F494376

General Info

Members Datasets Scaffolds Average Seq Length
1497 431 2994 236

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100377564|Ga0307409_1003775642
Length 279
Sequence MQLRKFPYTLESCVVKTLERLLVSHRHAGYPPAFTGRGREKGGMSQVIALVDDDRNILTSVSIALQQEGFITRVYSDGTTALKAIGDNPPDLGVFDIKMPGMDGMELLRRLRETSSVPVIFLTSKDDELDEALGLAMGADDYISKPFSQRLLIARIRAILRRQELERGEAAANSDEPEPPRLERGRLVMDPARHKVIWDGKDVSLTVTEFLILEALAQRPGVVKSRNQLLDIAYNDDVYVDDRTIDSHIKRIRRKFRAHDPQFDSIETLYGVGYRFDEQ

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
266 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
269 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
270 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
271 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
363 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
364 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
365 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
366 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
367 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
368 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
374 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
375 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
378 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
390 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
391 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
392 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
393 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
394 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
395 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
396 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
407 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
408 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
409 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
414 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
415 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
416 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
417 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
418 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
419 2643221583 Caulobacter sp. Root655 Isolate Unclassified
420 2643221584 Caulobacter sp. Root656 Isolate Unclassified
421 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
422 2818991435 Caulobacter henricii 536 Isolate Unclassified
423 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
424 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
425 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
426 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
427 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
428 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
429 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
430 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
431 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.27
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 4.21
Rhizosphere 87.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100377564 3300031995 Bacteria 1346
2 JGI24741J21665_1009291 3300001915 Bacteria 1813
3 JGI24752J21851_1006614 3300001976 Bacteria 1516
4 JGI24752J21851_1018781 3300001976 Bacteria 901
5 JGI24740J21852_10001751 3300001979 Bacteria 9977
6 JGI24740J21852_10011465 3300001979 Bacteria 3372
7 JGI24740J21852_10031692 3300001979 Bacteria 1701
8 JGI24739J22299_10001437 3300001989 Bacteria 8976
9 JGI24739J22299_10021447 3300001989 Bacteria 2299
10 JGI24737J22298_10004924 3300001990 Bacteria 4627
11 JGI24737J22298_10005430 3300001990 Bacteria 4401
12 JGI24737J22298_10027764 3300001990 Bacteria 1782
13 JGI24737J22298_10028978 3300001990 Bacteria 1738
14 JGI24737J22298_10073910 3300001990 Bacteria 1017
15 JGI24743J22301_10003950 3300001991 Bacteria 2378
16 JGI24743J22301_10030619 3300001991 Bacteria 1059
17 JGI24735J21928_10003716 3300002067 Bacteria 5177
18 JGI24735J21928_10004038 3300002067 Bacteria 4950
19 JGI24735J21928_10012841 3300002067 Bacteria 2644
20 JGI24735J21928_10022727 3300002067 Bacteria 1906
21 JGI24750J21931_1010515 3300002070 Bacteria 1207
22 JGI24738J21930_10004628 3300002075 Bacteria 3356
23 JGI25153J46596_10045638 3300003215 Bacteria 1305
24 Ga0055526_1030076 3300003771 Bacteria 1594
25 Ga0055524_1016758 3300003775 Bacteria 2611
26 Ga0055524_1040806 3300003775 Bacteria 1178
27 Ga0055528_1013757 3300003790 Bacteria 3044
28 Ga0055530_10000987 3300003791 Bacteria 22808
29 Ga0055530_10067721 3300003791 Bacteria 778
30 Ga0055531_10002442 3300003794 Bacteria 12439
31 Ga0055531_10020386 3300003794 Bacteria 2624
32 Ga0065165_1000583 3300005262 Bacteria 53842
33 Ga0065165_1001140 3300005262 Bacteria 31153
34 Ga0065712_10132582 3300005290 Bacteria 1532
35 Ga0065712_10228343 3300005290 Bacteria 1019
36 Ga0065715_10139509 3300005293 Bacteria 1875
37 Ga0065715_10164498 3300005293 Bacteria 1595
38 Ga0065715_10209071 3300005293 Bacteria 1323
39 Ga0065715_10261607 3300005293 Bacteria 1136
40 Ga0065715_10370799 3300005293 Bacteria 917
41 Ga0065707_10107500 3300005295 Bacteria 2551
42 Ga0070658_10000001 3300005327 Bacteria 856789
43 Ga0070658_10013428 3300005327 Bacteria 6571
44 Ga0070658_10031030 3300005327 Bacteria 4291
45 Ga0070658_10043979 3300005327 Bacteria 3608
46 Ga0070658_10049315 3300005327 Bacteria 3410
47 Ga0070658_10159215 3300005327 Bacteria 1894
48 Ga0070658_10200792 3300005327 Bacteria 1682
49 Ga0070658_10461660 3300005327 Bacteria 1095
50 Ga0070658_10613073 3300005327 Bacteria 943
51 Ga0070658_10618156 3300005327 Bacteria 939
52 Ga0070676_10003480 3300005328 Bacteria 8209
53 Ga0070676_10029061 3300005328 Bacteria 3142
54 Ga0070676_10191766 3300005328 Bacteria 1335
55 Ga0070683_100017503 3300005329 Bacteria 6334
56 Ga0070683_100070865 3300005329 Bacteria 3252
57 Ga0070683_100076509 3300005329 Bacteria 3128
58 Ga0070683_100090361 3300005329 Bacteria 2875
59 Ga0070690_100072921 3300005330 Bacteria 2233
60 Ga0070690_100134831 3300005330 Bacteria 1671
61 Ga0070670_100001683 3300005331 Bacteria 17959
62 Ga0070670_100008579 3300005331 Bacteria 8717
63 Ga0070670_100051615 3300005331 Bacteria 3531
64 Ga0070670_100067846 3300005331 Bacteria 3060
65 Ga0070670_100099944 3300005331 Bacteria 2496
66 Ga0070670_100123249 3300005331 Bacteria 2236
67 Ga0070670_100491413 3300005331 Bacteria 1091
68 Ga0070677_10143027 3300005333 Bacteria 1105
69 Ga0068869_100007757 3300005334 Bacteria 6883
70 Ga0068869_100079799 3300005334 Bacteria 2439
71 Ga0070666_10000560 3300005335 Bacteria 22474
72 Ga0070666_10000589 3300005335 Bacteria 21952
73 Ga0070666_10006877 3300005335 Bacteria 7007
74 Ga0070666_10023181 3300005335 Bacteria 4038
75 Ga0070666_10028457 3300005335 Bacteria 3667
76 Ga0070666_10150239 3300005335 Bacteria 1625
77 Ga0070666_10151542 3300005335 Bacteria 1617
78 Ga0070680_100000762 3300005336 Bacteria 22541
79 Ga0070680_100000835 3300005336 Bacteria 21767
80 Ga0070680_100017079 3300005336 Bacteria 5716
81 Ga0070680_100182656 3300005336 Bacteria 1767
82 Ga0070682_100044268 3300005337 Bacteria 2755
83 Ga0070682_100057303 3300005337 Bacteria 2454
84 Ga0068868_100001536 3300005338 Bacteria 15801
85 Ga0068868_100151370 3300005338 Bacteria 1911
86 Ga0068868_100217849 3300005338 Bacteria 1597
87 Ga0068868_100380232 3300005338 Bacteria 1215
88 Ga0070660_100005075 3300005339 Bacteria 9098
89 Ga0070660_100011166 3300005339 Bacteria 6373
90 Ga0070660_100033069 3300005339 Bacteria 3895
91 Ga0070660_100195215 3300005339 Bacteria 1640
92 Ga0070660_100312583 3300005339 Bacteria 1289
93 Ga0070660_100324853 3300005339 Bacteria 1264
94 Ga0070660_100369895 3300005339 Bacteria 1182
95 Ga0070687_100159773 3300005343 Bacteria 1331
96 Ga0070661_100000010 3300005344 Bacteria 175777
97 Ga0070661_100022365 3300005344 Bacteria 4526
98 Ga0070661_100024164 3300005344 Bacteria 4358
99 Ga0070661_100037007 3300005344 Bacteria 3550
100 Ga0070661_100038025 3300005344 Bacteria 3502
101 Ga0070661_100048673 3300005344 Bacteria 3103
102 Ga0070661_100086955 3300005344 Bacteria 2312
103 Ga0070661_100087995 3300005344 Bacteria 2298
104 Ga0070661_100163533 3300005344 Bacteria 1686
105 Ga0070661_100266386 3300005344 Bacteria 1326
106 Ga0070661_100469835 3300005344 Bacteria 1003
107 Ga0070668_100003316 3300005347 Bacteria 11877
108 Ga0070668_100024475 3300005347 Bacteria 4576
109 Ga0070668_100096442 3300005347 Bacteria 2337
110 Ga0070669_100000042 3300005353 Bacteria 123396
111 Ga0070669_100015724 3300005353 Bacteria 5397
112 Ga0070669_100037569 3300005353 Bacteria 3513
113 Ga0070669_100156266 3300005353 Bacteria 1769
114 Ga0070669_100264789 3300005353 Bacteria 1373
115 Ga0070675_100008232 3300005354 Bacteria 8089
116 Ga0070675_100055903 3300005354 Bacteria 3250
117 Ga0070675_100059392 3300005354 Bacteria 3155
118 Ga0070675_100092263 3300005354 Bacteria 2539
119 Ga0070675_100212004 3300005354 Bacteria 1684
120 Ga0070671_100000010 3300005355 Bacteria 202799
121 Ga0070671_100014861 3300005355 Bacteria 6289
122 Ga0070671_100016348 3300005355 Bacteria 6000
123 Ga0070671_100019917 3300005355 Bacteria 5466
124 Ga0070671_100020234 3300005355 Bacteria 5425
125 Ga0070671_100022996 3300005355 Bacteria 5093
126 Ga0070671_100023745 3300005355 Bacteria 5019
127 Ga0070671_100028714 3300005355 Bacteria 4583
128 Ga0070671_100286177 3300005355 Bacteria 1402
129 Ga0070674_100061300 3300005356 Bacteria 2625
130 Ga0070673_100000926 3300005364 Bacteria 16587
131 Ga0070673_100004977 3300005364 Bacteria 8470
132 Ga0070673_100021743 3300005364 Bacteria 4658
133 Ga0070673_100041683 3300005364 Bacteria 3534
134 Ga0070673_100061266 3300005364 Bacteria 2985
135 Ga0070673_100081617 3300005364 Bacteria 2622
136 Ga0070673_100142119 3300005364 Bacteria 2026
137 Ga0070673_100302763 3300005364 Bacteria 1408
138 Ga0070659_100000001 3300005366 Bacteria 576390
139 Ga0070659_100009955 3300005366 Bacteria 6994
140 Ga0070659_100016148 3300005366 Bacteria 5601
141 Ga0070659_100021317 3300005366 Bacteria 4933
142 Ga0070659_100024216 3300005366 Bacteria 4652
143 Ga0070659_100030375 3300005366 Bacteria 4182
144 Ga0070659_100061352 3300005366 Bacteria 2972
145 Ga0070659_100064515 3300005366 Bacteria 2899
146 Ga0070659_100080249 3300005366 Bacteria 2605
147 Ga0070659_100197383 3300005366 Bacteria 1655
148 Ga0070659_100402319 3300005366 Bacteria 1156
149 Ga0070659_100464984 3300005366 Bacteria 1075
150 Ga0070659_100556024 3300005366 Bacteria 983
151 Ga0070667_100006418 3300005367 Bacteria 9774
152 Ga0070667_100008406 3300005367 Bacteria 8560
153 Ga0070667_100029024 3300005367 Bacteria 4607
154 Ga0070667_100046823 3300005367 Bacteria 3638
155 Ga0070667_100084928 3300005367 Bacteria 2714
156 Ga0070667_100343370 3300005367 Bacteria 1350
157 Ga0070667_100356690 3300005367 Bacteria 1325
158 Ga0070667_100851205 3300005367 Bacteria 848
159 Ga0070709_10028601 3300005434 Bacteria 3326
160 Ga0070714_100015883 3300005435 Bacteria 6068
161 Ga0070714_100019297 3300005435 Bacteria 5550
162 Ga0070714_100030646 3300005435 Bacteria 4480
163 Ga0070713_100025410 3300005436 Bacteria 4630
164 Ga0070713_100031098 3300005436 Bacteria 4248
165 Ga0070713_100134331 3300005436 Bacteria 2185
166 Ga0070713_100255808 3300005436 Bacteria 1599
167 Ga0070713_100272995 3300005436 Bacteria 1549
168 Ga0070711_100174498 3300005439 Bacteria 1641
169 Ga0070711_100333518 3300005439 Bacteria 1215
170 Ga0070705_100062935 3300005440 Bacteria 2211
171 Ga0070694_100030397 3300005444 Bacteria 3533
172 Ga0070708_100213107 3300005445 Bacteria 1810
173 Ga0070663_100008986 3300005455 Bacteria 6170
174 Ga0070663_100030578 3300005455 Bacteria 3692
175 Ga0070663_100059342 3300005455 Bacteria 2750
176 Ga0070663_100067316 3300005455 Bacteria 2597
177 Ga0070663_100070177 3300005455 Bacteria 2547
178 Ga0070678_100008190 3300005456 Bacteria 6248
179 Ga0070678_100008901 3300005456 Bacteria 6043
180 Ga0070678_100031729 3300005456 Bacteria 3649
181 Ga0070678_100189326 3300005456 Bacteria 1690
182 Ga0070662_100004908 3300005457 Bacteria 8495
183 Ga0070662_100005390 3300005457 Bacteria 8167
184 Ga0070662_100010452 3300005457 Bacteria 6091
185 Ga0070662_100013093 3300005457 Bacteria 5513
186 Ga0070662_100015663 3300005457 Bacteria 5083
187 Ga0070662_100015798 3300005457 Bacteria 5062
188 Ga0070662_100062252 3300005457 Bacteria 2726
189 Ga0070662_100077047 3300005457 Bacteria 2473
190 Ga0070662_100120426 3300005457 Bacteria 2011
191 Ga0070662_100126353 3300005457 Bacteria 1966
192 Ga0070662_100166114 3300005457 Bacteria 1730
193 Ga0070662_100314216 3300005457 Bacteria 1276
194 Ga0070681_10045727 3300005458 Bacteria 4379
195 Ga0070681_10077048 3300005458 Bacteria 3292
196 Ga0070681_10102210 3300005458 Bacteria 2811
197 Ga0070681_10134375 3300005458 Bacteria 2405
198 Ga0068867_100018201 3300005459 Bacteria 4992
199 Ga0068867_100238152 3300005459 Bacteria 1474
200 Ga0070685_10204339 3300005466 Bacteria 1286
201 Ga0070698_100437446 3300005471 Bacteria 1243
202 Ga0070679_100000005 3300005530 Bacteria 263201
203 Ga0070679_100048005 3300005530 Bacteria 4255
204 Ga0070679_100060540 3300005530 Bacteria 3773
205 Ga0070679_100131321 3300005530 Bacteria 2486
206 Ga0070679_100384186 3300005530 Bacteria 1351
207 Ga0070684_100015958 3300005535 Bacteria 6133
208 Ga0070684_100141978 3300005535 Bacteria 2172
209 Ga0070697_100318495 3300005536 Bacteria 1339
210 Ga0068853_100011737 3300005539 Bacteria 7120
211 Ga0068853_100031940 3300005539 Bacteria 4457
212 Ga0068853_100060811 3300005539 Bacteria 3265
213 Ga0068853_100101709 3300005539 Bacteria 2542
214 Ga0068853_100122125 3300005539 Bacteria 2324
215 Ga0068853_100130600 3300005539 Bacteria 2248
216 Ga0068853_100194643 3300005539 Bacteria 1843
217 Ga0070672_100018334 3300005543 Bacteria 5058
218 Ga0070672_100080237 3300005543 Bacteria 2614
219 Ga0070672_100097854 3300005543 Bacteria 2376
220 Ga0070672_100124754 3300005543 Bacteria 2111
221 Ga0070672_100241396 3300005543 Bacteria 1520
222 Ga0070672_100277966 3300005543 Bacteria 1415
223 Ga0070686_100049303 3300005544 Bacteria 2671
224 Ga0070686_100101663 3300005544 Bacteria 1943
225 Ga0070686_100157522 3300005544 Bacteria 1596
226 Ga0070695_100125097 3300005545 Bacteria 1764
227 Ga0070696_100029968 3300005546 Bacteria 3722
228 Ga0070696_100287654 3300005546 Bacteria 1255
229 Ga0070693_100019430 3300005547 Bacteria 3562
230 Ga0070693_100025424 3300005547 Bacteria 3187
231 Ga0070693_100107954 3300005547 Bacteria 1707
232 Ga0070693_100350686 3300005547 Bacteria 1010
233 Ga0070665_100000075 3300005548 Bacteria 189496
234 Ga0070665_100000705 3300005548 Bacteria 44568
235 Ga0070665_100006901 3300005548 Bacteria 11543
236 Ga0070665_100017020 3300005548 Bacteria 7289
237 Ga0070665_100020609 3300005548 Bacteria 6624
238 Ga0070665_100039761 3300005548 Bacteria 4727
239 Ga0070665_100041899 3300005548 Bacteria 4603
240 Ga0070665_100102810 3300005548 Bacteria 2861
241 Ga0070665_100123413 3300005548 Bacteria 2592
242 Ga0070665_100158243 3300005548 Bacteria 2267
243 Ga0070665_100216796 3300005548 Bacteria 1914
244 Ga0070665_100362544 3300005548 Bacteria 1455
245 Ga0068855_100000075 3300005563 Bacteria 119094
246 Ga0068855_100047862 3300005563 Bacteria 5050
247 Ga0068855_100110265 3300005563 Bacteria 3159
248 Ga0068855_100111054 3300005563 Bacteria 3147
249 Ga0068855_100128065 3300005563 Bacteria 2901
250 Ga0068855_100187397 3300005563 Bacteria 2336
251 Ga0068855_100235859 3300005563 Bacteria 2046
252 Ga0068855_100291514 3300005563 Bacteria 1809
253 Ga0068855_100941118 3300005563 Bacteria 911
254 Ga0070664_100001286 3300005564 Bacteria 20075
255 Ga0070664_100002393 3300005564 Bacteria 15065
256 Ga0070664_100002719 3300005564 Bacteria 14275
257 Ga0070664_100008077 3300005564 Bacteria 8505
258 Ga0070664_100008895 3300005564 Bacteria 8136
259 Ga0070664_100035616 3300005564 Bacteria 4178
260 Ga0070664_100038260 3300005564 Bacteria 4037
261 Ga0070664_100058638 3300005564 Bacteria 3274
262 Ga0070664_100077294 3300005564 Bacteria 2862
263 Ga0070664_100094475 3300005564 Bacteria 2593
264 Ga0070664_100131923 3300005564 Bacteria 2195
265 Ga0070664_100215005 3300005564 Bacteria 1718
266 Ga0070664_100237039 3300005564 Bacteria 1637
267 Ga0070664_100644543 3300005564 Bacteria 984
268 Ga0068857_100013797 3300005577 Bacteria 7038
269 Ga0068857_100017690 3300005577 Bacteria 6251
270 Ga0068857_100046949 3300005577 Bacteria 3833
271 Ga0068857_100117168 3300005577 Bacteria 2397
272 Ga0068857_100155883 3300005577 Bacteria 2071
273 Ga0068857_100323095 3300005577 Bacteria 1425
274 Ga0068857_100364716 3300005577 Bacteria 1339
275 Ga0068854_100000526 3300005578 Bacteria 23217
276 Ga0068854_100042423 3300005578 Bacteria 3220
277 Ga0068854_100105510 3300005578 Bacteria 2118
278 Ga0068854_100133236 3300005578 Bacteria 1900
279 Ga0068854_100935739 3300005578 Bacteria 764
280 Ga0068856_100023109 3300005614 Bacteria 6047
281 Ga0068856_100056588 3300005614 Bacteria 3870
282 Ga0068856_100092865 3300005614 Bacteria 3003
283 Ga0068856_100165919 3300005614 Bacteria 2219
284 Ga0068856_100187752 3300005614 Bacteria 2081
285 Ga0068856_100191531 3300005614 Bacteria 2058
286 Ga0068852_100002222 3300005616 Bacteria 13311
287 Ga0068852_100014896 3300005616 Bacteria 6008
288 Ga0068852_100019408 3300005616 Bacteria 5380
289 Ga0068852_100087335 3300005616 Bacteria 2782
290 Ga0068852_100110504 3300005616 Bacteria 2498
291 Ga0068852_100124025 3300005616 Bacteria 2369
292 Ga0068852_100148166 3300005616 Bacteria 2179
293 Ga0068852_100249884 3300005616 Bacteria 1699
294 Ga0068852_100261542 3300005616 Bacteria 1662
295 Ga0068852_100298436 3300005616 Bacteria 1559
296 Ga0068852_100307804 3300005616 Bacteria 1535
297 Ga0068859_100000068 3300005617 Bacteria 96701
298 Ga0068859_100000311 3300005617 Bacteria 48667
299 Ga0068859_100039170 3300005617 Bacteria 4754
300 Ga0068859_100046359 3300005617 Bacteria 4365
301 Ga0068859_100085280 3300005617 Bacteria 3204
302 Ga0068859_100232809 3300005617 Bacteria 1930
303 Ga0068859_100506664 3300005617 Bacteria 1302
304 Ga0068864_100000339 3300005618 Bacteria 41252
305 Ga0068864_100005196 3300005618 Bacteria 10665
306 Ga0068864_100006681 3300005618 Bacteria 9445
307 Ga0068864_100011656 3300005618 Bacteria 7260
308 Ga0068864_100029571 3300005618 Bacteria 4641
309 Ga0068864_100048060 3300005618 Bacteria 3667
310 Ga0068864_100169986 3300005618 Bacteria 1987
311 Ga0068864_100806575 3300005618 Bacteria 923
312 Ga0068866_10027339 3300005718 Bacteria 2704
313 Ga0068866_10234463 3300005718 Bacteria 1115
314 Ga0068861_100007994 3300005719 Bacteria 7279
315 Ga0068861_100124674 3300005719 Bacteria 2083
316 Ga0068861_100294763 3300005719 Bacteria 1402
317 Ga0068851_10019988 3300005834 Bacteria 3239
318 Ga0068863_100000535 3300005841 Bacteria 38753
319 Ga0068863_100002834 3300005841 Bacteria 17170
320 Ga0068863_100006405 3300005841 Bacteria 11540
321 Ga0068863_100010392 3300005841 Bacteria 9045
322 Ga0068863_100013383 3300005841 Bacteria 7910
323 Ga0068863_100018241 3300005841 Bacteria 6719
324 Ga0068863_100026520 3300005841 Bacteria 5526
325 Ga0068863_100053435 3300005841 Bacteria 3829
326 Ga0068863_100156949 3300005841 Bacteria 2178
327 Ga0068858_100000911 3300005842 Bacteria 30658
328 Ga0068858_100001148 3300005842 Bacteria 27405
329 Ga0068858_100001843 3300005842 Bacteria 21605
330 Ga0068858_100006411 3300005842 Bacteria 11459
331 Ga0068858_100013165 3300005842 Bacteria 7797
332 Ga0068858_100018073 3300005842 Bacteria 6603
333 Ga0068858_100022455 3300005842 Bacteria 5889
334 Ga0068858_100064168 3300005842 Bacteria 3399
335 Ga0068858_100080280 3300005842 Bacteria 3031
336 Ga0068860_100002412 3300005843 Bacteria 19607
337 Ga0068860_100004375 3300005843 Bacteria 14422
338 Ga0068860_100010285 3300005843 Bacteria 9258
339 Ga0068860_100018987 3300005843 Bacteria 6676
340 Ga0068860_100037485 3300005843 Bacteria 4641
341 Ga0068860_100045940 3300005843 Bacteria 4165
342 Ga0068860_100087335 3300005843 Bacteria 2969
343 Ga0068862_100000620 3300005844 Bacteria 36954
344 Ga0068862_100004223 3300005844 Bacteria 12167
345 Ga0068862_100011413 3300005844 Bacteria 7333
346 Ga0068862_100017674 3300005844 Bacteria 5936
347 Ga0068862_100019273 3300005844 Bacteria 5691
348 Ga0068862_100028904 3300005844 Bacteria 4669
349 Ga0068862_100403713 3300005844 Bacteria 1279
350 Ga0081539_10006847 3300005985 Bacteria 10659
351 Ga0081539_10057900 3300005985 Bacteria 2141
352 Ga0070717_10008598 3300006028 Bacteria 7628
353 Ga0075364_10035282 3300006051 Bacteria 3232
354 Ga0070716_100036482 3300006173 Bacteria 2711
355 Ga0070712_100138312 3300006175 Bacteria 1855
356 Ga0097621_100001143 3300006237 Bacteria 18430
357 Ga0097621_100179218 3300006237 Bacteria 1830
358 Ga0097621_100261324 3300006237 Bacteria 1519
359 Ga0075370_10040095 3300006353 Bacteria 2641
360 Ga0068871_100007297 3300006358 Bacteria 7887
361 Ga0068871_100007948 3300006358 Bacteria 7605
362 Ga0068871_100009459 3300006358 Bacteria 7064
363 Ga0068871_100048942 3300006358 Bacteria 3414
364 Ga0068871_100055538 3300006358 Bacteria 3215
365 Ga0068871_100168343 3300006358 Bacteria 1877
366 Ga0068871_100332583 3300006358 Bacteria 1340
367 Ga0075428_100325722 3300006844 Bacteria 1651
368 Ga0075431_100428110 3300006847 Bacteria 1322
369 Ga0075433_10138803 3300006852 Bacteria 2161
370 Ga0075434_100267848 3300006871 Bacteria 1727
371 Ga0068865_100001892 3300006881 Bacteria 12306
372 Ga0068865_100063316 3300006881 Bacteria 2599
373 Ga0068865_100208916 3300006881 Bacteria 1520
374 Ga0068865_100209233 3300006881 Bacteria 1519
375 Ga0097620_100000068 3300006931 Bacteria 96701
376 Ga0097620_100000311 3300006931 Bacteria 48667
377 Ga0097620_100039170 3300006931 Bacteria 4754
378 Ga0097620_100046360 3300006931 Bacteria 4365
379 Ga0097620_100085275 3300006931 Bacteria 3204
380 Ga0097620_100232804 3300006931 Bacteria 1930
381 Ga0097620_100506691 3300006931 Bacteria 1302
382 Ga0105250_10029474 3300009092 Bacteria 2208
383 Ga0105240_10000091 3300009093 Bacteria 182507
384 Ga0105240_10018168 3300009093 Bacteria 9453
385 Ga0105240_10018820 3300009093 Bacteria 9250
386 Ga0111539_10039920 3300009094 Bacteria 5652
387 Ga0105245_10038453 3300009098 Bacteria 4257
388 Ga0105245_10045234 3300009098 Bacteria 3931
389 Ga0105245_10332623 3300009098 Bacteria 1500
390 Ga0105245_10461990 3300009098 Bacteria 1280
391 Ga0105247_10006552 3300009101 Bacteria 7201
392 Ga0105247_10010078 3300009101 Bacteria 5726
393 Ga0105247_10117241 3300009101 Bacteria 1721
394 Ga0105247_10378153 3300009101 Bacteria 1003
395 Ga0105243_10003153 3300009148 Bacteria 13521
396 Ga0105243_10052349 3300009148 Bacteria 3233
397 Ga0105243_10546061 3300009148 Bacteria 1106
398 Ga0105243_10761741 3300009148 Bacteria 950
399 Ga0105241_10125832 3300009174 Bacteria 2069
400 Ga0105241_10314855 3300009174 Bacteria 1347
401 Ga0105242_10040052 3300009176 Bacteria 3774
402 Ga0105242_10206036 3300009176 Bacteria 1749
403 Ga0105248_10000071 3300009177 Bacteria 118281
404 Ga0105248_10000135 3300009177 Bacteria 85668
405 Ga0105248_10002473 3300009177 Bacteria 20524
406 Ga0105248_10010095 3300009177 Bacteria 10400
407 Ga0105248_10018255 3300009177 Bacteria 7746
408 Ga0105248_10032489 3300009177 Bacteria 5833
409 Ga0105248_10050916 3300009177 Bacteria 4647
410 Ga0105248_10062739 3300009177 Bacteria 4172
411 Ga0105248_10068022 3300009177 Bacteria 3999
412 Ga0105248_10111087 3300009177 Bacteria 3091
413 Ga0105237_10010442 3300009545 Bacteria 9876
414 Ga0105237_10041678 3300009545 Bacteria 4629
415 Ga0105238_10132874 3300009551 Bacteria 2467
416 Ga0105238_10268678 3300009551 Bacteria 1686
417 Ga0105238_10331751 3300009551 Bacteria 1508
418 Ga0105238_10356022 3300009551 Bacteria 1453
419 Ga0105238_10473383 3300009551 Bacteria 1251
420 Ga0105238_10805032 3300009551 Bacteria 955
421 Ga0105249_10003308 3300009553 Bacteria 13962
422 Ga0105249_10015105 3300009553 Bacteria 6831
423 Ga0105249_10040558 3300009553 Bacteria 4229
424 Ga0105148_103867 3300009978 Bacteria 1067
425 Ga0105239_10000881 3300010375 Bacteria 42563
426 Ga0105239_10103619 3300010375 Bacteria 3149
427 Ga0105239_10226472 3300010375 Bacteria 2097
428 Ga0105246_10039899 3300011119 Bacteria 3166
429 Ga0105246_10055314 3300011119 Bacteria 2738
430 Ga0105246_10124763 3300011119 Bacteria 1914
431 Ga0157373_10024193 3300013100 Bacteria 4400
432 Ga0157373_10101559 3300013100 Bacteria 2023
433 Ga0157373_10114186 3300013100 Bacteria 1898
434 Ga0157373_10120822 3300013100 Bacteria 1841
435 Ga0157373_10270810 3300013100 Bacteria 1202
436 Ga0157373_10278622 3300013100 Bacteria 1185
437 Ga0157373_10344620 3300013100 Bacteria 1062
438 Ga0157373_10449610 3300013100 Bacteria 927
439 Ga0157371_10012023 3300013102 Bacteria 6637
440 Ga0157371_10024353 3300013102 Bacteria 4421
441 Ga0157371_10029707 3300013102 Bacteria 3949
442 Ga0157371_10077860 3300013102 Bacteria 2348
443 Ga0157371_10085929 3300013102 Bacteria 2228
444 Ga0157371_10104520 3300013102 Bacteria 2010
445 Ga0157371_10138133 3300013102 Bacteria 1736
446 Ga0157371_10237073 3300013102 Bacteria 1312
447 Ga0157371_10462013 3300013102 Bacteria 934
448 Ga0157371_10649785 3300013102 Bacteria 787
449 Ga0157370_10003624 3300013104 Bacteria 18072
450 Ga0157370_10058050 3300013104 Bacteria 3678
451 Ga0157370_10078248 3300013104 Bacteria 3114
452 Ga0157370_10148955 3300013104 Bacteria 2178
453 Ga0157370_10247494 3300013104 Bacteria 1649
454 Ga0157370_10302570 3300013104 Bacteria 1476
455 Ga0157370_10410062 3300013104 Bacteria 1247
456 Ga0157369_10002508 3300013105 Bacteria 21971
457 Ga0157369_10020723 3300013105 Bacteria 7350
458 Ga0157369_10032088 3300013105 Bacteria 5777
459 Ga0157369_10065562 3300013105 Bacteria 3908
460 Ga0157369_10083278 3300013105 Bacteria 3422
461 Ga0157369_10178855 3300013105 Bacteria 2233
462 Ga0157369_10277161 3300013105 Bacteria 1747
463 Ga0157369_10324979 3300013105 Bacteria 1599
464 Ga0157369_10526171 3300013105 Bacteria 1223
465 Ga0157369_10544261 3300013105 Bacteria 1200
466 Ga0157369_11004628 3300013105 Bacteria 854
467 Ga0157374_10008290 3300013296 Bacteria 8866
468 Ga0157374_10036780 3300013296 Bacteria 4487
469 Ga0157374_10114521 3300013296 Bacteria 2596
470 Ga0157374_10182170 3300013296 Bacteria 2052
471 Ga0157374_10217281 3300013296 Bacteria 1875
472 Ga0157378_10025018 3300013297 Bacteria 5258
473 Ga0157378_10057242 3300013297 Bacteria 3474
474 Ga0157378_10741990 3300013297 Bacteria 1004
475 Ga0163162_10004777 3300013306 Bacteria 13080
476 Ga0163162_10013372 3300013306 Bacteria 8015
477 Ga0163162_10015345 3300013306 Bacteria 7484
478 Ga0163162_10037196 3300013306 Bacteria 4855
479 Ga0163162_10067868 3300013306 Bacteria 3617
480 Ga0163162_10074241 3300013306 Bacteria 3459
481 Ga0163162_10103648 3300013306 Bacteria 2939
482 Ga0163162_10138889 3300013306 Bacteria 2542
483 Ga0163162_10193751 3300013306 Bacteria 2160
484 Ga0163162_10384259 3300013306 Bacteria 1537
485 Ga0163162_10792412 3300013306 Bacteria 1065
486 Ga0163162_11232633 3300013306 Bacteria 849
487 Ga0157372_10011794 3300013307 Bacteria 9310
488 Ga0157372_10045540 3300013307 Bacteria 4867
489 Ga0157372_10190381 3300013307 Bacteria 2376
490 Ga0157372_10441694 3300013307 Bacteria 1516
491 Ga0157372_10475342 3300013307 Bacteria 1457
492 Ga0157375_10030724 3300013308 Bacteria 5069
493 Ga0157375_10145304 3300013308 Bacteria 2502
494 Ga0157375_10331488 3300013308 Bacteria 1687
495 Ga0157375_10430942 3300013308 Bacteria 1485
496 Ga0157375_10540708 3300013308 Bacteria 1327
497 Ga0163163_10000995 3300014325 Bacteria 23981
498 Ga0163163_10002903 3300014325 Bacteria 14499
499 Ga0163163_10034083 3300014325 Bacteria 4929
500 Ga0163163_10086013 3300014325 Bacteria 3152
501 Ga0163163_10170758 3300014325 Bacteria 2221
502 Ga0163163_10194840 3300014325 Bacteria 2074
503 Ga0163163_10199126 3300014325 Bacteria 2051
504 Ga0163163_10931248 3300014325 Bacteria 932
505 Ga0157380_10044845 3300014326 Bacteria 3467
506 Ga0157380_10102199 3300014326 Bacteria 2390
507 Ga0157380_10162256 3300014326 Bacteria 1944
508 Ga0157380_10234971 3300014326 Bacteria 1649
509 Ga0157380_10235070 3300014326 Bacteria 1648
510 Ga0157379_10001410 3300014968 Bacteria 19707
511 Ga0157379_10004123 3300014968 Bacteria 12399
512 Ga0157379_10005617 3300014968 Bacteria 10779
513 Ga0157379_10020816 3300014968 Bacteria 5805
514 Ga0157379_10050010 3300014968 Bacteria 3731
515 Ga0157379_10069147 3300014968 Bacteria 3157
516 Ga0157379_10074159 3300014968 Bacteria 3046
517 Ga0157379_10180064 3300014968 Bacteria 1909
518 Ga0157379_10184206 3300014968 Bacteria 1886
519 Ga0157379_10200366 3300014968 Bacteria 1805
520 Ga0157379_10293736 3300014968 Bacteria 1480
521 Ga0157376_10027721 3300014969 Bacteria 4494
522 Ga0163161_10005877 3300017792 Bacteria 8511
523 Ga0163161_10057436 3300017792 Bacteria 2827
524 Ga0163161_10434721 3300017792 Bacteria 1058
525 Ga0197907_11049312 3300020069 Bacteria 1377
526 Ga0213873_10000015 3300021358 Bacteria 131343
527 Ga0213872_10004505 3300021361 Bacteria 7381
528 Ga0213872_10132579 3300021361 Bacteria 1097
529 Ga0213874_10002022 3300021377 Bacteria 4284
530 Ga0213874_10057844 3300021377 Bacteria 1207
531 Ga0213876_10000005 3300021384 Bacteria 727326
532 Ga0213876_10000235 3300021384 Bacteria 53826
533 Ga0213876_10002081 3300021384 Bacteria 11844
534 Ga0213876_10013218 3300021384 Bacteria 4387
535 Ga0213876_10014952 3300021384 Bacteria 4114
536 Ga0213876_10031775 3300021384 Bacteria 2785
537 Ga0213876_10159656 3300021384 Bacteria 1199
538 Ga0213875_10000465 3300021388 Bacteria 34808
539 Ga0213875_10066523 3300021388 Bacteria 1684
540 Ga0213871_10015110 3300021441 Bacteria 1841
541 Ga0209026_1004799 3300025250 Bacteria 3862
542 Ga0209565_1000505 3300025263 Bacteria 28359
543 Ga0209673_1001029 3300025273 Bacteria 33050
544 Ga0207673_1007757 3300025290 Bacteria 1351
545 Ga0209758_1003766 3300025297 Bacteria 13400
546 Ga0209758_1026982 3300025297 Bacteria 2468
547 Ga0209050_1000053 3300025298 Bacteria 349521
548 Ga0209256_1001196 3300025299 Bacteria 29062
549 Ga0209256_1003919 3300025299 Bacteria 9820
550 Ga0209257_1000247 3300025304 Bacteria 125419
551 Ga0209257_1000705 3300025304 Bacteria 51728
552 Ga0207697_10000004 3300025315 Bacteria 90016
553 Ga0207656_10007575 3300025321 Bacteria 3961
554 Ga0207656_10008592 3300025321 Bacteria 3764
555 Ga0207656_10086271 3300025321 Bacteria 1418
556 Ga0207656_10244489 3300025321 Bacteria 878
557 Ga0207696_1011753 3300025711 Bacteria 3134
558 Ga0207682_10051387 3300025893 Bacteria 1707
559 Ga0207682_10103096 3300025893 Bacteria 1249
560 Ga0207642_10011059 3300025899 Bacteria 3206
561 Ga0207642_10015908 3300025899 Bacteria 2818
562 Ga0207710_10017260 3300025900 Bacteria 3061
563 Ga0207710_10163941 3300025900 Bacteria 1084
564 Ga0207710_10245774 3300025900 Bacteria 894
565 Ga0207688_10019179 3300025901 Bacteria 3723
566 Ga0207680_10000110 3300025903 Bacteria 37399
567 Ga0207680_10000479 3300025903 Bacteria 18923
568 Ga0207680_10002339 3300025903 Bacteria 8818
569 Ga0207647_10001330 3300025904 Bacteria 18984
570 Ga0207647_10005953 3300025904 Bacteria 8888
571 Ga0207647_10020301 3300025904 Bacteria 4456
572 Ga0207647_10031336 3300025904 Bacteria 3422
573 Ga0207647_10031605 3300025904 Bacteria 3406
574 Ga0207647_10079903 3300025904 Bacteria 1962
575 Ga0207699_10005926 3300025906 Bacteria 5879
576 Ga0207645_10007286 3300025907 Bacteria 7824
577 Ga0207645_10029495 3300025907 Bacteria 3536
578 Ga0207645_10052457 3300025907 Bacteria 2606
579 Ga0207645_10331820 3300025907 Bacteria 1016
580 Ga0207705_10000002 3300025909 Bacteria 2046852
581 Ga0207705_10009316 3300025909 Bacteria 7140
582 Ga0207705_10013718 3300025909 Bacteria 5847
583 Ga0207705_10042364 3300025909 Bacteria 3268
584 Ga0207705_10113019 3300025909 Bacteria 2008
585 Ga0207705_10134789 3300025909 Bacteria 1840
586 Ga0207705_10139550 3300025909 Bacteria 1809
587 Ga0207705_10279689 3300025909 Bacteria 1277
588 Ga0207654_10384124 3300025911 Bacteria 973
589 Ga0207707_10015128 3300025912 Bacteria 6717
590 Ga0207707_10028578 3300025912 Bacteria 4874
591 Ga0207707_10079116 3300025912 Bacteria 2870
592 Ga0207707_10194441 3300025912 Bacteria 1769
593 Ga0207707_10303778 3300025912 Bacteria 1380
594 Ga0207695_10000018 3300025913 Bacteria 766611
595 Ga0207695_10040048 3300025913 Bacteria 5030
596 Ga0207695_10048897 3300025913 Bacteria 4462
597 Ga0207671_10175130 3300025914 Bacteria 1667
598 Ga0207671_10233779 3300025914 Bacteria 1442
599 Ga0207693_10016941 3300025915 Bacteria 5818
600 Ga0207693_10394972 3300025915 Bacteria 1081
601 Ga0207693_10470174 3300025915 Bacteria 982
602 Ga0207663_10262127 3300025916 Bacteria 1277
603 Ga0207660_10004061 3300025917 Bacteria 9550
604 Ga0207660_10004720 3300025917 Bacteria 8874
605 Ga0207660_10005872 3300025917 Bacteria 7971
606 Ga0207660_10006996 3300025917 Bacteria 7305
607 Ga0207657_10003536 3300025919 Bacteria 16692
608 Ga0207657_10006575 3300025919 Bacteria 12036
609 Ga0207657_10009507 3300025919 Bacteria 9762
610 Ga0207657_10027948 3300025919 Bacteria 5156
611 Ga0207657_10028001 3300025919 Bacteria 5150
612 Ga0207657_10042970 3300025919 Bacteria 3985
613 Ga0207657_10048511 3300025919 Bacteria 3707
614 Ga0207657_10163872 3300025919 Bacteria 1804
615 Ga0207657_10219948 3300025919 Bacteria 1522
616 Ga0207649_10000165 3300025920 Bacteria 54047
617 Ga0207649_10006461 3300025920 Bacteria 6367
618 Ga0207649_10009943 3300025920 Bacteria 5214
619 Ga0207649_10015525 3300025920 Bacteria 4279
620 Ga0207649_10024744 3300025920 Bacteria 3493
621 Ga0207649_10033588 3300025920 Bacteria 3067
622 Ga0207649_10033852 3300025920 Bacteria 3056
623 Ga0207649_10099279 3300025920 Bacteria 1923
624 Ga0207649_10142993 3300025920 Bacteria 1639
625 Ga0207649_10149594 3300025920 Bacteria 1606
626 Ga0207649_10263747 3300025920 Bacteria 1246
627 Ga0207649_10329251 3300025920 Bacteria 1124
628 Ga0207649_10450115 3300025920 Bacteria 972
629 Ga0207652_10000005 3300025921 Bacteria 343384
630 Ga0207652_10000006 3300025921 Bacteria 302991
631 Ga0207652_10000007 3300025921 Bacteria 301303
632 Ga0207652_10000009 3300025921 Bacteria 257234
633 Ga0207652_10014430 3300025921 Bacteria 6399
634 Ga0207652_10105887 3300025921 Bacteria 2489
635 Ga0207652_10191953 3300025921 Bacteria 1837
636 Ga0207652_10485934 3300025921 Bacteria 1112
637 Ga0207681_10000002 3300025923 Bacteria 985597
638 Ga0207681_10068262 3300025923 Bacteria 2468
639 Ga0207681_10124419 3300025923 Bacteria 1896
640 Ga0207681_10132550 3300025923 Bacteria 1844
641 Ga0207681_10161995 3300025923 Bacteria 1687
642 Ga0207681_10683900 3300025923 Bacteria 852
643 Ga0207694_10000018 3300025924 Bacteria 331281
644 Ga0207694_10166265 3300025924 Bacteria 1784
645 Ga0207694_10343885 3300025924 Bacteria 1234
646 Ga0207650_10000969 3300025925 Bacteria 21577
647 Ga0207650_10002248 3300025925 Bacteria 13488
648 Ga0207650_10008363 3300025925 Bacteria 7063
649 Ga0207650_10012641 3300025925 Bacteria 5825
650 Ga0207650_10016491 3300025925 Bacteria 5165
651 Ga0207650_10024587 3300025925 Bacteria 4283
652 Ga0207650_10039127 3300025925 Bacteria 3465
653 Ga0207650_10075984 3300025925 Bacteria 2537
654 Ga0207650_10371202 3300025925 Bacteria 1180
655 Ga0207650_10445551 3300025925 Bacteria 1077
656 Ga0207650_10645587 3300025925 Bacteria 892
657 Ga0207659_10001482 3300025926 Bacteria 13991
658 Ga0207659_10008772 3300025926 Bacteria 6297
659 Ga0207659_10012530 3300025926 Bacteria 5398
660 Ga0207659_10038749 3300025926 Bacteria 3318
661 Ga0207659_10080451 3300025926 Bacteria 2407
662 Ga0207659_10088754 3300025926 Bacteria 2304
663 Ga0207687_10173341 3300025927 Bacteria 1665
664 Ga0207687_10395342 3300025927 Bacteria 1136
665 Ga0207700_10036947 3300025928 Bacteria 3533
666 Ga0207700_10051616 3300025928 Bacteria 3070
667 Ga0207700_10337353 3300025928 Bacteria 1310
668 Ga0207664_10012423 3300025929 Bacteria 6087
669 Ga0207664_10074089 3300025929 Bacteria 2749
670 Ga0207664_10087005 3300025929 Bacteria 2554
671 Ga0207664_10345839 3300025929 Bacteria 1315
672 Ga0207644_10000002 3300025931 Bacteria 942221
673 Ga0207644_10003017 3300025931 Bacteria 10833
674 Ga0207644_10004808 3300025931 Bacteria 8798
675 Ga0207644_10005364 3300025931 Bacteria 8364
676 Ga0207644_10015607 3300025931 Bacteria 5101
677 Ga0207644_10043825 3300025931 Bacteria 3176
678 Ga0207644_10055495 3300025931 Bacteria 2855
679 Ga0207644_10136403 3300025931 Bacteria 1884
680 Ga0207644_10152321 3300025931 Bacteria 1790
681 Ga0207644_10166836 3300025931 Bacteria 1716
682 Ga0207644_10499426 3300025931 Bacteria 1003
683 Ga0207690_10000001 3300025932 Bacteria 807539
684 Ga0207690_10000002 3300025932 Bacteria 807473
685 Ga0207690_10000003 3300025932 Bacteria 783011
686 Ga0207690_10000004 3300025932 Bacteria 746138
687 Ga0207690_10004241 3300025932 Bacteria 8468
688 Ga0207690_10005677 3300025932 Bacteria 7376
689 Ga0207690_10044230 3300025932 Bacteria 2934
690 Ga0207690_10048921 3300025932 Bacteria 2815
691 Ga0207690_10075230 3300025932 Bacteria 2341
692 Ga0207690_10105226 3300025932 Bacteria 2023
693 Ga0207690_10193460 3300025932 Bacteria 1540
694 Ga0207690_10312382 3300025932 Bacteria 1233
695 Ga0207690_10431198 3300025932 Bacteria 1056
696 Ga0207690_10603853 3300025932 Bacteria 896
697 Ga0207706_10001775 3300025933 Bacteria 21183
698 Ga0207706_10013591 3300025933 Bacteria 7396
699 Ga0207706_10014352 3300025933 Bacteria 7180
700 Ga0207706_10016990 3300025933 Bacteria 6565
701 Ga0207706_10026829 3300025933 Bacteria 5156
702 Ga0207706_10029595 3300025933 Bacteria 4888
703 Ga0207706_10034967 3300025933 Bacteria 4469
704 Ga0207706_10035201 3300025933 Bacteria 4454
705 Ga0207706_10041550 3300025933 Bacteria 4076
706 Ga0207706_10053746 3300025933 Bacteria 3555
707 Ga0207706_10079732 3300025933 Bacteria 2879
708 Ga0207706_10081223 3300025933 Bacteria 2849
709 Ga0207706_10120961 3300025933 Bacteria 2302
710 Ga0207706_10147680 3300025933 Bacteria 2068
711 Ga0207706_10307645 3300025933 Bacteria 1380
712 Ga0207706_10342823 3300025933 Bacteria 1300
713 Ga0207686_10159591 3300025934 Bacteria 1579
714 Ga0207709_10051918 3300025935 Bacteria 2515
715 Ga0207709_10099071 3300025935 Bacteria 1923
716 Ga0207669_10023635 3300025937 Bacteria 3288
717 Ga0207669_10063436 3300025937 Bacteria 2281
718 Ga0207669_10131721 3300025937 Bacteria 1719
719 Ga0207704_10012992 3300025938 Bacteria 4151
720 Ga0207665_10063049 3300025939 Bacteria 2516
721 Ga0207691_10003366 3300025940 Bacteria 15559
722 Ga0207691_10007374 3300025940 Bacteria 10598
723 Ga0207691_10105062 3300025940 Bacteria 2516
724 Ga0207691_10113501 3300025940 Bacteria 2408
725 Ga0207691_10159231 3300025940 Bacteria 1982
726 Ga0207691_10159659 3300025940 Bacteria 1978
727 Ga0207691_10166087 3300025940 Bacteria 1934
728 Ga0207691_10378636 3300025940 Bacteria 1208
729 Ga0207711_10000046 3300025941 Bacteria 153238
730 Ga0207711_10002278 3300025941 Bacteria 17229
731 Ga0207711_10004428 3300025941 Bacteria 11971
732 Ga0207711_10014784 3300025941 Bacteria 6486
733 Ga0207711_10015275 3300025941 Bacteria 6374
734 Ga0207711_10020724 3300025941 Bacteria 5486
735 Ga0207711_10037259 3300025941 Bacteria 4129
736 Ga0207711_10129168 3300025941 Bacteria 2264
737 Ga0207711_10188147 3300025941 Bacteria 1880
738 Ga0207711_10286143 3300025941 Bacteria 1519
739 Ga0207711_10757051 3300025941 Bacteria 905
740 Ga0207689_10013570 3300025942 Bacteria 6954
741 Ga0207689_10031414 3300025942 Bacteria 4421
742 Ga0207689_10071625 3300025942 Bacteria 2847
743 Ga0207689_10094252 3300025942 Bacteria 2459
744 Ga0207661_10011896 3300025944 Bacteria 6319
745 Ga0207661_10022719 3300025944 Bacteria 4730
746 Ga0207661_10237463 3300025944 Bacteria 1616
747 Ga0207679_10002042 3300025945 Bacteria 12522
748 Ga0207679_10006229 3300025945 Bacteria 7529
749 Ga0207679_10019755 3300025945 Bacteria 4534
750 Ga0207679_10021213 3300025945 Bacteria 4399
751 Ga0207679_10022413 3300025945 Bacteria 4300
752 Ga0207679_10025568 3300025945 Bacteria 4062
753 Ga0207679_10051243 3300025945 Bacteria 3021
754 Ga0207679_10055334 3300025945 Bacteria 2924
755 Ga0207679_10065289 3300025945 Bacteria 2723
756 Ga0207679_10322471 3300025945 Bacteria 1338
757 Ga0207667_10000052 3300025949 Bacteria 232415
758 Ga0207667_10013558 3300025949 Bacteria 9319
759 Ga0207667_10086505 3300025949 Bacteria 3244
760 Ga0207667_10107922 3300025949 Bacteria 2872
761 Ga0207667_10147195 3300025949 Bacteria 2424
762 Ga0207667_10149213 3300025949 Bacteria 2407
763 Ga0207667_10160325 3300025949 Bacteria 2314
764 Ga0207667_10164785 3300025949 Bacteria 2279
765 Ga0207667_10435794 3300025949 Bacteria 1333
766 Ga0207667_10698147 3300025949 Bacteria 1017
767 Ga0207651_10001348 3300025960 Bacteria 11100
768 Ga0207651_10005720 3300025960 Bacteria 6418
769 Ga0207651_10008811 3300025960 Bacteria 5476
770 Ga0207651_10039726 3300025960 Bacteria 3106
771 Ga0207651_10044049 3300025960 Bacteria 2983
772 Ga0207651_10068581 3300025960 Bacteria 2501
773 Ga0207651_10073887 3300025960 Bacteria 2426
774 Ga0207651_10081814 3300025960 Bacteria 2329
775 Ga0207651_10086843 3300025960 Bacteria 2275
776 Ga0207651_10287748 3300025960 Bacteria 1361
777 Ga0207651_10485529 3300025960 Bacteria 1066
778 Ga0207651_10565449 3300025960 Bacteria 990
779 Ga0207712_10001687 3300025961 Bacteria 14829
780 Ga0207712_10005663 3300025961 Bacteria 7881
781 Ga0207712_10023425 3300025961 Bacteria 4074
782 Ga0207668_10000489 3300025972 Bacteria 24856
783 Ga0207668_10000769 3300025972 Bacteria 19619
784 Ga0207640_10000749 3300025981 Bacteria 18650
785 Ga0207640_10017661 3300025981 Bacteria 4178
786 Ga0207640_10044357 3300025981 Bacteria 2848
787 Ga0207640_10124367 3300025981 Bacteria 1854
788 Ga0207640_10279654 3300025981 Bacteria 1310
789 Ga0207658_10001284 3300025986 Bacteria 19875
790 Ga0207658_10005468 3300025986 Bacteria 8709
791 Ga0207658_10013090 3300025986 Bacteria 5666
792 Ga0207658_10032364 3300025986 Bacteria 3721
793 Ga0207658_10048208 3300025986 Bacteria 3122
794 Ga0207658_10071300 3300025986 Bacteria 2631
795 Ga0207658_10095960 3300025986 Bacteria 2311
796 Ga0207658_10218468 3300025986 Bacteria 1602
797 Ga0207658_10332911 3300025986 Bacteria 1317
798 Ga0207658_10534207 3300025986 Bacteria 1048
799 Ga0207658_10576435 3300025986 Bacteria 1009
800 Ga0207677_10000110 3300026023 Bacteria 66525
801 Ga0207677_10005322 3300026023 Bacteria 6978
802 Ga0207677_10025231 3300026023 Bacteria 3705
803 Ga0207677_10546040 3300026023 Bacteria 1009
804 Ga0207703_10002629 3300026035 Bacteria 15501
805 Ga0207703_10005579 3300026035 Bacteria 10099
806 Ga0207703_10005684 3300026035 Bacteria 10009
807 Ga0207703_10008355 3300026035 Bacteria 8184
808 Ga0207703_10009045 3300026035 Bacteria 7844
809 Ga0207703_10009335 3300026035 Bacteria 7710
810 Ga0207703_10059553 3300026035 Bacteria 3119
811 Ga0207703_10154464 3300026035 Bacteria 2004
812 Ga0207703_10203154 3300026035 Bacteria 1762
813 Ga0207703_10226456 3300026035 Bacteria 1674
814 Ga0207703_10280919 3300026035 Bacteria 1512
815 Ga0207639_10007752 3300026041 Bacteria 7336
816 Ga0207639_10145570 3300026041 Bacteria 1979
817 Ga0207678_10000587 3300026067 Bacteria 33282
818 Ga0207678_10003028 3300026067 Bacteria 15206
819 Ga0207678_10011154 3300026067 Bacteria 7893
820 Ga0207678_10027601 3300026067 Bacteria 4954
821 Ga0207678_10028649 3300026067 Bacteria 4860
822 Ga0207678_10057595 3300026067 Bacteria 3344
823 Ga0207678_10076951 3300026067 Bacteria 2858
824 Ga0207678_10164585 3300026067 Bacteria 1894
825 Ga0207678_10289862 3300026067 Bacteria 1406
826 Ga0207678_10362601 3300026067 Bacteria 1251
827 Ga0207678_10380004 3300026067 Bacteria 1221
828 Ga0207702_10010616 3300026078 Bacteria 7697
829 Ga0207702_10041239 3300026078 Bacteria 3870
830 Ga0207702_10117122 3300026078 Bacteria 2378
831 Ga0207702_10163328 3300026078 Bacteria 2035
832 Ga0207702_10191976 3300026078 Bacteria 1888
833 Ga0207641_10002509 3300026088 Bacteria 16932
834 Ga0207641_10002980 3300026088 Bacteria 15314
835 Ga0207641_10010032 3300026088 Bacteria 7789
836 Ga0207641_10018279 3300026088 Bacteria 5746
837 Ga0207641_10022810 3300026088 Bacteria 5153
838 Ga0207641_10032834 3300026088 Bacteria 4311
839 Ga0207641_10060259 3300026088 Bacteria 3235
840 Ga0207641_10133163 3300026088 Bacteria 2234
841 Ga0207641_10525760 3300026088 Bacteria 1151
842 Ga0207648_10007028 3300026089 Bacteria 11130
843 Ga0207648_10035272 3300026089 Bacteria 4407
844 Ga0207648_10146565 3300026089 Bacteria 2082
845 Ga0207648_10884343 3300026089 Bacteria 834
846 Ga0207676_10000604 3300026095 Bacteria 29483
847 Ga0207676_10003007 3300026095 Bacteria 12023
848 Ga0207676_10003565 3300026095 Bacteria 10997
849 Ga0207676_10004050 3300026095 Bacteria 10334
850 Ga0207676_10005776 3300026095 Bacteria 8750
851 Ga0207676_10027604 3300026095 Bacteria 4230
852 Ga0207676_10152309 3300026095 Bacteria 1993
853 Ga0207676_10160905 3300026095 Bacteria 1945
854 Ga0207676_10163068 3300026095 Bacteria 1933
855 Ga0207676_10698858 3300026095 Bacteria 982
856 Ga0207674_10001949 3300026116 Bacteria 26188
857 Ga0207674_10001996 3300026116 Bacteria 25880
858 Ga0207674_10005064 3300026116 Bacteria 15730
859 Ga0207674_10008156 3300026116 Bacteria 12145
860 Ga0207674_10013773 3300026116 Bacteria 8949
861 Ga0207674_10035520 3300026116 Bacteria 5201
862 Ga0207674_10066919 3300026116 Bacteria 3618
863 Ga0207674_10109779 3300026116 Bacteria 2734
864 Ga0207674_10135829 3300026116 Bacteria 2421
865 Ga0207675_100001590 3300026118 Bacteria 22733
866 Ga0207675_100023360 3300026118 Bacteria 5750
867 Ga0207675_100039452 3300026118 Bacteria 4407
868 Ga0207675_100147463 3300026118 Bacteria 2238
869 Ga0207675_100328814 3300026118 Bacteria 1494
870 Ga0207675_100682740 3300026118 Bacteria 1035
871 Ga0207683_10002686 3300026121 Bacteria 15540
872 Ga0207683_10026087 3300026121 Bacteria 5045
873 Ga0207683_10042498 3300026121 Bacteria 3970
874 Ga0207683_10107823 3300026121 Bacteria 2492
875 Ga0207683_10113412 3300026121 Bacteria 2428
876 Ga0207683_10182797 3300026121 Bacteria 1901
877 Ga0207698_10003413 3300026142 Bacteria 9561
878 Ga0207698_10014872 3300026142 Bacteria 5190
879 Ga0207698_10019539 3300026142 Bacteria 4641
880 Ga0207698_10135129 3300026142 Bacteria 2115
881 Ga0207698_10185975 3300026142 Bacteria 1845
882 Ga0207698_10211595 3300026142 Bacteria 1745
883 Ga0207698_10342845 3300026142 Bacteria 1408
884 Ga0207698_10460900 3300026142 Bacteria 1229
885 Ga0207698_10462306 3300026142 Bacteria 1227
886 Ga0207698_10492282 3300026142 Bacteria 1191
887 Ga0207698_10530245 3300026142 Bacteria 1151
888 Ga0209974_10014636 3300027876 Bacteria 2608
889 Ga0268266_10000133 3300028379 Bacteria 143210
890 Ga0268266_10000468 3300028379 Bacteria 58386
891 Ga0268266_10004851 3300028379 Bacteria 12769
892 Ga0268266_10030905 3300028379 Bacteria 4548
893 Ga0268266_10037494 3300028379 Bacteria 4129
894 Ga0268266_10046227 3300028379 Bacteria 3727
895 Ga0268266_10078341 3300028379 Bacteria 2875
896 Ga0268266_10110747 3300028379 Bacteria 2432
897 Ga0268266_10126853 3300028379 Bacteria 2278
898 Ga0268266_10173648 3300028379 Bacteria 1957
899 Ga0268266_10185619 3300028379 Bacteria 1896
900 Ga0268266_10188136 3300028379 Bacteria 1884
901 Ga0268266_10217023 3300028379 Bacteria 1756
902 Ga0268266_10272484 3300028379 Bacteria 1571
903 Ga0268265_10000260 3300028380 Bacteria 60001
904 Ga0268265_10003169 3300028380 Bacteria 11962
905 Ga0268265_10006467 3300028380 Bacteria 7942
906 Ga0268265_10011653 3300028380 Bacteria 5946
907 Ga0268265_10014013 3300028380 Bacteria 5461
908 Ga0268265_10014765 3300028380 Bacteria 5329
909 Ga0268265_10033543 3300028380 Bacteria 3733
910 Ga0268265_10038143 3300028380 Bacteria 3532
911 Ga0268265_10187409 3300028380 Bacteria 1783
912 Ga0268265_10240208 3300028380 Bacteria 1598
913 Ga0268265_10414757 3300028380 Bacteria 1248
914 Ga0268265_10748343 3300028380 Bacteria 948
915 Ga0268264_10000010 3300028381 Bacteria 596543
916 Ga0268264_10000395 3300028381 Bacteria 62904
917 Ga0268264_10001804 3300028381 Bacteria 19568
918 Ga0268264_10002210 3300028381 Bacteria 17265
919 Ga0268264_10042887 3300028381 Bacteria 3747
920 Ga0268264_10123575 3300028381 Bacteria 2284
921 Ga0268264_10131560 3300028381 Bacteria 2219
922 Ga0265319_1028169 3300028563 Bacteria 1983
923 Ga0307515_10038723 3300028794 Bacteria 7614
924 Ga0307515_10201254 3300028794 Bacteria 1866
925 Ga0265338_10037468 3300028800 Bacteria 4615
926 Ga0307511_10002678 3300030521 Bacteria 18563
927 Ga0316178_1048998 3300030735 Bacteria 2907
928 Ga0316182_1079022 3300030745 Bacteria 2880
929 Ga0265331_10003604 3300031250 Bacteria 9914
930 Ga0265327_10000287 3300031251 Bacteria 99268
931 Ga0265327_10001092 3300031251 Bacteria 37637
932 Ga0265316_10022279 3300031344 Bacteria 5346
933 Ga0307513_10003819 3300031456 Bacteria 20311
934 Ga0307408_100040705 3300031548 Bacteria 3291
935 Ga0307408_100052891 3300031548 Bacteria 2931
936 Ga0307408_100323847 3300031548 Bacteria 1299
937 Ga0307408_100340379 3300031548 Bacteria 1269
938 Ga0307408_100439334 3300031548 Bacteria 1129
939 Ga0307508_10080130 3300031616 Bacteria 2847
940 Ga0316576_10141838 3300031727 Bacteria 1809
941 Ga0307516_10045056 3300031730 Bacteria 4359
942 Ga0307405_10013459 3300031731 Bacteria 4365
943 Ga0307405_10022524 3300031731 Bacteria 3563
944 Ga0307405_10033698 3300031731 Bacteria 3041
945 Ga0307405_10062168 3300031731 Bacteria 2364
946 Ga0307405_10110982 3300031731 Bacteria 1858
947 Ga0307405_10149118 3300031731 Bacteria 1642
948 Ga0307405_10443293 3300031731 Bacteria 1027
949 Ga0307405_10631070 3300031731 Bacteria 878
950 Ga0307413_10012378 3300031824 Bacteria 4244
951 Ga0307413_10021556 3300031824 Bacteria 3453
952 Ga0307413_10030086 3300031824 Bacteria 3046
953 Ga0307413_10037137 3300031824 Bacteria 2811
954 Ga0307413_10044674 3300031824 Bacteria 2620
955 Ga0307413_10088134 3300031824 Bacteria 2012
956 Ga0307413_10103733 3300031824 Bacteria 1886
957 Ga0307413_10149629 3300031824 Bacteria 1625
958 Ga0307413_10590832 3300031824 Bacteria 907
959 Ga0307410_10004118 3300031852 Bacteria 7450
960 Ga0307410_10005331 3300031852 Bacteria 6792
961 Ga0307410_10022347 3300031852 Bacteria 3907
962 Ga0307410_10030516 3300031852 Bacteria 3446
963 Ga0307410_10049287 3300031852 Bacteria 2826
964 Ga0307410_10073172 3300031852 Bacteria 2382
965 Ga0307410_10090208 3300031852 Bacteria 2173
966 Ga0307410_10096942 3300031852 Bacteria 2106
967 Ga0307410_10124619 3300031852 Bacteria 1884
968 Ga0307410_10233568 3300031852 Bacteria 1421
969 Ga0307410_10239004 3300031852 Bacteria 1407
970 Ga0307410_10485966 3300031852 Bacteria 1014
971 Ga0307406_10013030 3300031901 Bacteria 4753
972 Ga0307406_10029387 3300031901 Bacteria 3329
973 Ga0307406_10410042 3300031901 Bacteria 1076
974 Ga0307406_10492366 3300031901 Bacteria 992
975 Ga0307407_10004244 3300031903 Bacteria 6050
976 Ga0307407_10048360 3300031903 Bacteria 2420
977 Ga0307407_10144523 3300031903 Bacteria 1538
978 Ga0307407_10174373 3300031903 Bacteria 1419
979 Ga0307407_10211181 3300031903 Bacteria 1307
980 Ga0307407_10226107 3300031903 Bacteria 1268
981 Ga0307412_10001412 3300031911 Bacteria 13375
982 Ga0307412_10047476 3300031911 Bacteria 2821
983 Ga0307412_10049113 3300031911 Bacteria 2779
984 Ga0307412_10059063 3300031911 Bacteria 2568
985 Ga0307412_10126735 3300031911 Bacteria 1848
986 Ga0307412_10154812 3300031911 Bacteria 1696
987 Ga0307412_10340506 3300031911 Bacteria 1200
988 Ga0307412_10400002 3300031911 Bacteria 1118
989 Ga0307409_100010865 3300031995 Bacteria 5697
990 Ga0307409_100018847 3300031995 Bacteria 4655
991 Ga0307409_100020903 3300031995 Bacteria 4474
992 Ga0307409_100089860 3300031995 Bacteria 2512
993 Ga0307409_100098564 3300031995 Bacteria 2417
994 Ga0307409_100103192 3300031995 Bacteria 2371
995 Ga0307409_100111654 3300031995 Bacteria 2293
996 Ga0307409_100235664 3300031995 Bacteria 1662
997 Ga0307409_100374291 3300031995 Bacteria 1351
998 Ga0307409_100507557 3300031995 Bacteria 1175
999 Ga0307416_100005969 3300032002 Bacteria 7568
1000 Ga0307416_100021093 3300032002 Bacteria 4669
1001 Ga0307416_100039417 3300032002 Bacteria 3657
1002 Ga0307416_100071347 3300032002 Bacteria 2885
1003 Ga0307416_100114611 3300032002 Bacteria 2385
1004 Ga0307416_100149077 3300032002 Bacteria 2142
1005 Ga0307416_100321736 3300032002 Bacteria 1549
1006 Ga0307416_101055760 3300032002 Bacteria 916
1007 Ga0307414_10002011 3300032004 Bacteria 10559
1008 Ga0307414_10005482 3300032004 Bacteria 6991
1009 Ga0307414_10011191 3300032004 Bacteria 5250
1010 Ga0307414_10014217 3300032004 Bacteria 4763
1011 Ga0307414_10018323 3300032004 Bacteria 4307
1012 Ga0307414_10037422 3300032004 Bacteria 3249
1013 Ga0307414_10065339 3300032004 Bacteria 2595
1014 Ga0307414_10130317 3300032004 Bacteria 1951
1015 Ga0307414_10303565 3300032004 Bacteria 1351
1016 Ga0307414_10336066 3300032004 Bacteria 1291
1017 Ga0307414_10532293 3300032004 Bacteria 1044
1018 Ga0307411_10009114 3300032005 Bacteria 5194
1019 Ga0307411_10017646 3300032005 Bacteria 4074
1020 Ga0307411_10032330 3300032005 Bacteria 3231
1021 Ga0307411_10037964 3300032005 Bacteria 3034
1022 Ga0307411_10038968 3300032005 Bacteria 3003
1023 Ga0307411_10100399 3300032005 Bacteria 2045
1024 Ga0307411_10106201 3300032005 Bacteria 1998
1025 Ga0307415_100001168 3300032126 Bacteria 12279
1026 Ga0307415_100015982 3300032126 Bacteria 4459
1027 Ga0307415_100021846 3300032126 Bacteria 3941
1028 Ga0307415_100024978 3300032126 Bacteria 3742
1029 Ga0307415_100027584 3300032126 Bacteria 3600
1030 Ga0307415_100058956 3300032126 Bacteria 2645
1031 Ga0307415_100062766 3300032126 Bacteria 2578
1032 Ga0307415_100072011 3300032126 Bacteria 2432
1033 Ga0307415_100283126 3300032126 Bacteria 1364
1034 Ga0307415_100313059 3300032126 Bacteria 1305
1035 Ga0307415_100321418 3300032126 Bacteria 1290
1036 Ga0307415_100369077 3300032126 Bacteria 1215
1037 Ga0307415_100385423 3300032126 Bacteria 1192
1038 Ga0316583_10016259 3300032133 Bacteria 2678
1039 Ga0307510_10004465 3300033180 Bacteria 16455
1040 Ga0307510_10120251 3300033180 Bacteria 2334
1041 Ga0316592_1041731 3300033524 Bacteria 1016
1042 Ga0316586_1037026 3300033527 Bacteria 849
1043 Ga0316596_1060658 3300033541 Bacteria 1009
1044 Ga0373949_0034715 3300035090 Bacteria 1217
1045 Ga0373923_0021988 3300035111 Bacteria 2496
1046 Ga0373939_0101958 3300035114 Bacteria 986
1047 Ga0373955_0000253 3300035172 Bacteria 22174
1048 Ga0316574_0025244 3300035398 Bacteria 3565
1049 Ga0373931_0148998 3300035691 Bacteria 1362
1050 Ga0373935_0027403 3300035692 Bacteria 3521
1051 Ga0373927_0072570 3300035695 Bacteria 2228
1052 Ga0373927_0136311 3300035695 Bacteria 1604
1053 Ga0373933_0042508 3300035724 Bacteria 2687
1054 Ga0373947_0020121 3300035725 Bacteria 3852
1055 Ga0373937_0001410 3300036401 Bacteria 20068
1056 Ga0316582_0037263 3300036647 Bacteria 3014
1057 Ga0316582_0455677 3300036647 Bacteria 882
1058 Ga0316584_0012541 3300036712 Bacteria 5980
1059 Ga0316584_0017465 3300036712 Bacteria 5159
1060 Ga0316584_0124217 3300036712 Bacteria 1928
1061 Ga0395899_0002102 3300037312 Bacteria 16360
1062 Ga0395899_0013169 3300037312 Bacteria 6325
1063 Ga0395899_0030776 3300037312 Bacteria 4035
1064 Ga0395899_0043881 3300037312 Bacteria 3333
1065 Ga0395899_0065937 3300037312 Bacteria 2660
1066 Ga0395899_0075676 3300037312 Bacteria 2458
1067 Ga0395899_0078721 3300037312 Bacteria 2402
1068 Ga0395899_0122288 3300037312 Bacteria 1863
1069 Ga0395899_0207973 3300037312 Bacteria 1361
1070 Ga0395900_0001365 3300037418 Bacteria 29397
1071 Ga0395900_0007243 3300037418 Bacteria 11487
1072 Ga0395900_0014084 3300037418 Bacteria 8164
1073 Ga0395900_0020186 3300037418 Bacteria 6798
1074 Ga0395900_0021692 3300037418 Bacteria 6566
1075 Ga0395900_0031168 3300037418 Bacteria 5476
1076 Ga0395900_0032675 3300037418 Bacteria 5351
1077 Ga0395900_0033698 3300037418 Bacteria 5270
1078 Ga0395900_0042491 3300037418 Bacteria 4684
1079 Ga0395900_0042726 3300037418 Bacteria 4670
1080 Ga0395900_0047189 3300037418 Bacteria 4435
1081 Ga0395900_0054412 3300037418 Bacteria 4121
1082 Ga0395900_0071338 3300037418 Bacteria 3571
1083 Ga0395900_0087392 3300037418 Bacteria 3204
1084 Ga0395900_0094563 3300037418 Bacteria 3070
1085 Ga0395900_0164235 3300037418 Bacteria 2264
1086 Ga0395900_0178521 3300037418 Bacteria 2159
1087 Ga0395900_0182009 3300037418 Bacteria 2135
1088 Ga0395900_0206212 3300037418 Bacteria 1987
1089 Ga0395900_0302652 3300037418 Bacteria 1585
1090 Ga0395900_0483497 3300037418 Bacteria 1190
1091 Ga0395900_0902591 3300037418 Bacteria 807
1092 Ga0395898_0028102 3300037466 Bacteria 5640
1093 Ga0395898_0057860 3300037466 Bacteria 3776
1094 Ga0395898_0060891 3300037466 Bacteria 3667
1095 Ga0395898_0085638 3300037466 Bacteria 3037
1096 Ga0395898_0177417 3300037466 Bacteria 2036
1097 Ga0395898_0195749 3300037466 Bacteria 1931
1098 Ga0395898_0243248 3300037466 Bacteria 1716
1099 Ga0395898_0316929 3300037466 Bacteria 1488
1100 Ga0395898_0334837 3300037466 Bacteria 1443
1101 Ga0395905_0000193 3300037471 Bacteria 96667
1102 Ga0395905_0001786 3300037471 Bacteria 24960
1103 Ga0395905_0003261 3300037471 Bacteria 17446
1104 Ga0395905_0003299 3300037471 Bacteria 17323
1105 Ga0395905_0004799 3300037471 Bacteria 13960
1106 Ga0395905_0009715 3300037471 Bacteria 9387
1107 Ga0395905_0012830 3300037471 Bacteria 8057
1108 Ga0395905_0027620 3300037471 Bacteria 5351
1109 Ga0395905_0029464 3300037471 Bacteria 5171
1110 Ga0395905_0031843 3300037471 Bacteria 4962
1111 Ga0395905_0034174 3300037471 Bacteria 4773
1112 Ga0395905_0034645 3300037471 Bacteria 4742
1113 Ga0395905_0049371 3300037471 Bacteria 3943
1114 Ga0395905_0056070 3300037471 Bacteria 3688
1115 Ga0395905_0068125 3300037471 Bacteria 3334
1116 Ga0395905_0077510 3300037471 Bacteria 3114
1117 Ga0395905_0081154 3300037471 Bacteria 3039
1118 Ga0395905_0084359 3300037471 Bacteria 2976
1119 Ga0395905_0129719 3300037471 Bacteria 2371
1120 Ga0395905_0138377 3300037471 Bacteria 2291
1121 Ga0395905_0147675 3300037471 Bacteria 2212
1122 Ga0395905_0268181 3300037471 Bacteria 1593
1123 Ga0395905_0298285 3300037471 Bacteria 1499
1124 Ga0395905_0329355 3300037471 Bacteria 1417
1125 Ga0395905_0337314 3300037471 Bacteria 1398
1126 Ga0395905_0340473 3300037471 Bacteria 1391
1127 Ga0395905_0430943 3300037471 Bacteria 1215
1128 Ga0395905_0536765 3300037471 Bacteria 1070
1129 Ga0436364_0017202 3300037853 Bacteria 10673
1130 Ga0436364_0063093 3300037853 Bacteria 1134
1131 Ga0436364_0090132 3300037853 Bacteria 1486
1132 Ga0436364_1395218 3300037853 Bacteria 11283
1133 Ga0395901_0000934 3300038443 Bacteria 31772
1134 Ga0395901_0001501 3300038443 Bacteria 24244
1135 Ga0395901_0006612 3300038443 Bacteria 11715
1136 Ga0395901_0011981 3300038443 Bacteria 8796
1137 Ga0395901_0016705 3300038443 Bacteria 7478
1138 Ga0395901_0021798 3300038443 Bacteria 6566
1139 Ga0395901_0025716 3300038443 Bacteria 6043
1140 Ga0395901_0038482 3300038443 Bacteria 4947
1141 Ga0395901_0042089 3300038443 Bacteria 4735
1142 Ga0395901_0043523 3300038443 Bacteria 4657
1143 Ga0395901_0085298 3300038443 Bacteria 3301
1144 Ga0395901_0091651 3300038443 Bacteria 3181
1145 Ga0395901_0191869 3300038443 Bacteria 2142
1146 Ga0395901_0364420 3300038443 Bacteria 1490
1147 Ga0395901_0380430 3300038443 Bacteria 1453
1148 Ga0395901_0409318 3300038443 Bacteria 1393
1149 Ga0395901_0459791 3300038443 Bacteria 1301
1150 Ga0395901_0999777 3300038443 Bacteria 812
1151 Ga0400489_52975 3300039093 Bacteria 1577
1152 Ga0436365_0103782 3300039437 Bacteria 2936
1153 Ga0436365_0284985 3300039437 Bacteria 1199
1154 Ga0436365_0833878 3300039437 Bacteria 37717
1155 Ga0436365_0984498 3300039437 Bacteria 18563
1156 Ga0436365_1132330 3300039437 Bacteria 76795
1157 Ga0436365_1201209 3300039437 Bacteria 12682
1158 Ga0436365_1508968 3300039437 Bacteria 1685
1159 Ga0436365_1650855 3300039437 Bacteria 128546
1160 Ga0436360_0076173 3300039438 Bacteria 2995
1161 Ga0436360_1171319 3300039438 Bacteria 1218
1162 Ga0436361_0675132 3300039447 Bacteria 5477
1163 Ga0436363_0142313 3300039450 Bacteria 1175
1164 Ga0436363_0551063 3300039450 Bacteria 1818
1165 Ga0436363_0983416 3300039450 Bacteria 14608
1166 Ga0436363_1540769 3300039450 Bacteria 7722
1167 Ga0436362_0284509 3300039453 Bacteria 45469
1168 Ga0436362_1269102 3300039453 Bacteria 2926
1169 Ga0439465_0142098 3300041413 Bacteria 853
1170 Ga0439431_0032534 3300041997 Bacteria 1301
1171 Ga0439445_0012379 3300042004 Bacteria 2049
1172 Ga0439448_0005347 3300042005 Bacteria 3660
1173 Ga0439448_0028107 3300042005 Bacteria 1774
1174 Ga0439432_035378 3300042006 Bacteria 1600
1175 Ga0439432_086450 3300042006 Bacteria 946
1176 Ga0439449_0110082 3300042007 Bacteria 1020
1177 Ga0439455_0001446 3300042012 Bacteria 3974
1178 Ga0439462_0038210 3300042015 Bacteria 1280
1179 Ga0439446_0001493 3300042156 Bacteria 5349
1180 Ga0439446_0103679 3300042156 Bacteria 902
1181 Ga0439458_0000158 3300042157 Bacteria 14998
1182 Ga0439435_0001209 3300042436 Bacteria 4665
1183 Ga0439459_0005999 3300042438 Bacteria 2014
1184 Ga0439464_0032379 3300042439 Bacteria 1469
1185 Ga0450901_006714 3300042533 Bacteria 1185
1186 Ga0466969_0035161 3300044656 Bacteria 2535
1187 Ga0466965_0108554 3300044683 Bacteria 1425
1188 Ga0466963_0000501 3300044694 Bacteria 18241
1189 Ga0466963_0011908 3300044694 Bacteria 5311
1190 Ga0466963_0013247 3300044694 Bacteria 5061
1191 Ga0466963_0018123 3300044694 Bacteria 4396
1192 Ga0466963_0047776 3300044694 Bacteria 2826
1193 Ga0466963_0062418 3300044694 Bacteria 2492
1194 Ga0466963_0150112 3300044694 Bacteria 1618
1195 Ga0466963_0553476 3300044694 Bacteria 812
1196 Ga0466964_0007276 3300044706 Bacteria 4139
1197 Ga0466964_0160003 3300044706 Bacteria 1051
1198 Ga0466964_0262696 3300044706 Bacteria 856
1199 Ga0466957_0000802 3300044842 Bacteria 16030
1200 Ga0466957_0013729 3300044842 Bacteria 4704
1201 Ga0466957_0030914 3300044842 Bacteria 3198
1202 Ga0466957_0381626 3300044842 Bacteria 961
1203 Ga0466960_0154608 3300044901 Bacteria 1228
1204 Ga0466959_0013649 3300045049 Bacteria 5893
1205 Ga0466958_0013632 3300045836 Bacteria 4632
1206 Ga0466958_0020502 3300045836 Bacteria 3856
1207 Ga0466958_0288674 3300045836 Bacteria 1052
1208 Ga0466967_0000024 3300045976 Bacteria 71156
1209 Ga0466967_0002769 3300045976 Bacteria 11099
1210 Ga0466967_0015588 3300045976 Bacteria 5960
1211 Ga0466967_0046896 3300045976 Bacteria 3765
1212 Ga0466967_0077387 3300045976 Bacteria 2994
1213 Ga0466967_0100109 3300045976 Bacteria 2648
1214 Ga0466967_0111750 3300045976 Bacteria 2511
1215 Ga0466967_0187525 3300045976 Bacteria 1953
1216 Ga0466967_0194427 3300045976 Bacteria 1919
1217 Ga0466967_0358664 3300045976 Bacteria 1412
1218 Ga0466967_0604378 3300045976 Bacteria 1083
1219 Ga0495627_000513 3300046453 Bacteria 32122
1220 Ga0495592_0150922 3300046454 Bacteria 1607
1221 Ga0495590_0000309 3300046457 Bacteria 25577
1222 Ga0495638_0000230 3300046460 Bacteria 76565
1223 Ga0495638_0000782 3300046460 Bacteria 33588
1224 Ga0495638_0006940 3300046460 Bacteria 8172
1225 Ga0495638_0010430 3300046460 Bacteria 6453
1226 Ga0495638_0010791 3300046460 Bacteria 6319
1227 Ga0495651_0232429 3300046462 Bacteria 1269
1228 Ga0495650_0000207 3300046471 Bacteria 127568
1229 Ga0495585_0116160 3300046492 Bacteria 1419
1230 Ga0495583_0000399 3300046506 Bacteria 66020
1231 Ga0495606_0000235 3300046507 Bacteria 98069
1232 Ga0495606_0019418 3300046507 Bacteria 5058
1233 Ga0495606_0158771 3300046507 Bacteria 1321
1234 Ga0495608_0180336 3300046511 Bacteria 1336
1235 Ga0495610_0003520 3300046512 Bacteria 12142
1236 Ga0495616_0001022 3300046513 Bacteria 20016
1237 Ga0495631_0003193 3300046518 Bacteria 9024
1238 Ga0495637_0017854 3300046520 Bacteria 3298
1239 Ga0495637_0027794 3300046520 Bacteria 2527
1240 Ga0495648_0001057 3300046524 Bacteria 27927
1241 Ga0495648_0116952 3300046524 Bacteria 1440
1242 Ga0495663_0028746 3300046525 Bacteria 1638
1243 Ga0495654_0000016 3300046530 Bacteria 306416
1244 Ga0495587_0051650 3300046536 Bacteria 2429
1245 Ga0495587_0124576 3300046536 Bacteria 1475
1246 Ga0495598_0000857 3300046537 Bacteria 5849
1247 Ga0495609_0023724 3300046538 Bacteria 2817
1248 Ga0495621_0000049 3300046539 Bacteria 23603
1249 Ga0495621_0088369 3300046539 Bacteria 1165
1250 Ga0495633_0065016 3300046558 Bacteria 1705
1251 Ga0495668_0017135 3300046616 Bacteria 4207
1252 Ga0495625_0005971 3300046660 Bacteria 10945
1253 Ga0495635_0192347 3300046663 Bacteria 1385
1254 Ga0495669_0000006 3300046684 Bacteria 190838
1255 Ga0495669_0000398 3300046684 Bacteria 21390
1256 Ga0495669_0005037 3300046684 Bacteria 5494
1257 Ga0495669_0007319 3300046684 Bacteria 4624
1258 Ga0495669_0013960 3300046684 Bacteria 3429
1259 Ga0495669_0188377 3300046684 Bacteria 984
1260 Ga0495613_0000590 3300046689 Bacteria 29335
1261 Ga0495670_0000265 3300046691 Bacteria 24414
1262 Ga0495660_0268352 3300046810 Bacteria 785
1263 Ga0495636_0153802 3300047318 Bacteria 1033
1264 Ga0495672_0002013 3300047320 Bacteria 19166
1265 Ga0495672_0052103 3300047320 Bacteria 2406
1266 Ga0495680_0380985 3300047322 Bacteria 977
1267 Ga0495677_0059853 3300047445 Bacteria 1411
1268 Ga0495677_0112864 3300047445 Bacteria 1034
1269 Ga0495685_091204 3300047447 Bacteria 1010
1270 Ga0495685_092571 3300047447 Bacteria 1001
1271 Ga0495673_0000223 3300047469 Bacteria 84150
1272 Ga0495673_0000289 3300047469 Bacteria 67437
1273 Ga0495681_0041632 3300047470 Bacteria 2229
1274 Ga0495686_0000173 3300047472 Bacteria 122787
1275 Ga0495686_0000302 3300047472 Bacteria 84826
1276 Ga0495686_0001197 3300047472 Bacteria 29986
1277 Ga0495686_0005206 3300047472 Bacteria 10346
1278 Ga0495686_0009790 3300047472 Bacteria 6878
1279 Ga0496100_0045726 3300048903 Bacteria 2811
1280 Ga0496100_0110933 3300048903 Bacteria 1905
1281 Ga0496100_0509314 3300048903 Bacteria 928
1282 Ga0496101_0081333 3300048904 Bacteria 2395
1283 Ga0496101_0135091 3300048904 Bacteria 1876
1284 Ga0496101_0159463 3300048904 Bacteria 1730
1285 Ga0496101_0314019 3300048904 Bacteria 1229
1286 Ga0496102_0000043 3300048905 Bacteria 189201
1287 Ga0496102_0043292 3300048905 Bacteria 4082
1288 Ga0496102_0060888 3300048905 Bacteria 3454
1289 Ga0496102_0094769 3300048905 Bacteria 2766
1290 Ga0496102_0142838 3300048905 Bacteria 2245
1291 Ga0496102_0186159 3300048905 Bacteria 1957
1292 Ga0496102_0561976 3300048905 Bacteria 1064
1293 Ga0496103_0000133 3300048906 Bacteria 78740
1294 Ga0496103_0010883 3300048906 Bacteria 5383
1295 Ga0496104_0341073 3300048907 Bacteria 1411
1296 Ga0496104_0689853 3300048907 Bacteria 929
1297 Ga0496105_0188569 3300048908 Bacteria 1687
1298 Ga0496106_0003227 3300048909 Bacteria 12209
1299 Ga0496106_0038710 3300048909 Bacteria 3570
1300 Ga0496106_0139118 3300048909 Bacteria 1909
1301 Ga0496107_0000029 3300048910 Bacteria 102345
1302 Ga0496107_0006522 3300048910 Bacteria 8028
1303 Ga0496107_0007192 3300048910 Bacteria 7667
1304 Ga0496107_0035157 3300048910 Bacteria 3592
1305 Ga0496107_0074657 3300048910 Bacteria 2467
1306 Ga0496107_0089908 3300048910 Bacteria 2243
1307 Ga0496108_0006530 3300048911 Bacteria 9457
1308 Ga0496108_0008130 3300048911 Bacteria 8506
1309 Ga0496108_0008556 3300048911 Bacteria 8300
1310 Ga0496108_0134690 3300048911 Bacteria 2124
1311 Ga0496108_0160410 3300048911 Bacteria 1943
1312 Ga0496109_0004600 3300048912 Bacteria 11514
1313 Ga0496109_0021876 3300048912 Bacteria 5660
1314 Ga0496109_0064963 3300048912 Bacteria 3340
1315 Ga0496109_0082404 3300048912 Bacteria 2964
1316 Ga0496109_0103556 3300048912 Bacteria 2642
1317 Ga0496109_0123626 3300048912 Bacteria 2412
1318 Ga0496109_0444530 3300048912 Bacteria 1225
1319 Ga0496110_0006236 3300048913 Bacteria 9401
1320 Ga0496110_0020235 3300048913 Bacteria 5616
1321 Ga0496110_0096382 3300048913 Bacteria 2651
1322 Ga0496110_0433396 3300048913 Bacteria 1198
1323 Ga0496110_0611554 3300048913 Bacteria 988
1324 Ga0496111_0023348 3300048914 Bacteria 4340
1325 Ga0496111_0027139 3300048914 Bacteria 4048
1326 Ga0496111_0451894 3300048914 Bacteria 948
1327 Ga0496112_0000530 3300048915 Bacteria 26090
1328 Ga0496112_0014138 3300048915 Bacteria 7393
1329 Ga0496112_0227574 3300048915 Bacteria 1820
1330 Ga0496112_0239270 3300048915 Bacteria 1768
1331 Ga0496112_0477867 3300048915 Bacteria 1183
1332 Ga0496113_0032649 3300048916 Bacteria 3783
1333 Ga0496113_0040762 3300048916 Bacteria 3423
1334 Ga0496113_0125824 3300048916 Bacteria 2007
1335 Ga0496113_0433730 3300048916 Bacteria 1056
1336 Ga0496114_0006408 3300048917 Bacteria 9269
1337 Ga0496114_0051260 3300048917 Bacteria 3436
1338 Ga0496114_0319928 3300048917 Bacteria 1371
1339 Ga0496115_0053223 3300048918 Bacteria 3248
1340 Ga0496115_0232389 3300048918 Bacteria 1520
1341 Ga0496115_0249675 3300048918 Bacteria 1461
1342 Ga0496116_0000682 3300048919 Bacteria 44118
1343 Ga0496117_0000104 3300048920 Bacteria 189201
1344 Ga0496117_0025476 3300048920 Bacteria 4650
1345 Ga0496117_0041931 3300048920 Bacteria 3346
1346 Ga0496118_0000080 3300048921 Bacteria 189201
1347 Ga0496118_0000525 3300048921 Bacteria 62968
1348 Ga0496118_0043175 3300048921 Bacteria 3548
1349 Ga0496120_0187970 3300048923 Bacteria 1009
1350 Ga0496121_0000066 3300048924 Bacteria 267065
1351 Ga0496121_0006516 3300048924 Bacteria 14437
1352 Ga0496121_0011567 3300048924 Bacteria 9774
1353 Ga0496121_0401820 3300048924 Bacteria 897
1354 Ga0496123_0068947 3300048926 Bacteria 2224
1355 Ga0496124_0000093 3300048927 Bacteria 189201
1356 Ga0496124_0087875 3300048927 Bacteria 2542
1357 Ga0495678_000773 3300049459 Bacteria 28865
1358 Ga0495682_0000658 3300049460 Bacteria 22982
1359 Ga0501031_0036865 3300049568 Bacteria 3190
1360 Ga0501032_0008554 3300049569 Bacteria 7465
1361 Ga0501032_0009632 3300049569 Bacteria 6999
1362 Ga0501032_0170923 3300049569 Bacteria 1425
1363 Ga0501032_0360545 3300049569 Bacteria 936
1364 Ga0501033_0004236 3300049570 Bacteria 11540
1365 Ga0501033_0005853 3300049570 Bacteria 9663
1366 Ga0501033_0253042 3300049570 Bacteria 1248
1367 Ga0501034_0002130 3300049571 Bacteria 24593
1368 Ga0501034_0005232 3300049571 Bacteria 14237
1369 Ga0501034_0032948 3300049571 Bacteria 5261
1370 Ga0501034_0169748 3300049571 Bacteria 2149
1371 Ga0501036_0011308 3300049572 Bacteria 7384
1372 Ga0501036_0029813 3300049572 Bacteria 4610
1373 Ga0501037_0014252 3300049573 Bacteria 5857
1374 Ga0501037_0016778 3300049573 Bacteria 5387
1375 Ga0501037_0145967 3300049573 Bacteria 1692
1376 Ga0501038_0028740 3300049574 Bacteria 4937
1377 Ga0501038_0032796 3300049574 Bacteria 4578
1378 Ga0501039_0003743 3300049575 Bacteria 11433
1379 Ga0501043_0013446 3300049579 Bacteria 6401
1380 Ga0501043_0024575 3300049579 Bacteria 4728
1381 Ga0501043_0116693 3300049579 Bacteria 2094
1382 Ga0501046_0002274 3300049580 Bacteria 18108
1383 Ga0501046_0008229 3300049580 Bacteria 9107
1384 Ga0501047_0112775 3300049581 Bacteria 2601
1385 Ga0501047_0126532 3300049581 Bacteria 2436
1386 Ga0501047_0282973 3300049581 Bacteria 1502
1387 Ga0501047_0408262 3300049581 Bacteria 1191
1388 Ga0501048_0013582 3300049582 Bacteria 6043
1389 Ga0501067_0000644 3300049583 Bacteria 18750
1390 Ga0501067_0014831 3300049583 Bacteria 4312
1391 Ga0501067_0042411 3300049583 Bacteria 2526
1392 Ga0501068_0227725 3300049584 Bacteria 1185
1393 Ga0501069_0032248 3300049585 Bacteria 2883
1394 Ga0501070_0005951 3300049586 Bacteria 10395
1395 Ga0501070_0018814 3300049586 Bacteria 5794
1396 Ga0501070_0020265 3300049586 Bacteria 5578
1397 Ga0501070_0227898 3300049586 Bacteria 1527
1398 Ga0501072_0069426 3300049588 Bacteria 2783
1399 Ga0501073_0008900 3300049589 Bacteria 7420
1400 Ga0501073_0030538 3300049589 Bacteria 3847
1401 Ga0501074_0000896 3300049590 Bacteria 19028
1402 Ga0501074_0032006 3300049590 Bacteria 3812
1403 Ga0501074_0079037 3300049590 Bacteria 2360
1404 Ga0501074_0242197 3300049590 Bacteria 1283
1405 Ga0501209_015118 3300049656 Bacteria 1713
1406 Ga0501217_053211 3300049661 Bacteria 1064
1407 Ga0501223_001035 3300049663 Bacteria 6564
1408 Ga0501224_000028 3300049664 Bacteria 53596
1409 Ga0501235_010652 3300049669 Bacteria 2009
1410 Ga0501238_003510 3300049671 Bacteria 1930
1411 Ga0501238_043476 3300049671 Bacteria 664
1412 Ga0501253_018228 3300049683 Bacteria 1195
1413 Ga0501225_0001850 3300049705 Bacteria 6639
1414 Ga0501234_002566 3300049707 Bacteria 2859
1415 Ga0501080_0105632 3300049742 Bacteria 2611
1416 Ga0501080_0129778 3300049742 Bacteria 2333
1417 Ga0501083_0008289 3300049744 Bacteria 7350
1418 Ga0501083_0022513 3300049744 Bacteria 4372
1419 Ga0501270_017546 3300049767 Bacteria 1049
1420 Ga0501273_001732 3300049770 Bacteria 2128
1421 Ga0501035_0005815 3300049822 Bacteria 11625
1422 Ga0501035_0108293 3300049822 Bacteria 2436
1423 Ga0501035_0240154 3300049822 Bacteria 1541
1424 Ga0501035_0582535 3300049822 Bacteria 914
1425 Ga0501044_0006073 3300049823 Bacteria 13326
1426 Ga0501044_0014438 3300049823 Bacteria 8527
1427 Ga0501044_0022693 3300049823 Bacteria 6683
1428 Ga0501044_0044949 3300049823 Bacteria 4579
1429 Ga0501044_0052094 3300049823 Bacteria 4219
1430 Ga0501044_0064110 3300049823 Bacteria 3752
1431 Ga0501044_0115403 3300049823 Bacteria 2691
1432 Ga0501044_0115827 3300049823 Bacteria 2686
1433 Ga0501226_000146 3300049853 Bacteria 13414
1434 nmdc:mga03683_28884_c1 3300050489 Bacteria 1623
1435 nmdc:mga00v17_140697_c1 3300050491 Bacteria 1547
1436 nmdc:mga00v17_485519_c1 3300050491 Bacteria 801
1437 nmdc:mga0k408_211209_c1 3300050493 Bacteria 1159
1438 nmdc:mga05p37_775333_c1 3300050507 Bacteria 1053
1439 nmdc:mga06r32_454547_c1 3300050510 Bacteria 1260
1440 Ga0495601_0058425 3300053077 Bacteria 2444
1441 Ga0495655_0020270 3300053083 Bacteria 1489
1442 Ga0495595_0073272 3300053084 Bacteria 1621
1443 Ga0495619_0009805 3300053085 Bacteria 6038
1444 Ga0500578_0001117 3300053086 Bacteria 28820
1445 Ga0500643_000167 3300053087 Bacteria 64874
1446 Ga0500643_000491 3300053087 Bacteria 28711
1447 Ga0500643_001394 3300053087 Bacteria 13966
1448 Ga0500644_0000074 3300053088 Bacteria 60285
1449 Ga0500646_0007172 3300053090 Bacteria 2844
1450 Ga0500554_005310 3300053102 Bacteria 2796
1451 Ga0500555_040626 3300053103 Bacteria 1296
1452 Ga0500556_0000954 3300053104 Bacteria 15555
1453 Ga0500594_0000093 3300053118 Bacteria 27296
1454 Ga0500608_076530 3300053122 Bacteria 1585
1455 Ga0500618_000152 3300053125 Bacteria 57055
1456 Ga0500655_001656 3300053133 Bacteria 4189
1457 Ga0500658_0000106 3300053134 Bacteria 38868
1458 Ga0500559_0000016 3300053136 Bacteria 151244
1459 Ga0500559_0000054 3300053136 Bacteria 90695
1460 Ga0500559_0041779 3300053136 Bacteria 1999
1461 Ga0500564_000094 3300053138 Bacteria 22644
1462 Ga0500568_0000708 3300053139 Bacteria 23914
1463 Ga0500577_0001695 3300053142 Bacteria 5632
1464 Ga0500604_0000004 3300053151 Bacteria 146374
1465 Ga0500616_0000195 3300053153 Bacteria 99188
1466 Ga0500622_0001162 3300053156 Bacteria 21873
1467 Ga0500622_0027985 3300053156 Bacteria 2969
1468 Ga0500627_0001136 3300053158 Bacteria 7290
1469 Ga0500633_0032807 3300053160 Bacteria 1690
1470 Ga0500611_007405 3300053727 Bacteria 1647
1471 Ga0500609_000159 3300053731 Bacteria 9335
1472 Ga0501084_0008910 3300054114 Bacteria 8300
1473 Ga0501084_0160520 3300054114 Bacteria 1896
1474 Ga0500661_001304 3300055283 Bacteria 4655
1475 Ga0500661_006208 3300055283 Bacteria 2227
1476 Ga0501082_0007396 3300060353 Bacteria 9478
1477 Ga0501082_0008750 3300060353 Bacteria 8726
1478 Ga0501082_0033247 3300060353 Bacteria 4449
1479 2511121904 2510917020 Bacteria 5657507
1480 2585148266 2582581279 Bacteria 4980720
1481 2585150955 2582581280 Bacteria 5994497
1482 2585196383 2582581293 Bacteria 5907401
1483 2643750351 2643221545 Bacteria 5083237
1484 2643780461 2643221552 Bacteria 5708754
1485 2643926969 2643221583 Bacteria 5218014
1486 2643932136 2643221584 Bacteria 5511711
1487 2644507240 2643221691 Bacteria 5093099
1488 2819538107 2818991435 Bacteria 5433759
1489 2819647323 2818991454 Bacteria 5563326
1490 2830077709 2830075706 Bacteria 3855215
1491 2837651421 2837651117 Bacteria 3772164
1492 2848298467 2848297114 Bacteria 3608511
1493 2891048537 2891048133 Bacteria 4447501
1494 2895884264 2895880812 Bacteria 11255272
1495 2896430475 2896429255 Bacteria 2557483
1496 2946788531 2946787523 Bacteria 4366789
1497 2995394393 2995392953 Bacteria 4539380
1498 Ga0307409_100377564
1499 JGI24741J21665_1009291
1500 JGI24752J21851_1006614
1501 JGI24752J21851_1018781
1502 JGI24740J21852_10001751
1503 JGI24740J21852_10011465
1504 JGI24740J21852_10031692
1505 JGI24739J22299_10001437
1506 JGI24739J22299_10021447
1507 JGI24737J22298_10004924
1508 JGI24737J22298_10005430
1509 JGI24737J22298_10027764
1510 JGI24737J22298_10028978
1511 JGI24737J22298_10073910
1512 JGI24743J22301_10003950
1513 JGI24743J22301_10030619
1514 JGI24735J21928_10003716
1515 JGI24735J21928_10004038
1516 JGI24735J21928_10012841
1517 JGI24735J21928_10022727
1518 JGI24750J21931_1010515
1519 JGI24738J21930_10004628
1520 JGI25153J46596_10045638
1521 Ga0055526_1030076
1522 Ga0055524_1016758
1523 Ga0055524_1040806
1524 Ga0055528_1013757
1525 Ga0055530_10000987
1526 Ga0055530_10067721
1527 Ga0055531_10002442
1528 Ga0055531_10020386
1529 Ga0065165_1000583
1530 Ga0065165_1001140
1531 Ga0065712_10132582
1532 Ga0065712_10228343
1533 Ga0065715_10139509
1534 Ga0065715_10164498
1535 Ga0065715_10209071
1536 Ga0065715_10261607
1537 Ga0065715_10370799
1538 Ga0065707_10107500
1539 Ga0070658_10000001
1540 Ga0070658_10013428
1541 Ga0070658_10031030
1542 Ga0070658_10043979
1543 Ga0070658_10049315
1544 Ga0070658_10159215
1545 Ga0070658_10200792
1546 Ga0070658_10461660
1547 Ga0070658_10613073
1548 Ga0070658_10618156
1549 Ga0070676_10003480
1550 Ga0070676_10029061
1551 Ga0070676_10191766
1552 Ga0070683_100017503
1553 Ga0070683_100070865
1554 Ga0070683_100076509
1555 Ga0070683_100090361
1556 Ga0070690_100072921
1557 Ga0070690_100134831
1558 Ga0070670_100001683
1559 Ga0070670_100008579
1560 Ga0070670_100051615
1561 Ga0070670_100067846
1562 Ga0070670_100099944
1563 Ga0070670_100123249
1564 Ga0070670_100491413
1565 Ga0070677_10143027
1566 Ga0068869_100007757
1567 Ga0068869_100079799
1568 Ga0070666_10000560
1569 Ga0070666_10000589
1570 Ga0070666_10006877
1571 Ga0070666_10023181
1572 Ga0070666_10028457
1573 Ga0070666_10150239
1574 Ga0070666_10151542
1575 Ga0070680_100000762
1576 Ga0070680_100000835
1577 Ga0070680_100017079
1578 Ga0070680_100182656
1579 Ga0070682_100044268
1580 Ga0070682_100057303
1581 Ga0068868_100001536
1582 Ga0068868_100151370
1583 Ga0068868_100217849
1584 Ga0068868_100380232
1585 Ga0070660_100005075
1586 Ga0070660_100011166
1587 Ga0070660_100033069
1588 Ga0070660_100195215
1589 Ga0070660_100312583
1590 Ga0070660_100324853
1591 Ga0070660_100369895
1592 Ga0070687_100159773
1593 Ga0070661_100000010
1594 Ga0070661_100022365
1595 Ga0070661_100024164
1596 Ga0070661_100037007
1597 Ga0070661_100038025
1598 Ga0070661_100048673
1599 Ga0070661_100086955
1600 Ga0070661_100087995
1601 Ga0070661_100163533
1602 Ga0070661_100266386
1603 Ga0070661_100469835
1604 Ga0070668_100003316
1605 Ga0070668_100024475
1606 Ga0070668_100096442
1607 Ga0070669_100000042
1608 Ga0070669_100015724
1609 Ga0070669_100037569
1610 Ga0070669_100156266
1611 Ga0070669_100264789
1612 Ga0070675_100008232
1613 Ga0070675_100055903
1614 Ga0070675_100059392
1615 Ga0070675_100092263
1616 Ga0070675_100212004
1617 Ga0070671_100000010
1618 Ga0070671_100014861
1619 Ga0070671_100016348
1620 Ga0070671_100019917
1621 Ga0070671_100020234
1622 Ga0070671_100022996
1623 Ga0070671_100023745
1624 Ga0070671_100028714
1625 Ga0070671_100286177
1626 Ga0070674_100061300
1627 Ga0070673_100000926
1628 Ga0070673_100004977
1629 Ga0070673_100021743
1630 Ga0070673_100041683
1631 Ga0070673_100061266
1632 Ga0070673_100081617
1633 Ga0070673_100142119
1634 Ga0070673_100302763
1635 Ga0070659_100000001
1636 Ga0070659_100009955
1637 Ga0070659_100016148
1638 Ga0070659_100021317
1639 Ga0070659_100024216
1640 Ga0070659_100030375
1641 Ga0070659_100061352
1642 Ga0070659_100064515
1643 Ga0070659_100080249
1644 Ga0070659_100197383
1645 Ga0070659_100402319
1646 Ga0070659_100464984
1647 Ga0070659_100556024
1648 Ga0070667_100006418
1649 Ga0070667_100008406
1650 Ga0070667_100029024
1651 Ga0070667_100046823
1652 Ga0070667_100084928
1653 Ga0070667_100343370
1654 Ga0070667_100356690
1655 Ga0070667_100851205
1656 Ga0070709_10028601
1657 Ga0070714_100015883
1658 Ga0070714_100019297
1659 Ga0070714_100030646
1660 Ga0070713_100025410
1661 Ga0070713_100031098
1662 Ga0070713_100134331
1663 Ga0070713_100255808
1664 Ga0070713_100272995
1665 Ga0070711_100174498
1666 Ga0070711_100333518
1667 Ga0070705_100062935
1668 Ga0070694_100030397
1669 Ga0070708_100213107
1670 Ga0070663_100008986
1671 Ga0070663_100030578
1672 Ga0070663_100059342
1673 Ga0070663_100067316
1674 Ga0070663_100070177
1675 Ga0070678_100008190
1676 Ga0070678_100008901
1677 Ga0070678_100031729
1678 Ga0070678_100189326
1679 Ga0070662_100004908
1680 Ga0070662_100005390
1681 Ga0070662_100010452
1682 Ga0070662_100013093
1683 Ga0070662_100015663
1684 Ga0070662_100015798
1685 Ga0070662_100062252
1686 Ga0070662_100077047
1687 Ga0070662_100120426
1688 Ga0070662_100126353
1689 Ga0070662_100166114
1690 Ga0070662_100314216
1691 Ga0070681_10045727
1692 Ga0070681_10077048
1693 Ga0070681_10102210
1694 Ga0070681_10134375
1695 Ga0068867_100018201
1696 Ga0068867_100238152
1697 Ga0070685_10204339
1698 Ga0070698_100437446
1699 Ga0070679_100000005
1700 Ga0070679_100048005
1701 Ga0070679_100060540
1702 Ga0070679_100131321
1703 Ga0070679_100384186
1704 Ga0070684_100015958
1705 Ga0070684_100141978
1706 Ga0070697_100318495
1707 Ga0068853_100011737
1708 Ga0068853_100031940
1709 Ga0068853_100060811
1710 Ga0068853_100101709
1711 Ga0068853_100122125
1712 Ga0068853_100130600
1713 Ga0068853_100194643
1714 Ga0070672_100018334
1715 Ga0070672_100080237
1716 Ga0070672_100097854
1717 Ga0070672_100124754
1718 Ga0070672_100241396
1719 Ga0070672_100277966
1720 Ga0070686_100049303
1721 Ga0070686_100101663
1722 Ga0070686_100157522
1723 Ga0070695_100125097
1724 Ga0070696_100029968
1725 Ga0070696_100287654
1726 Ga0070693_100019430
1727 Ga0070693_100025424
1728 Ga0070693_100107954
1729 Ga0070693_100350686
1730 Ga0070665_100000075
1731 Ga0070665_100000705
1732 Ga0070665_100006901
1733 Ga0070665_100017020
1734 Ga0070665_100020609
1735 Ga0070665_100039761
1736 Ga0070665_100041899
1737 Ga0070665_100102810
1738 Ga0070665_100123413
1739 Ga0070665_100158243
1740 Ga0070665_100216796
1741 Ga0070665_100362544
1742 Ga0068855_100000075
1743 Ga0068855_100047862
1744 Ga0068855_100110265
1745 Ga0068855_100111054
1746 Ga0068855_100128065
1747 Ga0068855_100187397
1748 Ga0068855_100235859
1749 Ga0068855_100291514
1750 Ga0068855_100941118
1751 Ga0070664_100001286
1752 Ga0070664_100002393
1753 Ga0070664_100002719
1754 Ga0070664_100008077
1755 Ga0070664_100008895
1756 Ga0070664_100035616
1757 Ga0070664_100038260
1758 Ga0070664_100058638
1759 Ga0070664_100077294
1760 Ga0070664_100094475
1761 Ga0070664_100131923
1762 Ga0070664_100215005
1763 Ga0070664_100237039
1764 Ga0070664_100644543
1765 Ga0068857_100013797
1766 Ga0068857_100017690
1767 Ga0068857_100046949
1768 Ga0068857_100117168
1769 Ga0068857_100155883
1770 Ga0068857_100323095
1771 Ga0068857_100364716
1772 Ga0068854_100000526
1773 Ga0068854_100042423
1774 Ga0068854_100105510
1775 Ga0068854_100133236
1776 Ga0068854_100935739
1777 Ga0068856_100023109
1778 Ga0068856_100056588
1779 Ga0068856_100092865
1780 Ga0068856_100165919
1781 Ga0068856_100187752
1782 Ga0068856_100191531
1783 Ga0068852_100002222
1784 Ga0068852_100014896
1785 Ga0068852_100019408
1786 Ga0068852_100087335
1787 Ga0068852_100110504
1788 Ga0068852_100124025
1789 Ga0068852_100148166
1790 Ga0068852_100249884
1791 Ga0068852_100261542
1792 Ga0068852_100298436
1793 Ga0068852_100307804
1794 Ga0068859_100000068
1795 Ga0068859_100000311
1796 Ga0068859_100039170
1797 Ga0068859_100046359
1798 Ga0068859_100085280
1799 Ga0068859_100232809
1800 Ga0068859_100506664
1801 Ga0068864_100000339
1802 Ga0068864_100005196
1803 Ga0068864_100006681
1804 Ga0068864_100011656
1805 Ga0068864_100029571
1806 Ga0068864_100048060
1807 Ga0068864_100169986
1808 Ga0068864_100806575
1809 Ga0068866_10027339
1810 Ga0068866_10234463
1811 Ga0068861_100007994
1812 Ga0068861_100124674
1813 Ga0068861_100294763
1814 Ga0068851_10019988
1815 Ga0068863_100000535
1816 Ga0068863_100002834
1817 Ga0068863_100006405
1818 Ga0068863_100010392
1819 Ga0068863_100013383
1820 Ga0068863_100018241
1821 Ga0068863_100026520
1822 Ga0068863_100053435
1823 Ga0068863_100156949
1824 Ga0068858_100000911
1825 Ga0068858_100001148
1826 Ga0068858_100001843
1827 Ga0068858_100006411
1828 Ga0068858_100013165
1829 Ga0068858_100018073
1830 Ga0068858_100022455
1831 Ga0068858_100064168
1832 Ga0068858_100080280
1833 Ga0068860_100002412
1834 Ga0068860_100004375
1835 Ga0068860_100010285
1836 Ga0068860_100018987
1837 Ga0068860_100037485
1838 Ga0068860_100045940
1839 Ga0068860_100087335
1840 Ga0068862_100000620
1841 Ga0068862_100004223
1842 Ga0068862_100011413
1843 Ga0068862_100017674
1844 Ga0068862_100019273
1845 Ga0068862_100028904
1846 Ga0068862_100403713
1847 Ga0081539_10006847
1848 Ga0081539_10057900
1849 Ga0070717_10008598
1850 Ga0075364_10035282
1851 Ga0070716_100036482
1852 Ga0070712_100138312
1853 Ga0097621_100001143
1854 Ga0097621_100179218
1855 Ga0097621_100261324
1856 Ga0075370_10040095
1857 Ga0068871_100007297
1858 Ga0068871_100007948
1859 Ga0068871_100009459
1860 Ga0068871_100048942
1861 Ga0068871_100055538
1862 Ga0068871_100168343
1863 Ga0068871_100332583
1864 Ga0075428_100325722
1865 Ga0075431_100428110
1866 Ga0075433_10138803
1867 Ga0075434_100267848
1868 Ga0068865_100001892
1869 Ga0068865_100063316
1870 Ga0068865_100208916
1871 Ga0068865_100209233
1872 Ga0097620_100000068
1873 Ga0097620_100000311
1874 Ga0097620_100039170
1875 Ga0097620_100046360
1876 Ga0097620_100085275
1877 Ga0097620_100232804
1878 Ga0097620_100506691
1879 Ga0105250_10029474
1880 Ga0105240_10000091
1881 Ga0105240_10018168
1882 Ga0105240_10018820
1883 Ga0111539_10039920
1884 Ga0105245_10038453
1885 Ga0105245_10045234
1886 Ga0105245_10332623
1887 Ga0105245_10461990
1888 Ga0105247_10006552
1889 Ga0105247_10010078
1890 Ga0105247_10117241
1891 Ga0105247_10378153
1892 Ga0105243_10003153
1893 Ga0105243_10052349
1894 Ga0105243_10546061
1895 Ga0105243_10761741
1896 Ga0105241_10125832
1897 Ga0105241_10314855
1898 Ga0105242_10040052
1899 Ga0105242_10206036
1900 Ga0105248_10000071
1901 Ga0105248_10000135
1902 Ga0105248_10002473
1903 Ga0105248_10010095
1904 Ga0105248_10018255
1905 Ga0105248_10032489
1906 Ga0105248_10050916
1907 Ga0105248_10062739
1908 Ga0105248_10068022
1909 Ga0105248_10111087
1910 Ga0105237_10010442
1911 Ga0105237_10041678
1912 Ga0105238_10132874
1913 Ga0105238_10268678
1914 Ga0105238_10331751
1915 Ga0105238_10356022
1916 Ga0105238_10473383
1917 Ga0105238_10805032
1918 Ga0105249_10003308
1919 Ga0105249_10015105
1920 Ga0105249_10040558
1921 Ga0105148_103867
1922 Ga0105239_10000881
1923 Ga0105239_10103619
1924 Ga0105239_10226472
1925 Ga0105246_10039899
1926 Ga0105246_10055314
1927 Ga0105246_10124763
1928 Ga0157373_10024193
1929 Ga0157373_10101559
1930 Ga0157373_10114186
1931 Ga0157373_10120822
1932 Ga0157373_10270810
1933 Ga0157373_10278622
1934 Ga0157373_10344620
1935 Ga0157373_10449610
1936 Ga0157371_10012023
1937 Ga0157371_10024353
1938 Ga0157371_10029707
1939 Ga0157371_10077860
1940 Ga0157371_10085929
1941 Ga0157371_10104520
1942 Ga0157371_10138133
1943 Ga0157371_10237073
1944 Ga0157371_10462013
1945 Ga0157371_10649785
1946 Ga0157370_10003624
1947 Ga0157370_10058050
1948 Ga0157370_10078248
1949 Ga0157370_10148955
1950 Ga0157370_10247494
1951 Ga0157370_10302570
1952 Ga0157370_10410062
1953 Ga0157369_10002508
1954 Ga0157369_10020723
1955 Ga0157369_10032088
1956 Ga0157369_10065562
1957 Ga0157369_10083278
1958 Ga0157369_10178855
1959 Ga0157369_10277161
1960 Ga0157369_10324979
1961 Ga0157369_10526171
1962 Ga0157369_10544261
1963 Ga0157369_11004628
1964 Ga0157374_10008290
1965 Ga0157374_10036780
1966 Ga0157374_10114521
1967 Ga0157374_10182170
1968 Ga0157374_10217281
1969 Ga0157378_10025018
1970 Ga0157378_10057242
1971 Ga0157378_10741990
1972 Ga0163162_10004777
1973 Ga0163162_10013372
1974 Ga0163162_10015345
1975 Ga0163162_10037196
1976 Ga0163162_10067868
1977 Ga0163162_10074241
1978 Ga0163162_10103648
1979 Ga0163162_10138889
1980 Ga0163162_10193751
1981 Ga0163162_10384259
1982 Ga0163162_10792412
1983 Ga0163162_11232633
1984 Ga0157372_10011794
1985 Ga0157372_10045540
1986 Ga0157372_10190381
1987 Ga0157372_10441694
1988 Ga0157372_10475342
1989 Ga0157375_10030724
1990 Ga0157375_10145304
1991 Ga0157375_10331488
1992 Ga0157375_10430942
1993 Ga0157375_10540708
1994 Ga0163163_10000995
1995 Ga0163163_10002903
1996 Ga0163163_10034083
1997 Ga0163163_10086013
1998 Ga0163163_10170758
1999 Ga0163163_10194840
2000 Ga0163163_10199126
2001 Ga0163163_10931248
2002 Ga0157380_10044845
2003 Ga0157380_10102199
2004 Ga0157380_10162256
2005 Ga0157380_10234971
2006 Ga0157380_10235070
2007 Ga0157379_10001410
2008 Ga0157379_10004123
2009 Ga0157379_10005617
2010 Ga0157379_10020816
2011 Ga0157379_10050010
2012 Ga0157379_10069147
2013 Ga0157379_10074159
2014 Ga0157379_10180064
2015 Ga0157379_10184206
2016 Ga0157379_10200366
2017 Ga0157379_10293736
2018 Ga0157376_10027721
2019 Ga0163161_10005877
2020 Ga0163161_10057436
2021 Ga0163161_10434721
2022 Ga0197907_11049312
2023 Ga0213873_10000015
2024 Ga0213872_10004505
2025 Ga0213872_10132579
2026 Ga0213874_10002022
2027 Ga0213874_10057844
2028 Ga0213876_10000005
2029 Ga0213876_10000235
2030 Ga0213876_10002081
2031 Ga0213876_10013218
2032 Ga0213876_10014952
2033 Ga0213876_10031775
2034 Ga0213876_10159656
2035 Ga0213875_10000465
2036 Ga0213875_10066523
2037 Ga0213871_10015110
2038 Ga0209026_1004799
2039 Ga0209565_1000505
2040 Ga0209673_1001029
2041 Ga0207673_1007757
2042 Ga0209758_1003766
2043 Ga0209758_1026982
2044 Ga0209050_1000053
2045 Ga0209256_1001196
2046 Ga0209256_1003919
2047 Ga0209257_1000247
2048 Ga0209257_1000705
2049 Ga0207697_10000004
2050 Ga0207656_10007575
2051 Ga0207656_10008592
2052 Ga0207656_10086271
2053 Ga0207656_10244489
2054 Ga0207696_1011753
2055 Ga0207682_10051387
2056 Ga0207682_10103096
2057 Ga0207642_10011059
2058 Ga0207642_10015908
2059 Ga0207710_10017260
2060 Ga0207710_10163941
2061 Ga0207710_10245774
2062 Ga0207688_10019179
2063 Ga0207680_10000110
2064 Ga0207680_10000479
2065 Ga0207680_10002339
2066 Ga0207647_10001330
2067 Ga0207647_10005953
2068 Ga0207647_10020301
2069 Ga0207647_10031336
2070 Ga0207647_10031605
2071 Ga0207647_10079903
2072 Ga0207699_10005926
2073 Ga0207645_10007286
2074 Ga0207645_10029495
2075 Ga0207645_10052457
2076 Ga0207645_10331820
2077 Ga0207705_10000002
2078 Ga0207705_10009316
2079 Ga0207705_10013718
2080 Ga0207705_10042364
2081 Ga0207705_10113019
2082 Ga0207705_10134789
2083 Ga0207705_10139550
2084 Ga0207705_10279689
2085 Ga0207654_10384124
2086 Ga0207707_10015128
2087 Ga0207707_10028578
2088 Ga0207707_10079116
2089 Ga0207707_10194441
2090 Ga0207707_10303778
2091 Ga0207695_10000018
2092 Ga0207695_10040048
2093 Ga0207695_10048897
2094 Ga0207671_10175130
2095 Ga0207671_10233779
2096 Ga0207693_10016941
2097 Ga0207693_10394972
2098 Ga0207693_10470174
2099 Ga0207663_10262127
2100 Ga0207660_10004061
2101 Ga0207660_10004720
2102 Ga0207660_10005872
2103 Ga0207660_10006996
2104 Ga0207657_10003536
2105 Ga0207657_10006575
2106 Ga0207657_10009507
2107 Ga0207657_10027948
2108 Ga0207657_10028001
2109 Ga0207657_10042970
2110 Ga0207657_10048511
2111 Ga0207657_10163872
2112 Ga0207657_10219948
2113 Ga0207649_10000165
2114 Ga0207649_10006461
2115 Ga0207649_10009943
2116 Ga0207649_10015525
2117 Ga0207649_10024744
2118 Ga0207649_10033588
2119 Ga0207649_10033852
2120 Ga0207649_10099279
2121 Ga0207649_10142993
2122 Ga0207649_10149594
2123 Ga0207649_10263747
2124 Ga0207649_10329251
2125 Ga0207649_10450115
2126 Ga0207652_10000005
2127 Ga0207652_10000006
2128 Ga0207652_10000007
2129 Ga0207652_10000009
2130 Ga0207652_10014430
2131 Ga0207652_10105887
2132 Ga0207652_10191953
2133 Ga0207652_10485934
2134 Ga0207681_10000002
2135 Ga0207681_10068262
2136 Ga0207681_10124419
2137 Ga0207681_10132550
2138 Ga0207681_10161995
2139 Ga0207681_10683900
2140 Ga0207694_10000018
2141 Ga0207694_10166265
2142 Ga0207694_10343885
2143 Ga0207650_10000969
2144 Ga0207650_10002248
2145 Ga0207650_10008363
2146 Ga0207650_10012641
2147 Ga0207650_10016491
2148 Ga0207650_10024587
2149 Ga0207650_10039127
2150 Ga0207650_10075984
2151 Ga0207650_10371202
2152 Ga0207650_10445551
2153 Ga0207650_10645587
2154 Ga0207659_10001482
2155 Ga0207659_10008772
2156 Ga0207659_10012530
2157 Ga0207659_10038749
2158 Ga0207659_10080451
2159 Ga0207659_10088754
2160 Ga0207687_10173341
2161 Ga0207687_10395342
2162 Ga0207700_10036947
2163 Ga0207700_10051616
2164 Ga0207700_10337353
2165 Ga0207664_10012423
2166 Ga0207664_10074089
2167 Ga0207664_10087005
2168 Ga0207664_10345839
2169 Ga0207644_10000002
2170 Ga0207644_10003017
2171 Ga0207644_10004808
2172 Ga0207644_10005364
2173 Ga0207644_10015607
2174 Ga0207644_10043825
2175 Ga0207644_10055495
2176 Ga0207644_10136403
2177 Ga0207644_10152321
2178 Ga0207644_10166836
2179 Ga0207644_10499426
2180 Ga0207690_10000001
2181 Ga0207690_10000002
2182 Ga0207690_10000003
2183 Ga0207690_10000004
2184 Ga0207690_10004241
2185 Ga0207690_10005677
2186 Ga0207690_10044230
2187 Ga0207690_10048921
2188 Ga0207690_10075230
2189 Ga0207690_10105226
2190 Ga0207690_10193460
2191 Ga0207690_10312382
2192 Ga0207690_10431198
2193 Ga0207690_10603853
2194 Ga0207706_10001775
2195 Ga0207706_10013591
2196 Ga0207706_10014352
2197 Ga0207706_10016990
2198 Ga0207706_10026829
2199 Ga0207706_10029595
2200 Ga0207706_10034967
2201 Ga0207706_10035201
2202 Ga0207706_10041550
2203 Ga0207706_10053746
2204 Ga0207706_10079732
2205 Ga0207706_10081223
2206 Ga0207706_10120961
2207 Ga0207706_10147680
2208 Ga0207706_10307645
2209 Ga0207706_10342823
2210 Ga0207686_10159591
2211 Ga0207709_10051918
2212 Ga0207709_10099071
2213 Ga0207669_10023635
2214 Ga0207669_10063436
2215 Ga0207669_10131721
2216 Ga0207704_10012992
2217 Ga0207665_10063049
2218 Ga0207691_10003366
2219 Ga0207691_10007374
2220 Ga0207691_10105062
2221 Ga0207691_10113501
2222 Ga0207691_10159231
2223 Ga0207691_10159659
2224 Ga0207691_10166087
2225 Ga0207691_10378636
2226 Ga0207711_10000046
2227 Ga0207711_10002278
2228 Ga0207711_10004428
2229 Ga0207711_10014784
2230 Ga0207711_10015275
2231 Ga0207711_10020724
2232 Ga0207711_10037259
2233 Ga0207711_10129168
2234 Ga0207711_10188147
2235 Ga0207711_10286143
2236 Ga0207711_10757051
2237 Ga0207689_10013570
2238 Ga0207689_10031414
2239 Ga0207689_10071625
2240 Ga0207689_10094252
2241 Ga0207661_10011896
2242 Ga0207661_10022719
2243 Ga0207661_10237463
2244 Ga0207679_10002042
2245 Ga0207679_10006229
2246 Ga0207679_10019755
2247 Ga0207679_10021213
2248 Ga0207679_10022413
2249 Ga0207679_10025568
2250 Ga0207679_10051243
2251 Ga0207679_10055334
2252 Ga0207679_10065289
2253 Ga0207679_10322471
2254 Ga0207667_10000052
2255 Ga0207667_10013558
2256 Ga0207667_10086505
2257 Ga0207667_10107922
2258 Ga0207667_10147195
2259 Ga0207667_10149213
2260 Ga0207667_10160325
2261 Ga0207667_10164785
2262 Ga0207667_10435794
2263 Ga0207667_10698147
2264 Ga0207651_10001348
2265 Ga0207651_10005720
2266 Ga0207651_10008811
2267 Ga0207651_10039726
2268 Ga0207651_10044049
2269 Ga0207651_10068581
2270 Ga0207651_10073887
2271 Ga0207651_10081814
2272 Ga0207651_10086843
2273 Ga0207651_10287748
2274 Ga0207651_10485529
2275 Ga0207651_10565449
2276 Ga0207712_10001687
2277 Ga0207712_10005663
2278 Ga0207712_10023425
2279 Ga0207668_10000489
2280 Ga0207668_10000769
2281 Ga0207640_10000749
2282 Ga0207640_10017661
2283 Ga0207640_10044357
2284 Ga0207640_10124367
2285 Ga0207640_10279654
2286 Ga0207658_10001284
2287 Ga0207658_10005468
2288 Ga0207658_10013090
2289 Ga0207658_10032364
2290 Ga0207658_10048208
2291 Ga0207658_10071300
2292 Ga0207658_10095960
2293 Ga0207658_10218468
2294 Ga0207658_10332911
2295 Ga0207658_10534207
2296 Ga0207658_10576435
2297 Ga0207677_10000110
2298 Ga0207677_10005322
2299 Ga0207677_10025231
2300 Ga0207677_10546040
2301 Ga0207703_10002629
2302 Ga0207703_10005579
2303 Ga0207703_10005684
2304 Ga0207703_10008355
2305 Ga0207703_10009045
2306 Ga0207703_10009335
2307 Ga0207703_10059553
2308 Ga0207703_10154464
2309 Ga0207703_10203154
2310 Ga0207703_10226456
2311 Ga0207703_10280919
2312 Ga0207639_10007752
2313 Ga0207639_10145570
2314 Ga0207678_10000587
2315 Ga0207678_10003028
2316 Ga0207678_10011154
2317 Ga0207678_10027601
2318 Ga0207678_10028649
2319 Ga0207678_10057595
2320 Ga0207678_10076951
2321 Ga0207678_10164585
2322 Ga0207678_10289862
2323 Ga0207678_10362601
2324 Ga0207678_10380004
2325 Ga0207702_10010616
2326 Ga0207702_10041239
2327 Ga0207702_10117122
2328 Ga0207702_10163328
2329 Ga0207702_10191976
2330 Ga0207641_10002509
2331 Ga0207641_10002980
2332 Ga0207641_10010032
2333 Ga0207641_10018279
2334 Ga0207641_10022810
2335 Ga0207641_10032834
2336 Ga0207641_10060259
2337 Ga0207641_10133163
2338 Ga0207641_10525760
2339 Ga0207648_10007028
2340 Ga0207648_10035272
2341 Ga0207648_10146565
2342 Ga0207648_10884343
2343 Ga0207676_10000604
2344 Ga0207676_10003007
2345 Ga0207676_10003565
2346 Ga0207676_10004050
2347 Ga0207676_10005776
2348 Ga0207676_10027604
2349 Ga0207676_10152309
2350 Ga0207676_10160905
2351 Ga0207676_10163068
2352 Ga0207676_10698858
2353 Ga0207674_10001949
2354 Ga0207674_10001996
2355 Ga0207674_10005064
2356 Ga0207674_10008156
2357 Ga0207674_10013773
2358 Ga0207674_10035520
2359 Ga0207674_10066919
2360 Ga0207674_10109779
2361 Ga0207674_10135829
2362 Ga0207675_100001590
2363 Ga0207675_100023360
2364 Ga0207675_100039452
2365 Ga0207675_100147463
2366 Ga0207675_100328814
2367 Ga0207675_100682740
2368 Ga0207683_10002686
2369 Ga0207683_10026087
2370 Ga0207683_10042498
2371 Ga0207683_10107823
2372 Ga0207683_10113412
2373 Ga0207683_10182797
2374 Ga0207698_10003413
2375 Ga0207698_10014872
2376 Ga0207698_10019539
2377 Ga0207698_10135129
2378 Ga0207698_10185975
2379 Ga0207698_10211595
2380 Ga0207698_10342845
2381 Ga0207698_10460900
2382 Ga0207698_10462306
2383 Ga0207698_10492282
2384 Ga0207698_10530245
2385 Ga0209974_10014636
2386 Ga0268266_10000133
2387 Ga0268266_10000468
2388 Ga0268266_10004851
2389 Ga0268266_10030905
2390 Ga0268266_10037494
2391 Ga0268266_10046227
2392 Ga0268266_10078341
2393 Ga0268266_10110747
2394 Ga0268266_10126853
2395 Ga0268266_10173648
2396 Ga0268266_10185619
2397 Ga0268266_10188136
2398 Ga0268266_10217023
2399 Ga0268266_10272484
2400 Ga0268265_10000260
2401 Ga0268265_10003169
2402 Ga0268265_10006467
2403 Ga0268265_10011653
2404 Ga0268265_10014013
2405 Ga0268265_10014765
2406 Ga0268265_10033543
2407 Ga0268265_10038143
2408 Ga0268265_10187409
2409 Ga0268265_10240208
2410 Ga0268265_10414757
2411 Ga0268265_10748343
2412 Ga0268264_10000010
2413 Ga0268264_10000395
2414 Ga0268264_10001804
2415 Ga0268264_10002210
2416 Ga0268264_10042887
2417 Ga0268264_10123575
2418 Ga0268264_10131560
2419 Ga0265319_1028169
2420 Ga0307515_10038723
2421 Ga0307515_10201254
2422 Ga0265338_10037468
2423 Ga0307511_10002678
2424 Ga0316178_1048998
2425 Ga0316182_1079022
2426 Ga0265331_10003604
2427 Ga0265327_10000287
2428 Ga0265327_10001092
2429 Ga0265316_10022279
2430 Ga0307513_10003819
2431 Ga0307408_100040705
2432 Ga0307408_100052891
2433 Ga0307408_100323847
2434 Ga0307408_100340379
2435 Ga0307408_100439334
2436 Ga0307508_10080130
2437 Ga0316576_10141838
2438 Ga0307516_10045056
2439 Ga0307405_10013459
2440 Ga0307405_10022524
2441 Ga0307405_10033698
2442 Ga0307405_10062168
2443 Ga0307405_10110982
2444 Ga0307405_10149118
2445 Ga0307405_10443293
2446 Ga0307405_10631070
2447 Ga0307413_10012378
2448 Ga0307413_10021556
2449 Ga0307413_10030086
2450 Ga0307413_10037137
2451 Ga0307413_10044674
2452 Ga0307413_10088134
2453 Ga0307413_10103733
2454 Ga0307413_10149629
2455 Ga0307413_10590832
2456 Ga0307410_10004118
2457 Ga0307410_10005331
2458 Ga0307410_10022347
2459 Ga0307410_10030516
2460 Ga0307410_10049287
2461 Ga0307410_10073172
2462 Ga0307410_10090208
2463 Ga0307410_10096942
2464 Ga0307410_10124619
2465 Ga0307410_10233568
2466 Ga0307410_10239004
2467 Ga0307410_10485966
2468 Ga0307406_10013030
2469 Ga0307406_10029387
2470 Ga0307406_10410042
2471 Ga0307406_10492366
2472 Ga0307407_10004244
2473 Ga0307407_10048360
2474 Ga0307407_10144523
2475 Ga0307407_10174373
2476 Ga0307407_10211181
2477 Ga0307407_10226107
2478 Ga0307412_10001412
2479 Ga0307412_10047476
2480 Ga0307412_10049113
2481 Ga0307412_10059063
2482 Ga0307412_10126735
2483 Ga0307412_10154812
2484 Ga0307412_10340506
2485 Ga0307412_10400002
2486 Ga0307409_100010865
2487 Ga0307409_100018847
2488 Ga0307409_100020903
2489 Ga0307409_100089860
2490 Ga0307409_100098564
2491 Ga0307409_100103192
2492 Ga0307409_100111654
2493 Ga0307409_100235664
2494 Ga0307409_100374291
2495 Ga0307409_100507557
2496 Ga0307416_100005969
2497 Ga0307416_100021093
2498 Ga0307416_100039417
2499 Ga0307416_100071347
2500 Ga0307416_100114611
2501 Ga0307416_100149077
2502 Ga0307416_100321736
2503 Ga0307416_101055760
2504 Ga0307414_10002011
2505 Ga0307414_10005482
2506 Ga0307414_10011191
2507 Ga0307414_10014217
2508 Ga0307414_10018323
2509 Ga0307414_10037422
2510 Ga0307414_10065339
2511 Ga0307414_10130317
2512 Ga0307414_10303565
2513 Ga0307414_10336066
2514 Ga0307414_10532293
2515 Ga0307411_10009114
2516 Ga0307411_10017646
2517 Ga0307411_10032330
2518 Ga0307411_10037964
2519 Ga0307411_10038968
2520 Ga0307411_10100399
2521 Ga0307411_10106201
2522 Ga0307415_100001168
2523 Ga0307415_100015982
2524 Ga0307415_100021846
2525 Ga0307415_100024978
2526 Ga0307415_100027584
2527 Ga0307415_100058956
2528 Ga0307415_100062766
2529 Ga0307415_100072011
2530 Ga0307415_100283126
2531 Ga0307415_100313059
2532 Ga0307415_100321418
2533 Ga0307415_100369077
2534 Ga0307415_100385423
2535 Ga0316583_10016259
2536 Ga0307510_10004465
2537 Ga0307510_10120251
2538 Ga0316592_1041731
2539 Ga0316586_1037026
2540 Ga0316596_1060658
2541 Ga0373949_0034715
2542 Ga0373923_0021988
2543 Ga0373939_0101958
2544 Ga0373955_0000253
2545 Ga0316574_0025244
2546 Ga0373931_0148998
2547 Ga0373935_0027403
2548 Ga0373927_0072570
2549 Ga0373927_0136311
2550 Ga0373933_0042508
2551 Ga0373947_0020121
2552 Ga0373937_0001410
2553 Ga0316582_0037263
2554 Ga0316582_0455677
2555 Ga0316584_0012541
2556 Ga0316584_0017465
2557 Ga0316584_0124217
2558 Ga0395899_0002102
2559 Ga0395899_0013169
2560 Ga0395899_0030776
2561 Ga0395899_0043881
2562 Ga0395899_0065937
2563 Ga0395899_0075676
2564 Ga0395899_0078721
2565 Ga0395899_0122288
2566 Ga0395899_0207973
2567 Ga0395900_0001365
2568 Ga0395900_0007243
2569 Ga0395900_0014084
2570 Ga0395900_0020186
2571 Ga0395900_0021692
2572 Ga0395900_0031168
2573 Ga0395900_0032675
2574 Ga0395900_0033698
2575 Ga0395900_0042491
2576 Ga0395900_0042726
2577 Ga0395900_0047189
2578 Ga0395900_0054412
2579 Ga0395900_0071338
2580 Ga0395900_0087392
2581 Ga0395900_0094563
2582 Ga0395900_0164235
2583 Ga0395900_0178521
2584 Ga0395900_0182009
2585 Ga0395900_0206212
2586 Ga0395900_0302652
2587 Ga0395900_0483497
2588 Ga0395900_0902591
2589 Ga0395898_0028102
2590 Ga0395898_0057860
2591 Ga0395898_0060891
2592 Ga0395898_0085638
2593 Ga0395898_0177417
2594 Ga0395898_0195749
2595 Ga0395898_0243248
2596 Ga0395898_0316929
2597 Ga0395898_0334837
2598 Ga0395905_0000193
2599 Ga0395905_0001786
2600 Ga0395905_0003261
2601 Ga0395905_0003299
2602 Ga0395905_0004799
2603 Ga0395905_0009715
2604 Ga0395905_0012830
2605 Ga0395905_0027620
2606 Ga0395905_0029464
2607 Ga0395905_0031843
2608 Ga0395905_0034174
2609 Ga0395905_0034645
2610 Ga0395905_0049371
2611 Ga0395905_0056070
2612 Ga0395905_0068125
2613 Ga0395905_0077510
2614 Ga0395905_0081154
2615 Ga0395905_0084359
2616 Ga0395905_0129719
2617 Ga0395905_0138377
2618 Ga0395905_0147675
2619 Ga0395905_0268181
2620 Ga0395905_0298285
2621 Ga0395905_0329355
2622 Ga0395905_0337314
2623 Ga0395905_0340473
2624 Ga0395905_0430943
2625 Ga0395905_0536765
2626 Ga0436364_0017202
2627 Ga0436364_0063093
2628 Ga0436364_0090132
2629 Ga0436364_1395218
2630 Ga0395901_0000934
2631 Ga0395901_0001501
2632 Ga0395901_0006612
2633 Ga0395901_0011981
2634 Ga0395901_0016705
2635 Ga0395901_0021798
2636 Ga0395901_0025716
2637 Ga0395901_0038482
2638 Ga0395901_0042089
2639 Ga0395901_0043523
2640 Ga0395901_0085298
2641 Ga0395901_0091651
2642 Ga0395901_0191869
2643 Ga0395901_0364420
2644 Ga0395901_0380430
2645 Ga0395901_0409318
2646 Ga0395901_0459791
2647 Ga0395901_0999777
2648 Ga0400489_52975
2649 Ga0436365_0103782
2650 Ga0436365_0284985
2651 Ga0436365_0833878
2652 Ga0436365_0984498
2653 Ga0436365_1132330
2654 Ga0436365_1201209
2655 Ga0436365_1508968
2656 Ga0436365_1650855
2657 Ga0436360_0076173
2658 Ga0436360_1171319
2659 Ga0436361_0675132
2660 Ga0436363_0142313
2661 Ga0436363_0551063
2662 Ga0436363_0983416
2663 Ga0436363_1540769
2664 Ga0436362_0284509
2665 Ga0436362_1269102
2666 Ga0439465_0142098
2667 Ga0439431_0032534
2668 Ga0439445_0012379
2669 Ga0439448_0005347
2670 Ga0439448_0028107
2671 Ga0439432_035378
2672 Ga0439432_086450
2673 Ga0439449_0110082
2674 Ga0439455_0001446
2675 Ga0439462_0038210
2676 Ga0439446_0001493
2677 Ga0439446_0103679
2678 Ga0439458_0000158
2679 Ga0439435_0001209
2680 Ga0439459_0005999
2681 Ga0439464_0032379
2682 Ga0450901_006714
2683 Ga0466969_0035161
2684 Ga0466965_0108554
2685 Ga0466963_0000501
2686 Ga0466963_0011908
2687 Ga0466963_0013247
2688 Ga0466963_0018123
2689 Ga0466963_0047776
2690 Ga0466963_0062418
2691 Ga0466963_0150112
2692 Ga0466963_0553476
2693 Ga0466964_0007276
2694 Ga0466964_0160003
2695 Ga0466964_0262696
2696 Ga0466957_0000802
2697 Ga0466957_0013729
2698 Ga0466957_0030914
2699 Ga0466957_0381626
2700 Ga0466960_0154608
2701 Ga0466959_0013649
2702 Ga0466958_0013632
2703 Ga0466958_0020502
2704 Ga0466958_0288674
2705 Ga0466967_0000024
2706 Ga0466967_0002769
2707 Ga0466967_0015588
2708 Ga0466967_0046896
2709 Ga0466967_0077387
2710 Ga0466967_0100109
2711 Ga0466967_0111750
2712 Ga0466967_0187525
2713 Ga0466967_0194427
2714 Ga0466967_0358664
2715 Ga0466967_0604378
2716 Ga0495627_000513
2717 Ga0495592_0150922
2718 Ga0495590_0000309
2719 Ga0495638_0000230
2720 Ga0495638_0000782
2721 Ga0495638_0006940
2722 Ga0495638_0010430
2723 Ga0495638_0010791
2724 Ga0495651_0232429
2725 Ga0495650_0000207
2726 Ga0495585_0116160
2727 Ga0495583_0000399
2728 Ga0495606_0000235
2729 Ga0495606_0019418
2730 Ga0495606_0158771
2731 Ga0495608_0180336
2732 Ga0495610_0003520
2733 Ga0495616_0001022
2734 Ga0495631_0003193
2735 Ga0495637_0017854
2736 Ga0495637_0027794
2737 Ga0495648_0001057
2738 Ga0495648_0116952
2739 Ga0495663_0028746
2740 Ga0495654_0000016
2741 Ga0495587_0051650
2742 Ga0495587_0124576
2743 Ga0495598_0000857
2744 Ga0495609_0023724
2745 Ga0495621_0000049
2746 Ga0495621_0088369
2747 Ga0495633_0065016
2748 Ga0495668_0017135
2749 Ga0495625_0005971
2750 Ga0495635_0192347
2751 Ga0495669_0000006
2752 Ga0495669_0000398
2753 Ga0495669_0005037
2754 Ga0495669_0007319
2755 Ga0495669_0013960
2756 Ga0495669_0188377
2757 Ga0495613_0000590
2758 Ga0495670_0000265
2759 Ga0495660_0268352
2760 Ga0495636_0153802
2761 Ga0495672_0002013
2762 Ga0495672_0052103
2763 Ga0495680_0380985
2764 Ga0495677_0059853
2765 Ga0495677_0112864
2766 Ga0495685_091204
2767 Ga0495685_092571
2768 Ga0495673_0000223
2769 Ga0495673_0000289
2770 Ga0495681_0041632
2771 Ga0495686_0000173
2772 Ga0495686_0000302
2773 Ga0495686_0001197
2774 Ga0495686_0005206
2775 Ga0495686_0009790
2776 Ga0496100_0045726
2777 Ga0496100_0110933
2778 Ga0496100_0509314
2779 Ga0496101_0081333
2780 Ga0496101_0135091
2781 Ga0496101_0159463
2782 Ga0496101_0314019
2783 Ga0496102_0000043
2784 Ga0496102_0043292
2785 Ga0496102_0060888
2786 Ga0496102_0094769
2787 Ga0496102_0142838
2788 Ga0496102_0186159
2789 Ga0496102_0561976
2790 Ga0496103_0000133
2791 Ga0496103_0010883
2792 Ga0496104_0341073
2793 Ga0496104_0689853
2794 Ga0496105_0188569
2795 Ga0496106_0003227
2796 Ga0496106_0038710
2797 Ga0496106_0139118
2798 Ga0496107_0000029
2799 Ga0496107_0006522
2800 Ga0496107_0007192
2801 Ga0496107_0035157
2802 Ga0496107_0074657
2803 Ga0496107_0089908
2804 Ga0496108_0006530
2805 Ga0496108_0008130
2806 Ga0496108_0008556
2807 Ga0496108_0134690
2808 Ga0496108_0160410
2809 Ga0496109_0004600
2810 Ga0496109_0021876
2811 Ga0496109_0064963
2812 Ga0496109_0082404
2813 Ga0496109_0103556
2814 Ga0496109_0123626
2815 Ga0496109_0444530
2816 Ga0496110_0006236
2817 Ga0496110_0020235
2818 Ga0496110_0096382
2819 Ga0496110_0433396
2820 Ga0496110_0611554
2821 Ga0496111_0023348
2822 Ga0496111_0027139
2823 Ga0496111_0451894
2824 Ga0496112_0000530
2825 Ga0496112_0014138
2826 Ga0496112_0227574
2827 Ga0496112_0239270
2828 Ga0496112_0477867
2829 Ga0496113_0032649
2830 Ga0496113_0040762
2831 Ga0496113_0125824
2832 Ga0496113_0433730
2833 Ga0496114_0006408
2834 Ga0496114_0051260
2835 Ga0496114_0319928
2836 Ga0496115_0053223
2837 Ga0496115_0232389
2838 Ga0496115_0249675
2839 Ga0496116_0000682
2840 Ga0496117_0000104
2841 Ga0496117_0025476
2842 Ga0496117_0041931
2843 Ga0496118_0000080
2844 Ga0496118_0000525
2845 Ga0496118_0043175
2846 Ga0496120_0187970
2847 Ga0496121_0000066
2848 Ga0496121_0006516
2849 Ga0496121_0011567
2850 Ga0496121_0401820
2851 Ga0496123_0068947
2852 Ga0496124_0000093
2853 Ga0496124_0087875
2854 Ga0495678_000773
2855 Ga0495682_0000658
2856 Ga0501031_0036865
2857 Ga0501032_0008554
2858 Ga0501032_0009632
2859 Ga0501032_0170923
2860 Ga0501032_0360545
2861 Ga0501033_0004236
2862 Ga0501033_0005853
2863 Ga0501033_0253042
2864 Ga0501034_0002130
2865 Ga0501034_0005232
2866 Ga0501034_0032948
2867 Ga0501034_0169748
2868 Ga0501036_0011308
2869 Ga0501036_0029813
2870 Ga0501037_0014252
2871 Ga0501037_0016778
2872 Ga0501037_0145967
2873 Ga0501038_0028740
2874 Ga0501038_0032796
2875 Ga0501039_0003743
2876 Ga0501043_0013446
2877 Ga0501043_0024575
2878 Ga0501043_0116693
2879 Ga0501046_0002274
2880 Ga0501046_0008229
2881 Ga0501047_0112775
2882 Ga0501047_0126532
2883 Ga0501047_0282973
2884 Ga0501047_0408262
2885 Ga0501048_0013582
2886 Ga0501067_0000644
2887 Ga0501067_0014831
2888 Ga0501067_0042411
2889 Ga0501068_0227725
2890 Ga0501069_0032248
2891 Ga0501070_0005951
2892 Ga0501070_0018814
2893 Ga0501070_0020265
2894 Ga0501070_0227898
2895 Ga0501072_0069426
2896 Ga0501073_0008900
2897 Ga0501073_0030538
2898 Ga0501074_0000896
2899 Ga0501074_0032006
2900 Ga0501074_0079037
2901 Ga0501074_0242197
2902 Ga0501209_015118
2903 Ga0501217_053211
2904 Ga0501223_001035
2905 Ga0501224_000028
2906 Ga0501235_010652
2907 Ga0501238_003510
2908 Ga0501238_043476
2909 Ga0501253_018228
2910 Ga0501225_0001850
2911 Ga0501234_002566
2912 Ga0501080_0105632
2913 Ga0501080_0129778
2914 Ga0501083_0008289
2915 Ga0501083_0022513
2916 Ga0501270_017546
2917 Ga0501273_001732
2918 Ga0501035_0005815
2919 Ga0501035_0108293
2920 Ga0501035_0240154
2921 Ga0501035_0582535
2922 Ga0501044_0006073
2923 Ga0501044_0014438
2924 Ga0501044_0022693
2925 Ga0501044_0044949
2926 Ga0501044_0052094
2927 Ga0501044_0064110
2928 Ga0501044_0115403
2929 Ga0501044_0115827
2930 Ga0501226_000146
2931 nmdc:mga03683_28884_c1
2932 nmdc:mga00v17_140697_c1
2933 nmdc:mga00v17_485519_c1
2934 nmdc:mga0k408_211209_c1
2935 nmdc:mga05p37_775333_c1
2936 nmdc:mga06r32_454547_c1
2937 Ga0495601_0058425
2938 Ga0495655_0020270
2939 Ga0495595_0073272
2940 Ga0495619_0009805
2941 Ga0500578_0001117
2942 Ga0500643_000167
2943 Ga0500643_000491
2944 Ga0500643_001394
2945 Ga0500644_0000074
2946 Ga0500646_0007172
2947 Ga0500554_005310
2948 Ga0500555_040626
2949 Ga0500556_0000954
2950 Ga0500594_0000093
2951 Ga0500608_076530
2952 Ga0500618_000152
2953 Ga0500655_001656
2954 Ga0500658_0000106
2955 Ga0500559_0000016
2956 Ga0500559_0000054
2957 Ga0500559_0041779
2958 Ga0500564_000094
2959 Ga0500568_0000708
2960 Ga0500577_0001695
2961 Ga0500604_0000004
2962 Ga0500616_0000195
2963 Ga0500622_0001162
2964 Ga0500622_0027985
2965 Ga0500627_0001136
2966 Ga0500633_0032807
2967 Ga0500611_007405
2968 Ga0500609_000159
2969 Ga0501084_0008910
2970 Ga0501084_0160520
2971 Ga0500661_001304
2972 Ga0500661_006208
2973 Ga0501082_0007396
2974 Ga0501082_0008750
2975 Ga0501082_0033247
2976 2511121904
2977 2585148266
2978 2585150955
2979 2585196383
2980 2643750351
2981 2643780461
2982 2643926969
2983 2643932136
2984 2644507240
2985 2819538107
2986 2819647323
2987 2830077709
2988 2837651421
2989 2848298467
2990 2891048537
2991 2895884264
2992 2896430475
2993 2946788531
2994 2995394393

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

48

157

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

200

276

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9716 3 119
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9688 2 115
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9675 1 118
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9627 3 120
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9571 3 119
ID Description Score Start End Superfamily
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9874 3 81 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9752 3 81 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9743 1 81 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9739 3 81 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9702 3 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A382R6X6-F1-model_v4 Response regulatory domain-containing protein 0.9798 1 116 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A149UWK3-F1-model_v4 deleted 0.9786 1 121
AF-A0A3A1PHS9-F1-model_v4 DNA-binding response regulator 0.9782 1 115 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2A4RET6-F1-model_v4 DNA-binding response regulator 0.9782 1 116 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-J3A137-F1-model_v4 Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain 0.9765 2 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map