F494376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1497 | 431 | 2994 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100377564|Ga0307409_1003775642 |
| Length | 279 |
| Sequence | MQLRKFPYTLESCVVKTLERLLVSHRHAGYPPAFTGRGREKGGMSQVIALVDDDRNILTSVSIALQQEGFITRVYSDGTTALKAIGDNPPDLGVFDIKMPGMDGMELLRRLRETSSVPVIFLTSKDDELDEALGLAMGADDYISKPFSQRLLIARIRAILRRQELERGEAAANSDEPEPPRLERGRLVMDPARHKVIWDGKDVSLTVTEFLILEALAQRPGVVKSRNQLLDIAYNDDVYVDDRTIDSHIKRIRRKFRAHDPQFDSIETLYGVGYRFDEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 209 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 266 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 269 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 270 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 271 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 363 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 368 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 369 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 375 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 378 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 381 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 388 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 391 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 392 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 402 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 408 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 409 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 414 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 415 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 416 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 417 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 418 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 419 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 420 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 421 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 422 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 423 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 424 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 425 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 426 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 427 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 428 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 429 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 430 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 431 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0.27 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 0 |
| Rhizoplane | 4.21 |
| Rhizosphere | 87.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307409_100377564 | 3300031995 | Bacteria | 1346 |
| 2 | JGI24741J21665_1009291 | 3300001915 | Bacteria | 1813 |
| 3 | JGI24752J21851_1006614 | 3300001976 | Bacteria | 1516 |
| 4 | JGI24752J21851_1018781 | 3300001976 | Bacteria | 901 |
| 5 | JGI24740J21852_10001751 | 3300001979 | Bacteria | 9977 |
| 6 | JGI24740J21852_10011465 | 3300001979 | Bacteria | 3372 |
| 7 | JGI24740J21852_10031692 | 3300001979 | Bacteria | 1701 |
| 8 | JGI24739J22299_10001437 | 3300001989 | Bacteria | 8976 |
| 9 | JGI24739J22299_10021447 | 3300001989 | Bacteria | 2299 |
| 10 | JGI24737J22298_10004924 | 3300001990 | Bacteria | 4627 |
| 11 | JGI24737J22298_10005430 | 3300001990 | Bacteria | 4401 |
| 12 | JGI24737J22298_10027764 | 3300001990 | Bacteria | 1782 |
| 13 | JGI24737J22298_10028978 | 3300001990 | Bacteria | 1738 |
| 14 | JGI24737J22298_10073910 | 3300001990 | Bacteria | 1017 |
| 15 | JGI24743J22301_10003950 | 3300001991 | Bacteria | 2378 |
| 16 | JGI24743J22301_10030619 | 3300001991 | Bacteria | 1059 |
| 17 | JGI24735J21928_10003716 | 3300002067 | Bacteria | 5177 |
| 18 | JGI24735J21928_10004038 | 3300002067 | Bacteria | 4950 |
| 19 | JGI24735J21928_10012841 | 3300002067 | Bacteria | 2644 |
| 20 | JGI24735J21928_10022727 | 3300002067 | Bacteria | 1906 |
| 21 | JGI24750J21931_1010515 | 3300002070 | Bacteria | 1207 |
| 22 | JGI24738J21930_10004628 | 3300002075 | Bacteria | 3356 |
| 23 | JGI25153J46596_10045638 | 3300003215 | Bacteria | 1305 |
| 24 | Ga0055526_1030076 | 3300003771 | Bacteria | 1594 |
| 25 | Ga0055524_1016758 | 3300003775 | Bacteria | 2611 |
| 26 | Ga0055524_1040806 | 3300003775 | Bacteria | 1178 |
| 27 | Ga0055528_1013757 | 3300003790 | Bacteria | 3044 |
| 28 | Ga0055530_10000987 | 3300003791 | Bacteria | 22808 |
| 29 | Ga0055530_10067721 | 3300003791 | Bacteria | 778 |
| 30 | Ga0055531_10002442 | 3300003794 | Bacteria | 12439 |
| 31 | Ga0055531_10020386 | 3300003794 | Bacteria | 2624 |
| 32 | Ga0065165_1000583 | 3300005262 | Bacteria | 53842 |
| 33 | Ga0065165_1001140 | 3300005262 | Bacteria | 31153 |
| 34 | Ga0065712_10132582 | 3300005290 | Bacteria | 1532 |
| 35 | Ga0065712_10228343 | 3300005290 | Bacteria | 1019 |
| 36 | Ga0065715_10139509 | 3300005293 | Bacteria | 1875 |
| 37 | Ga0065715_10164498 | 3300005293 | Bacteria | 1595 |
| 38 | Ga0065715_10209071 | 3300005293 | Bacteria | 1323 |
| 39 | Ga0065715_10261607 | 3300005293 | Bacteria | 1136 |
| 40 | Ga0065715_10370799 | 3300005293 | Bacteria | 917 |
| 41 | Ga0065707_10107500 | 3300005295 | Bacteria | 2551 |
| 42 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 43 | Ga0070658_10013428 | 3300005327 | Bacteria | 6571 |
| 44 | Ga0070658_10031030 | 3300005327 | Bacteria | 4291 |
| 45 | Ga0070658_10043979 | 3300005327 | Bacteria | 3608 |
| 46 | Ga0070658_10049315 | 3300005327 | Bacteria | 3410 |
| 47 | Ga0070658_10159215 | 3300005327 | Bacteria | 1894 |
| 48 | Ga0070658_10200792 | 3300005327 | Bacteria | 1682 |
| 49 | Ga0070658_10461660 | 3300005327 | Bacteria | 1095 |
| 50 | Ga0070658_10613073 | 3300005327 | Bacteria | 943 |
| 51 | Ga0070658_10618156 | 3300005327 | Bacteria | 939 |
| 52 | Ga0070676_10003480 | 3300005328 | Bacteria | 8209 |
| 53 | Ga0070676_10029061 | 3300005328 | Bacteria | 3142 |
| 54 | Ga0070676_10191766 | 3300005328 | Bacteria | 1335 |
| 55 | Ga0070683_100017503 | 3300005329 | Bacteria | 6334 |
| 56 | Ga0070683_100070865 | 3300005329 | Bacteria | 3252 |
| 57 | Ga0070683_100076509 | 3300005329 | Bacteria | 3128 |
| 58 | Ga0070683_100090361 | 3300005329 | Bacteria | 2875 |
| 59 | Ga0070690_100072921 | 3300005330 | Bacteria | 2233 |
| 60 | Ga0070690_100134831 | 3300005330 | Bacteria | 1671 |
| 61 | Ga0070670_100001683 | 3300005331 | Bacteria | 17959 |
| 62 | Ga0070670_100008579 | 3300005331 | Bacteria | 8717 |
| 63 | Ga0070670_100051615 | 3300005331 | Bacteria | 3531 |
| 64 | Ga0070670_100067846 | 3300005331 | Bacteria | 3060 |
| 65 | Ga0070670_100099944 | 3300005331 | Bacteria | 2496 |
| 66 | Ga0070670_100123249 | 3300005331 | Bacteria | 2236 |
| 67 | Ga0070670_100491413 | 3300005331 | Bacteria | 1091 |
| 68 | Ga0070677_10143027 | 3300005333 | Bacteria | 1105 |
| 69 | Ga0068869_100007757 | 3300005334 | Bacteria | 6883 |
| 70 | Ga0068869_100079799 | 3300005334 | Bacteria | 2439 |
| 71 | Ga0070666_10000560 | 3300005335 | Bacteria | 22474 |
| 72 | Ga0070666_10000589 | 3300005335 | Bacteria | 21952 |
| 73 | Ga0070666_10006877 | 3300005335 | Bacteria | 7007 |
| 74 | Ga0070666_10023181 | 3300005335 | Bacteria | 4038 |
| 75 | Ga0070666_10028457 | 3300005335 | Bacteria | 3667 |
| 76 | Ga0070666_10150239 | 3300005335 | Bacteria | 1625 |
| 77 | Ga0070666_10151542 | 3300005335 | Bacteria | 1617 |
| 78 | Ga0070680_100000762 | 3300005336 | Bacteria | 22541 |
| 79 | Ga0070680_100000835 | 3300005336 | Bacteria | 21767 |
| 80 | Ga0070680_100017079 | 3300005336 | Bacteria | 5716 |
| 81 | Ga0070680_100182656 | 3300005336 | Bacteria | 1767 |
| 82 | Ga0070682_100044268 | 3300005337 | Bacteria | 2755 |
| 83 | Ga0070682_100057303 | 3300005337 | Bacteria | 2454 |
| 84 | Ga0068868_100001536 | 3300005338 | Bacteria | 15801 |
| 85 | Ga0068868_100151370 | 3300005338 | Bacteria | 1911 |
| 86 | Ga0068868_100217849 | 3300005338 | Bacteria | 1597 |
| 87 | Ga0068868_100380232 | 3300005338 | Bacteria | 1215 |
| 88 | Ga0070660_100005075 | 3300005339 | Bacteria | 9098 |
| 89 | Ga0070660_100011166 | 3300005339 | Bacteria | 6373 |
| 90 | Ga0070660_100033069 | 3300005339 | Bacteria | 3895 |
| 91 | Ga0070660_100195215 | 3300005339 | Bacteria | 1640 |
| 92 | Ga0070660_100312583 | 3300005339 | Bacteria | 1289 |
| 93 | Ga0070660_100324853 | 3300005339 | Bacteria | 1264 |
| 94 | Ga0070660_100369895 | 3300005339 | Bacteria | 1182 |
| 95 | Ga0070687_100159773 | 3300005343 | Bacteria | 1331 |
| 96 | Ga0070661_100000010 | 3300005344 | Bacteria | 175777 |
| 97 | Ga0070661_100022365 | 3300005344 | Bacteria | 4526 |
| 98 | Ga0070661_100024164 | 3300005344 | Bacteria | 4358 |
| 99 | Ga0070661_100037007 | 3300005344 | Bacteria | 3550 |
| 100 | Ga0070661_100038025 | 3300005344 | Bacteria | 3502 |
| 101 | Ga0070661_100048673 | 3300005344 | Bacteria | 3103 |
| 102 | Ga0070661_100086955 | 3300005344 | Bacteria | 2312 |
| 103 | Ga0070661_100087995 | 3300005344 | Bacteria | 2298 |
| 104 | Ga0070661_100163533 | 3300005344 | Bacteria | 1686 |
| 105 | Ga0070661_100266386 | 3300005344 | Bacteria | 1326 |
| 106 | Ga0070661_100469835 | 3300005344 | Bacteria | 1003 |
| 107 | Ga0070668_100003316 | 3300005347 | Bacteria | 11877 |
| 108 | Ga0070668_100024475 | 3300005347 | Bacteria | 4576 |
| 109 | Ga0070668_100096442 | 3300005347 | Bacteria | 2337 |
| 110 | Ga0070669_100000042 | 3300005353 | Bacteria | 123396 |
| 111 | Ga0070669_100015724 | 3300005353 | Bacteria | 5397 |
| 112 | Ga0070669_100037569 | 3300005353 | Bacteria | 3513 |
| 113 | Ga0070669_100156266 | 3300005353 | Bacteria | 1769 |
| 114 | Ga0070669_100264789 | 3300005353 | Bacteria | 1373 |
| 115 | Ga0070675_100008232 | 3300005354 | Bacteria | 8089 |
| 116 | Ga0070675_100055903 | 3300005354 | Bacteria | 3250 |
| 117 | Ga0070675_100059392 | 3300005354 | Bacteria | 3155 |
| 118 | Ga0070675_100092263 | 3300005354 | Bacteria | 2539 |
| 119 | Ga0070675_100212004 | 3300005354 | Bacteria | 1684 |
| 120 | Ga0070671_100000010 | 3300005355 | Bacteria | 202799 |
| 121 | Ga0070671_100014861 | 3300005355 | Bacteria | 6289 |
| 122 | Ga0070671_100016348 | 3300005355 | Bacteria | 6000 |
| 123 | Ga0070671_100019917 | 3300005355 | Bacteria | 5466 |
| 124 | Ga0070671_100020234 | 3300005355 | Bacteria | 5425 |
| 125 | Ga0070671_100022996 | 3300005355 | Bacteria | 5093 |
| 126 | Ga0070671_100023745 | 3300005355 | Bacteria | 5019 |
| 127 | Ga0070671_100028714 | 3300005355 | Bacteria | 4583 |
| 128 | Ga0070671_100286177 | 3300005355 | Bacteria | 1402 |
| 129 | Ga0070674_100061300 | 3300005356 | Bacteria | 2625 |
| 130 | Ga0070673_100000926 | 3300005364 | Bacteria | 16587 |
| 131 | Ga0070673_100004977 | 3300005364 | Bacteria | 8470 |
| 132 | Ga0070673_100021743 | 3300005364 | Bacteria | 4658 |
| 133 | Ga0070673_100041683 | 3300005364 | Bacteria | 3534 |
| 134 | Ga0070673_100061266 | 3300005364 | Bacteria | 2985 |
| 135 | Ga0070673_100081617 | 3300005364 | Bacteria | 2622 |
| 136 | Ga0070673_100142119 | 3300005364 | Bacteria | 2026 |
| 137 | Ga0070673_100302763 | 3300005364 | Bacteria | 1408 |
| 138 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 139 | Ga0070659_100009955 | 3300005366 | Bacteria | 6994 |
| 140 | Ga0070659_100016148 | 3300005366 | Bacteria | 5601 |
| 141 | Ga0070659_100021317 | 3300005366 | Bacteria | 4933 |
| 142 | Ga0070659_100024216 | 3300005366 | Bacteria | 4652 |
| 143 | Ga0070659_100030375 | 3300005366 | Bacteria | 4182 |
| 144 | Ga0070659_100061352 | 3300005366 | Bacteria | 2972 |
| 145 | Ga0070659_100064515 | 3300005366 | Bacteria | 2899 |
| 146 | Ga0070659_100080249 | 3300005366 | Bacteria | 2605 |
| 147 | Ga0070659_100197383 | 3300005366 | Bacteria | 1655 |
| 148 | Ga0070659_100402319 | 3300005366 | Bacteria | 1156 |
| 149 | Ga0070659_100464984 | 3300005366 | Bacteria | 1075 |
| 150 | Ga0070659_100556024 | 3300005366 | Bacteria | 983 |
| 151 | Ga0070667_100006418 | 3300005367 | Bacteria | 9774 |
| 152 | Ga0070667_100008406 | 3300005367 | Bacteria | 8560 |
| 153 | Ga0070667_100029024 | 3300005367 | Bacteria | 4607 |
| 154 | Ga0070667_100046823 | 3300005367 | Bacteria | 3638 |
| 155 | Ga0070667_100084928 | 3300005367 | Bacteria | 2714 |
| 156 | Ga0070667_100343370 | 3300005367 | Bacteria | 1350 |
| 157 | Ga0070667_100356690 | 3300005367 | Bacteria | 1325 |
| 158 | Ga0070667_100851205 | 3300005367 | Bacteria | 848 |
| 159 | Ga0070709_10028601 | 3300005434 | Bacteria | 3326 |
| 160 | Ga0070714_100015883 | 3300005435 | Bacteria | 6068 |
| 161 | Ga0070714_100019297 | 3300005435 | Bacteria | 5550 |
| 162 | Ga0070714_100030646 | 3300005435 | Bacteria | 4480 |
| 163 | Ga0070713_100025410 | 3300005436 | Bacteria | 4630 |
| 164 | Ga0070713_100031098 | 3300005436 | Bacteria | 4248 |
| 165 | Ga0070713_100134331 | 3300005436 | Bacteria | 2185 |
| 166 | Ga0070713_100255808 | 3300005436 | Bacteria | 1599 |
| 167 | Ga0070713_100272995 | 3300005436 | Bacteria | 1549 |
| 168 | Ga0070711_100174498 | 3300005439 | Bacteria | 1641 |
| 169 | Ga0070711_100333518 | 3300005439 | Bacteria | 1215 |
| 170 | Ga0070705_100062935 | 3300005440 | Bacteria | 2211 |
| 171 | Ga0070694_100030397 | 3300005444 | Bacteria | 3533 |
| 172 | Ga0070708_100213107 | 3300005445 | Bacteria | 1810 |
| 173 | Ga0070663_100008986 | 3300005455 | Bacteria | 6170 |
| 174 | Ga0070663_100030578 | 3300005455 | Bacteria | 3692 |
| 175 | Ga0070663_100059342 | 3300005455 | Bacteria | 2750 |
| 176 | Ga0070663_100067316 | 3300005455 | Bacteria | 2597 |
| 177 | Ga0070663_100070177 | 3300005455 | Bacteria | 2547 |
| 178 | Ga0070678_100008190 | 3300005456 | Bacteria | 6248 |
| 179 | Ga0070678_100008901 | 3300005456 | Bacteria | 6043 |
| 180 | Ga0070678_100031729 | 3300005456 | Bacteria | 3649 |
| 181 | Ga0070678_100189326 | 3300005456 | Bacteria | 1690 |
| 182 | Ga0070662_100004908 | 3300005457 | Bacteria | 8495 |
| 183 | Ga0070662_100005390 | 3300005457 | Bacteria | 8167 |
| 184 | Ga0070662_100010452 | 3300005457 | Bacteria | 6091 |
| 185 | Ga0070662_100013093 | 3300005457 | Bacteria | 5513 |
| 186 | Ga0070662_100015663 | 3300005457 | Bacteria | 5083 |
| 187 | Ga0070662_100015798 | 3300005457 | Bacteria | 5062 |
| 188 | Ga0070662_100062252 | 3300005457 | Bacteria | 2726 |
| 189 | Ga0070662_100077047 | 3300005457 | Bacteria | 2473 |
| 190 | Ga0070662_100120426 | 3300005457 | Bacteria | 2011 |
| 191 | Ga0070662_100126353 | 3300005457 | Bacteria | 1966 |
| 192 | Ga0070662_100166114 | 3300005457 | Bacteria | 1730 |
| 193 | Ga0070662_100314216 | 3300005457 | Bacteria | 1276 |
| 194 | Ga0070681_10045727 | 3300005458 | Bacteria | 4379 |
| 195 | Ga0070681_10077048 | 3300005458 | Bacteria | 3292 |
| 196 | Ga0070681_10102210 | 3300005458 | Bacteria | 2811 |
| 197 | Ga0070681_10134375 | 3300005458 | Bacteria | 2405 |
| 198 | Ga0068867_100018201 | 3300005459 | Bacteria | 4992 |
| 199 | Ga0068867_100238152 | 3300005459 | Bacteria | 1474 |
| 200 | Ga0070685_10204339 | 3300005466 | Bacteria | 1286 |
| 201 | Ga0070698_100437446 | 3300005471 | Bacteria | 1243 |
| 202 | Ga0070679_100000005 | 3300005530 | Bacteria | 263201 |
| 203 | Ga0070679_100048005 | 3300005530 | Bacteria | 4255 |
| 204 | Ga0070679_100060540 | 3300005530 | Bacteria | 3773 |
| 205 | Ga0070679_100131321 | 3300005530 | Bacteria | 2486 |
| 206 | Ga0070679_100384186 | 3300005530 | Bacteria | 1351 |
| 207 | Ga0070684_100015958 | 3300005535 | Bacteria | 6133 |
| 208 | Ga0070684_100141978 | 3300005535 | Bacteria | 2172 |
| 209 | Ga0070697_100318495 | 3300005536 | Bacteria | 1339 |
| 210 | Ga0068853_100011737 | 3300005539 | Bacteria | 7120 |
| 211 | Ga0068853_100031940 | 3300005539 | Bacteria | 4457 |
| 212 | Ga0068853_100060811 | 3300005539 | Bacteria | 3265 |
| 213 | Ga0068853_100101709 | 3300005539 | Bacteria | 2542 |
| 214 | Ga0068853_100122125 | 3300005539 | Bacteria | 2324 |
| 215 | Ga0068853_100130600 | 3300005539 | Bacteria | 2248 |
| 216 | Ga0068853_100194643 | 3300005539 | Bacteria | 1843 |
| 217 | Ga0070672_100018334 | 3300005543 | Bacteria | 5058 |
| 218 | Ga0070672_100080237 | 3300005543 | Bacteria | 2614 |
| 219 | Ga0070672_100097854 | 3300005543 | Bacteria | 2376 |
| 220 | Ga0070672_100124754 | 3300005543 | Bacteria | 2111 |
| 221 | Ga0070672_100241396 | 3300005543 | Bacteria | 1520 |
| 222 | Ga0070672_100277966 | 3300005543 | Bacteria | 1415 |
| 223 | Ga0070686_100049303 | 3300005544 | Bacteria | 2671 |
| 224 | Ga0070686_100101663 | 3300005544 | Bacteria | 1943 |
| 225 | Ga0070686_100157522 | 3300005544 | Bacteria | 1596 |
| 226 | Ga0070695_100125097 | 3300005545 | Bacteria | 1764 |
| 227 | Ga0070696_100029968 | 3300005546 | Bacteria | 3722 |
| 228 | Ga0070696_100287654 | 3300005546 | Bacteria | 1255 |
| 229 | Ga0070693_100019430 | 3300005547 | Bacteria | 3562 |
| 230 | Ga0070693_100025424 | 3300005547 | Bacteria | 3187 |
| 231 | Ga0070693_100107954 | 3300005547 | Bacteria | 1707 |
| 232 | Ga0070693_100350686 | 3300005547 | Bacteria | 1010 |
| 233 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 234 | Ga0070665_100000705 | 3300005548 | Bacteria | 44568 |
| 235 | Ga0070665_100006901 | 3300005548 | Bacteria | 11543 |
| 236 | Ga0070665_100017020 | 3300005548 | Bacteria | 7289 |
| 237 | Ga0070665_100020609 | 3300005548 | Bacteria | 6624 |
| 238 | Ga0070665_100039761 | 3300005548 | Bacteria | 4727 |
| 239 | Ga0070665_100041899 | 3300005548 | Bacteria | 4603 |
| 240 | Ga0070665_100102810 | 3300005548 | Bacteria | 2861 |
| 241 | Ga0070665_100123413 | 3300005548 | Bacteria | 2592 |
| 242 | Ga0070665_100158243 | 3300005548 | Bacteria | 2267 |
| 243 | Ga0070665_100216796 | 3300005548 | Bacteria | 1914 |
| 244 | Ga0070665_100362544 | 3300005548 | Bacteria | 1455 |
| 245 | Ga0068855_100000075 | 3300005563 | Bacteria | 119094 |
| 246 | Ga0068855_100047862 | 3300005563 | Bacteria | 5050 |
| 247 | Ga0068855_100110265 | 3300005563 | Bacteria | 3159 |
| 248 | Ga0068855_100111054 | 3300005563 | Bacteria | 3147 |
| 249 | Ga0068855_100128065 | 3300005563 | Bacteria | 2901 |
| 250 | Ga0068855_100187397 | 3300005563 | Bacteria | 2336 |
| 251 | Ga0068855_100235859 | 3300005563 | Bacteria | 2046 |
| 252 | Ga0068855_100291514 | 3300005563 | Bacteria | 1809 |
| 253 | Ga0068855_100941118 | 3300005563 | Bacteria | 911 |
| 254 | Ga0070664_100001286 | 3300005564 | Bacteria | 20075 |
| 255 | Ga0070664_100002393 | 3300005564 | Bacteria | 15065 |
| 256 | Ga0070664_100002719 | 3300005564 | Bacteria | 14275 |
| 257 | Ga0070664_100008077 | 3300005564 | Bacteria | 8505 |
| 258 | Ga0070664_100008895 | 3300005564 | Bacteria | 8136 |
| 259 | Ga0070664_100035616 | 3300005564 | Bacteria | 4178 |
| 260 | Ga0070664_100038260 | 3300005564 | Bacteria | 4037 |
| 261 | Ga0070664_100058638 | 3300005564 | Bacteria | 3274 |
| 262 | Ga0070664_100077294 | 3300005564 | Bacteria | 2862 |
| 263 | Ga0070664_100094475 | 3300005564 | Bacteria | 2593 |
| 264 | Ga0070664_100131923 | 3300005564 | Bacteria | 2195 |
| 265 | Ga0070664_100215005 | 3300005564 | Bacteria | 1718 |
| 266 | Ga0070664_100237039 | 3300005564 | Bacteria | 1637 |
| 267 | Ga0070664_100644543 | 3300005564 | Bacteria | 984 |
| 268 | Ga0068857_100013797 | 3300005577 | Bacteria | 7038 |
| 269 | Ga0068857_100017690 | 3300005577 | Bacteria | 6251 |
| 270 | Ga0068857_100046949 | 3300005577 | Bacteria | 3833 |
| 271 | Ga0068857_100117168 | 3300005577 | Bacteria | 2397 |
| 272 | Ga0068857_100155883 | 3300005577 | Bacteria | 2071 |
| 273 | Ga0068857_100323095 | 3300005577 | Bacteria | 1425 |
| 274 | Ga0068857_100364716 | 3300005577 | Bacteria | 1339 |
| 275 | Ga0068854_100000526 | 3300005578 | Bacteria | 23217 |
| 276 | Ga0068854_100042423 | 3300005578 | Bacteria | 3220 |
| 277 | Ga0068854_100105510 | 3300005578 | Bacteria | 2118 |
| 278 | Ga0068854_100133236 | 3300005578 | Bacteria | 1900 |
| 279 | Ga0068854_100935739 | 3300005578 | Bacteria | 764 |
| 280 | Ga0068856_100023109 | 3300005614 | Bacteria | 6047 |
| 281 | Ga0068856_100056588 | 3300005614 | Bacteria | 3870 |
| 282 | Ga0068856_100092865 | 3300005614 | Bacteria | 3003 |
| 283 | Ga0068856_100165919 | 3300005614 | Bacteria | 2219 |
| 284 | Ga0068856_100187752 | 3300005614 | Bacteria | 2081 |
| 285 | Ga0068856_100191531 | 3300005614 | Bacteria | 2058 |
| 286 | Ga0068852_100002222 | 3300005616 | Bacteria | 13311 |
| 287 | Ga0068852_100014896 | 3300005616 | Bacteria | 6008 |
| 288 | Ga0068852_100019408 | 3300005616 | Bacteria | 5380 |
| 289 | Ga0068852_100087335 | 3300005616 | Bacteria | 2782 |
| 290 | Ga0068852_100110504 | 3300005616 | Bacteria | 2498 |
| 291 | Ga0068852_100124025 | 3300005616 | Bacteria | 2369 |
| 292 | Ga0068852_100148166 | 3300005616 | Bacteria | 2179 |
| 293 | Ga0068852_100249884 | 3300005616 | Bacteria | 1699 |
| 294 | Ga0068852_100261542 | 3300005616 | Bacteria | 1662 |
| 295 | Ga0068852_100298436 | 3300005616 | Bacteria | 1559 |
| 296 | Ga0068852_100307804 | 3300005616 | Bacteria | 1535 |
| 297 | Ga0068859_100000068 | 3300005617 | Bacteria | 96701 |
| 298 | Ga0068859_100000311 | 3300005617 | Bacteria | 48667 |
| 299 | Ga0068859_100039170 | 3300005617 | Bacteria | 4754 |
| 300 | Ga0068859_100046359 | 3300005617 | Bacteria | 4365 |
| 301 | Ga0068859_100085280 | 3300005617 | Bacteria | 3204 |
| 302 | Ga0068859_100232809 | 3300005617 | Bacteria | 1930 |
| 303 | Ga0068859_100506664 | 3300005617 | Bacteria | 1302 |
| 304 | Ga0068864_100000339 | 3300005618 | Bacteria | 41252 |
| 305 | Ga0068864_100005196 | 3300005618 | Bacteria | 10665 |
| 306 | Ga0068864_100006681 | 3300005618 | Bacteria | 9445 |
| 307 | Ga0068864_100011656 | 3300005618 | Bacteria | 7260 |
| 308 | Ga0068864_100029571 | 3300005618 | Bacteria | 4641 |
| 309 | Ga0068864_100048060 | 3300005618 | Bacteria | 3667 |
| 310 | Ga0068864_100169986 | 3300005618 | Bacteria | 1987 |
| 311 | Ga0068864_100806575 | 3300005618 | Bacteria | 923 |
| 312 | Ga0068866_10027339 | 3300005718 | Bacteria | 2704 |
| 313 | Ga0068866_10234463 | 3300005718 | Bacteria | 1115 |
| 314 | Ga0068861_100007994 | 3300005719 | Bacteria | 7279 |
| 315 | Ga0068861_100124674 | 3300005719 | Bacteria | 2083 |
| 316 | Ga0068861_100294763 | 3300005719 | Bacteria | 1402 |
| 317 | Ga0068851_10019988 | 3300005834 | Bacteria | 3239 |
| 318 | Ga0068863_100000535 | 3300005841 | Bacteria | 38753 |
| 319 | Ga0068863_100002834 | 3300005841 | Bacteria | 17170 |
| 320 | Ga0068863_100006405 | 3300005841 | Bacteria | 11540 |
| 321 | Ga0068863_100010392 | 3300005841 | Bacteria | 9045 |
| 322 | Ga0068863_100013383 | 3300005841 | Bacteria | 7910 |
| 323 | Ga0068863_100018241 | 3300005841 | Bacteria | 6719 |
| 324 | Ga0068863_100026520 | 3300005841 | Bacteria | 5526 |
| 325 | Ga0068863_100053435 | 3300005841 | Bacteria | 3829 |
| 326 | Ga0068863_100156949 | 3300005841 | Bacteria | 2178 |
| 327 | Ga0068858_100000911 | 3300005842 | Bacteria | 30658 |
| 328 | Ga0068858_100001148 | 3300005842 | Bacteria | 27405 |
| 329 | Ga0068858_100001843 | 3300005842 | Bacteria | 21605 |
| 330 | Ga0068858_100006411 | 3300005842 | Bacteria | 11459 |
| 331 | Ga0068858_100013165 | 3300005842 | Bacteria | 7797 |
| 332 | Ga0068858_100018073 | 3300005842 | Bacteria | 6603 |
| 333 | Ga0068858_100022455 | 3300005842 | Bacteria | 5889 |
| 334 | Ga0068858_100064168 | 3300005842 | Bacteria | 3399 |
| 335 | Ga0068858_100080280 | 3300005842 | Bacteria | 3031 |
| 336 | Ga0068860_100002412 | 3300005843 | Bacteria | 19607 |
| 337 | Ga0068860_100004375 | 3300005843 | Bacteria | 14422 |
| 338 | Ga0068860_100010285 | 3300005843 | Bacteria | 9258 |
| 339 | Ga0068860_100018987 | 3300005843 | Bacteria | 6676 |
| 340 | Ga0068860_100037485 | 3300005843 | Bacteria | 4641 |
| 341 | Ga0068860_100045940 | 3300005843 | Bacteria | 4165 |
| 342 | Ga0068860_100087335 | 3300005843 | Bacteria | 2969 |
| 343 | Ga0068862_100000620 | 3300005844 | Bacteria | 36954 |
| 344 | Ga0068862_100004223 | 3300005844 | Bacteria | 12167 |
| 345 | Ga0068862_100011413 | 3300005844 | Bacteria | 7333 |
| 346 | Ga0068862_100017674 | 3300005844 | Bacteria | 5936 |
| 347 | Ga0068862_100019273 | 3300005844 | Bacteria | 5691 |
| 348 | Ga0068862_100028904 | 3300005844 | Bacteria | 4669 |
| 349 | Ga0068862_100403713 | 3300005844 | Bacteria | 1279 |
| 350 | Ga0081539_10006847 | 3300005985 | Bacteria | 10659 |
| 351 | Ga0081539_10057900 | 3300005985 | Bacteria | 2141 |
| 352 | Ga0070717_10008598 | 3300006028 | Bacteria | 7628 |
| 353 | Ga0075364_10035282 | 3300006051 | Bacteria | 3232 |
| 354 | Ga0070716_100036482 | 3300006173 | Bacteria | 2711 |
| 355 | Ga0070712_100138312 | 3300006175 | Bacteria | 1855 |
| 356 | Ga0097621_100001143 | 3300006237 | Bacteria | 18430 |
| 357 | Ga0097621_100179218 | 3300006237 | Bacteria | 1830 |
| 358 | Ga0097621_100261324 | 3300006237 | Bacteria | 1519 |
| 359 | Ga0075370_10040095 | 3300006353 | Bacteria | 2641 |
| 360 | Ga0068871_100007297 | 3300006358 | Bacteria | 7887 |
| 361 | Ga0068871_100007948 | 3300006358 | Bacteria | 7605 |
| 362 | Ga0068871_100009459 | 3300006358 | Bacteria | 7064 |
| 363 | Ga0068871_100048942 | 3300006358 | Bacteria | 3414 |
| 364 | Ga0068871_100055538 | 3300006358 | Bacteria | 3215 |
| 365 | Ga0068871_100168343 | 3300006358 | Bacteria | 1877 |
| 366 | Ga0068871_100332583 | 3300006358 | Bacteria | 1340 |
| 367 | Ga0075428_100325722 | 3300006844 | Bacteria | 1651 |
| 368 | Ga0075431_100428110 | 3300006847 | Bacteria | 1322 |
| 369 | Ga0075433_10138803 | 3300006852 | Bacteria | 2161 |
| 370 | Ga0075434_100267848 | 3300006871 | Bacteria | 1727 |
| 371 | Ga0068865_100001892 | 3300006881 | Bacteria | 12306 |
| 372 | Ga0068865_100063316 | 3300006881 | Bacteria | 2599 |
| 373 | Ga0068865_100208916 | 3300006881 | Bacteria | 1520 |
| 374 | Ga0068865_100209233 | 3300006881 | Bacteria | 1519 |
| 375 | Ga0097620_100000068 | 3300006931 | Bacteria | 96701 |
| 376 | Ga0097620_100000311 | 3300006931 | Bacteria | 48667 |
| 377 | Ga0097620_100039170 | 3300006931 | Bacteria | 4754 |
| 378 | Ga0097620_100046360 | 3300006931 | Bacteria | 4365 |
| 379 | Ga0097620_100085275 | 3300006931 | Bacteria | 3204 |
| 380 | Ga0097620_100232804 | 3300006931 | Bacteria | 1930 |
| 381 | Ga0097620_100506691 | 3300006931 | Bacteria | 1302 |
| 382 | Ga0105250_10029474 | 3300009092 | Bacteria | 2208 |
| 383 | Ga0105240_10000091 | 3300009093 | Bacteria | 182507 |
| 384 | Ga0105240_10018168 | 3300009093 | Bacteria | 9453 |
| 385 | Ga0105240_10018820 | 3300009093 | Bacteria | 9250 |
| 386 | Ga0111539_10039920 | 3300009094 | Bacteria | 5652 |
| 387 | Ga0105245_10038453 | 3300009098 | Bacteria | 4257 |
| 388 | Ga0105245_10045234 | 3300009098 | Bacteria | 3931 |
| 389 | Ga0105245_10332623 | 3300009098 | Bacteria | 1500 |
| 390 | Ga0105245_10461990 | 3300009098 | Bacteria | 1280 |
| 391 | Ga0105247_10006552 | 3300009101 | Bacteria | 7201 |
| 392 | Ga0105247_10010078 | 3300009101 | Bacteria | 5726 |
| 393 | Ga0105247_10117241 | 3300009101 | Bacteria | 1721 |
| 394 | Ga0105247_10378153 | 3300009101 | Bacteria | 1003 |
| 395 | Ga0105243_10003153 | 3300009148 | Bacteria | 13521 |
| 396 | Ga0105243_10052349 | 3300009148 | Bacteria | 3233 |
| 397 | Ga0105243_10546061 | 3300009148 | Bacteria | 1106 |
| 398 | Ga0105243_10761741 | 3300009148 | Bacteria | 950 |
| 399 | Ga0105241_10125832 | 3300009174 | Bacteria | 2069 |
| 400 | Ga0105241_10314855 | 3300009174 | Bacteria | 1347 |
| 401 | Ga0105242_10040052 | 3300009176 | Bacteria | 3774 |
| 402 | Ga0105242_10206036 | 3300009176 | Bacteria | 1749 |
| 403 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 404 | Ga0105248_10000135 | 3300009177 | Bacteria | 85668 |
| 405 | Ga0105248_10002473 | 3300009177 | Bacteria | 20524 |
| 406 | Ga0105248_10010095 | 3300009177 | Bacteria | 10400 |
| 407 | Ga0105248_10018255 | 3300009177 | Bacteria | 7746 |
| 408 | Ga0105248_10032489 | 3300009177 | Bacteria | 5833 |
| 409 | Ga0105248_10050916 | 3300009177 | Bacteria | 4647 |
| 410 | Ga0105248_10062739 | 3300009177 | Bacteria | 4172 |
| 411 | Ga0105248_10068022 | 3300009177 | Bacteria | 3999 |
| 412 | Ga0105248_10111087 | 3300009177 | Bacteria | 3091 |
| 413 | Ga0105237_10010442 | 3300009545 | Bacteria | 9876 |
| 414 | Ga0105237_10041678 | 3300009545 | Bacteria | 4629 |
| 415 | Ga0105238_10132874 | 3300009551 | Bacteria | 2467 |
| 416 | Ga0105238_10268678 | 3300009551 | Bacteria | 1686 |
| 417 | Ga0105238_10331751 | 3300009551 | Bacteria | 1508 |
| 418 | Ga0105238_10356022 | 3300009551 | Bacteria | 1453 |
| 419 | Ga0105238_10473383 | 3300009551 | Bacteria | 1251 |
| 420 | Ga0105238_10805032 | 3300009551 | Bacteria | 955 |
| 421 | Ga0105249_10003308 | 3300009553 | Bacteria | 13962 |
| 422 | Ga0105249_10015105 | 3300009553 | Bacteria | 6831 |
| 423 | Ga0105249_10040558 | 3300009553 | Bacteria | 4229 |
| 424 | Ga0105148_103867 | 3300009978 | Bacteria | 1067 |
| 425 | Ga0105239_10000881 | 3300010375 | Bacteria | 42563 |
| 426 | Ga0105239_10103619 | 3300010375 | Bacteria | 3149 |
| 427 | Ga0105239_10226472 | 3300010375 | Bacteria | 2097 |
| 428 | Ga0105246_10039899 | 3300011119 | Bacteria | 3166 |
| 429 | Ga0105246_10055314 | 3300011119 | Bacteria | 2738 |
| 430 | Ga0105246_10124763 | 3300011119 | Bacteria | 1914 |
| 431 | Ga0157373_10024193 | 3300013100 | Bacteria | 4400 |
| 432 | Ga0157373_10101559 | 3300013100 | Bacteria | 2023 |
| 433 | Ga0157373_10114186 | 3300013100 | Bacteria | 1898 |
| 434 | Ga0157373_10120822 | 3300013100 | Bacteria | 1841 |
| 435 | Ga0157373_10270810 | 3300013100 | Bacteria | 1202 |
| 436 | Ga0157373_10278622 | 3300013100 | Bacteria | 1185 |
| 437 | Ga0157373_10344620 | 3300013100 | Bacteria | 1062 |
| 438 | Ga0157373_10449610 | 3300013100 | Bacteria | 927 |
| 439 | Ga0157371_10012023 | 3300013102 | Bacteria | 6637 |
| 440 | Ga0157371_10024353 | 3300013102 | Bacteria | 4421 |
| 441 | Ga0157371_10029707 | 3300013102 | Bacteria | 3949 |
| 442 | Ga0157371_10077860 | 3300013102 | Bacteria | 2348 |
| 443 | Ga0157371_10085929 | 3300013102 | Bacteria | 2228 |
| 444 | Ga0157371_10104520 | 3300013102 | Bacteria | 2010 |
| 445 | Ga0157371_10138133 | 3300013102 | Bacteria | 1736 |
| 446 | Ga0157371_10237073 | 3300013102 | Bacteria | 1312 |
| 447 | Ga0157371_10462013 | 3300013102 | Bacteria | 934 |
| 448 | Ga0157371_10649785 | 3300013102 | Bacteria | 787 |
| 449 | Ga0157370_10003624 | 3300013104 | Bacteria | 18072 |
| 450 | Ga0157370_10058050 | 3300013104 | Bacteria | 3678 |
| 451 | Ga0157370_10078248 | 3300013104 | Bacteria | 3114 |
| 452 | Ga0157370_10148955 | 3300013104 | Bacteria | 2178 |
| 453 | Ga0157370_10247494 | 3300013104 | Bacteria | 1649 |
| 454 | Ga0157370_10302570 | 3300013104 | Bacteria | 1476 |
| 455 | Ga0157370_10410062 | 3300013104 | Bacteria | 1247 |
| 456 | Ga0157369_10002508 | 3300013105 | Bacteria | 21971 |
| 457 | Ga0157369_10020723 | 3300013105 | Bacteria | 7350 |
| 458 | Ga0157369_10032088 | 3300013105 | Bacteria | 5777 |
| 459 | Ga0157369_10065562 | 3300013105 | Bacteria | 3908 |
| 460 | Ga0157369_10083278 | 3300013105 | Bacteria | 3422 |
| 461 | Ga0157369_10178855 | 3300013105 | Bacteria | 2233 |
| 462 | Ga0157369_10277161 | 3300013105 | Bacteria | 1747 |
| 463 | Ga0157369_10324979 | 3300013105 | Bacteria | 1599 |
| 464 | Ga0157369_10526171 | 3300013105 | Bacteria | 1223 |
| 465 | Ga0157369_10544261 | 3300013105 | Bacteria | 1200 |
| 466 | Ga0157369_11004628 | 3300013105 | Bacteria | 854 |
| 467 | Ga0157374_10008290 | 3300013296 | Bacteria | 8866 |
| 468 | Ga0157374_10036780 | 3300013296 | Bacteria | 4487 |
| 469 | Ga0157374_10114521 | 3300013296 | Bacteria | 2596 |
| 470 | Ga0157374_10182170 | 3300013296 | Bacteria | 2052 |
| 471 | Ga0157374_10217281 | 3300013296 | Bacteria | 1875 |
| 472 | Ga0157378_10025018 | 3300013297 | Bacteria | 5258 |
| 473 | Ga0157378_10057242 | 3300013297 | Bacteria | 3474 |
| 474 | Ga0157378_10741990 | 3300013297 | Bacteria | 1004 |
| 475 | Ga0163162_10004777 | 3300013306 | Bacteria | 13080 |
| 476 | Ga0163162_10013372 | 3300013306 | Bacteria | 8015 |
| 477 | Ga0163162_10015345 | 3300013306 | Bacteria | 7484 |
| 478 | Ga0163162_10037196 | 3300013306 | Bacteria | 4855 |
| 479 | Ga0163162_10067868 | 3300013306 | Bacteria | 3617 |
| 480 | Ga0163162_10074241 | 3300013306 | Bacteria | 3459 |
| 481 | Ga0163162_10103648 | 3300013306 | Bacteria | 2939 |
| 482 | Ga0163162_10138889 | 3300013306 | Bacteria | 2542 |
| 483 | Ga0163162_10193751 | 3300013306 | Bacteria | 2160 |
| 484 | Ga0163162_10384259 | 3300013306 | Bacteria | 1537 |
| 485 | Ga0163162_10792412 | 3300013306 | Bacteria | 1065 |
| 486 | Ga0163162_11232633 | 3300013306 | Bacteria | 849 |
| 487 | Ga0157372_10011794 | 3300013307 | Bacteria | 9310 |
| 488 | Ga0157372_10045540 | 3300013307 | Bacteria | 4867 |
| 489 | Ga0157372_10190381 | 3300013307 | Bacteria | 2376 |
| 490 | Ga0157372_10441694 | 3300013307 | Bacteria | 1516 |
| 491 | Ga0157372_10475342 | 3300013307 | Bacteria | 1457 |
| 492 | Ga0157375_10030724 | 3300013308 | Bacteria | 5069 |
| 493 | Ga0157375_10145304 | 3300013308 | Bacteria | 2502 |
| 494 | Ga0157375_10331488 | 3300013308 | Bacteria | 1687 |
| 495 | Ga0157375_10430942 | 3300013308 | Bacteria | 1485 |
| 496 | Ga0157375_10540708 | 3300013308 | Bacteria | 1327 |
| 497 | Ga0163163_10000995 | 3300014325 | Bacteria | 23981 |
| 498 | Ga0163163_10002903 | 3300014325 | Bacteria | 14499 |
| 499 | Ga0163163_10034083 | 3300014325 | Bacteria | 4929 |
| 500 | Ga0163163_10086013 | 3300014325 | Bacteria | 3152 |
| 501 | Ga0163163_10170758 | 3300014325 | Bacteria | 2221 |
| 502 | Ga0163163_10194840 | 3300014325 | Bacteria | 2074 |
| 503 | Ga0163163_10199126 | 3300014325 | Bacteria | 2051 |
| 504 | Ga0163163_10931248 | 3300014325 | Bacteria | 932 |
| 505 | Ga0157380_10044845 | 3300014326 | Bacteria | 3467 |
| 506 | Ga0157380_10102199 | 3300014326 | Bacteria | 2390 |
| 507 | Ga0157380_10162256 | 3300014326 | Bacteria | 1944 |
| 508 | Ga0157380_10234971 | 3300014326 | Bacteria | 1649 |
| 509 | Ga0157380_10235070 | 3300014326 | Bacteria | 1648 |
| 510 | Ga0157379_10001410 | 3300014968 | Bacteria | 19707 |
| 511 | Ga0157379_10004123 | 3300014968 | Bacteria | 12399 |
| 512 | Ga0157379_10005617 | 3300014968 | Bacteria | 10779 |
| 513 | Ga0157379_10020816 | 3300014968 | Bacteria | 5805 |
| 514 | Ga0157379_10050010 | 3300014968 | Bacteria | 3731 |
| 515 | Ga0157379_10069147 | 3300014968 | Bacteria | 3157 |
| 516 | Ga0157379_10074159 | 3300014968 | Bacteria | 3046 |
| 517 | Ga0157379_10180064 | 3300014968 | Bacteria | 1909 |
| 518 | Ga0157379_10184206 | 3300014968 | Bacteria | 1886 |
| 519 | Ga0157379_10200366 | 3300014968 | Bacteria | 1805 |
| 520 | Ga0157379_10293736 | 3300014968 | Bacteria | 1480 |
| 521 | Ga0157376_10027721 | 3300014969 | Bacteria | 4494 |
| 522 | Ga0163161_10005877 | 3300017792 | Bacteria | 8511 |
| 523 | Ga0163161_10057436 | 3300017792 | Bacteria | 2827 |
| 524 | Ga0163161_10434721 | 3300017792 | Bacteria | 1058 |
| 525 | Ga0197907_11049312 | 3300020069 | Bacteria | 1377 |
| 526 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 527 | Ga0213872_10004505 | 3300021361 | Bacteria | 7381 |
| 528 | Ga0213872_10132579 | 3300021361 | Bacteria | 1097 |
| 529 | Ga0213874_10002022 | 3300021377 | Bacteria | 4284 |
| 530 | Ga0213874_10057844 | 3300021377 | Bacteria | 1207 |
| 531 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 532 | Ga0213876_10000235 | 3300021384 | Bacteria | 53826 |
| 533 | Ga0213876_10002081 | 3300021384 | Bacteria | 11844 |
| 534 | Ga0213876_10013218 | 3300021384 | Bacteria | 4387 |
| 535 | Ga0213876_10014952 | 3300021384 | Bacteria | 4114 |
| 536 | Ga0213876_10031775 | 3300021384 | Bacteria | 2785 |
| 537 | Ga0213876_10159656 | 3300021384 | Bacteria | 1199 |
| 538 | Ga0213875_10000465 | 3300021388 | Bacteria | 34808 |
| 539 | Ga0213875_10066523 | 3300021388 | Bacteria | 1684 |
| 540 | Ga0213871_10015110 | 3300021441 | Bacteria | 1841 |
| 541 | Ga0209026_1004799 | 3300025250 | Bacteria | 3862 |
| 542 | Ga0209565_1000505 | 3300025263 | Bacteria | 28359 |
| 543 | Ga0209673_1001029 | 3300025273 | Bacteria | 33050 |
| 544 | Ga0207673_1007757 | 3300025290 | Bacteria | 1351 |
| 545 | Ga0209758_1003766 | 3300025297 | Bacteria | 13400 |
| 546 | Ga0209758_1026982 | 3300025297 | Bacteria | 2468 |
| 547 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 548 | Ga0209256_1001196 | 3300025299 | Bacteria | 29062 |
| 549 | Ga0209256_1003919 | 3300025299 | Bacteria | 9820 |
| 550 | Ga0209257_1000247 | 3300025304 | Bacteria | 125419 |
| 551 | Ga0209257_1000705 | 3300025304 | Bacteria | 51728 |
| 552 | Ga0207697_10000004 | 3300025315 | Bacteria | 90016 |
| 553 | Ga0207656_10007575 | 3300025321 | Bacteria | 3961 |
| 554 | Ga0207656_10008592 | 3300025321 | Bacteria | 3764 |
| 555 | Ga0207656_10086271 | 3300025321 | Bacteria | 1418 |
| 556 | Ga0207656_10244489 | 3300025321 | Bacteria | 878 |
| 557 | Ga0207696_1011753 | 3300025711 | Bacteria | 3134 |
| 558 | Ga0207682_10051387 | 3300025893 | Bacteria | 1707 |
| 559 | Ga0207682_10103096 | 3300025893 | Bacteria | 1249 |
| 560 | Ga0207642_10011059 | 3300025899 | Bacteria | 3206 |
| 561 | Ga0207642_10015908 | 3300025899 | Bacteria | 2818 |
| 562 | Ga0207710_10017260 | 3300025900 | Bacteria | 3061 |
| 563 | Ga0207710_10163941 | 3300025900 | Bacteria | 1084 |
| 564 | Ga0207710_10245774 | 3300025900 | Bacteria | 894 |
| 565 | Ga0207688_10019179 | 3300025901 | Bacteria | 3723 |
| 566 | Ga0207680_10000110 | 3300025903 | Bacteria | 37399 |
| 567 | Ga0207680_10000479 | 3300025903 | Bacteria | 18923 |
| 568 | Ga0207680_10002339 | 3300025903 | Bacteria | 8818 |
| 569 | Ga0207647_10001330 | 3300025904 | Bacteria | 18984 |
| 570 | Ga0207647_10005953 | 3300025904 | Bacteria | 8888 |
| 571 | Ga0207647_10020301 | 3300025904 | Bacteria | 4456 |
| 572 | Ga0207647_10031336 | 3300025904 | Bacteria | 3422 |
| 573 | Ga0207647_10031605 | 3300025904 | Bacteria | 3406 |
| 574 | Ga0207647_10079903 | 3300025904 | Bacteria | 1962 |
| 575 | Ga0207699_10005926 | 3300025906 | Bacteria | 5879 |
| 576 | Ga0207645_10007286 | 3300025907 | Bacteria | 7824 |
| 577 | Ga0207645_10029495 | 3300025907 | Bacteria | 3536 |
| 578 | Ga0207645_10052457 | 3300025907 | Bacteria | 2606 |
| 579 | Ga0207645_10331820 | 3300025907 | Bacteria | 1016 |
| 580 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 581 | Ga0207705_10009316 | 3300025909 | Bacteria | 7140 |
| 582 | Ga0207705_10013718 | 3300025909 | Bacteria | 5847 |
| 583 | Ga0207705_10042364 | 3300025909 | Bacteria | 3268 |
| 584 | Ga0207705_10113019 | 3300025909 | Bacteria | 2008 |
| 585 | Ga0207705_10134789 | 3300025909 | Bacteria | 1840 |
| 586 | Ga0207705_10139550 | 3300025909 | Bacteria | 1809 |
| 587 | Ga0207705_10279689 | 3300025909 | Bacteria | 1277 |
| 588 | Ga0207654_10384124 | 3300025911 | Bacteria | 973 |
| 589 | Ga0207707_10015128 | 3300025912 | Bacteria | 6717 |
| 590 | Ga0207707_10028578 | 3300025912 | Bacteria | 4874 |
| 591 | Ga0207707_10079116 | 3300025912 | Bacteria | 2870 |
| 592 | Ga0207707_10194441 | 3300025912 | Bacteria | 1769 |
| 593 | Ga0207707_10303778 | 3300025912 | Bacteria | 1380 |
| 594 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 595 | Ga0207695_10040048 | 3300025913 | Bacteria | 5030 |
| 596 | Ga0207695_10048897 | 3300025913 | Bacteria | 4462 |
| 597 | Ga0207671_10175130 | 3300025914 | Bacteria | 1667 |
| 598 | Ga0207671_10233779 | 3300025914 | Bacteria | 1442 |
| 599 | Ga0207693_10016941 | 3300025915 | Bacteria | 5818 |
| 600 | Ga0207693_10394972 | 3300025915 | Bacteria | 1081 |
| 601 | Ga0207693_10470174 | 3300025915 | Bacteria | 982 |
| 602 | Ga0207663_10262127 | 3300025916 | Bacteria | 1277 |
| 603 | Ga0207660_10004061 | 3300025917 | Bacteria | 9550 |
| 604 | Ga0207660_10004720 | 3300025917 | Bacteria | 8874 |
| 605 | Ga0207660_10005872 | 3300025917 | Bacteria | 7971 |
| 606 | Ga0207660_10006996 | 3300025917 | Bacteria | 7305 |
| 607 | Ga0207657_10003536 | 3300025919 | Bacteria | 16692 |
| 608 | Ga0207657_10006575 | 3300025919 | Bacteria | 12036 |
| 609 | Ga0207657_10009507 | 3300025919 | Bacteria | 9762 |
| 610 | Ga0207657_10027948 | 3300025919 | Bacteria | 5156 |
| 611 | Ga0207657_10028001 | 3300025919 | Bacteria | 5150 |
| 612 | Ga0207657_10042970 | 3300025919 | Bacteria | 3985 |
| 613 | Ga0207657_10048511 | 3300025919 | Bacteria | 3707 |
| 614 | Ga0207657_10163872 | 3300025919 | Bacteria | 1804 |
| 615 | Ga0207657_10219948 | 3300025919 | Bacteria | 1522 |
| 616 | Ga0207649_10000165 | 3300025920 | Bacteria | 54047 |
| 617 | Ga0207649_10006461 | 3300025920 | Bacteria | 6367 |
| 618 | Ga0207649_10009943 | 3300025920 | Bacteria | 5214 |
| 619 | Ga0207649_10015525 | 3300025920 | Bacteria | 4279 |
| 620 | Ga0207649_10024744 | 3300025920 | Bacteria | 3493 |
| 621 | Ga0207649_10033588 | 3300025920 | Bacteria | 3067 |
| 622 | Ga0207649_10033852 | 3300025920 | Bacteria | 3056 |
| 623 | Ga0207649_10099279 | 3300025920 | Bacteria | 1923 |
| 624 | Ga0207649_10142993 | 3300025920 | Bacteria | 1639 |
| 625 | Ga0207649_10149594 | 3300025920 | Bacteria | 1606 |
| 626 | Ga0207649_10263747 | 3300025920 | Bacteria | 1246 |
| 627 | Ga0207649_10329251 | 3300025920 | Bacteria | 1124 |
| 628 | Ga0207649_10450115 | 3300025920 | Bacteria | 972 |
| 629 | Ga0207652_10000005 | 3300025921 | Bacteria | 343384 |
| 630 | Ga0207652_10000006 | 3300025921 | Bacteria | 302991 |
| 631 | Ga0207652_10000007 | 3300025921 | Bacteria | 301303 |
| 632 | Ga0207652_10000009 | 3300025921 | Bacteria | 257234 |
| 633 | Ga0207652_10014430 | 3300025921 | Bacteria | 6399 |
| 634 | Ga0207652_10105887 | 3300025921 | Bacteria | 2489 |
| 635 | Ga0207652_10191953 | 3300025921 | Bacteria | 1837 |
| 636 | Ga0207652_10485934 | 3300025921 | Bacteria | 1112 |
| 637 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 638 | Ga0207681_10068262 | 3300025923 | Bacteria | 2468 |
| 639 | Ga0207681_10124419 | 3300025923 | Bacteria | 1896 |
| 640 | Ga0207681_10132550 | 3300025923 | Bacteria | 1844 |
| 641 | Ga0207681_10161995 | 3300025923 | Bacteria | 1687 |
| 642 | Ga0207681_10683900 | 3300025923 | Bacteria | 852 |
| 643 | Ga0207694_10000018 | 3300025924 | Bacteria | 331281 |
| 644 | Ga0207694_10166265 | 3300025924 | Bacteria | 1784 |
| 645 | Ga0207694_10343885 | 3300025924 | Bacteria | 1234 |
| 646 | Ga0207650_10000969 | 3300025925 | Bacteria | 21577 |
| 647 | Ga0207650_10002248 | 3300025925 | Bacteria | 13488 |
| 648 | Ga0207650_10008363 | 3300025925 | Bacteria | 7063 |
| 649 | Ga0207650_10012641 | 3300025925 | Bacteria | 5825 |
| 650 | Ga0207650_10016491 | 3300025925 | Bacteria | 5165 |
| 651 | Ga0207650_10024587 | 3300025925 | Bacteria | 4283 |
| 652 | Ga0207650_10039127 | 3300025925 | Bacteria | 3465 |
| 653 | Ga0207650_10075984 | 3300025925 | Bacteria | 2537 |
| 654 | Ga0207650_10371202 | 3300025925 | Bacteria | 1180 |
| 655 | Ga0207650_10445551 | 3300025925 | Bacteria | 1077 |
| 656 | Ga0207650_10645587 | 3300025925 | Bacteria | 892 |
| 657 | Ga0207659_10001482 | 3300025926 | Bacteria | 13991 |
| 658 | Ga0207659_10008772 | 3300025926 | Bacteria | 6297 |
| 659 | Ga0207659_10012530 | 3300025926 | Bacteria | 5398 |
| 660 | Ga0207659_10038749 | 3300025926 | Bacteria | 3318 |
| 661 | Ga0207659_10080451 | 3300025926 | Bacteria | 2407 |
| 662 | Ga0207659_10088754 | 3300025926 | Bacteria | 2304 |
| 663 | Ga0207687_10173341 | 3300025927 | Bacteria | 1665 |
| 664 | Ga0207687_10395342 | 3300025927 | Bacteria | 1136 |
| 665 | Ga0207700_10036947 | 3300025928 | Bacteria | 3533 |
| 666 | Ga0207700_10051616 | 3300025928 | Bacteria | 3070 |
| 667 | Ga0207700_10337353 | 3300025928 | Bacteria | 1310 |
| 668 | Ga0207664_10012423 | 3300025929 | Bacteria | 6087 |
| 669 | Ga0207664_10074089 | 3300025929 | Bacteria | 2749 |
| 670 | Ga0207664_10087005 | 3300025929 | Bacteria | 2554 |
| 671 | Ga0207664_10345839 | 3300025929 | Bacteria | 1315 |
| 672 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 673 | Ga0207644_10003017 | 3300025931 | Bacteria | 10833 |
| 674 | Ga0207644_10004808 | 3300025931 | Bacteria | 8798 |
| 675 | Ga0207644_10005364 | 3300025931 | Bacteria | 8364 |
| 676 | Ga0207644_10015607 | 3300025931 | Bacteria | 5101 |
| 677 | Ga0207644_10043825 | 3300025931 | Bacteria | 3176 |
| 678 | Ga0207644_10055495 | 3300025931 | Bacteria | 2855 |
| 679 | Ga0207644_10136403 | 3300025931 | Bacteria | 1884 |
| 680 | Ga0207644_10152321 | 3300025931 | Bacteria | 1790 |
| 681 | Ga0207644_10166836 | 3300025931 | Bacteria | 1716 |
| 682 | Ga0207644_10499426 | 3300025931 | Bacteria | 1003 |
| 683 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 684 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 685 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 686 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 687 | Ga0207690_10004241 | 3300025932 | Bacteria | 8468 |
| 688 | Ga0207690_10005677 | 3300025932 | Bacteria | 7376 |
| 689 | Ga0207690_10044230 | 3300025932 | Bacteria | 2934 |
| 690 | Ga0207690_10048921 | 3300025932 | Bacteria | 2815 |
| 691 | Ga0207690_10075230 | 3300025932 | Bacteria | 2341 |
| 692 | Ga0207690_10105226 | 3300025932 | Bacteria | 2023 |
| 693 | Ga0207690_10193460 | 3300025932 | Bacteria | 1540 |
| 694 | Ga0207690_10312382 | 3300025932 | Bacteria | 1233 |
| 695 | Ga0207690_10431198 | 3300025932 | Bacteria | 1056 |
| 696 | Ga0207690_10603853 | 3300025932 | Bacteria | 896 |
| 697 | Ga0207706_10001775 | 3300025933 | Bacteria | 21183 |
| 698 | Ga0207706_10013591 | 3300025933 | Bacteria | 7396 |
| 699 | Ga0207706_10014352 | 3300025933 | Bacteria | 7180 |
| 700 | Ga0207706_10016990 | 3300025933 | Bacteria | 6565 |
| 701 | Ga0207706_10026829 | 3300025933 | Bacteria | 5156 |
| 702 | Ga0207706_10029595 | 3300025933 | Bacteria | 4888 |
| 703 | Ga0207706_10034967 | 3300025933 | Bacteria | 4469 |
| 704 | Ga0207706_10035201 | 3300025933 | Bacteria | 4454 |
| 705 | Ga0207706_10041550 | 3300025933 | Bacteria | 4076 |
| 706 | Ga0207706_10053746 | 3300025933 | Bacteria | 3555 |
| 707 | Ga0207706_10079732 | 3300025933 | Bacteria | 2879 |
| 708 | Ga0207706_10081223 | 3300025933 | Bacteria | 2849 |
| 709 | Ga0207706_10120961 | 3300025933 | Bacteria | 2302 |
| 710 | Ga0207706_10147680 | 3300025933 | Bacteria | 2068 |
| 711 | Ga0207706_10307645 | 3300025933 | Bacteria | 1380 |
| 712 | Ga0207706_10342823 | 3300025933 | Bacteria | 1300 |
| 713 | Ga0207686_10159591 | 3300025934 | Bacteria | 1579 |
| 714 | Ga0207709_10051918 | 3300025935 | Bacteria | 2515 |
| 715 | Ga0207709_10099071 | 3300025935 | Bacteria | 1923 |
| 716 | Ga0207669_10023635 | 3300025937 | Bacteria | 3288 |
| 717 | Ga0207669_10063436 | 3300025937 | Bacteria | 2281 |
| 718 | Ga0207669_10131721 | 3300025937 | Bacteria | 1719 |
| 719 | Ga0207704_10012992 | 3300025938 | Bacteria | 4151 |
| 720 | Ga0207665_10063049 | 3300025939 | Bacteria | 2516 |
| 721 | Ga0207691_10003366 | 3300025940 | Bacteria | 15559 |
| 722 | Ga0207691_10007374 | 3300025940 | Bacteria | 10598 |
| 723 | Ga0207691_10105062 | 3300025940 | Bacteria | 2516 |
| 724 | Ga0207691_10113501 | 3300025940 | Bacteria | 2408 |
| 725 | Ga0207691_10159231 | 3300025940 | Bacteria | 1982 |
| 726 | Ga0207691_10159659 | 3300025940 | Bacteria | 1978 |
| 727 | Ga0207691_10166087 | 3300025940 | Bacteria | 1934 |
| 728 | Ga0207691_10378636 | 3300025940 | Bacteria | 1208 |
| 729 | Ga0207711_10000046 | 3300025941 | Bacteria | 153238 |
| 730 | Ga0207711_10002278 | 3300025941 | Bacteria | 17229 |
| 731 | Ga0207711_10004428 | 3300025941 | Bacteria | 11971 |
| 732 | Ga0207711_10014784 | 3300025941 | Bacteria | 6486 |
| 733 | Ga0207711_10015275 | 3300025941 | Bacteria | 6374 |
| 734 | Ga0207711_10020724 | 3300025941 | Bacteria | 5486 |
| 735 | Ga0207711_10037259 | 3300025941 | Bacteria | 4129 |
| 736 | Ga0207711_10129168 | 3300025941 | Bacteria | 2264 |
| 737 | Ga0207711_10188147 | 3300025941 | Bacteria | 1880 |
| 738 | Ga0207711_10286143 | 3300025941 | Bacteria | 1519 |
| 739 | Ga0207711_10757051 | 3300025941 | Bacteria | 905 |
| 740 | Ga0207689_10013570 | 3300025942 | Bacteria | 6954 |
| 741 | Ga0207689_10031414 | 3300025942 | Bacteria | 4421 |
| 742 | Ga0207689_10071625 | 3300025942 | Bacteria | 2847 |
| 743 | Ga0207689_10094252 | 3300025942 | Bacteria | 2459 |
| 744 | Ga0207661_10011896 | 3300025944 | Bacteria | 6319 |
| 745 | Ga0207661_10022719 | 3300025944 | Bacteria | 4730 |
| 746 | Ga0207661_10237463 | 3300025944 | Bacteria | 1616 |
| 747 | Ga0207679_10002042 | 3300025945 | Bacteria | 12522 |
| 748 | Ga0207679_10006229 | 3300025945 | Bacteria | 7529 |
| 749 | Ga0207679_10019755 | 3300025945 | Bacteria | 4534 |
| 750 | Ga0207679_10021213 | 3300025945 | Bacteria | 4399 |
| 751 | Ga0207679_10022413 | 3300025945 | Bacteria | 4300 |
| 752 | Ga0207679_10025568 | 3300025945 | Bacteria | 4062 |
| 753 | Ga0207679_10051243 | 3300025945 | Bacteria | 3021 |
| 754 | Ga0207679_10055334 | 3300025945 | Bacteria | 2924 |
| 755 | Ga0207679_10065289 | 3300025945 | Bacteria | 2723 |
| 756 | Ga0207679_10322471 | 3300025945 | Bacteria | 1338 |
| 757 | Ga0207667_10000052 | 3300025949 | Bacteria | 232415 |
| 758 | Ga0207667_10013558 | 3300025949 | Bacteria | 9319 |
| 759 | Ga0207667_10086505 | 3300025949 | Bacteria | 3244 |
| 760 | Ga0207667_10107922 | 3300025949 | Bacteria | 2872 |
| 761 | Ga0207667_10147195 | 3300025949 | Bacteria | 2424 |
| 762 | Ga0207667_10149213 | 3300025949 | Bacteria | 2407 |
| 763 | Ga0207667_10160325 | 3300025949 | Bacteria | 2314 |
| 764 | Ga0207667_10164785 | 3300025949 | Bacteria | 2279 |
| 765 | Ga0207667_10435794 | 3300025949 | Bacteria | 1333 |
| 766 | Ga0207667_10698147 | 3300025949 | Bacteria | 1017 |
| 767 | Ga0207651_10001348 | 3300025960 | Bacteria | 11100 |
| 768 | Ga0207651_10005720 | 3300025960 | Bacteria | 6418 |
| 769 | Ga0207651_10008811 | 3300025960 | Bacteria | 5476 |
| 770 | Ga0207651_10039726 | 3300025960 | Bacteria | 3106 |
| 771 | Ga0207651_10044049 | 3300025960 | Bacteria | 2983 |
| 772 | Ga0207651_10068581 | 3300025960 | Bacteria | 2501 |
| 773 | Ga0207651_10073887 | 3300025960 | Bacteria | 2426 |
| 774 | Ga0207651_10081814 | 3300025960 | Bacteria | 2329 |
| 775 | Ga0207651_10086843 | 3300025960 | Bacteria | 2275 |
| 776 | Ga0207651_10287748 | 3300025960 | Bacteria | 1361 |
| 777 | Ga0207651_10485529 | 3300025960 | Bacteria | 1066 |
| 778 | Ga0207651_10565449 | 3300025960 | Bacteria | 990 |
| 779 | Ga0207712_10001687 | 3300025961 | Bacteria | 14829 |
| 780 | Ga0207712_10005663 | 3300025961 | Bacteria | 7881 |
| 781 | Ga0207712_10023425 | 3300025961 | Bacteria | 4074 |
| 782 | Ga0207668_10000489 | 3300025972 | Bacteria | 24856 |
| 783 | Ga0207668_10000769 | 3300025972 | Bacteria | 19619 |
| 784 | Ga0207640_10000749 | 3300025981 | Bacteria | 18650 |
| 785 | Ga0207640_10017661 | 3300025981 | Bacteria | 4178 |
| 786 | Ga0207640_10044357 | 3300025981 | Bacteria | 2848 |
| 787 | Ga0207640_10124367 | 3300025981 | Bacteria | 1854 |
| 788 | Ga0207640_10279654 | 3300025981 | Bacteria | 1310 |
| 789 | Ga0207658_10001284 | 3300025986 | Bacteria | 19875 |
| 790 | Ga0207658_10005468 | 3300025986 | Bacteria | 8709 |
| 791 | Ga0207658_10013090 | 3300025986 | Bacteria | 5666 |
| 792 | Ga0207658_10032364 | 3300025986 | Bacteria | 3721 |
| 793 | Ga0207658_10048208 | 3300025986 | Bacteria | 3122 |
| 794 | Ga0207658_10071300 | 3300025986 | Bacteria | 2631 |
| 795 | Ga0207658_10095960 | 3300025986 | Bacteria | 2311 |
| 796 | Ga0207658_10218468 | 3300025986 | Bacteria | 1602 |
| 797 | Ga0207658_10332911 | 3300025986 | Bacteria | 1317 |
| 798 | Ga0207658_10534207 | 3300025986 | Bacteria | 1048 |
| 799 | Ga0207658_10576435 | 3300025986 | Bacteria | 1009 |
| 800 | Ga0207677_10000110 | 3300026023 | Bacteria | 66525 |
| 801 | Ga0207677_10005322 | 3300026023 | Bacteria | 6978 |
| 802 | Ga0207677_10025231 | 3300026023 | Bacteria | 3705 |
| 803 | Ga0207677_10546040 | 3300026023 | Bacteria | 1009 |
| 804 | Ga0207703_10002629 | 3300026035 | Bacteria | 15501 |
| 805 | Ga0207703_10005579 | 3300026035 | Bacteria | 10099 |
| 806 | Ga0207703_10005684 | 3300026035 | Bacteria | 10009 |
| 807 | Ga0207703_10008355 | 3300026035 | Bacteria | 8184 |
| 808 | Ga0207703_10009045 | 3300026035 | Bacteria | 7844 |
| 809 | Ga0207703_10009335 | 3300026035 | Bacteria | 7710 |
| 810 | Ga0207703_10059553 | 3300026035 | Bacteria | 3119 |
| 811 | Ga0207703_10154464 | 3300026035 | Bacteria | 2004 |
| 812 | Ga0207703_10203154 | 3300026035 | Bacteria | 1762 |
| 813 | Ga0207703_10226456 | 3300026035 | Bacteria | 1674 |
| 814 | Ga0207703_10280919 | 3300026035 | Bacteria | 1512 |
| 815 | Ga0207639_10007752 | 3300026041 | Bacteria | 7336 |
| 816 | Ga0207639_10145570 | 3300026041 | Bacteria | 1979 |
| 817 | Ga0207678_10000587 | 3300026067 | Bacteria | 33282 |
| 818 | Ga0207678_10003028 | 3300026067 | Bacteria | 15206 |
| 819 | Ga0207678_10011154 | 3300026067 | Bacteria | 7893 |
| 820 | Ga0207678_10027601 | 3300026067 | Bacteria | 4954 |
| 821 | Ga0207678_10028649 | 3300026067 | Bacteria | 4860 |
| 822 | Ga0207678_10057595 | 3300026067 | Bacteria | 3344 |
| 823 | Ga0207678_10076951 | 3300026067 | Bacteria | 2858 |
| 824 | Ga0207678_10164585 | 3300026067 | Bacteria | 1894 |
| 825 | Ga0207678_10289862 | 3300026067 | Bacteria | 1406 |
| 826 | Ga0207678_10362601 | 3300026067 | Bacteria | 1251 |
| 827 | Ga0207678_10380004 | 3300026067 | Bacteria | 1221 |
| 828 | Ga0207702_10010616 | 3300026078 | Bacteria | 7697 |
| 829 | Ga0207702_10041239 | 3300026078 | Bacteria | 3870 |
| 830 | Ga0207702_10117122 | 3300026078 | Bacteria | 2378 |
| 831 | Ga0207702_10163328 | 3300026078 | Bacteria | 2035 |
| 832 | Ga0207702_10191976 | 3300026078 | Bacteria | 1888 |
| 833 | Ga0207641_10002509 | 3300026088 | Bacteria | 16932 |
| 834 | Ga0207641_10002980 | 3300026088 | Bacteria | 15314 |
| 835 | Ga0207641_10010032 | 3300026088 | Bacteria | 7789 |
| 836 | Ga0207641_10018279 | 3300026088 | Bacteria | 5746 |
| 837 | Ga0207641_10022810 | 3300026088 | Bacteria | 5153 |
| 838 | Ga0207641_10032834 | 3300026088 | Bacteria | 4311 |
| 839 | Ga0207641_10060259 | 3300026088 | Bacteria | 3235 |
| 840 | Ga0207641_10133163 | 3300026088 | Bacteria | 2234 |
| 841 | Ga0207641_10525760 | 3300026088 | Bacteria | 1151 |
| 842 | Ga0207648_10007028 | 3300026089 | Bacteria | 11130 |
| 843 | Ga0207648_10035272 | 3300026089 | Bacteria | 4407 |
| 844 | Ga0207648_10146565 | 3300026089 | Bacteria | 2082 |
| 845 | Ga0207648_10884343 | 3300026089 | Bacteria | 834 |
| 846 | Ga0207676_10000604 | 3300026095 | Bacteria | 29483 |
| 847 | Ga0207676_10003007 | 3300026095 | Bacteria | 12023 |
| 848 | Ga0207676_10003565 | 3300026095 | Bacteria | 10997 |
| 849 | Ga0207676_10004050 | 3300026095 | Bacteria | 10334 |
| 850 | Ga0207676_10005776 | 3300026095 | Bacteria | 8750 |
| 851 | Ga0207676_10027604 | 3300026095 | Bacteria | 4230 |
| 852 | Ga0207676_10152309 | 3300026095 | Bacteria | 1993 |
| 853 | Ga0207676_10160905 | 3300026095 | Bacteria | 1945 |
| 854 | Ga0207676_10163068 | 3300026095 | Bacteria | 1933 |
| 855 | Ga0207676_10698858 | 3300026095 | Bacteria | 982 |
| 856 | Ga0207674_10001949 | 3300026116 | Bacteria | 26188 |
| 857 | Ga0207674_10001996 | 3300026116 | Bacteria | 25880 |
| 858 | Ga0207674_10005064 | 3300026116 | Bacteria | 15730 |
| 859 | Ga0207674_10008156 | 3300026116 | Bacteria | 12145 |
| 860 | Ga0207674_10013773 | 3300026116 | Bacteria | 8949 |
| 861 | Ga0207674_10035520 | 3300026116 | Bacteria | 5201 |
| 862 | Ga0207674_10066919 | 3300026116 | Bacteria | 3618 |
| 863 | Ga0207674_10109779 | 3300026116 | Bacteria | 2734 |
| 864 | Ga0207674_10135829 | 3300026116 | Bacteria | 2421 |
| 865 | Ga0207675_100001590 | 3300026118 | Bacteria | 22733 |
| 866 | Ga0207675_100023360 | 3300026118 | Bacteria | 5750 |
| 867 | Ga0207675_100039452 | 3300026118 | Bacteria | 4407 |
| 868 | Ga0207675_100147463 | 3300026118 | Bacteria | 2238 |
| 869 | Ga0207675_100328814 | 3300026118 | Bacteria | 1494 |
| 870 | Ga0207675_100682740 | 3300026118 | Bacteria | 1035 |
| 871 | Ga0207683_10002686 | 3300026121 | Bacteria | 15540 |
| 872 | Ga0207683_10026087 | 3300026121 | Bacteria | 5045 |
| 873 | Ga0207683_10042498 | 3300026121 | Bacteria | 3970 |
| 874 | Ga0207683_10107823 | 3300026121 | Bacteria | 2492 |
| 875 | Ga0207683_10113412 | 3300026121 | Bacteria | 2428 |
| 876 | Ga0207683_10182797 | 3300026121 | Bacteria | 1901 |
| 877 | Ga0207698_10003413 | 3300026142 | Bacteria | 9561 |
| 878 | Ga0207698_10014872 | 3300026142 | Bacteria | 5190 |
| 879 | Ga0207698_10019539 | 3300026142 | Bacteria | 4641 |
| 880 | Ga0207698_10135129 | 3300026142 | Bacteria | 2115 |
| 881 | Ga0207698_10185975 | 3300026142 | Bacteria | 1845 |
| 882 | Ga0207698_10211595 | 3300026142 | Bacteria | 1745 |
| 883 | Ga0207698_10342845 | 3300026142 | Bacteria | 1408 |
| 884 | Ga0207698_10460900 | 3300026142 | Bacteria | 1229 |
| 885 | Ga0207698_10462306 | 3300026142 | Bacteria | 1227 |
| 886 | Ga0207698_10492282 | 3300026142 | Bacteria | 1191 |
| 887 | Ga0207698_10530245 | 3300026142 | Bacteria | 1151 |
| 888 | Ga0209974_10014636 | 3300027876 | Bacteria | 2608 |
| 889 | Ga0268266_10000133 | 3300028379 | Bacteria | 143210 |
| 890 | Ga0268266_10000468 | 3300028379 | Bacteria | 58386 |
| 891 | Ga0268266_10004851 | 3300028379 | Bacteria | 12769 |
| 892 | Ga0268266_10030905 | 3300028379 | Bacteria | 4548 |
| 893 | Ga0268266_10037494 | 3300028379 | Bacteria | 4129 |
| 894 | Ga0268266_10046227 | 3300028379 | Bacteria | 3727 |
| 895 | Ga0268266_10078341 | 3300028379 | Bacteria | 2875 |
| 896 | Ga0268266_10110747 | 3300028379 | Bacteria | 2432 |
| 897 | Ga0268266_10126853 | 3300028379 | Bacteria | 2278 |
| 898 | Ga0268266_10173648 | 3300028379 | Bacteria | 1957 |
| 899 | Ga0268266_10185619 | 3300028379 | Bacteria | 1896 |
| 900 | Ga0268266_10188136 | 3300028379 | Bacteria | 1884 |
| 901 | Ga0268266_10217023 | 3300028379 | Bacteria | 1756 |
| 902 | Ga0268266_10272484 | 3300028379 | Bacteria | 1571 |
| 903 | Ga0268265_10000260 | 3300028380 | Bacteria | 60001 |
| 904 | Ga0268265_10003169 | 3300028380 | Bacteria | 11962 |
| 905 | Ga0268265_10006467 | 3300028380 | Bacteria | 7942 |
| 906 | Ga0268265_10011653 | 3300028380 | Bacteria | 5946 |
| 907 | Ga0268265_10014013 | 3300028380 | Bacteria | 5461 |
| 908 | Ga0268265_10014765 | 3300028380 | Bacteria | 5329 |
| 909 | Ga0268265_10033543 | 3300028380 | Bacteria | 3733 |
| 910 | Ga0268265_10038143 | 3300028380 | Bacteria | 3532 |
| 911 | Ga0268265_10187409 | 3300028380 | Bacteria | 1783 |
| 912 | Ga0268265_10240208 | 3300028380 | Bacteria | 1598 |
| 913 | Ga0268265_10414757 | 3300028380 | Bacteria | 1248 |
| 914 | Ga0268265_10748343 | 3300028380 | Bacteria | 948 |
| 915 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 916 | Ga0268264_10000395 | 3300028381 | Bacteria | 62904 |
| 917 | Ga0268264_10001804 | 3300028381 | Bacteria | 19568 |
| 918 | Ga0268264_10002210 | 3300028381 | Bacteria | 17265 |
| 919 | Ga0268264_10042887 | 3300028381 | Bacteria | 3747 |
| 920 | Ga0268264_10123575 | 3300028381 | Bacteria | 2284 |
| 921 | Ga0268264_10131560 | 3300028381 | Bacteria | 2219 |
| 922 | Ga0265319_1028169 | 3300028563 | Bacteria | 1983 |
| 923 | Ga0307515_10038723 | 3300028794 | Bacteria | 7614 |
| 924 | Ga0307515_10201254 | 3300028794 | Bacteria | 1866 |
| 925 | Ga0265338_10037468 | 3300028800 | Bacteria | 4615 |
| 926 | Ga0307511_10002678 | 3300030521 | Bacteria | 18563 |
| 927 | Ga0316178_1048998 | 3300030735 | Bacteria | 2907 |
| 928 | Ga0316182_1079022 | 3300030745 | Bacteria | 2880 |
| 929 | Ga0265331_10003604 | 3300031250 | Bacteria | 9914 |
| 930 | Ga0265327_10000287 | 3300031251 | Bacteria | 99268 |
| 931 | Ga0265327_10001092 | 3300031251 | Bacteria | 37637 |
| 932 | Ga0265316_10022279 | 3300031344 | Bacteria | 5346 |
| 933 | Ga0307513_10003819 | 3300031456 | Bacteria | 20311 |
| 934 | Ga0307408_100040705 | 3300031548 | Bacteria | 3291 |
| 935 | Ga0307408_100052891 | 3300031548 | Bacteria | 2931 |
| 936 | Ga0307408_100323847 | 3300031548 | Bacteria | 1299 |
| 937 | Ga0307408_100340379 | 3300031548 | Bacteria | 1269 |
| 938 | Ga0307408_100439334 | 3300031548 | Bacteria | 1129 |
| 939 | Ga0307508_10080130 | 3300031616 | Bacteria | 2847 |
| 940 | Ga0316576_10141838 | 3300031727 | Bacteria | 1809 |
| 941 | Ga0307516_10045056 | 3300031730 | Bacteria | 4359 |
| 942 | Ga0307405_10013459 | 3300031731 | Bacteria | 4365 |
| 943 | Ga0307405_10022524 | 3300031731 | Bacteria | 3563 |
| 944 | Ga0307405_10033698 | 3300031731 | Bacteria | 3041 |
| 945 | Ga0307405_10062168 | 3300031731 | Bacteria | 2364 |
| 946 | Ga0307405_10110982 | 3300031731 | Bacteria | 1858 |
| 947 | Ga0307405_10149118 | 3300031731 | Bacteria | 1642 |
| 948 | Ga0307405_10443293 | 3300031731 | Bacteria | 1027 |
| 949 | Ga0307405_10631070 | 3300031731 | Bacteria | 878 |
| 950 | Ga0307413_10012378 | 3300031824 | Bacteria | 4244 |
| 951 | Ga0307413_10021556 | 3300031824 | Bacteria | 3453 |
| 952 | Ga0307413_10030086 | 3300031824 | Bacteria | 3046 |
| 953 | Ga0307413_10037137 | 3300031824 | Bacteria | 2811 |
| 954 | Ga0307413_10044674 | 3300031824 | Bacteria | 2620 |
| 955 | Ga0307413_10088134 | 3300031824 | Bacteria | 2012 |
| 956 | Ga0307413_10103733 | 3300031824 | Bacteria | 1886 |
| 957 | Ga0307413_10149629 | 3300031824 | Bacteria | 1625 |
| 958 | Ga0307413_10590832 | 3300031824 | Bacteria | 907 |
| 959 | Ga0307410_10004118 | 3300031852 | Bacteria | 7450 |
| 960 | Ga0307410_10005331 | 3300031852 | Bacteria | 6792 |
| 961 | Ga0307410_10022347 | 3300031852 | Bacteria | 3907 |
| 962 | Ga0307410_10030516 | 3300031852 | Bacteria | 3446 |
| 963 | Ga0307410_10049287 | 3300031852 | Bacteria | 2826 |
| 964 | Ga0307410_10073172 | 3300031852 | Bacteria | 2382 |
| 965 | Ga0307410_10090208 | 3300031852 | Bacteria | 2173 |
| 966 | Ga0307410_10096942 | 3300031852 | Bacteria | 2106 |
| 967 | Ga0307410_10124619 | 3300031852 | Bacteria | 1884 |
| 968 | Ga0307410_10233568 | 3300031852 | Bacteria | 1421 |
| 969 | Ga0307410_10239004 | 3300031852 | Bacteria | 1407 |
| 970 | Ga0307410_10485966 | 3300031852 | Bacteria | 1014 |
| 971 | Ga0307406_10013030 | 3300031901 | Bacteria | 4753 |
| 972 | Ga0307406_10029387 | 3300031901 | Bacteria | 3329 |
| 973 | Ga0307406_10410042 | 3300031901 | Bacteria | 1076 |
| 974 | Ga0307406_10492366 | 3300031901 | Bacteria | 992 |
| 975 | Ga0307407_10004244 | 3300031903 | Bacteria | 6050 |
| 976 | Ga0307407_10048360 | 3300031903 | Bacteria | 2420 |
| 977 | Ga0307407_10144523 | 3300031903 | Bacteria | 1538 |
| 978 | Ga0307407_10174373 | 3300031903 | Bacteria | 1419 |
| 979 | Ga0307407_10211181 | 3300031903 | Bacteria | 1307 |
| 980 | Ga0307407_10226107 | 3300031903 | Bacteria | 1268 |
| 981 | Ga0307412_10001412 | 3300031911 | Bacteria | 13375 |
| 982 | Ga0307412_10047476 | 3300031911 | Bacteria | 2821 |
| 983 | Ga0307412_10049113 | 3300031911 | Bacteria | 2779 |
| 984 | Ga0307412_10059063 | 3300031911 | Bacteria | 2568 |
| 985 | Ga0307412_10126735 | 3300031911 | Bacteria | 1848 |
| 986 | Ga0307412_10154812 | 3300031911 | Bacteria | 1696 |
| 987 | Ga0307412_10340506 | 3300031911 | Bacteria | 1200 |
| 988 | Ga0307412_10400002 | 3300031911 | Bacteria | 1118 |
| 989 | Ga0307409_100010865 | 3300031995 | Bacteria | 5697 |
| 990 | Ga0307409_100018847 | 3300031995 | Bacteria | 4655 |
| 991 | Ga0307409_100020903 | 3300031995 | Bacteria | 4474 |
| 992 | Ga0307409_100089860 | 3300031995 | Bacteria | 2512 |
| 993 | Ga0307409_100098564 | 3300031995 | Bacteria | 2417 |
| 994 | Ga0307409_100103192 | 3300031995 | Bacteria | 2371 |
| 995 | Ga0307409_100111654 | 3300031995 | Bacteria | 2293 |
| 996 | Ga0307409_100235664 | 3300031995 | Bacteria | 1662 |
| 997 | Ga0307409_100374291 | 3300031995 | Bacteria | 1351 |
| 998 | Ga0307409_100507557 | 3300031995 | Bacteria | 1175 |
| 999 | Ga0307416_100005969 | 3300032002 | Bacteria | 7568 |
| 1000 | Ga0307416_100021093 | 3300032002 | Bacteria | 4669 |
| 1001 | Ga0307416_100039417 | 3300032002 | Bacteria | 3657 |
| 1002 | Ga0307416_100071347 | 3300032002 | Bacteria | 2885 |
| 1003 | Ga0307416_100114611 | 3300032002 | Bacteria | 2385 |
| 1004 | Ga0307416_100149077 | 3300032002 | Bacteria | 2142 |
| 1005 | Ga0307416_100321736 | 3300032002 | Bacteria | 1549 |
| 1006 | Ga0307416_101055760 | 3300032002 | Bacteria | 916 |
| 1007 | Ga0307414_10002011 | 3300032004 | Bacteria | 10559 |
| 1008 | Ga0307414_10005482 | 3300032004 | Bacteria | 6991 |
| 1009 | Ga0307414_10011191 | 3300032004 | Bacteria | 5250 |
| 1010 | Ga0307414_10014217 | 3300032004 | Bacteria | 4763 |
| 1011 | Ga0307414_10018323 | 3300032004 | Bacteria | 4307 |
| 1012 | Ga0307414_10037422 | 3300032004 | Bacteria | 3249 |
| 1013 | Ga0307414_10065339 | 3300032004 | Bacteria | 2595 |
| 1014 | Ga0307414_10130317 | 3300032004 | Bacteria | 1951 |
| 1015 | Ga0307414_10303565 | 3300032004 | Bacteria | 1351 |
| 1016 | Ga0307414_10336066 | 3300032004 | Bacteria | 1291 |
| 1017 | Ga0307414_10532293 | 3300032004 | Bacteria | 1044 |
| 1018 | Ga0307411_10009114 | 3300032005 | Bacteria | 5194 |
| 1019 | Ga0307411_10017646 | 3300032005 | Bacteria | 4074 |
| 1020 | Ga0307411_10032330 | 3300032005 | Bacteria | 3231 |
| 1021 | Ga0307411_10037964 | 3300032005 | Bacteria | 3034 |
| 1022 | Ga0307411_10038968 | 3300032005 | Bacteria | 3003 |
| 1023 | Ga0307411_10100399 | 3300032005 | Bacteria | 2045 |
| 1024 | Ga0307411_10106201 | 3300032005 | Bacteria | 1998 |
| 1025 | Ga0307415_100001168 | 3300032126 | Bacteria | 12279 |
| 1026 | Ga0307415_100015982 | 3300032126 | Bacteria | 4459 |
| 1027 | Ga0307415_100021846 | 3300032126 | Bacteria | 3941 |
| 1028 | Ga0307415_100024978 | 3300032126 | Bacteria | 3742 |
| 1029 | Ga0307415_100027584 | 3300032126 | Bacteria | 3600 |
| 1030 | Ga0307415_100058956 | 3300032126 | Bacteria | 2645 |
| 1031 | Ga0307415_100062766 | 3300032126 | Bacteria | 2578 |
| 1032 | Ga0307415_100072011 | 3300032126 | Bacteria | 2432 |
| 1033 | Ga0307415_100283126 | 3300032126 | Bacteria | 1364 |
| 1034 | Ga0307415_100313059 | 3300032126 | Bacteria | 1305 |
| 1035 | Ga0307415_100321418 | 3300032126 | Bacteria | 1290 |
| 1036 | Ga0307415_100369077 | 3300032126 | Bacteria | 1215 |
| 1037 | Ga0307415_100385423 | 3300032126 | Bacteria | 1192 |
| 1038 | Ga0316583_10016259 | 3300032133 | Bacteria | 2678 |
| 1039 | Ga0307510_10004465 | 3300033180 | Bacteria | 16455 |
| 1040 | Ga0307510_10120251 | 3300033180 | Bacteria | 2334 |
| 1041 | Ga0316592_1041731 | 3300033524 | Bacteria | 1016 |
| 1042 | Ga0316586_1037026 | 3300033527 | Bacteria | 849 |
| 1043 | Ga0316596_1060658 | 3300033541 | Bacteria | 1009 |
| 1044 | Ga0373949_0034715 | 3300035090 | Bacteria | 1217 |
| 1045 | Ga0373923_0021988 | 3300035111 | Bacteria | 2496 |
| 1046 | Ga0373939_0101958 | 3300035114 | Bacteria | 986 |
| 1047 | Ga0373955_0000253 | 3300035172 | Bacteria | 22174 |
| 1048 | Ga0316574_0025244 | 3300035398 | Bacteria | 3565 |
| 1049 | Ga0373931_0148998 | 3300035691 | Bacteria | 1362 |
| 1050 | Ga0373935_0027403 | 3300035692 | Bacteria | 3521 |
| 1051 | Ga0373927_0072570 | 3300035695 | Bacteria | 2228 |
| 1052 | Ga0373927_0136311 | 3300035695 | Bacteria | 1604 |
| 1053 | Ga0373933_0042508 | 3300035724 | Bacteria | 2687 |
| 1054 | Ga0373947_0020121 | 3300035725 | Bacteria | 3852 |
| 1055 | Ga0373937_0001410 | 3300036401 | Bacteria | 20068 |
| 1056 | Ga0316582_0037263 | 3300036647 | Bacteria | 3014 |
| 1057 | Ga0316582_0455677 | 3300036647 | Bacteria | 882 |
| 1058 | Ga0316584_0012541 | 3300036712 | Bacteria | 5980 |
| 1059 | Ga0316584_0017465 | 3300036712 | Bacteria | 5159 |
| 1060 | Ga0316584_0124217 | 3300036712 | Bacteria | 1928 |
| 1061 | Ga0395899_0002102 | 3300037312 | Bacteria | 16360 |
| 1062 | Ga0395899_0013169 | 3300037312 | Bacteria | 6325 |
| 1063 | Ga0395899_0030776 | 3300037312 | Bacteria | 4035 |
| 1064 | Ga0395899_0043881 | 3300037312 | Bacteria | 3333 |
| 1065 | Ga0395899_0065937 | 3300037312 | Bacteria | 2660 |
| 1066 | Ga0395899_0075676 | 3300037312 | Bacteria | 2458 |
| 1067 | Ga0395899_0078721 | 3300037312 | Bacteria | 2402 |
| 1068 | Ga0395899_0122288 | 3300037312 | Bacteria | 1863 |
| 1069 | Ga0395899_0207973 | 3300037312 | Bacteria | 1361 |
| 1070 | Ga0395900_0001365 | 3300037418 | Bacteria | 29397 |
| 1071 | Ga0395900_0007243 | 3300037418 | Bacteria | 11487 |
| 1072 | Ga0395900_0014084 | 3300037418 | Bacteria | 8164 |
| 1073 | Ga0395900_0020186 | 3300037418 | Bacteria | 6798 |
| 1074 | Ga0395900_0021692 | 3300037418 | Bacteria | 6566 |
| 1075 | Ga0395900_0031168 | 3300037418 | Bacteria | 5476 |
| 1076 | Ga0395900_0032675 | 3300037418 | Bacteria | 5351 |
| 1077 | Ga0395900_0033698 | 3300037418 | Bacteria | 5270 |
| 1078 | Ga0395900_0042491 | 3300037418 | Bacteria | 4684 |
| 1079 | Ga0395900_0042726 | 3300037418 | Bacteria | 4670 |
| 1080 | Ga0395900_0047189 | 3300037418 | Bacteria | 4435 |
| 1081 | Ga0395900_0054412 | 3300037418 | Bacteria | 4121 |
| 1082 | Ga0395900_0071338 | 3300037418 | Bacteria | 3571 |
| 1083 | Ga0395900_0087392 | 3300037418 | Bacteria | 3204 |
| 1084 | Ga0395900_0094563 | 3300037418 | Bacteria | 3070 |
| 1085 | Ga0395900_0164235 | 3300037418 | Bacteria | 2264 |
| 1086 | Ga0395900_0178521 | 3300037418 | Bacteria | 2159 |
| 1087 | Ga0395900_0182009 | 3300037418 | Bacteria | 2135 |
| 1088 | Ga0395900_0206212 | 3300037418 | Bacteria | 1987 |
| 1089 | Ga0395900_0302652 | 3300037418 | Bacteria | 1585 |
| 1090 | Ga0395900_0483497 | 3300037418 | Bacteria | 1190 |
| 1091 | Ga0395900_0902591 | 3300037418 | Bacteria | 807 |
| 1092 | Ga0395898_0028102 | 3300037466 | Bacteria | 5640 |
| 1093 | Ga0395898_0057860 | 3300037466 | Bacteria | 3776 |
| 1094 | Ga0395898_0060891 | 3300037466 | Bacteria | 3667 |
| 1095 | Ga0395898_0085638 | 3300037466 | Bacteria | 3037 |
| 1096 | Ga0395898_0177417 | 3300037466 | Bacteria | 2036 |
| 1097 | Ga0395898_0195749 | 3300037466 | Bacteria | 1931 |
| 1098 | Ga0395898_0243248 | 3300037466 | Bacteria | 1716 |
| 1099 | Ga0395898_0316929 | 3300037466 | Bacteria | 1488 |
| 1100 | Ga0395898_0334837 | 3300037466 | Bacteria | 1443 |
| 1101 | Ga0395905_0000193 | 3300037471 | Bacteria | 96667 |
| 1102 | Ga0395905_0001786 | 3300037471 | Bacteria | 24960 |
| 1103 | Ga0395905_0003261 | 3300037471 | Bacteria | 17446 |
| 1104 | Ga0395905_0003299 | 3300037471 | Bacteria | 17323 |
| 1105 | Ga0395905_0004799 | 3300037471 | Bacteria | 13960 |
| 1106 | Ga0395905_0009715 | 3300037471 | Bacteria | 9387 |
| 1107 | Ga0395905_0012830 | 3300037471 | Bacteria | 8057 |
| 1108 | Ga0395905_0027620 | 3300037471 | Bacteria | 5351 |
| 1109 | Ga0395905_0029464 | 3300037471 | Bacteria | 5171 |
| 1110 | Ga0395905_0031843 | 3300037471 | Bacteria | 4962 |
| 1111 | Ga0395905_0034174 | 3300037471 | Bacteria | 4773 |
| 1112 | Ga0395905_0034645 | 3300037471 | Bacteria | 4742 |
| 1113 | Ga0395905_0049371 | 3300037471 | Bacteria | 3943 |
| 1114 | Ga0395905_0056070 | 3300037471 | Bacteria | 3688 |
| 1115 | Ga0395905_0068125 | 3300037471 | Bacteria | 3334 |
| 1116 | Ga0395905_0077510 | 3300037471 | Bacteria | 3114 |
| 1117 | Ga0395905_0081154 | 3300037471 | Bacteria | 3039 |
| 1118 | Ga0395905_0084359 | 3300037471 | Bacteria | 2976 |
| 1119 | Ga0395905_0129719 | 3300037471 | Bacteria | 2371 |
| 1120 | Ga0395905_0138377 | 3300037471 | Bacteria | 2291 |
| 1121 | Ga0395905_0147675 | 3300037471 | Bacteria | 2212 |
| 1122 | Ga0395905_0268181 | 3300037471 | Bacteria | 1593 |
| 1123 | Ga0395905_0298285 | 3300037471 | Bacteria | 1499 |
| 1124 | Ga0395905_0329355 | 3300037471 | Bacteria | 1417 |
| 1125 | Ga0395905_0337314 | 3300037471 | Bacteria | 1398 |
| 1126 | Ga0395905_0340473 | 3300037471 | Bacteria | 1391 |
| 1127 | Ga0395905_0430943 | 3300037471 | Bacteria | 1215 |
| 1128 | Ga0395905_0536765 | 3300037471 | Bacteria | 1070 |
| 1129 | Ga0436364_0017202 | 3300037853 | Bacteria | 10673 |
| 1130 | Ga0436364_0063093 | 3300037853 | Bacteria | 1134 |
| 1131 | Ga0436364_0090132 | 3300037853 | Bacteria | 1486 |
| 1132 | Ga0436364_1395218 | 3300037853 | Bacteria | 11283 |
| 1133 | Ga0395901_0000934 | 3300038443 | Bacteria | 31772 |
| 1134 | Ga0395901_0001501 | 3300038443 | Bacteria | 24244 |
| 1135 | Ga0395901_0006612 | 3300038443 | Bacteria | 11715 |
| 1136 | Ga0395901_0011981 | 3300038443 | Bacteria | 8796 |
| 1137 | Ga0395901_0016705 | 3300038443 | Bacteria | 7478 |
| 1138 | Ga0395901_0021798 | 3300038443 | Bacteria | 6566 |
| 1139 | Ga0395901_0025716 | 3300038443 | Bacteria | 6043 |
| 1140 | Ga0395901_0038482 | 3300038443 | Bacteria | 4947 |
| 1141 | Ga0395901_0042089 | 3300038443 | Bacteria | 4735 |
| 1142 | Ga0395901_0043523 | 3300038443 | Bacteria | 4657 |
| 1143 | Ga0395901_0085298 | 3300038443 | Bacteria | 3301 |
| 1144 | Ga0395901_0091651 | 3300038443 | Bacteria | 3181 |
| 1145 | Ga0395901_0191869 | 3300038443 | Bacteria | 2142 |
| 1146 | Ga0395901_0364420 | 3300038443 | Bacteria | 1490 |
| 1147 | Ga0395901_0380430 | 3300038443 | Bacteria | 1453 |
| 1148 | Ga0395901_0409318 | 3300038443 | Bacteria | 1393 |
| 1149 | Ga0395901_0459791 | 3300038443 | Bacteria | 1301 |
| 1150 | Ga0395901_0999777 | 3300038443 | Bacteria | 812 |
| 1151 | Ga0400489_52975 | 3300039093 | Bacteria | 1577 |
| 1152 | Ga0436365_0103782 | 3300039437 | Bacteria | 2936 |
| 1153 | Ga0436365_0284985 | 3300039437 | Bacteria | 1199 |
| 1154 | Ga0436365_0833878 | 3300039437 | Bacteria | 37717 |
| 1155 | Ga0436365_0984498 | 3300039437 | Bacteria | 18563 |
| 1156 | Ga0436365_1132330 | 3300039437 | Bacteria | 76795 |
| 1157 | Ga0436365_1201209 | 3300039437 | Bacteria | 12682 |
| 1158 | Ga0436365_1508968 | 3300039437 | Bacteria | 1685 |
| 1159 | Ga0436365_1650855 | 3300039437 | Bacteria | 128546 |
| 1160 | Ga0436360_0076173 | 3300039438 | Bacteria | 2995 |
| 1161 | Ga0436360_1171319 | 3300039438 | Bacteria | 1218 |
| 1162 | Ga0436361_0675132 | 3300039447 | Bacteria | 5477 |
| 1163 | Ga0436363_0142313 | 3300039450 | Bacteria | 1175 |
| 1164 | Ga0436363_0551063 | 3300039450 | Bacteria | 1818 |
| 1165 | Ga0436363_0983416 | 3300039450 | Bacteria | 14608 |
| 1166 | Ga0436363_1540769 | 3300039450 | Bacteria | 7722 |
| 1167 | Ga0436362_0284509 | 3300039453 | Bacteria | 45469 |
| 1168 | Ga0436362_1269102 | 3300039453 | Bacteria | 2926 |
| 1169 | Ga0439465_0142098 | 3300041413 | Bacteria | 853 |
| 1170 | Ga0439431_0032534 | 3300041997 | Bacteria | 1301 |
| 1171 | Ga0439445_0012379 | 3300042004 | Bacteria | 2049 |
| 1172 | Ga0439448_0005347 | 3300042005 | Bacteria | 3660 |
| 1173 | Ga0439448_0028107 | 3300042005 | Bacteria | 1774 |
| 1174 | Ga0439432_035378 | 3300042006 | Bacteria | 1600 |
| 1175 | Ga0439432_086450 | 3300042006 | Bacteria | 946 |
| 1176 | Ga0439449_0110082 | 3300042007 | Bacteria | 1020 |
| 1177 | Ga0439455_0001446 | 3300042012 | Bacteria | 3974 |
| 1178 | Ga0439462_0038210 | 3300042015 | Bacteria | 1280 |
| 1179 | Ga0439446_0001493 | 3300042156 | Bacteria | 5349 |
| 1180 | Ga0439446_0103679 | 3300042156 | Bacteria | 902 |
| 1181 | Ga0439458_0000158 | 3300042157 | Bacteria | 14998 |
| 1182 | Ga0439435_0001209 | 3300042436 | Bacteria | 4665 |
| 1183 | Ga0439459_0005999 | 3300042438 | Bacteria | 2014 |
| 1184 | Ga0439464_0032379 | 3300042439 | Bacteria | 1469 |
| 1185 | Ga0450901_006714 | 3300042533 | Bacteria | 1185 |
| 1186 | Ga0466969_0035161 | 3300044656 | Bacteria | 2535 |
| 1187 | Ga0466965_0108554 | 3300044683 | Bacteria | 1425 |
| 1188 | Ga0466963_0000501 | 3300044694 | Bacteria | 18241 |
| 1189 | Ga0466963_0011908 | 3300044694 | Bacteria | 5311 |
| 1190 | Ga0466963_0013247 | 3300044694 | Bacteria | 5061 |
| 1191 | Ga0466963_0018123 | 3300044694 | Bacteria | 4396 |
| 1192 | Ga0466963_0047776 | 3300044694 | Bacteria | 2826 |
| 1193 | Ga0466963_0062418 | 3300044694 | Bacteria | 2492 |
| 1194 | Ga0466963_0150112 | 3300044694 | Bacteria | 1618 |
| 1195 | Ga0466963_0553476 | 3300044694 | Bacteria | 812 |
| 1196 | Ga0466964_0007276 | 3300044706 | Bacteria | 4139 |
| 1197 | Ga0466964_0160003 | 3300044706 | Bacteria | 1051 |
| 1198 | Ga0466964_0262696 | 3300044706 | Bacteria | 856 |
| 1199 | Ga0466957_0000802 | 3300044842 | Bacteria | 16030 |
| 1200 | Ga0466957_0013729 | 3300044842 | Bacteria | 4704 |
| 1201 | Ga0466957_0030914 | 3300044842 | Bacteria | 3198 |
| 1202 | Ga0466957_0381626 | 3300044842 | Bacteria | 961 |
| 1203 | Ga0466960_0154608 | 3300044901 | Bacteria | 1228 |
| 1204 | Ga0466959_0013649 | 3300045049 | Bacteria | 5893 |
| 1205 | Ga0466958_0013632 | 3300045836 | Bacteria | 4632 |
| 1206 | Ga0466958_0020502 | 3300045836 | Bacteria | 3856 |
| 1207 | Ga0466958_0288674 | 3300045836 | Bacteria | 1052 |
| 1208 | Ga0466967_0000024 | 3300045976 | Bacteria | 71156 |
| 1209 | Ga0466967_0002769 | 3300045976 | Bacteria | 11099 |
| 1210 | Ga0466967_0015588 | 3300045976 | Bacteria | 5960 |
| 1211 | Ga0466967_0046896 | 3300045976 | Bacteria | 3765 |
| 1212 | Ga0466967_0077387 | 3300045976 | Bacteria | 2994 |
| 1213 | Ga0466967_0100109 | 3300045976 | Bacteria | 2648 |
| 1214 | Ga0466967_0111750 | 3300045976 | Bacteria | 2511 |
| 1215 | Ga0466967_0187525 | 3300045976 | Bacteria | 1953 |
| 1216 | Ga0466967_0194427 | 3300045976 | Bacteria | 1919 |
| 1217 | Ga0466967_0358664 | 3300045976 | Bacteria | 1412 |
| 1218 | Ga0466967_0604378 | 3300045976 | Bacteria | 1083 |
| 1219 | Ga0495627_000513 | 3300046453 | Bacteria | 32122 |
| 1220 | Ga0495592_0150922 | 3300046454 | Bacteria | 1607 |
| 1221 | Ga0495590_0000309 | 3300046457 | Bacteria | 25577 |
| 1222 | Ga0495638_0000230 | 3300046460 | Bacteria | 76565 |
| 1223 | Ga0495638_0000782 | 3300046460 | Bacteria | 33588 |
| 1224 | Ga0495638_0006940 | 3300046460 | Bacteria | 8172 |
| 1225 | Ga0495638_0010430 | 3300046460 | Bacteria | 6453 |
| 1226 | Ga0495638_0010791 | 3300046460 | Bacteria | 6319 |
| 1227 | Ga0495651_0232429 | 3300046462 | Bacteria | 1269 |
| 1228 | Ga0495650_0000207 | 3300046471 | Bacteria | 127568 |
| 1229 | Ga0495585_0116160 | 3300046492 | Bacteria | 1419 |
| 1230 | Ga0495583_0000399 | 3300046506 | Bacteria | 66020 |
| 1231 | Ga0495606_0000235 | 3300046507 | Bacteria | 98069 |
| 1232 | Ga0495606_0019418 | 3300046507 | Bacteria | 5058 |
| 1233 | Ga0495606_0158771 | 3300046507 | Bacteria | 1321 |
| 1234 | Ga0495608_0180336 | 3300046511 | Bacteria | 1336 |
| 1235 | Ga0495610_0003520 | 3300046512 | Bacteria | 12142 |
| 1236 | Ga0495616_0001022 | 3300046513 | Bacteria | 20016 |
| 1237 | Ga0495631_0003193 | 3300046518 | Bacteria | 9024 |
| 1238 | Ga0495637_0017854 | 3300046520 | Bacteria | 3298 |
| 1239 | Ga0495637_0027794 | 3300046520 | Bacteria | 2527 |
| 1240 | Ga0495648_0001057 | 3300046524 | Bacteria | 27927 |
| 1241 | Ga0495648_0116952 | 3300046524 | Bacteria | 1440 |
| 1242 | Ga0495663_0028746 | 3300046525 | Bacteria | 1638 |
| 1243 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 1244 | Ga0495587_0051650 | 3300046536 | Bacteria | 2429 |
| 1245 | Ga0495587_0124576 | 3300046536 | Bacteria | 1475 |
| 1246 | Ga0495598_0000857 | 3300046537 | Bacteria | 5849 |
| 1247 | Ga0495609_0023724 | 3300046538 | Bacteria | 2817 |
| 1248 | Ga0495621_0000049 | 3300046539 | Bacteria | 23603 |
| 1249 | Ga0495621_0088369 | 3300046539 | Bacteria | 1165 |
| 1250 | Ga0495633_0065016 | 3300046558 | Bacteria | 1705 |
| 1251 | Ga0495668_0017135 | 3300046616 | Bacteria | 4207 |
| 1252 | Ga0495625_0005971 | 3300046660 | Bacteria | 10945 |
| 1253 | Ga0495635_0192347 | 3300046663 | Bacteria | 1385 |
| 1254 | Ga0495669_0000006 | 3300046684 | Bacteria | 190838 |
| 1255 | Ga0495669_0000398 | 3300046684 | Bacteria | 21390 |
| 1256 | Ga0495669_0005037 | 3300046684 | Bacteria | 5494 |
| 1257 | Ga0495669_0007319 | 3300046684 | Bacteria | 4624 |
| 1258 | Ga0495669_0013960 | 3300046684 | Bacteria | 3429 |
| 1259 | Ga0495669_0188377 | 3300046684 | Bacteria | 984 |
| 1260 | Ga0495613_0000590 | 3300046689 | Bacteria | 29335 |
| 1261 | Ga0495670_0000265 | 3300046691 | Bacteria | 24414 |
| 1262 | Ga0495660_0268352 | 3300046810 | Bacteria | 785 |
| 1263 | Ga0495636_0153802 | 3300047318 | Bacteria | 1033 |
| 1264 | Ga0495672_0002013 | 3300047320 | Bacteria | 19166 |
| 1265 | Ga0495672_0052103 | 3300047320 | Bacteria | 2406 |
| 1266 | Ga0495680_0380985 | 3300047322 | Bacteria | 977 |
| 1267 | Ga0495677_0059853 | 3300047445 | Bacteria | 1411 |
| 1268 | Ga0495677_0112864 | 3300047445 | Bacteria | 1034 |
| 1269 | Ga0495685_091204 | 3300047447 | Bacteria | 1010 |
| 1270 | Ga0495685_092571 | 3300047447 | Bacteria | 1001 |
| 1271 | Ga0495673_0000223 | 3300047469 | Bacteria | 84150 |
| 1272 | Ga0495673_0000289 | 3300047469 | Bacteria | 67437 |
| 1273 | Ga0495681_0041632 | 3300047470 | Bacteria | 2229 |
| 1274 | Ga0495686_0000173 | 3300047472 | Bacteria | 122787 |
| 1275 | Ga0495686_0000302 | 3300047472 | Bacteria | 84826 |
| 1276 | Ga0495686_0001197 | 3300047472 | Bacteria | 29986 |
| 1277 | Ga0495686_0005206 | 3300047472 | Bacteria | 10346 |
| 1278 | Ga0495686_0009790 | 3300047472 | Bacteria | 6878 |
| 1279 | Ga0496100_0045726 | 3300048903 | Bacteria | 2811 |
| 1280 | Ga0496100_0110933 | 3300048903 | Bacteria | 1905 |
| 1281 | Ga0496100_0509314 | 3300048903 | Bacteria | 928 |
| 1282 | Ga0496101_0081333 | 3300048904 | Bacteria | 2395 |
| 1283 | Ga0496101_0135091 | 3300048904 | Bacteria | 1876 |
| 1284 | Ga0496101_0159463 | 3300048904 | Bacteria | 1730 |
| 1285 | Ga0496101_0314019 | 3300048904 | Bacteria | 1229 |
| 1286 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 1287 | Ga0496102_0043292 | 3300048905 | Bacteria | 4082 |
| 1288 | Ga0496102_0060888 | 3300048905 | Bacteria | 3454 |
| 1289 | Ga0496102_0094769 | 3300048905 | Bacteria | 2766 |
| 1290 | Ga0496102_0142838 | 3300048905 | Bacteria | 2245 |
| 1291 | Ga0496102_0186159 | 3300048905 | Bacteria | 1957 |
| 1292 | Ga0496102_0561976 | 3300048905 | Bacteria | 1064 |
| 1293 | Ga0496103_0000133 | 3300048906 | Bacteria | 78740 |
| 1294 | Ga0496103_0010883 | 3300048906 | Bacteria | 5383 |
| 1295 | Ga0496104_0341073 | 3300048907 | Bacteria | 1411 |
| 1296 | Ga0496104_0689853 | 3300048907 | Bacteria | 929 |
| 1297 | Ga0496105_0188569 | 3300048908 | Bacteria | 1687 |
| 1298 | Ga0496106_0003227 | 3300048909 | Bacteria | 12209 |
| 1299 | Ga0496106_0038710 | 3300048909 | Bacteria | 3570 |
| 1300 | Ga0496106_0139118 | 3300048909 | Bacteria | 1909 |
| 1301 | Ga0496107_0000029 | 3300048910 | Bacteria | 102345 |
| 1302 | Ga0496107_0006522 | 3300048910 | Bacteria | 8028 |
| 1303 | Ga0496107_0007192 | 3300048910 | Bacteria | 7667 |
| 1304 | Ga0496107_0035157 | 3300048910 | Bacteria | 3592 |
| 1305 | Ga0496107_0074657 | 3300048910 | Bacteria | 2467 |
| 1306 | Ga0496107_0089908 | 3300048910 | Bacteria | 2243 |
| 1307 | Ga0496108_0006530 | 3300048911 | Bacteria | 9457 |
| 1308 | Ga0496108_0008130 | 3300048911 | Bacteria | 8506 |
| 1309 | Ga0496108_0008556 | 3300048911 | Bacteria | 8300 |
| 1310 | Ga0496108_0134690 | 3300048911 | Bacteria | 2124 |
| 1311 | Ga0496108_0160410 | 3300048911 | Bacteria | 1943 |
| 1312 | Ga0496109_0004600 | 3300048912 | Bacteria | 11514 |
| 1313 | Ga0496109_0021876 | 3300048912 | Bacteria | 5660 |
| 1314 | Ga0496109_0064963 | 3300048912 | Bacteria | 3340 |
| 1315 | Ga0496109_0082404 | 3300048912 | Bacteria | 2964 |
| 1316 | Ga0496109_0103556 | 3300048912 | Bacteria | 2642 |
| 1317 | Ga0496109_0123626 | 3300048912 | Bacteria | 2412 |
| 1318 | Ga0496109_0444530 | 3300048912 | Bacteria | 1225 |
| 1319 | Ga0496110_0006236 | 3300048913 | Bacteria | 9401 |
| 1320 | Ga0496110_0020235 | 3300048913 | Bacteria | 5616 |
| 1321 | Ga0496110_0096382 | 3300048913 | Bacteria | 2651 |
| 1322 | Ga0496110_0433396 | 3300048913 | Bacteria | 1198 |
| 1323 | Ga0496110_0611554 | 3300048913 | Bacteria | 988 |
| 1324 | Ga0496111_0023348 | 3300048914 | Bacteria | 4340 |
| 1325 | Ga0496111_0027139 | 3300048914 | Bacteria | 4048 |
| 1326 | Ga0496111_0451894 | 3300048914 | Bacteria | 948 |
| 1327 | Ga0496112_0000530 | 3300048915 | Bacteria | 26090 |
| 1328 | Ga0496112_0014138 | 3300048915 | Bacteria | 7393 |
| 1329 | Ga0496112_0227574 | 3300048915 | Bacteria | 1820 |
| 1330 | Ga0496112_0239270 | 3300048915 | Bacteria | 1768 |
| 1331 | Ga0496112_0477867 | 3300048915 | Bacteria | 1183 |
| 1332 | Ga0496113_0032649 | 3300048916 | Bacteria | 3783 |
| 1333 | Ga0496113_0040762 | 3300048916 | Bacteria | 3423 |
| 1334 | Ga0496113_0125824 | 3300048916 | Bacteria | 2007 |
| 1335 | Ga0496113_0433730 | 3300048916 | Bacteria | 1056 |
| 1336 | Ga0496114_0006408 | 3300048917 | Bacteria | 9269 |
| 1337 | Ga0496114_0051260 | 3300048917 | Bacteria | 3436 |
| 1338 | Ga0496114_0319928 | 3300048917 | Bacteria | 1371 |
| 1339 | Ga0496115_0053223 | 3300048918 | Bacteria | 3248 |
| 1340 | Ga0496115_0232389 | 3300048918 | Bacteria | 1520 |
| 1341 | Ga0496115_0249675 | 3300048918 | Bacteria | 1461 |
| 1342 | Ga0496116_0000682 | 3300048919 | Bacteria | 44118 |
| 1343 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 1344 | Ga0496117_0025476 | 3300048920 | Bacteria | 4650 |
| 1345 | Ga0496117_0041931 | 3300048920 | Bacteria | 3346 |
| 1346 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 1347 | Ga0496118_0000525 | 3300048921 | Bacteria | 62968 |
| 1348 | Ga0496118_0043175 | 3300048921 | Bacteria | 3548 |
| 1349 | Ga0496120_0187970 | 3300048923 | Bacteria | 1009 |
| 1350 | Ga0496121_0000066 | 3300048924 | Bacteria | 267065 |
| 1351 | Ga0496121_0006516 | 3300048924 | Bacteria | 14437 |
| 1352 | Ga0496121_0011567 | 3300048924 | Bacteria | 9774 |
| 1353 | Ga0496121_0401820 | 3300048924 | Bacteria | 897 |
| 1354 | Ga0496123_0068947 | 3300048926 | Bacteria | 2224 |
| 1355 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 1356 | Ga0496124_0087875 | 3300048927 | Bacteria | 2542 |
| 1357 | Ga0495678_000773 | 3300049459 | Bacteria | 28865 |
| 1358 | Ga0495682_0000658 | 3300049460 | Bacteria | 22982 |
| 1359 | Ga0501031_0036865 | 3300049568 | Bacteria | 3190 |
| 1360 | Ga0501032_0008554 | 3300049569 | Bacteria | 7465 |
| 1361 | Ga0501032_0009632 | 3300049569 | Bacteria | 6999 |
| 1362 | Ga0501032_0170923 | 3300049569 | Bacteria | 1425 |
| 1363 | Ga0501032_0360545 | 3300049569 | Bacteria | 936 |
| 1364 | Ga0501033_0004236 | 3300049570 | Bacteria | 11540 |
| 1365 | Ga0501033_0005853 | 3300049570 | Bacteria | 9663 |
| 1366 | Ga0501033_0253042 | 3300049570 | Bacteria | 1248 |
| 1367 | Ga0501034_0002130 | 3300049571 | Bacteria | 24593 |
| 1368 | Ga0501034_0005232 | 3300049571 | Bacteria | 14237 |
| 1369 | Ga0501034_0032948 | 3300049571 | Bacteria | 5261 |
| 1370 | Ga0501034_0169748 | 3300049571 | Bacteria | 2149 |
| 1371 | Ga0501036_0011308 | 3300049572 | Bacteria | 7384 |
| 1372 | Ga0501036_0029813 | 3300049572 | Bacteria | 4610 |
| 1373 | Ga0501037_0014252 | 3300049573 | Bacteria | 5857 |
| 1374 | Ga0501037_0016778 | 3300049573 | Bacteria | 5387 |
| 1375 | Ga0501037_0145967 | 3300049573 | Bacteria | 1692 |
| 1376 | Ga0501038_0028740 | 3300049574 | Bacteria | 4937 |
| 1377 | Ga0501038_0032796 | 3300049574 | Bacteria | 4578 |
| 1378 | Ga0501039_0003743 | 3300049575 | Bacteria | 11433 |
| 1379 | Ga0501043_0013446 | 3300049579 | Bacteria | 6401 |
| 1380 | Ga0501043_0024575 | 3300049579 | Bacteria | 4728 |
| 1381 | Ga0501043_0116693 | 3300049579 | Bacteria | 2094 |
| 1382 | Ga0501046_0002274 | 3300049580 | Bacteria | 18108 |
| 1383 | Ga0501046_0008229 | 3300049580 | Bacteria | 9107 |
| 1384 | Ga0501047_0112775 | 3300049581 | Bacteria | 2601 |
| 1385 | Ga0501047_0126532 | 3300049581 | Bacteria | 2436 |
| 1386 | Ga0501047_0282973 | 3300049581 | Bacteria | 1502 |
| 1387 | Ga0501047_0408262 | 3300049581 | Bacteria | 1191 |
| 1388 | Ga0501048_0013582 | 3300049582 | Bacteria | 6043 |
| 1389 | Ga0501067_0000644 | 3300049583 | Bacteria | 18750 |
| 1390 | Ga0501067_0014831 | 3300049583 | Bacteria | 4312 |
| 1391 | Ga0501067_0042411 | 3300049583 | Bacteria | 2526 |
| 1392 | Ga0501068_0227725 | 3300049584 | Bacteria | 1185 |
| 1393 | Ga0501069_0032248 | 3300049585 | Bacteria | 2883 |
| 1394 | Ga0501070_0005951 | 3300049586 | Bacteria | 10395 |
| 1395 | Ga0501070_0018814 | 3300049586 | Bacteria | 5794 |
| 1396 | Ga0501070_0020265 | 3300049586 | Bacteria | 5578 |
| 1397 | Ga0501070_0227898 | 3300049586 | Bacteria | 1527 |
| 1398 | Ga0501072_0069426 | 3300049588 | Bacteria | 2783 |
| 1399 | Ga0501073_0008900 | 3300049589 | Bacteria | 7420 |
| 1400 | Ga0501073_0030538 | 3300049589 | Bacteria | 3847 |
| 1401 | Ga0501074_0000896 | 3300049590 | Bacteria | 19028 |
| 1402 | Ga0501074_0032006 | 3300049590 | Bacteria | 3812 |
| 1403 | Ga0501074_0079037 | 3300049590 | Bacteria | 2360 |
| 1404 | Ga0501074_0242197 | 3300049590 | Bacteria | 1283 |
| 1405 | Ga0501209_015118 | 3300049656 | Bacteria | 1713 |
| 1406 | Ga0501217_053211 | 3300049661 | Bacteria | 1064 |
| 1407 | Ga0501223_001035 | 3300049663 | Bacteria | 6564 |
| 1408 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 1409 | Ga0501235_010652 | 3300049669 | Bacteria | 2009 |
| 1410 | Ga0501238_003510 | 3300049671 | Bacteria | 1930 |
| 1411 | Ga0501238_043476 | 3300049671 | Bacteria | 664 |
| 1412 | Ga0501253_018228 | 3300049683 | Bacteria | 1195 |
| 1413 | Ga0501225_0001850 | 3300049705 | Bacteria | 6639 |
| 1414 | Ga0501234_002566 | 3300049707 | Bacteria | 2859 |
| 1415 | Ga0501080_0105632 | 3300049742 | Bacteria | 2611 |
| 1416 | Ga0501080_0129778 | 3300049742 | Bacteria | 2333 |
| 1417 | Ga0501083_0008289 | 3300049744 | Bacteria | 7350 |
| 1418 | Ga0501083_0022513 | 3300049744 | Bacteria | 4372 |
| 1419 | Ga0501270_017546 | 3300049767 | Bacteria | 1049 |
| 1420 | Ga0501273_001732 | 3300049770 | Bacteria | 2128 |
| 1421 | Ga0501035_0005815 | 3300049822 | Bacteria | 11625 |
| 1422 | Ga0501035_0108293 | 3300049822 | Bacteria | 2436 |
| 1423 | Ga0501035_0240154 | 3300049822 | Bacteria | 1541 |
| 1424 | Ga0501035_0582535 | 3300049822 | Bacteria | 914 |
| 1425 | Ga0501044_0006073 | 3300049823 | Bacteria | 13326 |
| 1426 | Ga0501044_0014438 | 3300049823 | Bacteria | 8527 |
| 1427 | Ga0501044_0022693 | 3300049823 | Bacteria | 6683 |
| 1428 | Ga0501044_0044949 | 3300049823 | Bacteria | 4579 |
| 1429 | Ga0501044_0052094 | 3300049823 | Bacteria | 4219 |
| 1430 | Ga0501044_0064110 | 3300049823 | Bacteria | 3752 |
| 1431 | Ga0501044_0115403 | 3300049823 | Bacteria | 2691 |
| 1432 | Ga0501044_0115827 | 3300049823 | Bacteria | 2686 |
| 1433 | Ga0501226_000146 | 3300049853 | Bacteria | 13414 |
| 1434 | nmdc:mga03683_28884_c1 | 3300050489 | Bacteria | 1623 |
| 1435 | nmdc:mga00v17_140697_c1 | 3300050491 | Bacteria | 1547 |
| 1436 | nmdc:mga00v17_485519_c1 | 3300050491 | Bacteria | 801 |
| 1437 | nmdc:mga0k408_211209_c1 | 3300050493 | Bacteria | 1159 |
| 1438 | nmdc:mga05p37_775333_c1 | 3300050507 | Bacteria | 1053 |
| 1439 | nmdc:mga06r32_454547_c1 | 3300050510 | Bacteria | 1260 |
| 1440 | Ga0495601_0058425 | 3300053077 | Bacteria | 2444 |
| 1441 | Ga0495655_0020270 | 3300053083 | Bacteria | 1489 |
| 1442 | Ga0495595_0073272 | 3300053084 | Bacteria | 1621 |
| 1443 | Ga0495619_0009805 | 3300053085 | Bacteria | 6038 |
| 1444 | Ga0500578_0001117 | 3300053086 | Bacteria | 28820 |
| 1445 | Ga0500643_000167 | 3300053087 | Bacteria | 64874 |
| 1446 | Ga0500643_000491 | 3300053087 | Bacteria | 28711 |
| 1447 | Ga0500643_001394 | 3300053087 | Bacteria | 13966 |
| 1448 | Ga0500644_0000074 | 3300053088 | Bacteria | 60285 |
| 1449 | Ga0500646_0007172 | 3300053090 | Bacteria | 2844 |
| 1450 | Ga0500554_005310 | 3300053102 | Bacteria | 2796 |
| 1451 | Ga0500555_040626 | 3300053103 | Bacteria | 1296 |
| 1452 | Ga0500556_0000954 | 3300053104 | Bacteria | 15555 |
| 1453 | Ga0500594_0000093 | 3300053118 | Bacteria | 27296 |
| 1454 | Ga0500608_076530 | 3300053122 | Bacteria | 1585 |
| 1455 | Ga0500618_000152 | 3300053125 | Bacteria | 57055 |
| 1456 | Ga0500655_001656 | 3300053133 | Bacteria | 4189 |
| 1457 | Ga0500658_0000106 | 3300053134 | Bacteria | 38868 |
| 1458 | Ga0500559_0000016 | 3300053136 | Bacteria | 151244 |
| 1459 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 1460 | Ga0500559_0041779 | 3300053136 | Bacteria | 1999 |
| 1461 | Ga0500564_000094 | 3300053138 | Bacteria | 22644 |
| 1462 | Ga0500568_0000708 | 3300053139 | Bacteria | 23914 |
| 1463 | Ga0500577_0001695 | 3300053142 | Bacteria | 5632 |
| 1464 | Ga0500604_0000004 | 3300053151 | Bacteria | 146374 |
| 1465 | Ga0500616_0000195 | 3300053153 | Bacteria | 99188 |
| 1466 | Ga0500622_0001162 | 3300053156 | Bacteria | 21873 |
| 1467 | Ga0500622_0027985 | 3300053156 | Bacteria | 2969 |
| 1468 | Ga0500627_0001136 | 3300053158 | Bacteria | 7290 |
| 1469 | Ga0500633_0032807 | 3300053160 | Bacteria | 1690 |
| 1470 | Ga0500611_007405 | 3300053727 | Bacteria | 1647 |
| 1471 | Ga0500609_000159 | 3300053731 | Bacteria | 9335 |
| 1472 | Ga0501084_0008910 | 3300054114 | Bacteria | 8300 |
| 1473 | Ga0501084_0160520 | 3300054114 | Bacteria | 1896 |
| 1474 | Ga0500661_001304 | 3300055283 | Bacteria | 4655 |
| 1475 | Ga0500661_006208 | 3300055283 | Bacteria | 2227 |
| 1476 | Ga0501082_0007396 | 3300060353 | Bacteria | 9478 |
| 1477 | Ga0501082_0008750 | 3300060353 | Bacteria | 8726 |
| 1478 | Ga0501082_0033247 | 3300060353 | Bacteria | 4449 |
| 1479 | 2511121904 | 2510917020 | Bacteria | 5657507 |
| 1480 | 2585148266 | 2582581279 | Bacteria | 4980720 |
| 1481 | 2585150955 | 2582581280 | Bacteria | 5994497 |
| 1482 | 2585196383 | 2582581293 | Bacteria | 5907401 |
| 1483 | 2643750351 | 2643221545 | Bacteria | 5083237 |
| 1484 | 2643780461 | 2643221552 | Bacteria | 5708754 |
| 1485 | 2643926969 | 2643221583 | Bacteria | 5218014 |
| 1486 | 2643932136 | 2643221584 | Bacteria | 5511711 |
| 1487 | 2644507240 | 2643221691 | Bacteria | 5093099 |
| 1488 | 2819538107 | 2818991435 | Bacteria | 5433759 |
| 1489 | 2819647323 | 2818991454 | Bacteria | 5563326 |
| 1490 | 2830077709 | 2830075706 | Bacteria | 3855215 |
| 1491 | 2837651421 | 2837651117 | Bacteria | 3772164 |
| 1492 | 2848298467 | 2848297114 | Bacteria | 3608511 |
| 1493 | 2891048537 | 2891048133 | Bacteria | 4447501 |
| 1494 | 2895884264 | 2895880812 | Bacteria | 11255272 |
| 1495 | 2896430475 | 2896429255 | Bacteria | 2557483 |
| 1496 | 2946788531 | 2946787523 | Bacteria | 4366789 |
| 1497 | 2995394393 | 2995392953 | Bacteria | 4539380 |
| 1498 | Ga0307409_100377564 | |||
| 1499 | JGI24741J21665_1009291 | |||
| 1500 | JGI24752J21851_1006614 | |||
| 1501 | JGI24752J21851_1018781 | |||
| 1502 | JGI24740J21852_10001751 | |||
| 1503 | JGI24740J21852_10011465 | |||
| 1504 | JGI24740J21852_10031692 | |||
| 1505 | JGI24739J22299_10001437 | |||
| 1506 | JGI24739J22299_10021447 | |||
| 1507 | JGI24737J22298_10004924 | |||
| 1508 | JGI24737J22298_10005430 | |||
| 1509 | JGI24737J22298_10027764 | |||
| 1510 | JGI24737J22298_10028978 | |||
| 1511 | JGI24737J22298_10073910 | |||
| 1512 | JGI24743J22301_10003950 | |||
| 1513 | JGI24743J22301_10030619 | |||
| 1514 | JGI24735J21928_10003716 | |||
| 1515 | JGI24735J21928_10004038 | |||
| 1516 | JGI24735J21928_10012841 | |||
| 1517 | JGI24735J21928_10022727 | |||
| 1518 | JGI24750J21931_1010515 | |||
| 1519 | JGI24738J21930_10004628 | |||
| 1520 | JGI25153J46596_10045638 | |||
| 1521 | Ga0055526_1030076 | |||
| 1522 | Ga0055524_1016758 | |||
| 1523 | Ga0055524_1040806 | |||
| 1524 | Ga0055528_1013757 | |||
| 1525 | Ga0055530_10000987 | |||
| 1526 | Ga0055530_10067721 | |||
| 1527 | Ga0055531_10002442 | |||
| 1528 | Ga0055531_10020386 | |||
| 1529 | Ga0065165_1000583 | |||
| 1530 | Ga0065165_1001140 | |||
| 1531 | Ga0065712_10132582 | |||
| 1532 | Ga0065712_10228343 | |||
| 1533 | Ga0065715_10139509 | |||
| 1534 | Ga0065715_10164498 | |||
| 1535 | Ga0065715_10209071 | |||
| 1536 | Ga0065715_10261607 | |||
| 1537 | Ga0065715_10370799 | |||
| 1538 | Ga0065707_10107500 | |||
| 1539 | Ga0070658_10000001 | |||
| 1540 | Ga0070658_10013428 | |||
| 1541 | Ga0070658_10031030 | |||
| 1542 | Ga0070658_10043979 | |||
| 1543 | Ga0070658_10049315 | |||
| 1544 | Ga0070658_10159215 | |||
| 1545 | Ga0070658_10200792 | |||
| 1546 | Ga0070658_10461660 | |||
| 1547 | Ga0070658_10613073 | |||
| 1548 | Ga0070658_10618156 | |||
| 1549 | Ga0070676_10003480 | |||
| 1550 | Ga0070676_10029061 | |||
| 1551 | Ga0070676_10191766 | |||
| 1552 | Ga0070683_100017503 | |||
| 1553 | Ga0070683_100070865 | |||
| 1554 | Ga0070683_100076509 | |||
| 1555 | Ga0070683_100090361 | |||
| 1556 | Ga0070690_100072921 | |||
| 1557 | Ga0070690_100134831 | |||
| 1558 | Ga0070670_100001683 | |||
| 1559 | Ga0070670_100008579 | |||
| 1560 | Ga0070670_100051615 | |||
| 1561 | Ga0070670_100067846 | |||
| 1562 | Ga0070670_100099944 | |||
| 1563 | Ga0070670_100123249 | |||
| 1564 | Ga0070670_100491413 | |||
| 1565 | Ga0070677_10143027 | |||
| 1566 | Ga0068869_100007757 | |||
| 1567 | Ga0068869_100079799 | |||
| 1568 | Ga0070666_10000560 | |||
| 1569 | Ga0070666_10000589 | |||
| 1570 | Ga0070666_10006877 | |||
| 1571 | Ga0070666_10023181 | |||
| 1572 | Ga0070666_10028457 | |||
| 1573 | Ga0070666_10150239 | |||
| 1574 | Ga0070666_10151542 | |||
| 1575 | Ga0070680_100000762 | |||
| 1576 | Ga0070680_100000835 | |||
| 1577 | Ga0070680_100017079 | |||
| 1578 | Ga0070680_100182656 | |||
| 1579 | Ga0070682_100044268 | |||
| 1580 | Ga0070682_100057303 | |||
| 1581 | Ga0068868_100001536 | |||
| 1582 | Ga0068868_100151370 | |||
| 1583 | Ga0068868_100217849 | |||
| 1584 | Ga0068868_100380232 | |||
| 1585 | Ga0070660_100005075 | |||
| 1586 | Ga0070660_100011166 | |||
| 1587 | Ga0070660_100033069 | |||
| 1588 | Ga0070660_100195215 | |||
| 1589 | Ga0070660_100312583 | |||
| 1590 | Ga0070660_100324853 | |||
| 1591 | Ga0070660_100369895 | |||
| 1592 | Ga0070687_100159773 | |||
| 1593 | Ga0070661_100000010 | |||
| 1594 | Ga0070661_100022365 | |||
| 1595 | Ga0070661_100024164 | |||
| 1596 | Ga0070661_100037007 | |||
| 1597 | Ga0070661_100038025 | |||
| 1598 | Ga0070661_100048673 | |||
| 1599 | Ga0070661_100086955 | |||
| 1600 | Ga0070661_100087995 | |||
| 1601 | Ga0070661_100163533 | |||
| 1602 | Ga0070661_100266386 | |||
| 1603 | Ga0070661_100469835 | |||
| 1604 | Ga0070668_100003316 | |||
| 1605 | Ga0070668_100024475 | |||
| 1606 | Ga0070668_100096442 | |||
| 1607 | Ga0070669_100000042 | |||
| 1608 | Ga0070669_100015724 | |||
| 1609 | Ga0070669_100037569 | |||
| 1610 | Ga0070669_100156266 | |||
| 1611 | Ga0070669_100264789 | |||
| 1612 | Ga0070675_100008232 | |||
| 1613 | Ga0070675_100055903 | |||
| 1614 | Ga0070675_100059392 | |||
| 1615 | Ga0070675_100092263 | |||
| 1616 | Ga0070675_100212004 | |||
| 1617 | Ga0070671_100000010 | |||
| 1618 | Ga0070671_100014861 | |||
| 1619 | Ga0070671_100016348 | |||
| 1620 | Ga0070671_100019917 | |||
| 1621 | Ga0070671_100020234 | |||
| 1622 | Ga0070671_100022996 | |||
| 1623 | Ga0070671_100023745 | |||
| 1624 | Ga0070671_100028714 | |||
| 1625 | Ga0070671_100286177 | |||
| 1626 | Ga0070674_100061300 | |||
| 1627 | Ga0070673_100000926 | |||
| 1628 | Ga0070673_100004977 | |||
| 1629 | Ga0070673_100021743 | |||
| 1630 | Ga0070673_100041683 | |||
| 1631 | Ga0070673_100061266 | |||
| 1632 | Ga0070673_100081617 | |||
| 1633 | Ga0070673_100142119 | |||
| 1634 | Ga0070673_100302763 | |||
| 1635 | Ga0070659_100000001 | |||
| 1636 | Ga0070659_100009955 | |||
| 1637 | Ga0070659_100016148 | |||
| 1638 | Ga0070659_100021317 | |||
| 1639 | Ga0070659_100024216 | |||
| 1640 | Ga0070659_100030375 | |||
| 1641 | Ga0070659_100061352 | |||
| 1642 | Ga0070659_100064515 | |||
| 1643 | Ga0070659_100080249 | |||
| 1644 | Ga0070659_100197383 | |||
| 1645 | Ga0070659_100402319 | |||
| 1646 | Ga0070659_100464984 | |||
| 1647 | Ga0070659_100556024 | |||
| 1648 | Ga0070667_100006418 | |||
| 1649 | Ga0070667_100008406 | |||
| 1650 | Ga0070667_100029024 | |||
| 1651 | Ga0070667_100046823 | |||
| 1652 | Ga0070667_100084928 | |||
| 1653 | Ga0070667_100343370 | |||
| 1654 | Ga0070667_100356690 | |||
| 1655 | Ga0070667_100851205 | |||
| 1656 | Ga0070709_10028601 | |||
| 1657 | Ga0070714_100015883 | |||
| 1658 | Ga0070714_100019297 | |||
| 1659 | Ga0070714_100030646 | |||
| 1660 | Ga0070713_100025410 | |||
| 1661 | Ga0070713_100031098 | |||
| 1662 | Ga0070713_100134331 | |||
| 1663 | Ga0070713_100255808 | |||
| 1664 | Ga0070713_100272995 | |||
| 1665 | Ga0070711_100174498 | |||
| 1666 | Ga0070711_100333518 | |||
| 1667 | Ga0070705_100062935 | |||
| 1668 | Ga0070694_100030397 | |||
| 1669 | Ga0070708_100213107 | |||
| 1670 | Ga0070663_100008986 | |||
| 1671 | Ga0070663_100030578 | |||
| 1672 | Ga0070663_100059342 | |||
| 1673 | Ga0070663_100067316 | |||
| 1674 | Ga0070663_100070177 | |||
| 1675 | Ga0070678_100008190 | |||
| 1676 | Ga0070678_100008901 | |||
| 1677 | Ga0070678_100031729 | |||
| 1678 | Ga0070678_100189326 | |||
| 1679 | Ga0070662_100004908 | |||
| 1680 | Ga0070662_100005390 | |||
| 1681 | Ga0070662_100010452 | |||
| 1682 | Ga0070662_100013093 | |||
| 1683 | Ga0070662_100015663 | |||
| 1684 | Ga0070662_100015798 | |||
| 1685 | Ga0070662_100062252 | |||
| 1686 | Ga0070662_100077047 | |||
| 1687 | Ga0070662_100120426 | |||
| 1688 | Ga0070662_100126353 | |||
| 1689 | Ga0070662_100166114 | |||
| 1690 | Ga0070662_100314216 | |||
| 1691 | Ga0070681_10045727 | |||
| 1692 | Ga0070681_10077048 | |||
| 1693 | Ga0070681_10102210 | |||
| 1694 | Ga0070681_10134375 | |||
| 1695 | Ga0068867_100018201 | |||
| 1696 | Ga0068867_100238152 | |||
| 1697 | Ga0070685_10204339 | |||
| 1698 | Ga0070698_100437446 | |||
| 1699 | Ga0070679_100000005 | |||
| 1700 | Ga0070679_100048005 | |||
| 1701 | Ga0070679_100060540 | |||
| 1702 | Ga0070679_100131321 | |||
| 1703 | Ga0070679_100384186 | |||
| 1704 | Ga0070684_100015958 | |||
| 1705 | Ga0070684_100141978 | |||
| 1706 | Ga0070697_100318495 | |||
| 1707 | Ga0068853_100011737 | |||
| 1708 | Ga0068853_100031940 | |||
| 1709 | Ga0068853_100060811 | |||
| 1710 | Ga0068853_100101709 | |||
| 1711 | Ga0068853_100122125 | |||
| 1712 | Ga0068853_100130600 | |||
| 1713 | Ga0068853_100194643 | |||
| 1714 | Ga0070672_100018334 | |||
| 1715 | Ga0070672_100080237 | |||
| 1716 | Ga0070672_100097854 | |||
| 1717 | Ga0070672_100124754 | |||
| 1718 | Ga0070672_100241396 | |||
| 1719 | Ga0070672_100277966 | |||
| 1720 | Ga0070686_100049303 | |||
| 1721 | Ga0070686_100101663 | |||
| 1722 | Ga0070686_100157522 | |||
| 1723 | Ga0070695_100125097 | |||
| 1724 | Ga0070696_100029968 | |||
| 1725 | Ga0070696_100287654 | |||
| 1726 | Ga0070693_100019430 | |||
| 1727 | Ga0070693_100025424 | |||
| 1728 | Ga0070693_100107954 | |||
| 1729 | Ga0070693_100350686 | |||
| 1730 | Ga0070665_100000075 | |||
| 1731 | Ga0070665_100000705 | |||
| 1732 | Ga0070665_100006901 | |||
| 1733 | Ga0070665_100017020 | |||
| 1734 | Ga0070665_100020609 | |||
| 1735 | Ga0070665_100039761 | |||
| 1736 | Ga0070665_100041899 | |||
| 1737 | Ga0070665_100102810 | |||
| 1738 | Ga0070665_100123413 | |||
| 1739 | Ga0070665_100158243 | |||
| 1740 | Ga0070665_100216796 | |||
| 1741 | Ga0070665_100362544 | |||
| 1742 | Ga0068855_100000075 | |||
| 1743 | Ga0068855_100047862 | |||
| 1744 | Ga0068855_100110265 | |||
| 1745 | Ga0068855_100111054 | |||
| 1746 | Ga0068855_100128065 | |||
| 1747 | Ga0068855_100187397 | |||
| 1748 | Ga0068855_100235859 | |||
| 1749 | Ga0068855_100291514 | |||
| 1750 | Ga0068855_100941118 | |||
| 1751 | Ga0070664_100001286 | |||
| 1752 | Ga0070664_100002393 | |||
| 1753 | Ga0070664_100002719 | |||
| 1754 | Ga0070664_100008077 | |||
| 1755 | Ga0070664_100008895 | |||
| 1756 | Ga0070664_100035616 | |||
| 1757 | Ga0070664_100038260 | |||
| 1758 | Ga0070664_100058638 | |||
| 1759 | Ga0070664_100077294 | |||
| 1760 | Ga0070664_100094475 | |||
| 1761 | Ga0070664_100131923 | |||
| 1762 | Ga0070664_100215005 | |||
| 1763 | Ga0070664_100237039 | |||
| 1764 | Ga0070664_100644543 | |||
| 1765 | Ga0068857_100013797 | |||
| 1766 | Ga0068857_100017690 | |||
| 1767 | Ga0068857_100046949 | |||
| 1768 | Ga0068857_100117168 | |||
| 1769 | Ga0068857_100155883 | |||
| 1770 | Ga0068857_100323095 | |||
| 1771 | Ga0068857_100364716 | |||
| 1772 | Ga0068854_100000526 | |||
| 1773 | Ga0068854_100042423 | |||
| 1774 | Ga0068854_100105510 | |||
| 1775 | Ga0068854_100133236 | |||
| 1776 | Ga0068854_100935739 | |||
| 1777 | Ga0068856_100023109 | |||
| 1778 | Ga0068856_100056588 | |||
| 1779 | Ga0068856_100092865 | |||
| 1780 | Ga0068856_100165919 | |||
| 1781 | Ga0068856_100187752 | |||
| 1782 | Ga0068856_100191531 | |||
| 1783 | Ga0068852_100002222 | |||
| 1784 | Ga0068852_100014896 | |||
| 1785 | Ga0068852_100019408 | |||
| 1786 | Ga0068852_100087335 | |||
| 1787 | Ga0068852_100110504 | |||
| 1788 | Ga0068852_100124025 | |||
| 1789 | Ga0068852_100148166 | |||
| 1790 | Ga0068852_100249884 | |||
| 1791 | Ga0068852_100261542 | |||
| 1792 | Ga0068852_100298436 | |||
| 1793 | Ga0068852_100307804 | |||
| 1794 | Ga0068859_100000068 | |||
| 1795 | Ga0068859_100000311 | |||
| 1796 | Ga0068859_100039170 | |||
| 1797 | Ga0068859_100046359 | |||
| 1798 | Ga0068859_100085280 | |||
| 1799 | Ga0068859_100232809 | |||
| 1800 | Ga0068859_100506664 | |||
| 1801 | Ga0068864_100000339 | |||
| 1802 | Ga0068864_100005196 | |||
| 1803 | Ga0068864_100006681 | |||
| 1804 | Ga0068864_100011656 | |||
| 1805 | Ga0068864_100029571 | |||
| 1806 | Ga0068864_100048060 | |||
| 1807 | Ga0068864_100169986 | |||
| 1808 | Ga0068864_100806575 | |||
| 1809 | Ga0068866_10027339 | |||
| 1810 | Ga0068866_10234463 | |||
| 1811 | Ga0068861_100007994 | |||
| 1812 | Ga0068861_100124674 | |||
| 1813 | Ga0068861_100294763 | |||
| 1814 | Ga0068851_10019988 | |||
| 1815 | Ga0068863_100000535 | |||
| 1816 | Ga0068863_100002834 | |||
| 1817 | Ga0068863_100006405 | |||
| 1818 | Ga0068863_100010392 | |||
| 1819 | Ga0068863_100013383 | |||
| 1820 | Ga0068863_100018241 | |||
| 1821 | Ga0068863_100026520 | |||
| 1822 | Ga0068863_100053435 | |||
| 1823 | Ga0068863_100156949 | |||
| 1824 | Ga0068858_100000911 | |||
| 1825 | Ga0068858_100001148 | |||
| 1826 | Ga0068858_100001843 | |||
| 1827 | Ga0068858_100006411 | |||
| 1828 | Ga0068858_100013165 | |||
| 1829 | Ga0068858_100018073 | |||
| 1830 | Ga0068858_100022455 | |||
| 1831 | Ga0068858_100064168 | |||
| 1832 | Ga0068858_100080280 | |||
| 1833 | Ga0068860_100002412 | |||
| 1834 | Ga0068860_100004375 | |||
| 1835 | Ga0068860_100010285 | |||
| 1836 | Ga0068860_100018987 | |||
| 1837 | Ga0068860_100037485 | |||
| 1838 | Ga0068860_100045940 | |||
| 1839 | Ga0068860_100087335 | |||
| 1840 | Ga0068862_100000620 | |||
| 1841 | Ga0068862_100004223 | |||
| 1842 | Ga0068862_100011413 | |||
| 1843 | Ga0068862_100017674 | |||
| 1844 | Ga0068862_100019273 | |||
| 1845 | Ga0068862_100028904 | |||
| 1846 | Ga0068862_100403713 | |||
| 1847 | Ga0081539_10006847 | |||
| 1848 | Ga0081539_10057900 | |||
| 1849 | Ga0070717_10008598 | |||
| 1850 | Ga0075364_10035282 | |||
| 1851 | Ga0070716_100036482 | |||
| 1852 | Ga0070712_100138312 | |||
| 1853 | Ga0097621_100001143 | |||
| 1854 | Ga0097621_100179218 | |||
| 1855 | Ga0097621_100261324 | |||
| 1856 | Ga0075370_10040095 | |||
| 1857 | Ga0068871_100007297 | |||
| 1858 | Ga0068871_100007948 | |||
| 1859 | Ga0068871_100009459 | |||
| 1860 | Ga0068871_100048942 | |||
| 1861 | Ga0068871_100055538 | |||
| 1862 | Ga0068871_100168343 | |||
| 1863 | Ga0068871_100332583 | |||
| 1864 | Ga0075428_100325722 | |||
| 1865 | Ga0075431_100428110 | |||
| 1866 | Ga0075433_10138803 | |||
| 1867 | Ga0075434_100267848 | |||
| 1868 | Ga0068865_100001892 | |||
| 1869 | Ga0068865_100063316 | |||
| 1870 | Ga0068865_100208916 | |||
| 1871 | Ga0068865_100209233 | |||
| 1872 | Ga0097620_100000068 | |||
| 1873 | Ga0097620_100000311 | |||
| 1874 | Ga0097620_100039170 | |||
| 1875 | Ga0097620_100046360 | |||
| 1876 | Ga0097620_100085275 | |||
| 1877 | Ga0097620_100232804 | |||
| 1878 | Ga0097620_100506691 | |||
| 1879 | Ga0105250_10029474 | |||
| 1880 | Ga0105240_10000091 | |||
| 1881 | Ga0105240_10018168 | |||
| 1882 | Ga0105240_10018820 | |||
| 1883 | Ga0111539_10039920 | |||
| 1884 | Ga0105245_10038453 | |||
| 1885 | Ga0105245_10045234 | |||
| 1886 | Ga0105245_10332623 | |||
| 1887 | Ga0105245_10461990 | |||
| 1888 | Ga0105247_10006552 | |||
| 1889 | Ga0105247_10010078 | |||
| 1890 | Ga0105247_10117241 | |||
| 1891 | Ga0105247_10378153 | |||
| 1892 | Ga0105243_10003153 | |||
| 1893 | Ga0105243_10052349 | |||
| 1894 | Ga0105243_10546061 | |||
| 1895 | Ga0105243_10761741 | |||
| 1896 | Ga0105241_10125832 | |||
| 1897 | Ga0105241_10314855 | |||
| 1898 | Ga0105242_10040052 | |||
| 1899 | Ga0105242_10206036 | |||
| 1900 | Ga0105248_10000071 | |||
| 1901 | Ga0105248_10000135 | |||
| 1902 | Ga0105248_10002473 | |||
| 1903 | Ga0105248_10010095 | |||
| 1904 | Ga0105248_10018255 | |||
| 1905 | Ga0105248_10032489 | |||
| 1906 | Ga0105248_10050916 | |||
| 1907 | Ga0105248_10062739 | |||
| 1908 | Ga0105248_10068022 | |||
| 1909 | Ga0105248_10111087 | |||
| 1910 | Ga0105237_10010442 | |||
| 1911 | Ga0105237_10041678 | |||
| 1912 | Ga0105238_10132874 | |||
| 1913 | Ga0105238_10268678 | |||
| 1914 | Ga0105238_10331751 | |||
| 1915 | Ga0105238_10356022 | |||
| 1916 | Ga0105238_10473383 | |||
| 1917 | Ga0105238_10805032 | |||
| 1918 | Ga0105249_10003308 | |||
| 1919 | Ga0105249_10015105 | |||
| 1920 | Ga0105249_10040558 | |||
| 1921 | Ga0105148_103867 | |||
| 1922 | Ga0105239_10000881 | |||
| 1923 | Ga0105239_10103619 | |||
| 1924 | Ga0105239_10226472 | |||
| 1925 | Ga0105246_10039899 | |||
| 1926 | Ga0105246_10055314 | |||
| 1927 | Ga0105246_10124763 | |||
| 1928 | Ga0157373_10024193 | |||
| 1929 | Ga0157373_10101559 | |||
| 1930 | Ga0157373_10114186 | |||
| 1931 | Ga0157373_10120822 | |||
| 1932 | Ga0157373_10270810 | |||
| 1933 | Ga0157373_10278622 | |||
| 1934 | Ga0157373_10344620 | |||
| 1935 | Ga0157373_10449610 | |||
| 1936 | Ga0157371_10012023 | |||
| 1937 | Ga0157371_10024353 | |||
| 1938 | Ga0157371_10029707 | |||
| 1939 | Ga0157371_10077860 | |||
| 1940 | Ga0157371_10085929 | |||
| 1941 | Ga0157371_10104520 | |||
| 1942 | Ga0157371_10138133 | |||
| 1943 | Ga0157371_10237073 | |||
| 1944 | Ga0157371_10462013 | |||
| 1945 | Ga0157371_10649785 | |||
| 1946 | Ga0157370_10003624 | |||
| 1947 | Ga0157370_10058050 | |||
| 1948 | Ga0157370_10078248 | |||
| 1949 | Ga0157370_10148955 | |||
| 1950 | Ga0157370_10247494 | |||
| 1951 | Ga0157370_10302570 | |||
| 1952 | Ga0157370_10410062 | |||
| 1953 | Ga0157369_10002508 | |||
| 1954 | Ga0157369_10020723 | |||
| 1955 | Ga0157369_10032088 | |||
| 1956 | Ga0157369_10065562 | |||
| 1957 | Ga0157369_10083278 | |||
| 1958 | Ga0157369_10178855 | |||
| 1959 | Ga0157369_10277161 | |||
| 1960 | Ga0157369_10324979 | |||
| 1961 | Ga0157369_10526171 | |||
| 1962 | Ga0157369_10544261 | |||
| 1963 | Ga0157369_11004628 | |||
| 1964 | Ga0157374_10008290 | |||
| 1965 | Ga0157374_10036780 | |||
| 1966 | Ga0157374_10114521 | |||
| 1967 | Ga0157374_10182170 | |||
| 1968 | Ga0157374_10217281 | |||
| 1969 | Ga0157378_10025018 | |||
| 1970 | Ga0157378_10057242 | |||
| 1971 | Ga0157378_10741990 | |||
| 1972 | Ga0163162_10004777 | |||
| 1973 | Ga0163162_10013372 | |||
| 1974 | Ga0163162_10015345 | |||
| 1975 | Ga0163162_10037196 | |||
| 1976 | Ga0163162_10067868 | |||
| 1977 | Ga0163162_10074241 | |||
| 1978 | Ga0163162_10103648 | |||
| 1979 | Ga0163162_10138889 | |||
| 1980 | Ga0163162_10193751 | |||
| 1981 | Ga0163162_10384259 | |||
| 1982 | Ga0163162_10792412 | |||
| 1983 | Ga0163162_11232633 | |||
| 1984 | Ga0157372_10011794 | |||
| 1985 | Ga0157372_10045540 | |||
| 1986 | Ga0157372_10190381 | |||
| 1987 | Ga0157372_10441694 | |||
| 1988 | Ga0157372_10475342 | |||
| 1989 | Ga0157375_10030724 | |||
| 1990 | Ga0157375_10145304 | |||
| 1991 | Ga0157375_10331488 | |||
| 1992 | Ga0157375_10430942 | |||
| 1993 | Ga0157375_10540708 | |||
| 1994 | Ga0163163_10000995 | |||
| 1995 | Ga0163163_10002903 | |||
| 1996 | Ga0163163_10034083 | |||
| 1997 | Ga0163163_10086013 | |||
| 1998 | Ga0163163_10170758 | |||
| 1999 | Ga0163163_10194840 | |||
| 2000 | Ga0163163_10199126 | |||
| 2001 | Ga0163163_10931248 | |||
| 2002 | Ga0157380_10044845 | |||
| 2003 | Ga0157380_10102199 | |||
| 2004 | Ga0157380_10162256 | |||
| 2005 | Ga0157380_10234971 | |||
| 2006 | Ga0157380_10235070 | |||
| 2007 | Ga0157379_10001410 | |||
| 2008 | Ga0157379_10004123 | |||
| 2009 | Ga0157379_10005617 | |||
| 2010 | Ga0157379_10020816 | |||
| 2011 | Ga0157379_10050010 | |||
| 2012 | Ga0157379_10069147 | |||
| 2013 | Ga0157379_10074159 | |||
| 2014 | Ga0157379_10180064 | |||
| 2015 | Ga0157379_10184206 | |||
| 2016 | Ga0157379_10200366 | |||
| 2017 | Ga0157379_10293736 | |||
| 2018 | Ga0157376_10027721 | |||
| 2019 | Ga0163161_10005877 | |||
| 2020 | Ga0163161_10057436 | |||
| 2021 | Ga0163161_10434721 | |||
| 2022 | Ga0197907_11049312 | |||
| 2023 | Ga0213873_10000015 | |||
| 2024 | Ga0213872_10004505 | |||
| 2025 | Ga0213872_10132579 | |||
| 2026 | Ga0213874_10002022 | |||
| 2027 | Ga0213874_10057844 | |||
| 2028 | Ga0213876_10000005 | |||
| 2029 | Ga0213876_10000235 | |||
| 2030 | Ga0213876_10002081 | |||
| 2031 | Ga0213876_10013218 | |||
| 2032 | Ga0213876_10014952 | |||
| 2033 | Ga0213876_10031775 | |||
| 2034 | Ga0213876_10159656 | |||
| 2035 | Ga0213875_10000465 | |||
| 2036 | Ga0213875_10066523 | |||
| 2037 | Ga0213871_10015110 | |||
| 2038 | Ga0209026_1004799 | |||
| 2039 | Ga0209565_1000505 | |||
| 2040 | Ga0209673_1001029 | |||
| 2041 | Ga0207673_1007757 | |||
| 2042 | Ga0209758_1003766 | |||
| 2043 | Ga0209758_1026982 | |||
| 2044 | Ga0209050_1000053 | |||
| 2045 | Ga0209256_1001196 | |||
| 2046 | Ga0209256_1003919 | |||
| 2047 | Ga0209257_1000247 | |||
| 2048 | Ga0209257_1000705 | |||
| 2049 | Ga0207697_10000004 | |||
| 2050 | Ga0207656_10007575 | |||
| 2051 | Ga0207656_10008592 | |||
| 2052 | Ga0207656_10086271 | |||
| 2053 | Ga0207656_10244489 | |||
| 2054 | Ga0207696_1011753 | |||
| 2055 | Ga0207682_10051387 | |||
| 2056 | Ga0207682_10103096 | |||
| 2057 | Ga0207642_10011059 | |||
| 2058 | Ga0207642_10015908 | |||
| 2059 | Ga0207710_10017260 | |||
| 2060 | Ga0207710_10163941 | |||
| 2061 | Ga0207710_10245774 | |||
| 2062 | Ga0207688_10019179 | |||
| 2063 | Ga0207680_10000110 | |||
| 2064 | Ga0207680_10000479 | |||
| 2065 | Ga0207680_10002339 | |||
| 2066 | Ga0207647_10001330 | |||
| 2067 | Ga0207647_10005953 | |||
| 2068 | Ga0207647_10020301 | |||
| 2069 | Ga0207647_10031336 | |||
| 2070 | Ga0207647_10031605 | |||
| 2071 | Ga0207647_10079903 | |||
| 2072 | Ga0207699_10005926 | |||
| 2073 | Ga0207645_10007286 | |||
| 2074 | Ga0207645_10029495 | |||
| 2075 | Ga0207645_10052457 | |||
| 2076 | Ga0207645_10331820 | |||
| 2077 | Ga0207705_10000002 | |||
| 2078 | Ga0207705_10009316 | |||
| 2079 | Ga0207705_10013718 | |||
| 2080 | Ga0207705_10042364 | |||
| 2081 | Ga0207705_10113019 | |||
| 2082 | Ga0207705_10134789 | |||
| 2083 | Ga0207705_10139550 | |||
| 2084 | Ga0207705_10279689 | |||
| 2085 | Ga0207654_10384124 | |||
| 2086 | Ga0207707_10015128 | |||
| 2087 | Ga0207707_10028578 | |||
| 2088 | Ga0207707_10079116 | |||
| 2089 | Ga0207707_10194441 | |||
| 2090 | Ga0207707_10303778 | |||
| 2091 | Ga0207695_10000018 | |||
| 2092 | Ga0207695_10040048 | |||
| 2093 | Ga0207695_10048897 | |||
| 2094 | Ga0207671_10175130 | |||
| 2095 | Ga0207671_10233779 | |||
| 2096 | Ga0207693_10016941 | |||
| 2097 | Ga0207693_10394972 | |||
| 2098 | Ga0207693_10470174 | |||
| 2099 | Ga0207663_10262127 | |||
| 2100 | Ga0207660_10004061 | |||
| 2101 | Ga0207660_10004720 | |||
| 2102 | Ga0207660_10005872 | |||
| 2103 | Ga0207660_10006996 | |||
| 2104 | Ga0207657_10003536 | |||
| 2105 | Ga0207657_10006575 | |||
| 2106 | Ga0207657_10009507 | |||
| 2107 | Ga0207657_10027948 | |||
| 2108 | Ga0207657_10028001 | |||
| 2109 | Ga0207657_10042970 | |||
| 2110 | Ga0207657_10048511 | |||
| 2111 | Ga0207657_10163872 | |||
| 2112 | Ga0207657_10219948 | |||
| 2113 | Ga0207649_10000165 | |||
| 2114 | Ga0207649_10006461 | |||
| 2115 | Ga0207649_10009943 | |||
| 2116 | Ga0207649_10015525 | |||
| 2117 | Ga0207649_10024744 | |||
| 2118 | Ga0207649_10033588 | |||
| 2119 | Ga0207649_10033852 | |||
| 2120 | Ga0207649_10099279 | |||
| 2121 | Ga0207649_10142993 | |||
| 2122 | Ga0207649_10149594 | |||
| 2123 | Ga0207649_10263747 | |||
| 2124 | Ga0207649_10329251 | |||
| 2125 | Ga0207649_10450115 | |||
| 2126 | Ga0207652_10000005 | |||
| 2127 | Ga0207652_10000006 | |||
| 2128 | Ga0207652_10000007 | |||
| 2129 | Ga0207652_10000009 | |||
| 2130 | Ga0207652_10014430 | |||
| 2131 | Ga0207652_10105887 | |||
| 2132 | Ga0207652_10191953 | |||
| 2133 | Ga0207652_10485934 | |||
| 2134 | Ga0207681_10000002 | |||
| 2135 | Ga0207681_10068262 | |||
| 2136 | Ga0207681_10124419 | |||
| 2137 | Ga0207681_10132550 | |||
| 2138 | Ga0207681_10161995 | |||
| 2139 | Ga0207681_10683900 | |||
| 2140 | Ga0207694_10000018 | |||
| 2141 | Ga0207694_10166265 | |||
| 2142 | Ga0207694_10343885 | |||
| 2143 | Ga0207650_10000969 | |||
| 2144 | Ga0207650_10002248 | |||
| 2145 | Ga0207650_10008363 | |||
| 2146 | Ga0207650_10012641 | |||
| 2147 | Ga0207650_10016491 | |||
| 2148 | Ga0207650_10024587 | |||
| 2149 | Ga0207650_10039127 | |||
| 2150 | Ga0207650_10075984 | |||
| 2151 | Ga0207650_10371202 | |||
| 2152 | Ga0207650_10445551 | |||
| 2153 | Ga0207650_10645587 | |||
| 2154 | Ga0207659_10001482 | |||
| 2155 | Ga0207659_10008772 | |||
| 2156 | Ga0207659_10012530 | |||
| 2157 | Ga0207659_10038749 | |||
| 2158 | Ga0207659_10080451 | |||
| 2159 | Ga0207659_10088754 | |||
| 2160 | Ga0207687_10173341 | |||
| 2161 | Ga0207687_10395342 | |||
| 2162 | Ga0207700_10036947 | |||
| 2163 | Ga0207700_10051616 | |||
| 2164 | Ga0207700_10337353 | |||
| 2165 | Ga0207664_10012423 | |||
| 2166 | Ga0207664_10074089 | |||
| 2167 | Ga0207664_10087005 | |||
| 2168 | Ga0207664_10345839 | |||
| 2169 | Ga0207644_10000002 | |||
| 2170 | Ga0207644_10003017 | |||
| 2171 | Ga0207644_10004808 | |||
| 2172 | Ga0207644_10005364 | |||
| 2173 | Ga0207644_10015607 | |||
| 2174 | Ga0207644_10043825 | |||
| 2175 | Ga0207644_10055495 | |||
| 2176 | Ga0207644_10136403 | |||
| 2177 | Ga0207644_10152321 | |||
| 2178 | Ga0207644_10166836 | |||
| 2179 | Ga0207644_10499426 | |||
| 2180 | Ga0207690_10000001 | |||
| 2181 | Ga0207690_10000002 | |||
| 2182 | Ga0207690_10000003 | |||
| 2183 | Ga0207690_10000004 | |||
| 2184 | Ga0207690_10004241 | |||
| 2185 | Ga0207690_10005677 | |||
| 2186 | Ga0207690_10044230 | |||
| 2187 | Ga0207690_10048921 | |||
| 2188 | Ga0207690_10075230 | |||
| 2189 | Ga0207690_10105226 | |||
| 2190 | Ga0207690_10193460 | |||
| 2191 | Ga0207690_10312382 | |||
| 2192 | Ga0207690_10431198 | |||
| 2193 | Ga0207690_10603853 | |||
| 2194 | Ga0207706_10001775 | |||
| 2195 | Ga0207706_10013591 | |||
| 2196 | Ga0207706_10014352 | |||
| 2197 | Ga0207706_10016990 | |||
| 2198 | Ga0207706_10026829 | |||
| 2199 | Ga0207706_10029595 | |||
| 2200 | Ga0207706_10034967 | |||
| 2201 | Ga0207706_10035201 | |||
| 2202 | Ga0207706_10041550 | |||
| 2203 | Ga0207706_10053746 | |||
| 2204 | Ga0207706_10079732 | |||
| 2205 | Ga0207706_10081223 | |||
| 2206 | Ga0207706_10120961 | |||
| 2207 | Ga0207706_10147680 | |||
| 2208 | Ga0207706_10307645 | |||
| 2209 | Ga0207706_10342823 | |||
| 2210 | Ga0207686_10159591 | |||
| 2211 | Ga0207709_10051918 | |||
| 2212 | Ga0207709_10099071 | |||
| 2213 | Ga0207669_10023635 | |||
| 2214 | Ga0207669_10063436 | |||
| 2215 | Ga0207669_10131721 | |||
| 2216 | Ga0207704_10012992 | |||
| 2217 | Ga0207665_10063049 | |||
| 2218 | Ga0207691_10003366 | |||
| 2219 | Ga0207691_10007374 | |||
| 2220 | Ga0207691_10105062 | |||
| 2221 | Ga0207691_10113501 | |||
| 2222 | Ga0207691_10159231 | |||
| 2223 | Ga0207691_10159659 | |||
| 2224 | Ga0207691_10166087 | |||
| 2225 | Ga0207691_10378636 | |||
| 2226 | Ga0207711_10000046 | |||
| 2227 | Ga0207711_10002278 | |||
| 2228 | Ga0207711_10004428 | |||
| 2229 | Ga0207711_10014784 | |||
| 2230 | Ga0207711_10015275 | |||
| 2231 | Ga0207711_10020724 | |||
| 2232 | Ga0207711_10037259 | |||
| 2233 | Ga0207711_10129168 | |||
| 2234 | Ga0207711_10188147 | |||
| 2235 | Ga0207711_10286143 | |||
| 2236 | Ga0207711_10757051 | |||
| 2237 | Ga0207689_10013570 | |||
| 2238 | Ga0207689_10031414 | |||
| 2239 | Ga0207689_10071625 | |||
| 2240 | Ga0207689_10094252 | |||
| 2241 | Ga0207661_10011896 | |||
| 2242 | Ga0207661_10022719 | |||
| 2243 | Ga0207661_10237463 | |||
| 2244 | Ga0207679_10002042 | |||
| 2245 | Ga0207679_10006229 | |||
| 2246 | Ga0207679_10019755 | |||
| 2247 | Ga0207679_10021213 | |||
| 2248 | Ga0207679_10022413 | |||
| 2249 | Ga0207679_10025568 | |||
| 2250 | Ga0207679_10051243 | |||
| 2251 | Ga0207679_10055334 | |||
| 2252 | Ga0207679_10065289 | |||
| 2253 | Ga0207679_10322471 | |||
| 2254 | Ga0207667_10000052 | |||
| 2255 | Ga0207667_10013558 | |||
| 2256 | Ga0207667_10086505 | |||
| 2257 | Ga0207667_10107922 | |||
| 2258 | Ga0207667_10147195 | |||
| 2259 | Ga0207667_10149213 | |||
| 2260 | Ga0207667_10160325 | |||
| 2261 | Ga0207667_10164785 | |||
| 2262 | Ga0207667_10435794 | |||
| 2263 | Ga0207667_10698147 | |||
| 2264 | Ga0207651_10001348 | |||
| 2265 | Ga0207651_10005720 | |||
| 2266 | Ga0207651_10008811 | |||
| 2267 | Ga0207651_10039726 | |||
| 2268 | Ga0207651_10044049 | |||
| 2269 | Ga0207651_10068581 | |||
| 2270 | Ga0207651_10073887 | |||
| 2271 | Ga0207651_10081814 | |||
| 2272 | Ga0207651_10086843 | |||
| 2273 | Ga0207651_10287748 | |||
| 2274 | Ga0207651_10485529 | |||
| 2275 | Ga0207651_10565449 | |||
| 2276 | Ga0207712_10001687 | |||
| 2277 | Ga0207712_10005663 | |||
| 2278 | Ga0207712_10023425 | |||
| 2279 | Ga0207668_10000489 | |||
| 2280 | Ga0207668_10000769 | |||
| 2281 | Ga0207640_10000749 | |||
| 2282 | Ga0207640_10017661 | |||
| 2283 | Ga0207640_10044357 | |||
| 2284 | Ga0207640_10124367 | |||
| 2285 | Ga0207640_10279654 | |||
| 2286 | Ga0207658_10001284 | |||
| 2287 | Ga0207658_10005468 | |||
| 2288 | Ga0207658_10013090 | |||
| 2289 | Ga0207658_10032364 | |||
| 2290 | Ga0207658_10048208 | |||
| 2291 | Ga0207658_10071300 | |||
| 2292 | Ga0207658_10095960 | |||
| 2293 | Ga0207658_10218468 | |||
| 2294 | Ga0207658_10332911 | |||
| 2295 | Ga0207658_10534207 | |||
| 2296 | Ga0207658_10576435 | |||
| 2297 | Ga0207677_10000110 | |||
| 2298 | Ga0207677_10005322 | |||
| 2299 | Ga0207677_10025231 | |||
| 2300 | Ga0207677_10546040 | |||
| 2301 | Ga0207703_10002629 | |||
| 2302 | Ga0207703_10005579 | |||
| 2303 | Ga0207703_10005684 | |||
| 2304 | Ga0207703_10008355 | |||
| 2305 | Ga0207703_10009045 | |||
| 2306 | Ga0207703_10009335 | |||
| 2307 | Ga0207703_10059553 | |||
| 2308 | Ga0207703_10154464 | |||
| 2309 | Ga0207703_10203154 | |||
| 2310 | Ga0207703_10226456 | |||
| 2311 | Ga0207703_10280919 | |||
| 2312 | Ga0207639_10007752 | |||
| 2313 | Ga0207639_10145570 | |||
| 2314 | Ga0207678_10000587 | |||
| 2315 | Ga0207678_10003028 | |||
| 2316 | Ga0207678_10011154 | |||
| 2317 | Ga0207678_10027601 | |||
| 2318 | Ga0207678_10028649 | |||
| 2319 | Ga0207678_10057595 | |||
| 2320 | Ga0207678_10076951 | |||
| 2321 | Ga0207678_10164585 | |||
| 2322 | Ga0207678_10289862 | |||
| 2323 | Ga0207678_10362601 | |||
| 2324 | Ga0207678_10380004 | |||
| 2325 | Ga0207702_10010616 | |||
| 2326 | Ga0207702_10041239 | |||
| 2327 | Ga0207702_10117122 | |||
| 2328 | Ga0207702_10163328 | |||
| 2329 | Ga0207702_10191976 | |||
| 2330 | Ga0207641_10002509 | |||
| 2331 | Ga0207641_10002980 | |||
| 2332 | Ga0207641_10010032 | |||
| 2333 | Ga0207641_10018279 | |||
| 2334 | Ga0207641_10022810 | |||
| 2335 | Ga0207641_10032834 | |||
| 2336 | Ga0207641_10060259 | |||
| 2337 | Ga0207641_10133163 | |||
| 2338 | Ga0207641_10525760 | |||
| 2339 | Ga0207648_10007028 | |||
| 2340 | Ga0207648_10035272 | |||
| 2341 | Ga0207648_10146565 | |||
| 2342 | Ga0207648_10884343 | |||
| 2343 | Ga0207676_10000604 | |||
| 2344 | Ga0207676_10003007 | |||
| 2345 | Ga0207676_10003565 | |||
| 2346 | Ga0207676_10004050 | |||
| 2347 | Ga0207676_10005776 | |||
| 2348 | Ga0207676_10027604 | |||
| 2349 | Ga0207676_10152309 | |||
| 2350 | Ga0207676_10160905 | |||
| 2351 | Ga0207676_10163068 | |||
| 2352 | Ga0207676_10698858 | |||
| 2353 | Ga0207674_10001949 | |||
| 2354 | Ga0207674_10001996 | |||
| 2355 | Ga0207674_10005064 | |||
| 2356 | Ga0207674_10008156 | |||
| 2357 | Ga0207674_10013773 | |||
| 2358 | Ga0207674_10035520 | |||
| 2359 | Ga0207674_10066919 | |||
| 2360 | Ga0207674_10109779 | |||
| 2361 | Ga0207674_10135829 | |||
| 2362 | Ga0207675_100001590 | |||
| 2363 | Ga0207675_100023360 | |||
| 2364 | Ga0207675_100039452 | |||
| 2365 | Ga0207675_100147463 | |||
| 2366 | Ga0207675_100328814 | |||
| 2367 | Ga0207675_100682740 | |||
| 2368 | Ga0207683_10002686 | |||
| 2369 | Ga0207683_10026087 | |||
| 2370 | Ga0207683_10042498 | |||
| 2371 | Ga0207683_10107823 | |||
| 2372 | Ga0207683_10113412 | |||
| 2373 | Ga0207683_10182797 | |||
| 2374 | Ga0207698_10003413 | |||
| 2375 | Ga0207698_10014872 | |||
| 2376 | Ga0207698_10019539 | |||
| 2377 | Ga0207698_10135129 | |||
| 2378 | Ga0207698_10185975 | |||
| 2379 | Ga0207698_10211595 | |||
| 2380 | Ga0207698_10342845 | |||
| 2381 | Ga0207698_10460900 | |||
| 2382 | Ga0207698_10462306 | |||
| 2383 | Ga0207698_10492282 | |||
| 2384 | Ga0207698_10530245 | |||
| 2385 | Ga0209974_10014636 | |||
| 2386 | Ga0268266_10000133 | |||
| 2387 | Ga0268266_10000468 | |||
| 2388 | Ga0268266_10004851 | |||
| 2389 | Ga0268266_10030905 | |||
| 2390 | Ga0268266_10037494 | |||
| 2391 | Ga0268266_10046227 | |||
| 2392 | Ga0268266_10078341 | |||
| 2393 | Ga0268266_10110747 | |||
| 2394 | Ga0268266_10126853 | |||
| 2395 | Ga0268266_10173648 | |||
| 2396 | Ga0268266_10185619 | |||
| 2397 | Ga0268266_10188136 | |||
| 2398 | Ga0268266_10217023 | |||
| 2399 | Ga0268266_10272484 | |||
| 2400 | Ga0268265_10000260 | |||
| 2401 | Ga0268265_10003169 | |||
| 2402 | Ga0268265_10006467 | |||
| 2403 | Ga0268265_10011653 | |||
| 2404 | Ga0268265_10014013 | |||
| 2405 | Ga0268265_10014765 | |||
| 2406 | Ga0268265_10033543 | |||
| 2407 | Ga0268265_10038143 | |||
| 2408 | Ga0268265_10187409 | |||
| 2409 | Ga0268265_10240208 | |||
| 2410 | Ga0268265_10414757 | |||
| 2411 | Ga0268265_10748343 | |||
| 2412 | Ga0268264_10000010 | |||
| 2413 | Ga0268264_10000395 | |||
| 2414 | Ga0268264_10001804 | |||
| 2415 | Ga0268264_10002210 | |||
| 2416 | Ga0268264_10042887 | |||
| 2417 | Ga0268264_10123575 | |||
| 2418 | Ga0268264_10131560 | |||
| 2419 | Ga0265319_1028169 | |||
| 2420 | Ga0307515_10038723 | |||
| 2421 | Ga0307515_10201254 | |||
| 2422 | Ga0265338_10037468 | |||
| 2423 | Ga0307511_10002678 | |||
| 2424 | Ga0316178_1048998 | |||
| 2425 | Ga0316182_1079022 | |||
| 2426 | Ga0265331_10003604 | |||
| 2427 | Ga0265327_10000287 | |||
| 2428 | Ga0265327_10001092 | |||
| 2429 | Ga0265316_10022279 | |||
| 2430 | Ga0307513_10003819 | |||
| 2431 | Ga0307408_100040705 | |||
| 2432 | Ga0307408_100052891 | |||
| 2433 | Ga0307408_100323847 | |||
| 2434 | Ga0307408_100340379 | |||
| 2435 | Ga0307408_100439334 | |||
| 2436 | Ga0307508_10080130 | |||
| 2437 | Ga0316576_10141838 | |||
| 2438 | Ga0307516_10045056 | |||
| 2439 | Ga0307405_10013459 | |||
| 2440 | Ga0307405_10022524 | |||
| 2441 | Ga0307405_10033698 | |||
| 2442 | Ga0307405_10062168 | |||
| 2443 | Ga0307405_10110982 | |||
| 2444 | Ga0307405_10149118 | |||
| 2445 | Ga0307405_10443293 | |||
| 2446 | Ga0307405_10631070 | |||
| 2447 | Ga0307413_10012378 | |||
| 2448 | Ga0307413_10021556 | |||
| 2449 | Ga0307413_10030086 | |||
| 2450 | Ga0307413_10037137 | |||
| 2451 | Ga0307413_10044674 | |||
| 2452 | Ga0307413_10088134 | |||
| 2453 | Ga0307413_10103733 | |||
| 2454 | Ga0307413_10149629 | |||
| 2455 | Ga0307413_10590832 | |||
| 2456 | Ga0307410_10004118 | |||
| 2457 | Ga0307410_10005331 | |||
| 2458 | Ga0307410_10022347 | |||
| 2459 | Ga0307410_10030516 | |||
| 2460 | Ga0307410_10049287 | |||
| 2461 | Ga0307410_10073172 | |||
| 2462 | Ga0307410_10090208 | |||
| 2463 | Ga0307410_10096942 | |||
| 2464 | Ga0307410_10124619 | |||
| 2465 | Ga0307410_10233568 | |||
| 2466 | Ga0307410_10239004 | |||
| 2467 | Ga0307410_10485966 | |||
| 2468 | Ga0307406_10013030 | |||
| 2469 | Ga0307406_10029387 | |||
| 2470 | Ga0307406_10410042 | |||
| 2471 | Ga0307406_10492366 | |||
| 2472 | Ga0307407_10004244 | |||
| 2473 | Ga0307407_10048360 | |||
| 2474 | Ga0307407_10144523 | |||
| 2475 | Ga0307407_10174373 | |||
| 2476 | Ga0307407_10211181 | |||
| 2477 | Ga0307407_10226107 | |||
| 2478 | Ga0307412_10001412 | |||
| 2479 | Ga0307412_10047476 | |||
| 2480 | Ga0307412_10049113 | |||
| 2481 | Ga0307412_10059063 | |||
| 2482 | Ga0307412_10126735 | |||
| 2483 | Ga0307412_10154812 | |||
| 2484 | Ga0307412_10340506 | |||
| 2485 | Ga0307412_10400002 | |||
| 2486 | Ga0307409_100010865 | |||
| 2487 | Ga0307409_100018847 | |||
| 2488 | Ga0307409_100020903 | |||
| 2489 | Ga0307409_100089860 | |||
| 2490 | Ga0307409_100098564 | |||
| 2491 | Ga0307409_100103192 | |||
| 2492 | Ga0307409_100111654 | |||
| 2493 | Ga0307409_100235664 | |||
| 2494 | Ga0307409_100374291 | |||
| 2495 | Ga0307409_100507557 | |||
| 2496 | Ga0307416_100005969 | |||
| 2497 | Ga0307416_100021093 | |||
| 2498 | Ga0307416_100039417 | |||
| 2499 | Ga0307416_100071347 | |||
| 2500 | Ga0307416_100114611 | |||
| 2501 | Ga0307416_100149077 | |||
| 2502 | Ga0307416_100321736 | |||
| 2503 | Ga0307416_101055760 | |||
| 2504 | Ga0307414_10002011 | |||
| 2505 | Ga0307414_10005482 | |||
| 2506 | Ga0307414_10011191 | |||
| 2507 | Ga0307414_10014217 | |||
| 2508 | Ga0307414_10018323 | |||
| 2509 | Ga0307414_10037422 | |||
| 2510 | Ga0307414_10065339 | |||
| 2511 | Ga0307414_10130317 | |||
| 2512 | Ga0307414_10303565 | |||
| 2513 | Ga0307414_10336066 | |||
| 2514 | Ga0307414_10532293 | |||
| 2515 | Ga0307411_10009114 | |||
| 2516 | Ga0307411_10017646 | |||
| 2517 | Ga0307411_10032330 | |||
| 2518 | Ga0307411_10037964 | |||
| 2519 | Ga0307411_10038968 | |||
| 2520 | Ga0307411_10100399 | |||
| 2521 | Ga0307411_10106201 | |||
| 2522 | Ga0307415_100001168 | |||
| 2523 | Ga0307415_100015982 | |||
| 2524 | Ga0307415_100021846 | |||
| 2525 | Ga0307415_100024978 | |||
| 2526 | Ga0307415_100027584 | |||
| 2527 | Ga0307415_100058956 | |||
| 2528 | Ga0307415_100062766 | |||
| 2529 | Ga0307415_100072011 | |||
| 2530 | Ga0307415_100283126 | |||
| 2531 | Ga0307415_100313059 | |||
| 2532 | Ga0307415_100321418 | |||
| 2533 | Ga0307415_100369077 | |||
| 2534 | Ga0307415_100385423 | |||
| 2535 | Ga0316583_10016259 | |||
| 2536 | Ga0307510_10004465 | |||
| 2537 | Ga0307510_10120251 | |||
| 2538 | Ga0316592_1041731 | |||
| 2539 | Ga0316586_1037026 | |||
| 2540 | Ga0316596_1060658 | |||
| 2541 | Ga0373949_0034715 | |||
| 2542 | Ga0373923_0021988 | |||
| 2543 | Ga0373939_0101958 | |||
| 2544 | Ga0373955_0000253 | |||
| 2545 | Ga0316574_0025244 | |||
| 2546 | Ga0373931_0148998 | |||
| 2547 | Ga0373935_0027403 | |||
| 2548 | Ga0373927_0072570 | |||
| 2549 | Ga0373927_0136311 | |||
| 2550 | Ga0373933_0042508 | |||
| 2551 | Ga0373947_0020121 | |||
| 2552 | Ga0373937_0001410 | |||
| 2553 | Ga0316582_0037263 | |||
| 2554 | Ga0316582_0455677 | |||
| 2555 | Ga0316584_0012541 | |||
| 2556 | Ga0316584_0017465 | |||
| 2557 | Ga0316584_0124217 | |||
| 2558 | Ga0395899_0002102 | |||
| 2559 | Ga0395899_0013169 | |||
| 2560 | Ga0395899_0030776 | |||
| 2561 | Ga0395899_0043881 | |||
| 2562 | Ga0395899_0065937 | |||
| 2563 | Ga0395899_0075676 | |||
| 2564 | Ga0395899_0078721 | |||
| 2565 | Ga0395899_0122288 | |||
| 2566 | Ga0395899_0207973 | |||
| 2567 | Ga0395900_0001365 | |||
| 2568 | Ga0395900_0007243 | |||
| 2569 | Ga0395900_0014084 | |||
| 2570 | Ga0395900_0020186 | |||
| 2571 | Ga0395900_0021692 | |||
| 2572 | Ga0395900_0031168 | |||
| 2573 | Ga0395900_0032675 | |||
| 2574 | Ga0395900_0033698 | |||
| 2575 | Ga0395900_0042491 | |||
| 2576 | Ga0395900_0042726 | |||
| 2577 | Ga0395900_0047189 | |||
| 2578 | Ga0395900_0054412 | |||
| 2579 | Ga0395900_0071338 | |||
| 2580 | Ga0395900_0087392 | |||
| 2581 | Ga0395900_0094563 | |||
| 2582 | Ga0395900_0164235 | |||
| 2583 | Ga0395900_0178521 | |||
| 2584 | Ga0395900_0182009 | |||
| 2585 | Ga0395900_0206212 | |||
| 2586 | Ga0395900_0302652 | |||
| 2587 | Ga0395900_0483497 | |||
| 2588 | Ga0395900_0902591 | |||
| 2589 | Ga0395898_0028102 | |||
| 2590 | Ga0395898_0057860 | |||
| 2591 | Ga0395898_0060891 | |||
| 2592 | Ga0395898_0085638 | |||
| 2593 | Ga0395898_0177417 | |||
| 2594 | Ga0395898_0195749 | |||
| 2595 | Ga0395898_0243248 | |||
| 2596 | Ga0395898_0316929 | |||
| 2597 | Ga0395898_0334837 | |||
| 2598 | Ga0395905_0000193 | |||
| 2599 | Ga0395905_0001786 | |||
| 2600 | Ga0395905_0003261 | |||
| 2601 | Ga0395905_0003299 | |||
| 2602 | Ga0395905_0004799 | |||
| 2603 | Ga0395905_0009715 | |||
| 2604 | Ga0395905_0012830 | |||
| 2605 | Ga0395905_0027620 | |||
| 2606 | Ga0395905_0029464 | |||
| 2607 | Ga0395905_0031843 | |||
| 2608 | Ga0395905_0034174 | |||
| 2609 | Ga0395905_0034645 | |||
| 2610 | Ga0395905_0049371 | |||
| 2611 | Ga0395905_0056070 | |||
| 2612 | Ga0395905_0068125 | |||
| 2613 | Ga0395905_0077510 | |||
| 2614 | Ga0395905_0081154 | |||
| 2615 | Ga0395905_0084359 | |||
| 2616 | Ga0395905_0129719 | |||
| 2617 | Ga0395905_0138377 | |||
| 2618 | Ga0395905_0147675 | |||
| 2619 | Ga0395905_0268181 | |||
| 2620 | Ga0395905_0298285 | |||
| 2621 | Ga0395905_0329355 | |||
| 2622 | Ga0395905_0337314 | |||
| 2623 | Ga0395905_0340473 | |||
| 2624 | Ga0395905_0430943 | |||
| 2625 | Ga0395905_0536765 | |||
| 2626 | Ga0436364_0017202 | |||
| 2627 | Ga0436364_0063093 | |||
| 2628 | Ga0436364_0090132 | |||
| 2629 | Ga0436364_1395218 | |||
| 2630 | Ga0395901_0000934 | |||
| 2631 | Ga0395901_0001501 | |||
| 2632 | Ga0395901_0006612 | |||
| 2633 | Ga0395901_0011981 | |||
| 2634 | Ga0395901_0016705 | |||
| 2635 | Ga0395901_0021798 | |||
| 2636 | Ga0395901_0025716 | |||
| 2637 | Ga0395901_0038482 | |||
| 2638 | Ga0395901_0042089 | |||
| 2639 | Ga0395901_0043523 | |||
| 2640 | Ga0395901_0085298 | |||
| 2641 | Ga0395901_0091651 | |||
| 2642 | Ga0395901_0191869 | |||
| 2643 | Ga0395901_0364420 | |||
| 2644 | Ga0395901_0380430 | |||
| 2645 | Ga0395901_0409318 | |||
| 2646 | Ga0395901_0459791 | |||
| 2647 | Ga0395901_0999777 | |||
| 2648 | Ga0400489_52975 | |||
| 2649 | Ga0436365_0103782 | |||
| 2650 | Ga0436365_0284985 | |||
| 2651 | Ga0436365_0833878 | |||
| 2652 | Ga0436365_0984498 | |||
| 2653 | Ga0436365_1132330 | |||
| 2654 | Ga0436365_1201209 | |||
| 2655 | Ga0436365_1508968 | |||
| 2656 | Ga0436365_1650855 | |||
| 2657 | Ga0436360_0076173 | |||
| 2658 | Ga0436360_1171319 | |||
| 2659 | Ga0436361_0675132 | |||
| 2660 | Ga0436363_0142313 | |||
| 2661 | Ga0436363_0551063 | |||
| 2662 | Ga0436363_0983416 | |||
| 2663 | Ga0436363_1540769 | |||
| 2664 | Ga0436362_0284509 | |||
| 2665 | Ga0436362_1269102 | |||
| 2666 | Ga0439465_0142098 | |||
| 2667 | Ga0439431_0032534 | |||
| 2668 | Ga0439445_0012379 | |||
| 2669 | Ga0439448_0005347 | |||
| 2670 | Ga0439448_0028107 | |||
| 2671 | Ga0439432_035378 | |||
| 2672 | Ga0439432_086450 | |||
| 2673 | Ga0439449_0110082 | |||
| 2674 | Ga0439455_0001446 | |||
| 2675 | Ga0439462_0038210 | |||
| 2676 | Ga0439446_0001493 | |||
| 2677 | Ga0439446_0103679 | |||
| 2678 | Ga0439458_0000158 | |||
| 2679 | Ga0439435_0001209 | |||
| 2680 | Ga0439459_0005999 | |||
| 2681 | Ga0439464_0032379 | |||
| 2682 | Ga0450901_006714 | |||
| 2683 | Ga0466969_0035161 | |||
| 2684 | Ga0466965_0108554 | |||
| 2685 | Ga0466963_0000501 | |||
| 2686 | Ga0466963_0011908 | |||
| 2687 | Ga0466963_0013247 | |||
| 2688 | Ga0466963_0018123 | |||
| 2689 | Ga0466963_0047776 | |||
| 2690 | Ga0466963_0062418 | |||
| 2691 | Ga0466963_0150112 | |||
| 2692 | Ga0466963_0553476 | |||
| 2693 | Ga0466964_0007276 | |||
| 2694 | Ga0466964_0160003 | |||
| 2695 | Ga0466964_0262696 | |||
| 2696 | Ga0466957_0000802 | |||
| 2697 | Ga0466957_0013729 | |||
| 2698 | Ga0466957_0030914 | |||
| 2699 | Ga0466957_0381626 | |||
| 2700 | Ga0466960_0154608 | |||
| 2701 | Ga0466959_0013649 | |||
| 2702 | Ga0466958_0013632 | |||
| 2703 | Ga0466958_0020502 | |||
| 2704 | Ga0466958_0288674 | |||
| 2705 | Ga0466967_0000024 | |||
| 2706 | Ga0466967_0002769 | |||
| 2707 | Ga0466967_0015588 | |||
| 2708 | Ga0466967_0046896 | |||
| 2709 | Ga0466967_0077387 | |||
| 2710 | Ga0466967_0100109 | |||
| 2711 | Ga0466967_0111750 | |||
| 2712 | Ga0466967_0187525 | |||
| 2713 | Ga0466967_0194427 | |||
| 2714 | Ga0466967_0358664 | |||
| 2715 | Ga0466967_0604378 | |||
| 2716 | Ga0495627_000513 | |||
| 2717 | Ga0495592_0150922 | |||
| 2718 | Ga0495590_0000309 | |||
| 2719 | Ga0495638_0000230 | |||
| 2720 | Ga0495638_0000782 | |||
| 2721 | Ga0495638_0006940 | |||
| 2722 | Ga0495638_0010430 | |||
| 2723 | Ga0495638_0010791 | |||
| 2724 | Ga0495651_0232429 | |||
| 2725 | Ga0495650_0000207 | |||
| 2726 | Ga0495585_0116160 | |||
| 2727 | Ga0495583_0000399 | |||
| 2728 | Ga0495606_0000235 | |||
| 2729 | Ga0495606_0019418 | |||
| 2730 | Ga0495606_0158771 | |||
| 2731 | Ga0495608_0180336 | |||
| 2732 | Ga0495610_0003520 | |||
| 2733 | Ga0495616_0001022 | |||
| 2734 | Ga0495631_0003193 | |||
| 2735 | Ga0495637_0017854 | |||
| 2736 | Ga0495637_0027794 | |||
| 2737 | Ga0495648_0001057 | |||
| 2738 | Ga0495648_0116952 | |||
| 2739 | Ga0495663_0028746 | |||
| 2740 | Ga0495654_0000016 | |||
| 2741 | Ga0495587_0051650 | |||
| 2742 | Ga0495587_0124576 | |||
| 2743 | Ga0495598_0000857 | |||
| 2744 | Ga0495609_0023724 | |||
| 2745 | Ga0495621_0000049 | |||
| 2746 | Ga0495621_0088369 | |||
| 2747 | Ga0495633_0065016 | |||
| 2748 | Ga0495668_0017135 | |||
| 2749 | Ga0495625_0005971 | |||
| 2750 | Ga0495635_0192347 | |||
| 2751 | Ga0495669_0000006 | |||
| 2752 | Ga0495669_0000398 | |||
| 2753 | Ga0495669_0005037 | |||
| 2754 | Ga0495669_0007319 | |||
| 2755 | Ga0495669_0013960 | |||
| 2756 | Ga0495669_0188377 | |||
| 2757 | Ga0495613_0000590 | |||
| 2758 | Ga0495670_0000265 | |||
| 2759 | Ga0495660_0268352 | |||
| 2760 | Ga0495636_0153802 | |||
| 2761 | Ga0495672_0002013 | |||
| 2762 | Ga0495672_0052103 | |||
| 2763 | Ga0495680_0380985 | |||
| 2764 | Ga0495677_0059853 | |||
| 2765 | Ga0495677_0112864 | |||
| 2766 | Ga0495685_091204 | |||
| 2767 | Ga0495685_092571 | |||
| 2768 | Ga0495673_0000223 | |||
| 2769 | Ga0495673_0000289 | |||
| 2770 | Ga0495681_0041632 | |||
| 2771 | Ga0495686_0000173 | |||
| 2772 | Ga0495686_0000302 | |||
| 2773 | Ga0495686_0001197 | |||
| 2774 | Ga0495686_0005206 | |||
| 2775 | Ga0495686_0009790 | |||
| 2776 | Ga0496100_0045726 | |||
| 2777 | Ga0496100_0110933 | |||
| 2778 | Ga0496100_0509314 | |||
| 2779 | Ga0496101_0081333 | |||
| 2780 | Ga0496101_0135091 | |||
| 2781 | Ga0496101_0159463 | |||
| 2782 | Ga0496101_0314019 | |||
| 2783 | Ga0496102_0000043 | |||
| 2784 | Ga0496102_0043292 | |||
| 2785 | Ga0496102_0060888 | |||
| 2786 | Ga0496102_0094769 | |||
| 2787 | Ga0496102_0142838 | |||
| 2788 | Ga0496102_0186159 | |||
| 2789 | Ga0496102_0561976 | |||
| 2790 | Ga0496103_0000133 | |||
| 2791 | Ga0496103_0010883 | |||
| 2792 | Ga0496104_0341073 | |||
| 2793 | Ga0496104_0689853 | |||
| 2794 | Ga0496105_0188569 | |||
| 2795 | Ga0496106_0003227 | |||
| 2796 | Ga0496106_0038710 | |||
| 2797 | Ga0496106_0139118 | |||
| 2798 | Ga0496107_0000029 | |||
| 2799 | Ga0496107_0006522 | |||
| 2800 | Ga0496107_0007192 | |||
| 2801 | Ga0496107_0035157 | |||
| 2802 | Ga0496107_0074657 | |||
| 2803 | Ga0496107_0089908 | |||
| 2804 | Ga0496108_0006530 | |||
| 2805 | Ga0496108_0008130 | |||
| 2806 | Ga0496108_0008556 | |||
| 2807 | Ga0496108_0134690 | |||
| 2808 | Ga0496108_0160410 | |||
| 2809 | Ga0496109_0004600 | |||
| 2810 | Ga0496109_0021876 | |||
| 2811 | Ga0496109_0064963 | |||
| 2812 | Ga0496109_0082404 | |||
| 2813 | Ga0496109_0103556 | |||
| 2814 | Ga0496109_0123626 | |||
| 2815 | Ga0496109_0444530 | |||
| 2816 | Ga0496110_0006236 | |||
| 2817 | Ga0496110_0020235 | |||
| 2818 | Ga0496110_0096382 | |||
| 2819 | Ga0496110_0433396 | |||
| 2820 | Ga0496110_0611554 | |||
| 2821 | Ga0496111_0023348 | |||
| 2822 | Ga0496111_0027139 | |||
| 2823 | Ga0496111_0451894 | |||
| 2824 | Ga0496112_0000530 | |||
| 2825 | Ga0496112_0014138 | |||
| 2826 | Ga0496112_0227574 | |||
| 2827 | Ga0496112_0239270 | |||
| 2828 | Ga0496112_0477867 | |||
| 2829 | Ga0496113_0032649 | |||
| 2830 | Ga0496113_0040762 | |||
| 2831 | Ga0496113_0125824 | |||
| 2832 | Ga0496113_0433730 | |||
| 2833 | Ga0496114_0006408 | |||
| 2834 | Ga0496114_0051260 | |||
| 2835 | Ga0496114_0319928 | |||
| 2836 | Ga0496115_0053223 | |||
| 2837 | Ga0496115_0232389 | |||
| 2838 | Ga0496115_0249675 | |||
| 2839 | Ga0496116_0000682 | |||
| 2840 | Ga0496117_0000104 | |||
| 2841 | Ga0496117_0025476 | |||
| 2842 | Ga0496117_0041931 | |||
| 2843 | Ga0496118_0000080 | |||
| 2844 | Ga0496118_0000525 | |||
| 2845 | Ga0496118_0043175 | |||
| 2846 | Ga0496120_0187970 | |||
| 2847 | Ga0496121_0000066 | |||
| 2848 | Ga0496121_0006516 | |||
| 2849 | Ga0496121_0011567 | |||
| 2850 | Ga0496121_0401820 | |||
| 2851 | Ga0496123_0068947 | |||
| 2852 | Ga0496124_0000093 | |||
| 2853 | Ga0496124_0087875 | |||
| 2854 | Ga0495678_000773 | |||
| 2855 | Ga0495682_0000658 | |||
| 2856 | Ga0501031_0036865 | |||
| 2857 | Ga0501032_0008554 | |||
| 2858 | Ga0501032_0009632 | |||
| 2859 | Ga0501032_0170923 | |||
| 2860 | Ga0501032_0360545 | |||
| 2861 | Ga0501033_0004236 | |||
| 2862 | Ga0501033_0005853 | |||
| 2863 | Ga0501033_0253042 | |||
| 2864 | Ga0501034_0002130 | |||
| 2865 | Ga0501034_0005232 | |||
| 2866 | Ga0501034_0032948 | |||
| 2867 | Ga0501034_0169748 | |||
| 2868 | Ga0501036_0011308 | |||
| 2869 | Ga0501036_0029813 | |||
| 2870 | Ga0501037_0014252 | |||
| 2871 | Ga0501037_0016778 | |||
| 2872 | Ga0501037_0145967 | |||
| 2873 | Ga0501038_0028740 | |||
| 2874 | Ga0501038_0032796 | |||
| 2875 | Ga0501039_0003743 | |||
| 2876 | Ga0501043_0013446 | |||
| 2877 | Ga0501043_0024575 | |||
| 2878 | Ga0501043_0116693 | |||
| 2879 | Ga0501046_0002274 | |||
| 2880 | Ga0501046_0008229 | |||
| 2881 | Ga0501047_0112775 | |||
| 2882 | Ga0501047_0126532 | |||
| 2883 | Ga0501047_0282973 | |||
| 2884 | Ga0501047_0408262 | |||
| 2885 | Ga0501048_0013582 | |||
| 2886 | Ga0501067_0000644 | |||
| 2887 | Ga0501067_0014831 | |||
| 2888 | Ga0501067_0042411 | |||
| 2889 | Ga0501068_0227725 | |||
| 2890 | Ga0501069_0032248 | |||
| 2891 | Ga0501070_0005951 | |||
| 2892 | Ga0501070_0018814 | |||
| 2893 | Ga0501070_0020265 | |||
| 2894 | Ga0501070_0227898 | |||
| 2895 | Ga0501072_0069426 | |||
| 2896 | Ga0501073_0008900 | |||
| 2897 | Ga0501073_0030538 | |||
| 2898 | Ga0501074_0000896 | |||
| 2899 | Ga0501074_0032006 | |||
| 2900 | Ga0501074_0079037 | |||
| 2901 | Ga0501074_0242197 | |||
| 2902 | Ga0501209_015118 | |||
| 2903 | Ga0501217_053211 | |||
| 2904 | Ga0501223_001035 | |||
| 2905 | Ga0501224_000028 | |||
| 2906 | Ga0501235_010652 | |||
| 2907 | Ga0501238_003510 | |||
| 2908 | Ga0501238_043476 | |||
| 2909 | Ga0501253_018228 | |||
| 2910 | Ga0501225_0001850 | |||
| 2911 | Ga0501234_002566 | |||
| 2912 | Ga0501080_0105632 | |||
| 2913 | Ga0501080_0129778 | |||
| 2914 | Ga0501083_0008289 | |||
| 2915 | Ga0501083_0022513 | |||
| 2916 | Ga0501270_017546 | |||
| 2917 | Ga0501273_001732 | |||
| 2918 | Ga0501035_0005815 | |||
| 2919 | Ga0501035_0108293 | |||
| 2920 | Ga0501035_0240154 | |||
| 2921 | Ga0501035_0582535 | |||
| 2922 | Ga0501044_0006073 | |||
| 2923 | Ga0501044_0014438 | |||
| 2924 | Ga0501044_0022693 | |||
| 2925 | Ga0501044_0044949 | |||
| 2926 | Ga0501044_0052094 | |||
| 2927 | Ga0501044_0064110 | |||
| 2928 | Ga0501044_0115403 | |||
| 2929 | Ga0501044_0115827 | |||
| 2930 | Ga0501226_000146 | |||
| 2931 | nmdc:mga03683_28884_c1 | |||
| 2932 | nmdc:mga00v17_140697_c1 | |||
| 2933 | nmdc:mga00v17_485519_c1 | |||
| 2934 | nmdc:mga0k408_211209_c1 | |||
| 2935 | nmdc:mga05p37_775333_c1 | |||
| 2936 | nmdc:mga06r32_454547_c1 | |||
| 2937 | Ga0495601_0058425 | |||
| 2938 | Ga0495655_0020270 | |||
| 2939 | Ga0495595_0073272 | |||
| 2940 | Ga0495619_0009805 | |||
| 2941 | Ga0500578_0001117 | |||
| 2942 | Ga0500643_000167 | |||
| 2943 | Ga0500643_000491 | |||
| 2944 | Ga0500643_001394 | |||
| 2945 | Ga0500644_0000074 | |||
| 2946 | Ga0500646_0007172 | |||
| 2947 | Ga0500554_005310 | |||
| 2948 | Ga0500555_040626 | |||
| 2949 | Ga0500556_0000954 | |||
| 2950 | Ga0500594_0000093 | |||
| 2951 | Ga0500608_076530 | |||
| 2952 | Ga0500618_000152 | |||
| 2953 | Ga0500655_001656 | |||
| 2954 | Ga0500658_0000106 | |||
| 2955 | Ga0500559_0000016 | |||
| 2956 | Ga0500559_0000054 | |||
| 2957 | Ga0500559_0041779 | |||
| 2958 | Ga0500564_000094 | |||
| 2959 | Ga0500568_0000708 | |||
| 2960 | Ga0500577_0001695 | |||
| 2961 | Ga0500604_0000004 | |||
| 2962 | Ga0500616_0000195 | |||
| 2963 | Ga0500622_0001162 | |||
| 2964 | Ga0500622_0027985 | |||
| 2965 | Ga0500627_0001136 | |||
| 2966 | Ga0500633_0032807 | |||
| 2967 | Ga0500611_007405 | |||
| 2968 | Ga0500609_000159 | |||
| 2969 | Ga0501084_0008910 | |||
| 2970 | Ga0501084_0160520 | |||
| 2971 | Ga0500661_001304 | |||
| 2972 | Ga0500661_006208 | |||
| 2973 | Ga0501082_0007396 | |||
| 2974 | Ga0501082_0008750 | |||
| 2975 | Ga0501082_0033247 | |||
| 2976 | 2511121904 | |||
| 2977 | 2585148266 | |||
| 2978 | 2585150955 | |||
| 2979 | 2585196383 | |||
| 2980 | 2643750351 | |||
| 2981 | 2643780461 | |||
| 2982 | 2643926969 | |||
| 2983 | 2643932136 | |||
| 2984 | 2644507240 | |||
| 2985 | 2819538107 | |||
| 2986 | 2819647323 | |||
| 2987 | 2830077709 | |||
| 2988 | 2837651421 | |||
| 2989 | 2848298467 | |||
| 2990 | 2891048537 | |||
| 2991 | 2895884264 | |||
| 2992 | 2896430475 | |||
| 2993 | 2946788531 | |||
| 2994 | 2995394393 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9716 | 3 | 119 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9688 | 2 | 115 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9675 | 1 | 118 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9627 | 3 | 120 |
| 1zh4-assembly1.cif.gz_A | crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe | 0.9571 | 3 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9874 | 3 | 81 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9752 | 3 | 81 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9743 | 1 | 81 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9739 | 3 | 81 | 3.40.50.2300 |
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9702 | 3 | 84 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382R6X6-F1-model_v4 | Response regulatory domain-containing protein | 0.9798 | 1 | 116 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A149UWK3-F1-model_v4 | deleted | 0.9786 | 1 | 121 |
|
| AF-A0A3A1PHS9-F1-model_v4 | DNA-binding response regulator | 0.9782 | 1 | 115 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2A4RET6-F1-model_v4 | DNA-binding response regulator | 0.9782 | 1 | 116 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-J3A137-F1-model_v4 | Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain | 0.9765 | 2 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |