116 | Ga0500592_012737 | Ga0500592_012737_578_1309 | 241 |
| 1178 | 3300053119 | Ga0500595_012017 | Ga0500595_012017_714_1445 | 241 |
| 1179 | 3300053119 | Ga0500595_050611 | Ga0500595_050611_504_1235 | 241 |
| 1180 | 3300053122 | Ga0500608_018019 | Ga0500608_018019_1499_2227 | 241 |
| 1181 | 3300053122 | Ga0500608_206556 | Ga0500608_206556_22_753 | 241 |
| 1182 | 3300053130 | Ga0500642_0000148 | Ga0500642_0000148_20092_20823 | 241 |
| 1183 | 3300053134 | Ga0500658_0049209 | Ga0500658_0049209_41_772 | 241 |
| 1184 | 3300053136 | Ga0500559_0045944 | Ga0500559_0045944_315_1043 | 241 |
| 1185 | 3300053136 | Ga0500559_0094995 | Ga0500559_0094995_118_849 | 241 |
| 1186 | 3300053147 | Ga0500589_056512 | Ga0500589_056512_111_842 | 241 |
| 1187 | 3300053148 | Ga0500590_038022 | Ga0500590_038022_301_1029 | 241 |
| 1188 | 3300053150 | Ga0500603_001054 | Ga0500603_001054_5436_6164 | 241 |
| 1189 | 3300053153 | Ga0500616_0022040 | Ga0500616_0022040_135_866 | 241 |
| 1190 | 3300053158 | Ga0500627_0019805 | Ga0500627_0019805_262_993 | 241 |
| 1191 | 3300053159 | Ga0500630_001669 | Ga0500630_001669_1493_2221 | 241 |
| 1192 | 3300053162 | Ga0500638_016902 | Ga0500638_016902_1229_1957 | 241 |
| 1193 | 3300053162 | Ga0500638_133356 | Ga0500638_133356_328_1059 | 241 |
| 1194 | 3300053163 | Ga0500639_000006 | Ga0500639_000006_66547_67275 | 241 |
| 1195 | 3300053177 | Ga0500636_0042426 | Ga0500636_0042426_1634_2362 | 241 |
| 1196 | 3300053177 | Ga0500636_0134790 | Ga0500636_0134790_43_774 | 241 |
| 1197 | 3300053178 | Ga0500637_0007374 | Ga0500637_0007374_3207_3935 | 241 |
| 1198 | 3300053722 | Ga0500649_080458 | Ga0500649_080458_289_1020 | 241 |
| 1199 | 3300053730 | Ga0500645_069553 | Ga0500645_069553_178_909 | 241 |
| 1200 | 3300053732 | Ga0500656_007137 | Ga0500656_007137_367_1098 | 241 |
| 1201 | 3300053735 | Ga0500596_001921 | Ga0500596_001921_1488_2216 | 241 |
| 1202 | 3300053736 | Ga0500599_002836 | Ga0500599_002836_227_958 | 241 |
| 1203 | 3300053737 | Ga0500601_000387 | Ga0500601_000387_1500_2231 | 241 |
| 1204 | 3300053737 | Ga0500601_007366 | Ga0500601_007366_136_864 | 241 |
| 1205 | 3300053737 | Ga0500601_013177 | Ga0500601_013177_72_803 | 241 |
| 1206 | 3300054114 | Ga0501084_0002907 | Ga0501084_0002907_12685_13413 | 241 |
| 1207 | 3300055283 | Ga0500661_008965 | Ga0500661_008965_970_1701 | 241 |
| 1208 | 3300055283 | Ga0500661_013161 | Ga0500661_013161_426_1157 | 241 |
| 1209 | 3300060353 | Ga0501082_0010462 | Ga0501082_0010462_3927_4655 | 241 |
| 1210 | 3300061719 | Ga0466962_0027852 | Ga0466962_0027852_1405_2136 | 241 |
| 1211 | 3300061734 | Ga0530510_0173394 | Ga0530510_0173394_160_888 | 241 |
| 1212 | iso_pu_bacteria | 8056681323 | 8056684564 | 241 |
| 1213 | 3300046507 | Ga0495606_0013747 | Ga0495606_0013747_190_921 | 242 |
| 1214 | 3300002077 | JGI24744J21845_10012388 | JGI24744J21845_100123883 | 243 |
| 1215 | 3300003215 | JGI25153J46596_10000584 | JGI25153J46596_1000058421 | 243 |
| 1216 | 3300003659 | JGI25404J52841_10003812 | JGI25404J52841_100038122 | 243 |
| 1217 | 3300005330 | Ga0070690_100181224 | Ga0070690_1001812242 | 243 |
| 1218 | 3300005335 | Ga0070666_10140276 | Ga0070666_101402762 | 243 |
| 1219 | 3300005336 | Ga0070680_100108566 | Ga0070680_1001085662 | 243 |
| 1220 | 3300005338 | Ga0068868_100037777 | Ga0068868_1000377773 | 243 |
| 1221 | 3300005340 | Ga0070689_100398029 | Ga0070689_1003980292 | 243 |
| 1222 | 3300005341 | Ga0070691_10113795 | Ga0070691_101137952 | 243 |
| 1223 | 3300005344 | Ga0070661_100330189 | Ga0070661_1003301892 | 243 |
| 1224 | 3300005345 | Ga0070692_10272411 | Ga0070692_102724111 | 243 |
| 1225 | 3300005355 | Ga0070671_100089161 | Ga0070671_1000891613 | 243 |
| 1226 | 3300005355 | Ga0070671_100393849 | Ga0070671_1003938491 | 243 |
| 1227 | 3300005356 | Ga0070674_100041788 | Ga0070674_1000417882 | 243 |
| 1228 | 3300005438 | Ga0070701_10031761 | Ga0070701_100317613 | 243 |
| 1229 | 3300005455 | Ga0070663_100003861 | Ga0070663_10000386110 | 243 |
| 1230 | 3300005456 | Ga0070678_100009294 | Ga0070678_1000092943 | 243 |
| 1231 | 3300005456 | Ga0070678_100013992 | Ga0070678_1000139925 | 243 |
| 1232 | 3300005530 | Ga0070679_100048989 | Ga0070679_1000489893 | 243 |
| 1233 | 3300005539 | Ga0068853_100162295 | Ga0068853_1001622952 | 243 |
| 1234 | 3300005543 | Ga0070672_100110745 | Ga0070672_1001107452 | 243 |
| 1235 | 3300005543 | Ga0070672_100196003 | Ga0070672_1001960032 | 243 |
| 1236 | 3300005548 | Ga0070665_100229951 | Ga0070665_1002299511 | 243 |
| 1237 | 3300005549 | Ga0070704_100125092 | Ga0070704_1001250922 | 243 |
| 1238 | 3300005563 | Ga0068855_100015060 | Ga0068855_1000150609 | 243 |
| 1239 | 3300005564 | Ga0070664_100032584 | Ga0070664_1000325846 | 243 |
| 1240 | 3300005564 | Ga0070664_100077599 | Ga0070664_1000775993 | 243 |
| 1241 | 3300005614 | Ga0068856_100004253 | Ga0068856_1000042538 | 243 |
| 1242 | 3300005615 | Ga0070702_100381317 | Ga0070702_1003813171 | 243 |
| 1243 | 3300005616 | Ga0068852_100039288 | Ga0068852_1000392883 | 243 |
| 1244 | 3300005616 | Ga0068852_100164154 | Ga0068852_1001641542 | 243 |
| 1245 | 3300005618 | Ga0068864_100078193 | Ga0068864_1000781932 | 243 |
| 1246 | 3300005618 | Ga0068864_100266674 | Ga0068864_1002666742 | 243 |
| 1247 | 3300005719 | Ga0068861_100029518 | Ga0068861_1000295184 | 243 |
| 1248 | 3300005719 | Ga0068861_100252130 | Ga0068861_1002521302 | 243 |
| 1249 | 3300005840 | Ga0068870_10271348 | Ga0068870_102713482 | 243 |
| 1250 | 3300005841 | Ga0068863_100256927 | Ga0068863_1002569272 | 243 |
| 1251 | 3300005937 | Ga0081455_10233267 | Ga0081455_102332672 | 243 |
| 1252 | 3300005983 | Ga0081540_1002655 | Ga0081540_100265514 | 243 |
| 1253 | 3300005983 | Ga0081540_1081149 | Ga0081540_10811492 | 243 |
| 1254 | 3300005985 | Ga0081539_10154855 | Ga0081539_101548551 | 243 |
| 1255 | 3300006038 | Ga0075365_10094262 | Ga0075365_100942622 | 243 |
| 1256 | 3300006038 | Ga0075365_10112344 | Ga0075365_101123442 | 243 |
| 1257 | 3300006048 | Ga0075363_100046557 | Ga0075363_1000465573 | 243 |
| 1258 | 3300006051 | Ga0075364_10016329 | Ga0075364_100163293 | 243 |
| 1259 | 3300006173 | Ga0070716_100202404 | Ga0070716_1002024042 | 243 |
| 1260 | 3300006175 | Ga0070712_100009293 | Ga0070712_1000092935 | 243 |
| 1261 | 3300006186 | Ga0075369_10078534 | Ga0075369_100785342 | 243 |
| 1262 | 3300013297 | Ga0157378_10157077 | Ga0157378_101570772 | 243 |
| 1263 | 3300025297 | Ga0209758_1004893 | Ga0209758_100489311 | 243 |
| 1264 | 3300025905 | Ga0207685_10061918 | Ga0207685_100619182 | 243 |
| 1265 | 3300025907 | Ga0207645_10060303 | Ga0207645_100603032 | 243 |
| 1266 | 3300025907 | Ga0207645_10177475 | Ga0207645_101774752 | 243 |
| 1267 | 3300025908 | Ga0207643_10066630 | Ga0207643_100666302 | 243 |
| 1268 | 3300025913 | Ga0207695_10214399 | Ga0207695_102143992 | 243 |
| 1269 | 3300025915 | Ga0207693_10020689 | Ga0207693_100206893 | 243 |
| 1270 | 3300025917 | Ga0207660_10030192 | Ga0207660_100301922 | 243 |
| 1271 | 3300025921 | Ga0207652_10144479 | Ga0207652_101444792 | 243 |
| 1272 | 3300025925 | Ga0207650_10068179 | Ga0207650_100681793 | 243 |
| 1273 | 3300025927 | Ga0207687_10062803 | Ga0207687_100628032 | 243 |
| 1274 | 3300025931 | Ga0207644_10070670 | Ga0207644_100706702 | 243 |
| 1275 | 3300025931 | Ga0207644_10133935 | Ga0207644_101339352 | 243 |
| 1276 | 3300025935 | Ga0207709_10036879 | Ga0207709_100368792 | 243 |
| 1277 | 3300025937 | Ga0207669_10001419 | Ga0207669_100014198 | 243 |
| 1278 | 3300025937 | Ga0207669_10037824 | Ga0207669_100378242 | 243 |
| 1279 | 3300025938 | Ga0207704_10171336 | Ga0207704_101713362 | 243 |
| 1280 | 3300025939 | Ga0207665_10293523 | Ga0207665_102935232 | 243 |
| 1281 | 3300025940 | Ga0207691_10059792 | Ga0207691_100597922 | 243 |
| 1282 | 3300025940 | Ga0207691_10174355 | Ga0207691_101743552 | 243 |
| 1283 | 3300025944 | Ga0207661_10109127 | Ga0207661_101091271 | 243 |
| 1284 | 3300025945 | Ga0207679_10054782 | Ga0207679_100547823 | 243 |
| 1285 | 3300025949 | Ga0207667_10018590 | Ga0207667_100185904 | 243 |
| 1286 | 3300025960 | Ga0207651_10253449 | Ga0207651_102534492 | 243 |
| 1287 | 3300025960 | Ga0207651_10446024 | Ga0207651_104460242 | 243 |
| 1288 | 3300025972 | Ga0207668_10081235 | Ga0207668_100812353 | 243 |
| 1289 | 3300025972 | Ga0207668_10357051 | Ga0207668_103570512 | 243 |
| 1290 | 3300025981 | Ga0207640_10408574 | Ga0207640_104085742 | 243 |
| 1291 | 3300026023 | Ga0207677_10022070 | Ga0207677_100220703 | 243 |
| 1292 | 3300026035 | Ga0207703_10369690 | Ga0207703_103696902 | 243 |
| 1293 | 3300026067 | Ga0207678_10436092 | Ga0207678_104360922 | 243 |
| 1294 | 3300026075 | Ga0207708_10058337 | Ga0207708_100583372 | 243 |
| 1295 | 3300026078 | Ga0207702_10000014 | Ga0207702_1000001445 | 243 |
| 1296 | 3300026095 | Ga0207676_10105287 | Ga0207676_101052873 | 243 |
| 1297 | 3300026095 | Ga0207676_10528037 | Ga0207676_105280372 | 243 |
| 1298 | 3300026118 | Ga0207675_100505394 | Ga0207675_1005053942 | 243 |
| 1299 | 3300026121 | Ga0207683_10018157 | Ga0207683_100181578 | 243 |
| 1300 | 3300026121 | Ga0207683_10107416 | Ga0207683_101074162 | 243 |
| 1301 | 3300026142 | Ga0207698_10031103 | Ga0207698_100311032 | 243 |
| 1302 | 3300027866 | Ga0209813_10035175 | Ga0209813_100351751 | 243 |
| 1303 | 3300028379 | Ga0268266_10002343 | Ga0268266_100023434 | 243 |
| 1304 | 3300028379 | Ga0268266_10006350 | Ga0268266_100063502 | 243 |
| 1305 | 3300028379 | Ga0268266_10466119 | Ga0268266_104661191 | 243 |
| 1306 | 3300028786 | Ga0307517_10007290 | Ga0307517_1000729010 | 243 |
| 1307 | 3300028786 | Ga0307517_10301404 | Ga0307517_103014041 | 243 |
| 1308 | 3300028794 | Ga0307515_10037579 | Ga0307515_100375795 | 243 |
| 1309 | 3300031456 | Ga0307513_10117127 | Ga0307513_101171273 | 243 |
| 1310 | 3300031548 | Ga0307408_100260154 | Ga0307408_1002601542 | 243 |
| 1311 | 3300031711 | Ga0265314_10130938 | Ga0265314_101309382 | 243 |
| 1312 | 3300031901 | Ga0307406_10138959 | Ga0307406_101389592 | 243 |
| 1313 | 3300032005 | Ga0307411_10033487 | Ga0307411_100334872 | 243 |
| 1314 | 3300032126 | Ga0307415_100405779 | Ga0307415_1004057792 | 243 |
| 1315 | 3300032126 | Ga0307415_100577593 | Ga0307415_1005775931 | 243 |
| 1316 | 3300035092 | Ga0373952_0017543 | Ga0373952_0017543_150_884 | 243 |
| 1317 | 3300037068 | Ga0373925_0103159 | Ga0373925_0103159_477_1211 | 243 |
| 1318 | 3300037471 | Ga0395905_0206719 | Ga0395905_0206719_220_972 | 243 |
| 1319 | 3300046459 | Ga0495629_0037539 | Ga0495629_0037539_2168_2902 | 243 |
| 1320 | 3300048922 | Ga0496119_0093115 | Ga0496119_0093115_232_966 | 243 |
| 1321 | 3300048928 | Ga0496125_0390935 | Ga0496125_0390935_22_756 | 243 |
| 1322 | 3300049577 | Ga0501041_0337438 | Ga0501041_0337438_14_748 | 243 |
| 1323 | 3300049583 | Ga0501067_0032572 | Ga0501067_0032572_1700_2434 | 243 |
| 1324 | 3300049741 | Ga0501079_0202424 | Ga0501079_0202424_586_1320 | 243 |
| 1325 | 3300046461 | Ga0495641_0134744 | Ga0495641_0134744_309_1046 | 244 |
| 1326 | 3300048918 | Ga0496115_0069249 | Ga0496115_0069249_1507_2244 | 244 |
| 1327 | 3300003203 | JGI25406J46586_10000043 | JGI25406J46586_1000004335 | 245 |
| 1328 | 3300005840 | Ga0068870_10152444 | Ga0068870_101524442 | 245 |
| 1329 | 3300005985 | Ga0081539_10000324 | Ga0081539_1000032485 | 245 |
| 1330 | 3300006038 | Ga0075365_10087258 | Ga0075365_100872582 | 245 |
| 1331 | 3300009093 | Ga0105240_10068721 | Ga0105240_100687215 | 245 |
| 1332 | 3300009094 | Ga0111539_10029699 | Ga0111539_100296997 | 245 |
| 1333 | 3300009098 | Ga0105245_10031108 | Ga0105245_100311086 | 245 |
| 1334 | 3300009098 | Ga0105245_10069332 | Ga0105245_100693323 | 245 |
| 1335 | 3300009147 | Ga0114129_10069645 | Ga0114129_100696453 | 245 |
| 1336 | 3300009174 | Ga0105241_10021437 | Ga0105241_100214376 | 245 |
| 1337 | 3300009177 | Ga0105248_10017355 | Ga0105248_100173556 | 245 |
| 1338 | 3300009177 | Ga0105248_10350292 | Ga0105248_103502922 | 245 |
| 1339 | 3300010375 | Ga0105239_10171228 | Ga0105239_101712283 | 245 |
| 1340 | 3300013296 | Ga0157374_10025891 | Ga0157374_100258913 | 245 |
| 1341 | 3300013306 | Ga0163162_10011477 | Ga0163162_1001147710 | 245 |
| 1342 | 3300013306 | Ga0163162_10410990 | Ga0163162_104109902 | 245 |
| 1343 | 3300013308 | Ga0157375_10129123 | Ga0157375_101291233 | 245 |
| 1344 | 3300013308 | Ga0157375_10518484 | Ga0157375_105184842 | 245 |
| 1345 | 3300014325 | Ga0163163_10009818 | Ga0163163_100098186 | 245 |
| 1346 | 3300014325 | Ga0163163_10601784 | Ga0163163_106017842 | 245 |
| 1347 | 3300014326 | Ga0157380_10514719 | Ga0157380_105147192 | 245 |
| 1348 | 3300014745 | Ga0157377_10081149 | Ga0157377_100811492 | 245 |
| 1349 | 3300014969 | Ga0157376_10007833 | Ga0157376_100078337 | 245 |
| 1350 | 3300027907 | Ga0207428_10193448 | Ga0207428_101934482 | 245 |
| 1351 | 3300031711 | Ga0265314_10002529 | Ga0265314_1000252911 | 245 |
| 1352 | 3300031730 | Ga0307516_10031409 | Ga0307516_100314093 | 245 |
| 1353 | 3300031730 | Ga0307516_10232934 | Ga0307516_102329342 | 245 |
| 1354 | 3300031995 | Ga0307409_100395125 | Ga0307409_1003951252 | 245 |
| 1355 | 3300032005 | Ga0307411_10551584 | Ga0307411_105515842 | 245 |
| 1356 | 3300035695 | Ga0373927_0278256 | Ga0373927_0278256_213_953 | 245 |
| 1357 | 3300041459 | Ga0451800_1299000 | Ga0451800_1299000_974_1714 | 245 |
| 1358 | 3300041512 | Ga0451853_3984790 | Ga0451853_3984790_302_1042 | 245 |
| 1359 | 3300042004 | Ga0439445_0028170 | Ga0439445_0028170_548_1288 | 245 |
| 1360 | 3300046453 | Ga0495627_018888 | Ga0495627_018888_883_1623 | 245 |
| 1361 | 3300046455 | Ga0495603_0045295 | Ga0495603_0045295_491_1231 | 245 |
| 1362 | 3300046455 | Ga0495603_0176566 | Ga0495603_0176566_335_1075 | 245 |
| 1363 | 3300046458 | Ga0495591_032611 | Ga0495591_032611_381_1121 | 245 |
| 1364 | 3300046459 | Ga0495629_0353429 | Ga0495629_0353429_72_812 | 245 |
| 1365 | 3300046472 | Ga0495580_0335887 | Ga0495580_0335887_33_773 | 245 |
| 1366 | 3300046475 | Ga0495639_0184216 | Ga0495639_0184216_142_882 | 245 |
| 1367 | 3300046492 | Ga0495585_0078612 | Ga0495585_0078612_396_1136 | 245 |
| 1368 | 3300046507 | Ga0495606_0140641 | Ga0495606_0140641_597_1337 | 245 |
| 1369 | 3300046518 | Ga0495631_0120697 | Ga0495631_0120697_327_1067 | 245 |
| 1370 | 3300046523 | Ga0495644_0091189 | Ga0495644_0091189_275_1015 | 245 |
| 1371 | 3300046526 | Ga0495666_0050426 | Ga0495666_0050426_398_1138 | 245 |
| 1372 | 3300046537 | Ga0495598_0047126 | Ga0495598_0047126_309_1049 | 245 |
| 1373 | 3300046539 | Ga0495621_0062883 | Ga0495621_0062883_357_1097 | 245 |
| 1374 | 3300046558 | Ga0495633_0029685 | Ga0495633_0029685_97_837 | 245 |
| 1375 | 3300046558 | Ga0495633_0131655 | Ga0495633_0131655_326_1066 | 245 |
| 1376 | 3300046615 | Ga0495656_0003634 | Ga0495656_0003634_161_901 | 245 |
| 1377 | 3300046615 | Ga0495656_0061103 | Ga0495656_0061103_650_1390 | 245 |
| 1378 | 3300046616 | Ga0495668_0269517 | Ga0495668_0269517_140_880 | 245 |
| 1379 | 3300046664 | Ga0495659_0066742 | Ga0495659_0066742_346_1086 | 245 |
| 1380 | 3300046665 | Ga0495661_0221495 | Ga0495661_0221495_182_922 | 245 |
| 1381 | 3300046674 | Ga0495588_0032571 | Ga0495588_0032571_1630_2370 | 245 |
| 1382 | 3300046674 | Ga0495588_0160977 | Ga0495588_0160977_254_994 | 245 |
| 1383 | 3300046684 | Ga0495669_0025273 | Ga0495669_0025273_43_783 | 245 |
| 1384 | 3300046691 | Ga0495670_0029574 | Ga0495670_0029574_528_1268 | 245 |
| 1385 | 3300046691 | Ga0495670_0079354 | Ga0495670_0079354_419_1159 | 245 |
| 1386 | 3300047315 | Ga0495581_0400821 | Ga0495581_0400821_16_756 | 245 |
| 1387 | 3300047318 | Ga0495636_0071930 | Ga0495636_0071930_652_1392 | 245 |
| 1388 | 3300047320 | Ga0495672_0045971 | Ga0495672_0045971_856_1596 | 245 |
| 1389 | 3300048903 | Ga0496100_0030986 | Ga0496100_0030986_2130_2870 | 245 |
| 1390 | 3300048904 | Ga0496101_0001116 | Ga0496101_0001116_9593_10333 | 245 |
| 1391 | 3300048905 | Ga0496102_0011710 | Ga0496102_0011710_5428_6168 | 245 |
| 1392 | 3300048905 | Ga0496102_0705933 | Ga0496102_0705933_106_846 | 245 |
| 1393 | 3300048906 | Ga0496103_0017422 | Ga0496103_0017422_2138_2878 | 245 |
| 1394 | 3300048907 | Ga0496104_0108079 | Ga0496104_0108079_1612_2352 | 245 |
| 1395 | 3300048907 | Ga0496104_0546430 | Ga0496104_0546430_55_795 | 245 |
| 1396 | 3300048908 | Ga0496105_0028196 | Ga0496105_0028196_2167_2907 | 245 |
| 1397 | 3300048910 | Ga0496107_0063213 | Ga0496107_0063213_875_1615 | 245 |
| 1398 | 3300048910 | Ga0496107_0313582 | Ga0496107_0313582_165_905 | 245 |
| 1399 | 3300048913 | Ga0496110_0024274 | Ga0496110_0024274_546_1286 | 245 |
| 1400 | 3300048914 | Ga0496111_0035505 | Ga0496111_0035505_1437_2177 | 245 |
| 1401 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_91080_91820 | 245 |
| 1402 | 3300048917 | Ga0496114_0034331 | Ga0496114_0034331_223_963 | 245 |
| 1403 | 3300048918 | Ga0496115_0001457 | Ga0496115_0001457_6503_7243 | 245 |
| 1404 | 3300048918 | Ga0496115_0517521 | Ga0496115_0517521_147_887 | 245 |
| 1405 | 3300048922 | Ga0496119_0056925 | Ga0496119_0056925_1269_2009 | 245 |
| 1406 | 3300048924 | Ga0496121_0002915 | Ga0496121_0002915_16708_17451 | 245 |
| 1407 | 3300048924 | Ga0496121_0068006 | Ga0496121_0068006_1939_2679 | 245 |
| 1408 | 3300048925 | Ga0496122_0026757 | Ga0496122_0026757_1257_1997 | 245 |
| 1409 | 3300048926 | Ga0496123_0024339 | Ga0496123_0024339_2696_3436 | 245 |
| 1410 | 3300048927 | Ga0496124_0115301 | Ga0496124_0115301_593_1333 | 245 |
| 1411 | 3300048929 | Ga0496126_0001668 | Ga0496126_0001668_25674_26414 | 245 |
| 1412 | 3300048929 | Ga0496126_0036934 | Ga0496126_0036934_3410_4150 | 245 |
| 1413 | 3300049578 | Ga0501042_0544366 | Ga0501042_0544366_88_828 | 245 |
| 1414 | 3300049592 | Ga0501076_0279251 | Ga0501076_0279251_451_1191 | 245 |
| 1415 | 3300050492 | nmdc:mga0yw44_10820_c1 | nmdc:mga0yw44_10820_c1_3692_4432 | 245 |
| 1416 | 3300050492 | nmdc:mga0yw44_241651_c1 | nmdc:mga0yw44_241651_c1_84_824 | 245 |
| 1417 | 3300050495 | nmdc:mga04h51_124722_c1 | nmdc:mga04h51_124722_c1_155_895 | 245 |
| 1418 | 3300050508 | nmdc:mga09592_69360_c1 | nmdc:mga09592_69360_c1_1853_2593 | 245 |
| 1419 | 3300053083 | Ga0495655_0008988 | Ga0495655_0008988_304_1044 | 245 |
| 1420 | 3300053083 | Ga0495655_0033641 | Ga0495655_0033641_392_1132 | 245 |
| 1421 | 3300053094 | Ga0500566_0005320 | Ga0500566_0005320_4419_5159 | 245 |
| 1422 | 3300053096 | Ga0500641_0015731 | Ga0500641_0015731_2008_2748 | 245 |
| 1423 | 3300053102 | Ga0500554_008721 | Ga0500554_008721_1474_2214 | 245 |
| 1424 | 3300053119 | Ga0500595_000068 | Ga0500595_000068_16633_17373 | 245 |
| 1425 | 3300053119 | Ga0500595_008896 | Ga0500595_008896_3234_3977 | 245 |
| 1426 | 3300053139 | Ga0500568_0010665 | Ga0500568_0010665_908_1651 | 245 |
| 1427 | 3300053155 | Ga0500620_045449 | Ga0500620_045449_198_938 | 245 |
| 1428 | 3300053162 | Ga0500638_005706 | Ga0500638_005706_2857_3597 | 245 |
| 1429 | 3300053178 | Ga0500637_0002593 | Ga0500637_0002593_4893_5633 | 245 |
| 1430 | 3300053730 | Ga0500645_011367 | Ga0500645_011367_871_1611 | 245 |
| 1431 | 3300054114 | Ga0501084_0401359 | Ga0501084_0401359_373_1113 | 245 |
| 1432 | 3300055283 | Ga0500661_009319 | Ga0500661_009319_831_1571 | 245 |
| 1433 | 3300049572 | Ga0501036_0206702 | Ga0501036_0206702_29_775 | 246 |
| 1434 | 3300005842 | Ga0068858_100136563 | Ga0068858_1001365632 | 247 |
| 1435 | 3300025315 | Ga0207697_10065973 | Ga0207697_100659732 | 247 |
| 1436 | 3300025934 | Ga0207686_10149700 | Ga0207686_101497002 | 247 |
| 1437 | 3300025935 | Ga0207709_10229494 | Ga0207709_102294942 | 247 |
| 1438 | 3300026035 | Ga0207703_10503678 | Ga0207703_105036782 | 247 |
| 1439 | 3300026095 | Ga0207676_10157516 | Ga0207676_101575163 | 247 |
| 1440 | 3300001989 | JGI24739J22299_10013235 | JGI24739J22299_100132354 | 249 |
| 1441 | 3300001990 | JGI24737J22298_10020065 | JGI24737J22298_100200652 | 249 |
| 1442 | 3300002075 | JGI24738J21930_10040683 | JGI24738J21930_100406832 | 249 |
| 1443 | 3300005455 | Ga0070663_100042900 | Ga0070663_1000429002 | 249 |
| 1444 | 3300005539 | Ga0068853_100099687 | Ga0068853_1000996872 | 249 |
| 1445 | 3300005563 | Ga0068855_100071320 | Ga0068855_1000713205 | 249 |
| 1446 | 3300005577 | Ga0068857_100007059 | Ga0068857_1000070594 | 249 |
| 1447 | 3300005578 | Ga0068854_100042625 | Ga0068854_1000426252 | 249 |
| 1448 | 3300005614 | Ga0068856_100039035 | Ga0068856_1000390352 | 249 |
| 1449 | 3300009093 | Ga0105240_10078563 | Ga0105240_100785633 | 249 |
| 1450 | 3300009174 | Ga0105241_10003365 | Ga0105241_100033655 | 249 |
| 1451 | 3300009176 | Ga0105242_10166958 | Ga0105242_101669582 | 249 |
| 1452 | 3300009177 | Ga0105248_10206580 | Ga0105248_102065803 | 249 |
| 1453 | 3300009545 | Ga0105237_10100724 | Ga0105237_101007243 | 249 |
| 1454 | 3300009551 | Ga0105238_10003808 | Ga0105238_100038083 | 249 |
| 1455 | 3300009551 | Ga0105238_10028380 | Ga0105238_100283803 | 249 |
| 1456 | 3300010375 | Ga0105239_10159619 | Ga0105239_101596192 | 249 |
| 1457 | 3300010375 | Ga0105239_10402060 | Ga0105239_104020602 | 249 |
| 1458 | 3300025321 | Ga0207656_10029528 | Ga0207656_100295282 | 249 |
| 1459 | 3300025904 | Ga0207647_10012297 | Ga0207647_100122976 | 249 |
| 1460 | 3300025911 | Ga0207654_10280472 | Ga0207654_102804722 | 249 |
| 1461 | 3300025924 | Ga0207694_10045004 | Ga0207694_100450043 | 249 |
| 1462 | 3300025949 | Ga0207667_10026463 | Ga0207667_100264635 | 249 |
| 1463 | 3300025981 | Ga0207640_10010676 | Ga0207640_100106762 | 249 |
| 1464 | 3300026041 | Ga0207639_10082192 | Ga0207639_100821922 | 249 |
| 1465 | 3300026067 | Ga0207678_10048642 | Ga0207678_100486423 | 249 |
| 1466 | 3300026078 | Ga0207702_10033789 | Ga0207702_100337892 | 249 |
| 1467 | 3300026116 | Ga0207674_10022325 | Ga0207674_100223257 | 249 |
| 1468 | 3300035115 | Ga0373941_0051377 | Ga0373941_0051377_281_1033 | 249 |
| 1469 | 3300035691 | Ga0373931_0129764 | Ga0373931_0129764_614_1366 | 249 |
| 1470 | 3300035695 | Ga0373927_0012663 | Ga0373927_0012663_3778_4530 | 249 |
| 1471 | 3300035695 | Ga0373927_0051353 | Ga0373927_0051353_261_1013 | 249 |
| 1472 | 3300037068 | Ga0373925_0424248 | Ga0373925_0424248_24_776 | 249 |
| 1473 | 3300046475 | Ga0495639_0155951 | Ga0495639_0155951_25_777 | 249 |
| 1474 | 3300046517 | Ga0495630_0116733 | Ga0495630_0116733_335_1087 | 249 |
| 1475 | 3300046683 | Ga0495658_0143151 | Ga0495658_0143151_295_1047 | 249 |
| 1476 | 3300047319 | Ga0495674_0554644 | Ga0495674_0554644_112_864 | 249 |
| 1477 | 3300048903 | Ga0496100_0319795 | Ga0496100_0319795_138_890 | 249 |
| 1478 | 3300048904 | Ga0496101_0349694 | Ga0496101_0349694_307_1059 | 249 |
| 1479 | 3300048905 | Ga0496102_0139532 | Ga0496102_0139532_245_997 | 249 |
| 1480 | 3300048906 | Ga0496103_0079695 | Ga0496103_0079695_1272_2024 | 249 |
| 1481 | 3300048907 | Ga0496104_0396945 | Ga0496104_0396945_377_1129 | 249 |
| 1482 | 3300048908 | Ga0496105_0140536 | Ga0496105_0140536_368_1120 | 249 |
| 1483 | 3300048909 | Ga0496106_0083302 | Ga0496106_0083302_368_1120 | 249 |
| 1484 | 3300048910 | Ga0496107_0009363 | Ga0496107_0009363_5321_6073 | 249 |
| 1485 | 3300048912 | Ga0496109_0203135 | Ga0496109_0203135_286_1038 | 249 |
| 1486 | 3300048913 | Ga0496110_0065839 | Ga0496110_0065839_418_1170 | 249 |
| 1487 | 3300048914 | Ga0496111_0009582 | Ga0496111_0009582_5404_6156 | 249 |
| 1488 | 3300048915 | Ga0496112_0318223 | Ga0496112_0318223_419_1171 | 249 |
| 1489 | 3300048916 | Ga0496113_0339605 | Ga0496113_0339605_84_836 | 249 |
| 1490 | 3300048918 | Ga0496115_0013523 | Ga0496115_0013523_5290_6042 | 249 |
| 1491 | 3300053084 | Ga0495595_0014352 | Ga0495595_0014352_1118_1870 | 249 |
| 1492 | 3300053085 | Ga0495619_0065256 | Ga0495619_0065256_852_1604 | 249 |
| 1493 | 3300001979 | JGI24740J21852_10013460 | JGI24740J21852_100134602 | 255 |
| 1494 | 3300005455 | Ga0070663_100293598 | Ga0070663_1002935982 | 255 |
| 1495 | 3300005539 | Ga0068853_100009798 | Ga0068853_1000097986 | 255 |
| 1496 | 3300005563 | Ga0068855_100019571 | Ga0068855_1000195717 | 255 |
| 1497 | 3300005577 | Ga0068857_100028351 | Ga0068857_1000283512 | 255 |
| 1498 | 3300005578 | Ga0068854_100005211 | Ga0068854_1000052112 | 255 |
| 1499 | 3300005614 | Ga0068856_100010258 | Ga0068856_1000102585 | 255 |
| 1500 | 3300005616 | Ga0068852_100328460 | Ga0068852_1003284602 | 255 |
| 1501 | 3300005834 | Ga0068851_10000746 | Ga0068851_100007468 | 255 |
| 1502 | 3300025911 | Ga0207654_10002385 | Ga0207654_100023859 | 255 |
| 1503 | 3300025913 | Ga0207695_10000579 | Ga0207695_1000057946 | 255 |
| 1504 | 3300025924 | Ga0207694_10001208 | Ga0207694_1000120821 | 255 |
| 1505 | 3300025949 | Ga0207667_10007912 | Ga0207667_1000791212 | 255 |
| 1506 | 3300026041 | Ga0207639_10007424 | Ga0207639_100074242 | 255 |
| 1507 | 3300026067 | Ga0207678_10230307 | Ga0207678_102303072 | 255 |
| 1508 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003165 | 255 |
| 1509 | 3300026116 | Ga0207674_10007573 | Ga0207674_100075737 | 255 |
| 1510 | 3300026142 | Ga0207698_10013764 | Ga0207698_100137642 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9822 | 34 | 151 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9819 | 35 | 151 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9791 | 35 | 151 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9764 | 35 | 151 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9734 | 34 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.98 | 32 | 109 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9753 | 33 | 152 | 3.40.50.2300 |
| 1nxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9732 | 35 | 151 | 3.40.50.2300 |
| af_P23836_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9731 | 35 | 112 | 3.40.50.2300 |
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9715 | 35 | 112 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350Y6D3-F1-model_v4 | Histidine kinase | 0.9822 | 34 | 134 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0016301 GO:0032993 |
| AF-A0A1Z4LL58-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9814 | 33 | 150 |
GO:0000155
|
| AF-A0A7C9PZV4-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.98 | 34 | 150 |
GO:0000155
|
| AF-A0A6I5QSI8-F1-model_v4 | Response regulator | 0.9797 | 34 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3N5EU33-F1-model_v4 | Response regulator | 0.9792 | 33 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar