F494314
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1487 | 716 | 1270 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10723903|Ga0070658_107239032 |
| Length | 149 |
| Sequence | MNQAAATATRTVTLEREFAHPPEKVWRALTQPELVAEWLMRNDIKPVVGHRFNFRADPMPGWNGVTDCEVLVAEAPRRLSYTWNASGEEAKTGIKTVVTFTLTPTKAGTLLHMEQSGFRAEHDHDRFFQGAQYGWQKMLGALEGVLSRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 6 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 9 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 10 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 11 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 12 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 13 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 14 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 15 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 16 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 17 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 26 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 27 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 28 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 29 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 30 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 31 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 32 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 33 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 34 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 35 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 36 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 37 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 38 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 39 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 40 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 41 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 42 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 43 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 44 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 45 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 46 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 47 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 48 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 49 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 50 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 51 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 52 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 53 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 54 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 55 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 56 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 57 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 58 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 59 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 60 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 61 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 62 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 63 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 64 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 65 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 66 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 67 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 68 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 69 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 70 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 71 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 72 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 73 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 74 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 75 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 76 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 77 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 78 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 79 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 82 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 92 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 97 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 98 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 101 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 102 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 103 | 2904699407 | |||
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 108 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 109 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 110 | 2922368715 | |||
| 111 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 112 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 113 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 114 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 115 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 116 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 117 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 118 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 119 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 120 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 121 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 122 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 123 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 124 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 125 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 126 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 127 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 128 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 129 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 130 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 131 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 132 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 133 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 134 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 135 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 136 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 137 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 138 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 139 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 140 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 141 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 142 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 143 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 144 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 145 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 146 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 147 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 148 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 149 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 150 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 151 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 152 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 153 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 154 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 155 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 156 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 157 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 158 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 159 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 160 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 161 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 162 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 163 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 164 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 165 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 166 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 167 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 168 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 169 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 170 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 171 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 172 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 173 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 174 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 175 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 176 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 177 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 178 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 179 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 180 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 181 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 182 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 183 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 184 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 185 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 186 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 187 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 188 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 189 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 190 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 191 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 192 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 194 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 195 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 196 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 202 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 203 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 206 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 208 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 210 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 211 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 213 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 223 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 239 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 241 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 243 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 244 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 246 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 248 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 249 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 253 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 254 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 256 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 257 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 259 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 260 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 261 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 262 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 263 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 264 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 265 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 266 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 267 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 268 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 269 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 270 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 271 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 273 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 274 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 275 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 276 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 277 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 278 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 279 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 280 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 281 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 282 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 284 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 285 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 286 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 287 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 288 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 289 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 291 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 292 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 293 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 294 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 295 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 296 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 312 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 326 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 328 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 329 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 330 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 331 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 334 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 337 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 340 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 344 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 347 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 410 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 411 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 412 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 413 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 414 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 420 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 421 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 422 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 423 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 424 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 425 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 426 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 427 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 428 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 429 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 430 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 431 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 432 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 433 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 434 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 435 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 436 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 437 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 438 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 439 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 440 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 441 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 442 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 443 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 444 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 445 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 446 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 447 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 448 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 449 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 450 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 451 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 452 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 453 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 454 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 455 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 456 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 457 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 458 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 459 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 460 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 461 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 462 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 463 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 464 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 465 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 466 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 467 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 468 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 469 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 470 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 471 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 472 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 473 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 474 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 475 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 476 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 477 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 478 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 479 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 572 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 573 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 574 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 575 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 576 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 577 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 578 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 579 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 580 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 581 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 582 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 583 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 584 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 585 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 586 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 587 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 588 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 589 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 590 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 591 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 592 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 593 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 594 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 595 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 596 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 597 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 598 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 599 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 605 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 606 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 610 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 612 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 615 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 616 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 617 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 618 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 619 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 622 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 623 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 625 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 626 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 627 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 628 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 629 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 630 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 631 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 632 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 633 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 635 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 636 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 637 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 638 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 641 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 645 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 646 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 647 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 648 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 649 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 650 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 651 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 652 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 653 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 654 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 655 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 656 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 657 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 658 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 659 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 660 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 661 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 662 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 663 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 664 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 665 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 666 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 667 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 668 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 669 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 670 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 671 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 672 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 673 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 674 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 675 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 676 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 677 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 678 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 679 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 680 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 681 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 683 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 684 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 686 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 687 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 688 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 689 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 690 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 691 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 692 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 693 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 694 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 695 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 696 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 697 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 698 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 699 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 700 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 701 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 702 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 703 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 704 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 705 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 706 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 707 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 708 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 709 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 710 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 711 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 712 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 713 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 714 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 715 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 716 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.25 |
| Metatranscriptomes | 0.27 |
| Isolates | 14.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.49 |
| Nodule | 11.03 |
| Rhizoplane | 5.11 |
| Rhizosphere | 64.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003943 | 3300001979 | Bacteria | 6441 |
| 2 | JGI24740J21852_10051577 | 3300001979 | Bacteria | 1176 |
| 3 | JGI24739J22299_10074626 | 3300001989 | Bacteria | 1050 |
| 4 | JGI24737J22298_10192393 | 3300001990 | Bacteria | 602 |
| 5 | JGI24738J21930_10016468 | 3300002075 | Bacteria | 1561 |
| 6 | JGI25151J46595_10004677 | 3300003187 | Bacteria | 7198 |
| 7 | JGI25406J46586_10000580 | 3300003203 | Bacteria | 17278 |
| 8 | JGI25153J46596_10006573 | 3300003215 | Bacteria | 5862 |
| 9 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 10 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 11 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 12 | Ga0055524_1021940 | 3300003775 | Bacteria | 2101 |
| 13 | Ga0055531_10010256 | 3300003794 | Bacteria | 4683 |
| 14 | Ga0055543_1003926 | 3300004625 | Bacteria | 4202 |
| 15 | Ga0065165_1000891 | 3300005262 | Bacteria | 38572 |
| 16 | Ga0065165_1001577 | 3300005262 | Bacteria | 23479 |
| 17 | Ga0065165_1002943 | 3300005262 | Bacteria | 12977 |
| 18 | Ga0065165_1012860 | 3300005262 | Bacteria | 3374 |
| 19 | Ga0065165_1059411 | 3300005262 | Bacteria | 1052 |
| 20 | Ga0065165_1115834 | 3300005262 | Bacteria | 655 |
| 21 | Ga0065714_10469235 | 3300005288 | Bacteria | 542 |
| 22 | Ga0065715_10060973 | 3300005293 | Bacteria | 823 |
| 23 | Ga0065715_10792325 | 3300005293 | Bacteria | 613 |
| 24 | Ga0070658_10538913 | 3300005327 | Bacteria | 1010 |
| 25 | Ga0070658_10723903 | 3300005327 | Unclassified | 864 |
| 26 | Ga0070658_11875517 | 3300005327 | Bacteria | 518 |
| 27 | Ga0070676_10376874 | 3300005328 | Bacteria | 981 |
| 28 | Ga0070683_100299943 | 3300005329 | Bacteria | 1529 |
| 29 | Ga0070677_10233329 | 3300005333 | Bacteria | 905 |
| 30 | Ga0068869_100055689 | 3300005334 | Bacteria | 2882 |
| 31 | Ga0068869_100198606 | 3300005334 | Bacteria | 1580 |
| 32 | Ga0068869_100818109 | 3300005334 | Bacteria | 802 |
| 33 | Ga0068869_101428411 | 3300005334 | Bacteria | 613 |
| 34 | Ga0070666_10112021 | 3300005335 | Bacteria | 1888 |
| 35 | Ga0070680_100003117 | 3300005336 | Bacteria | 12308 |
| 36 | Ga0070680_100110465 | 3300005336 | Bacteria | 2289 |
| 37 | Ga0070682_100009795 | 3300005337 | Bacteria | 5425 |
| 38 | Ga0070682_100960234 | 3300005337 | Bacteria | 707 |
| 39 | Ga0070660_100025088 | 3300005339 | Bacteria | 4429 |
| 40 | Ga0070660_100408115 | 3300005339 | Bacteria | 1124 |
| 41 | Ga0070660_101326882 | 3300005339 | Bacteria | 611 |
| 42 | Ga0070689_100000310 | 3300005340 | Bacteria | 28390 |
| 43 | Ga0070691_10000574 | 3300005341 | Bacteria | 14032 |
| 44 | Ga0070691_10013745 | 3300005341 | Bacteria | 3714 |
| 45 | Ga0070687_100020588 | 3300005343 | Bacteria | 3087 |
| 46 | Ga0070687_100786691 | 3300005343 | Bacteria | 673 |
| 47 | Ga0070687_100892480 | 3300005343 | Bacteria | 637 |
| 48 | Ga0070661_100698507 | 3300005344 | Unclassified | 826 |
| 49 | Ga0070661_101071932 | 3300005344 | Bacteria | 670 |
| 50 | Ga0070661_101313280 | 3300005344 | Bacteria | 607 |
| 51 | Ga0070661_101499468 | 3300005344 | Bacteria | 569 |
| 52 | Ga0070692_10196571 | 3300005345 | Bacteria | 1178 |
| 53 | Ga0070668_100029805 | 3300005347 | Bacteria | 4146 |
| 54 | Ga0070668_100030699 | 3300005347 | Bacteria | 4088 |
| 55 | Ga0070669_100001017 | 3300005353 | Bacteria | 20430 |
| 56 | Ga0070669_100224944 | 3300005353 | Bacteria | 1485 |
| 57 | Ga0070671_100006071 | 3300005355 | Bacteria | 9625 |
| 58 | Ga0070671_100016959 | 3300005355 | Bacteria | 5890 |
| 59 | Ga0070674_100013611 | 3300005356 | Bacteria | 5034 |
| 60 | Ga0070674_100115388 | 3300005356 | Bacteria | 1980 |
| 61 | Ga0070674_100267362 | 3300005356 | Bacteria | 1350 |
| 62 | Ga0070673_100291174 | 3300005364 | Bacteria | 1435 |
| 63 | Ga0070688_100940626 | 3300005365 | Bacteria | 684 |
| 64 | Ga0070659_100598933 | 3300005366 | Bacteria | 947 |
| 65 | Ga0070667_100084821 | 3300005367 | Bacteria | 2716 |
| 66 | Ga0070667_100101966 | 3300005367 | Bacteria | 2479 |
| 67 | Ga0070667_100159713 | 3300005367 | Bacteria | 1984 |
| 68 | Ga0070703_10001384 | 3300005406 | Bacteria | 7352 |
| 69 | Ga0070709_10009416 | 3300005434 | Bacteria | 5389 |
| 70 | Ga0070714_100055909 | 3300005435 | Bacteria | 3374 |
| 71 | Ga0070714_100249358 | 3300005435 | Bacteria | 1641 |
| 72 | Ga0070714_100329505 | 3300005435 | Bacteria | 1429 |
| 73 | Ga0070713_100129970 | 3300005436 | Bacteria | 2220 |
| 74 | Ga0070713_100834282 | 3300005436 | Bacteria | 885 |
| 75 | Ga0070701_10137612 | 3300005438 | Bacteria | 1393 |
| 76 | Ga0070711_100007910 | 3300005439 | Bacteria | 6482 |
| 77 | Ga0070705_100002172 | 3300005440 | Bacteria | 9965 |
| 78 | Ga0070700_100002573 | 3300005441 | Bacteria | 9275 |
| 79 | Ga0070700_100052891 | 3300005441 | Bacteria | 2533 |
| 80 | Ga0070700_100177999 | 3300005441 | Bacteria | 1478 |
| 81 | Ga0070708_100040322 | 3300005445 | Bacteria | 4089 |
| 82 | Ga0070663_100007077 | 3300005455 | Bacteria | 6806 |
| 83 | Ga0070663_100059561 | 3300005455 | Bacteria | 2744 |
| 84 | Ga0070663_100088233 | 3300005455 | Bacteria | 2293 |
| 85 | Ga0070663_100143105 | 3300005455 | Bacteria | 1827 |
| 86 | Ga0070663_100236397 | 3300005455 | Bacteria | 1441 |
| 87 | Ga0070663_100268402 | 3300005455 | Bacteria | 1356 |
| 88 | Ga0070663_100420824 | 3300005455 | Bacteria | 1096 |
| 89 | Ga0070678_100750392 | 3300005456 | Bacteria | 883 |
| 90 | Ga0070662_100345002 | 3300005457 | Bacteria | 1219 |
| 91 | Ga0070662_101540312 | 3300005457 | Bacteria | 573 |
| 92 | Ga0070681_10564684 | 3300005458 | Bacteria | 1052 |
| 93 | Ga0068867_100024353 | 3300005459 | Bacteria | 4336 |
| 94 | Ga0068867_101139361 | 3300005459 | Bacteria | 714 |
| 95 | Ga0070707_100325697 | 3300005468 | Bacteria | 1493 |
| 96 | Ga0070707_100915434 | 3300005468 | Bacteria | 842 |
| 97 | Ga0070698_100298207 | 3300005471 | Bacteria | 1543 |
| 98 | Ga0070699_100000444 | 3300005518 | Bacteria | 39757 |
| 99 | Ga0070679_100033410 | 3300005530 | Bacteria | 5094 |
| 100 | Ga0070679_100379775 | 3300005530 | Bacteria | 1360 |
| 101 | Ga0070679_100483287 | 3300005530 | Bacteria | 1183 |
| 102 | Ga0070684_100181505 | 3300005535 | Bacteria | 1914 |
| 103 | Ga0070697_100524187 | 3300005536 | Bacteria | 1037 |
| 104 | Ga0068853_100014406 | 3300005539 | Bacteria | 6473 |
| 105 | Ga0068853_100332127 | 3300005539 | Bacteria | 1411 |
| 106 | Ga0070672_100194422 | 3300005543 | Bacteria | 1695 |
| 107 | Ga0070686_100004627 | 3300005544 | Bacteria | 7588 |
| 108 | Ga0070686_100014576 | 3300005544 | Bacteria | 4535 |
| 109 | Ga0070695_100267172 | 3300005545 | Bacteria | 1252 |
| 110 | Ga0070696_100000123 | 3300005546 | Bacteria | 40797 |
| 111 | Ga0070696_100026755 | 3300005546 | Bacteria | 3926 |
| 112 | Ga0070693_100008394 | 3300005547 | Bacteria | 5090 |
| 113 | Ga0070693_100412584 | 3300005547 | Bacteria | 939 |
| 114 | Ga0070665_100000186 | 3300005548 | Bacteria | 110750 |
| 115 | Ga0070665_100036208 | 3300005548 | Bacteria | 4965 |
| 116 | Ga0070665_100119168 | 3300005548 | Bacteria | 2641 |
| 117 | Ga0070665_100415465 | 3300005548 | Bacteria | 1354 |
| 118 | Ga0070665_100780062 | 3300005548 | Bacteria | 969 |
| 119 | Ga0070665_101028932 | 3300005548 | Bacteria | 836 |
| 120 | Ga0070665_101728303 | 3300005548 | Bacteria | 633 |
| 121 | Ga0070704_100000095 | 3300005549 | Bacteria | 30467 |
| 122 | Ga0070704_101306703 | 3300005549 | Bacteria | 664 |
| 123 | Ga0068855_100002071 | 3300005563 | Bacteria | 24841 |
| 124 | Ga0070664_100248835 | 3300005564 | Bacteria | 1597 |
| 125 | Ga0068857_100003759 | 3300005577 | Bacteria | 12760 |
| 126 | Ga0068857_100402373 | 3300005577 | Bacteria | 1274 |
| 127 | Ga0068856_100123838 | 3300005614 | Bacteria | 2588 |
| 128 | Ga0068856_100157077 | 3300005614 | Bacteria | 2285 |
| 129 | Ga0068856_100468497 | 3300005614 | Bacteria | 1280 |
| 130 | Ga0068856_100570800 | 3300005614 | Bacteria | 1152 |
| 131 | Ga0068856_101683472 | 3300005614 | Bacteria | 647 |
| 132 | Ga0070702_100000980 | 3300005615 | Bacteria | 11256 |
| 133 | Ga0070702_100135943 | 3300005615 | Bacteria | 1559 |
| 134 | Ga0070702_100392834 | 3300005615 | Bacteria | 990 |
| 135 | Ga0068852_100001899 | 3300005616 | Bacteria | 14214 |
| 136 | Ga0068852_100975061 | 3300005616 | Bacteria | 866 |
| 137 | Ga0068859_100000243 | 3300005617 | Bacteria | 53580 |
| 138 | Ga0068859_100001820 | 3300005617 | Bacteria | 21717 |
| 139 | Ga0068859_100457790 | 3300005617 | Bacteria | 1372 |
| 140 | Ga0068864_100379208 | 3300005618 | Bacteria | 1340 |
| 141 | Ga0068866_10053091 | 3300005718 | Bacteria | 2071 |
| 142 | Ga0068866_10620247 | 3300005718 | Bacteria | 733 |
| 143 | Ga0068861_100000133 | 3300005719 | Bacteria | 38239 |
| 144 | Ga0068861_100004883 | 3300005719 | Bacteria | 9025 |
| 145 | Ga0068861_100011940 | 3300005719 | Bacteria | 6049 |
| 146 | Ga0068861_100128229 | 3300005719 | Bacteria | 2056 |
| 147 | Ga0068861_100400345 | 3300005719 | Bacteria | 1218 |
| 148 | Ga0068851_10123075 | 3300005834 | Bacteria | 1396 |
| 149 | Ga0068870_10236720 | 3300005840 | Bacteria | 1125 |
| 150 | Ga0068863_100174025 | 3300005841 | Bacteria | 2065 |
| 151 | Ga0068858_100111947 | 3300005842 | Bacteria | 2549 |
| 152 | Ga0068858_101307606 | 3300005842 | Bacteria | 714 |
| 153 | Ga0068860_100002696 | 3300005843 | Bacteria | 18484 |
| 154 | Ga0068860_100153211 | 3300005843 | Bacteria | 2220 |
| 155 | Ga0068860_101556681 | 3300005843 | Bacteria | 683 |
| 156 | Ga0068862_100087870 | 3300005844 | Bacteria | 2703 |
| 157 | Ga0068862_100160424 | 3300005844 | Bacteria | 2007 |
| 158 | Ga0068862_100597866 | 3300005844 | Bacteria | 1059 |
| 159 | Ga0081538_10023382 | 3300005981 | Bacteria | 4445 |
| 160 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 161 | Ga0070717_10093009 | 3300006028 | Bacteria | 2548 |
| 162 | Ga0070717_10696414 | 3300006028 | Bacteria | 923 |
| 163 | Ga0075365_10011522 | 3300006038 | Bacteria | 5201 |
| 164 | Ga0075365_10172325 | 3300006038 | Bacteria | 1511 |
| 165 | Ga0075368_10080960 | 3300006042 | Bacteria | 1321 |
| 166 | Ga0075368_10333237 | 3300006042 | Bacteria | 659 |
| 167 | Ga0075363_100006916 | 3300006048 | Bacteria | 5187 |
| 168 | Ga0075363_100241070 | 3300006048 | Bacteria | 1039 |
| 169 | Ga0075364_10019010 | 3300006051 | Bacteria | 4309 |
| 170 | Ga0075364_10132828 | 3300006051 | Bacteria | 1671 |
| 171 | Ga0075364_10606421 | 3300006051 | Bacteria | 748 |
| 172 | Ga0075432_10013503 | 3300006058 | Bacteria | 2774 |
| 173 | Ga0075432_10082995 | 3300006058 | Bacteria | 1164 |
| 174 | Ga0070716_100008614 | 3300006173 | Bacteria | 5068 |
| 175 | Ga0070716_100266843 | 3300006173 | Bacteria | 1174 |
| 176 | Ga0075362_10075932 | 3300006177 | Bacteria | 1542 |
| 177 | Ga0075362_10150358 | 3300006177 | Bacteria | 1117 |
| 178 | Ga0075362_10190769 | 3300006177 | Bacteria | 995 |
| 179 | Ga0075367_10193645 | 3300006178 | Bacteria | 1269 |
| 180 | Ga0075369_10026088 | 3300006186 | Bacteria | 2434 |
| 181 | Ga0075369_10163813 | 3300006186 | Bacteria | 1019 |
| 182 | Ga0075366_10011171 | 3300006195 | Bacteria | 5063 |
| 183 | Ga0075366_10443400 | 3300006195 | Bacteria | 801 |
| 184 | Ga0075366_10672391 | 3300006195 | Bacteria | 643 |
| 185 | Ga0097621_100051794 | 3300006237 | Bacteria | 3342 |
| 186 | Ga0097621_100605629 | 3300006237 | Bacteria | 1002 |
| 187 | Ga0075370_10079858 | 3300006353 | Bacteria | 1879 |
| 188 | Ga0075370_10135879 | 3300006353 | Bacteria | 1436 |
| 189 | Ga0075370_10374871 | 3300006353 | Bacteria | 852 |
| 190 | Ga0068871_100121011 | 3300006358 | Bacteria | 2211 |
| 191 | Ga0075428_100056272 | 3300006844 | Bacteria | 4308 |
| 192 | Ga0075433_10206341 | 3300006852 | Bacteria | 1747 |
| 193 | Ga0075434_100314498 | 3300006871 | Bacteria | 1586 |
| 194 | Ga0068865_100044915 | 3300006881 | Bacteria | 3026 |
| 195 | Ga0097620_100000243 | 3300006931 | Bacteria | 53580 |
| 196 | Ga0097620_100001820 | 3300006931 | Bacteria | 21717 |
| 197 | Ga0097620_100457744 | 3300006931 | Bacteria | 1372 |
| 198 | Ga0099824_1042955 | 3300006942 | Bacteria | 1022 |
| 199 | Ga0099822_1080690 | 3300006943 | Bacteria | 800 |
| 200 | Ga0099823_1022671 | 3300006944 | Bacteria | 5798 |
| 201 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 202 | Ga0075435_101070598 | 3300007076 | Bacteria | 705 |
| 203 | Ga0099795_10082889 | 3300007788 | Bacteria | 1230 |
| 204 | Ga0105251_10533379 | 3300009011 | Bacteria | 551 |
| 205 | Ga0105240_10093354 | 3300009093 | Bacteria | 3673 |
| 206 | Ga0105240_10154472 | 3300009093 | Bacteria | 2731 |
| 207 | Ga0105240_10506534 | 3300009093 | Bacteria | 1342 |
| 208 | Ga0105240_10995885 | 3300009093 | Bacteria | 897 |
| 209 | Ga0105240_12083881 | 3300009093 | Unclassified | 589 |
| 210 | Ga0111539_10254859 | 3300009094 | Bacteria | 2043 |
| 211 | Ga0111539_10378931 | 3300009094 | Bacteria | 1647 |
| 212 | Ga0105245_10008658 | 3300009098 | Bacteria | 8874 |
| 213 | Ga0105245_10412605 | 3300009098 | Bacteria | 1352 |
| 214 | Ga0105245_11039253 | 3300009098 | Bacteria | 864 |
| 215 | Ga0105247_10012238 | 3300009101 | Bacteria | 5155 |
| 216 | Ga0105247_11127634 | 3300009101 | Bacteria | 620 |
| 217 | Ga0114129_10259791 | 3300009147 | Bacteria | 2328 |
| 218 | Ga0114129_10491158 | 3300009147 | Bacteria | 1605 |
| 219 | Ga0105243_10000213 | 3300009148 | Bacteria | 67585 |
| 220 | Ga0105243_10133638 | 3300009148 | Bacteria | 2108 |
| 221 | Ga0105243_10260542 | 3300009148 | Bacteria | 1552 |
| 222 | Ga0105243_10670767 | 3300009148 | Bacteria | 1007 |
| 223 | Ga0105243_11057650 | 3300009148 | Bacteria | 817 |
| 224 | Ga0105241_10002321 | 3300009174 | Bacteria | 14295 |
| 225 | Ga0105241_10044941 | 3300009174 | Bacteria | 3349 |
| 226 | Ga0105241_10078928 | 3300009174 | Bacteria | 2573 |
| 227 | Ga0105241_10214795 | 3300009174 | Bacteria | 1613 |
| 228 | Ga0105241_10730466 | 3300009174 | Bacteria | 906 |
| 229 | Ga0105241_11593163 | 3300009174 | Bacteria | 631 |
| 230 | Ga0105241_12188428 | 3300009174 | Bacteria | 548 |
| 231 | Ga0105242_10144122 | 3300009176 | Bacteria | 2070 |
| 232 | Ga0105242_10370256 | 3300009176 | Bacteria | 1328 |
| 233 | Ga0105242_10476589 | 3300009176 | Bacteria | 1182 |
| 234 | Ga0105248_10004700 | 3300009177 | Bacteria | 15102 |
| 235 | Ga0105248_10299583 | 3300009177 | Bacteria | 1810 |
| 236 | Ga0105248_10301647 | 3300009177 | Bacteria | 1804 |
| 237 | Ga0105237_10015096 | 3300009545 | Bacteria | 8049 |
| 238 | Ga0105237_10047396 | 3300009545 | Bacteria | 4320 |
| 239 | Ga0105237_10305688 | 3300009545 | Bacteria | 1593 |
| 240 | Ga0105237_10356014 | 3300009545 | Bacteria | 1468 |
| 241 | Ga0105237_11750868 | 3300009545 | Bacteria | 629 |
| 242 | Ga0105238_10023368 | 3300009551 | Bacteria | 6301 |
| 243 | Ga0105238_10098976 | 3300009551 | Bacteria | 2900 |
| 244 | Ga0105238_10102383 | 3300009551 | Bacteria | 2845 |
| 245 | Ga0105249_10006303 | 3300009553 | Bacteria | 10307 |
| 246 | Ga0105249_10018077 | 3300009553 | Bacteria | 6266 |
| 247 | Ga0105239_10142445 | 3300010375 | Bacteria | 2672 |
| 248 | Ga0105239_10153056 | 3300010375 | Bacteria | 2574 |
| 249 | Ga0105239_10321827 | 3300010375 | Bacteria | 1744 |
| 250 | Ga0105239_10338923 | 3300010375 | Bacteria | 1697 |
| 251 | Ga0105239_10923065 | 3300010375 | Bacteria | 1002 |
| 252 | Ga0105239_11365012 | 3300010375 | Bacteria | 818 |
| 253 | Ga0105239_11646180 | 3300010375 | Bacteria | 743 |
| 254 | Ga0105246_10114723 | 3300011119 | Bacteria | 1985 |
| 255 | Ga0157326_1002360 | 3300012513 | Bacteria | 2025 |
| 256 | Ga0157373_10013087 | 3300013100 | Bacteria | 6089 |
| 257 | Ga0157373_11298293 | 3300013100 | Bacteria | 551 |
| 258 | Ga0157371_10005011 | 3300013102 | Bacteria | 11350 |
| 259 | Ga0157370_10292366 | 3300013104 | Bacteria | 1505 |
| 260 | Ga0157369_10170583 | 3300013105 | Bacteria | 2293 |
| 261 | Ga0157369_10768302 | 3300013105 | Bacteria | 991 |
| 262 | Ga0157378_10053233 | 3300013297 | Bacteria | 3604 |
| 263 | Ga0157378_10797810 | 3300013297 | Bacteria | 970 |
| 264 | Ga0157378_12104533 | 3300013297 | Bacteria | 615 |
| 265 | Ga0163162_10026566 | 3300013306 | Bacteria | 5723 |
| 266 | Ga0163162_10053372 | 3300013306 | Bacteria | 4062 |
| 267 | Ga0163162_10120108 | 3300013306 | Bacteria | 2731 |
| 268 | Ga0163162_10482770 | 3300013306 | Bacteria | 1371 |
| 269 | Ga0157372_10321704 | 3300013307 | Bacteria | 1801 |
| 270 | Ga0157372_10599299 | 3300013307 | Bacteria | 1284 |
| 271 | Ga0157372_11951914 | 3300013307 | Unclassified | 675 |
| 272 | Ga0157375_10490855 | 3300013308 | Bacteria | 1393 |
| 273 | Ga0157375_11324236 | 3300013308 | Bacteria | 847 |
| 274 | Ga0163163_10047359 | 3300014325 | Bacteria | 4226 |
| 275 | Ga0163163_10376284 | 3300014325 | Bacteria | 1477 |
| 276 | Ga0157380_10056488 | 3300014326 | Bacteria | 3122 |
| 277 | Ga0157380_10081715 | 3300014326 | Bacteria | 2644 |
| 278 | Ga0157380_10960150 | 3300014326 | Bacteria | 885 |
| 279 | Ga0157380_11444586 | 3300014326 | Bacteria | 739 |
| 280 | Ga0157377_10012955 | 3300014745 | Bacteria | 4207 |
| 281 | Ga0157377_10259300 | 3300014745 | Bacteria | 1130 |
| 282 | Ga0157377_10552740 | 3300014745 | Bacteria | 813 |
| 283 | Ga0157379_10032845 | 3300014968 | Bacteria | 4627 |
| 284 | Ga0157379_10091372 | 3300014968 | Bacteria | 2731 |
| 285 | Ga0157379_10223613 | 3300014968 | Bacteria | 1706 |
| 286 | Ga0157379_10726321 | 3300014968 | Bacteria | 934 |
| 287 | Ga0157376_10199919 | 3300014969 | Bacteria | 1838 |
| 288 | Ga0182007_10349436 | 3300015262 | Bacteria | 555 |
| 289 | Ga0163161_10106650 | 3300017792 | Bacteria | 2091 |
| 290 | Ga0163161_10120402 | 3300017792 | Bacteria | 1972 |
| 291 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 292 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 293 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 294 | Ga0214545_1019813 | 3300021324 | Bacteria | 5618 |
| 295 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 296 | Ga0214543_1027099 | 3300021327 | Bacteria | 2961 |
| 297 | Ga0209674_115782 | 3300025226 | Bacteria | 643 |
| 298 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 299 | Ga0209563_102989 | 3300025230 | Bacteria | 3633 |
| 300 | Ga0207425_1009648 | 3300025245 | Bacteria | 2391 |
| 301 | Ga0209677_101529 | 3300025253 | Bacteria | 9890 |
| 302 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 303 | Ga0209148_1000578 | 3300025254 | Bacteria | 33857 |
| 304 | Ga0209148_1020537 | 3300025254 | Bacteria | 1084 |
| 305 | Ga0209148_1026795 | 3300025254 | Bacteria | 891 |
| 306 | Ga0209129_1000285 | 3300025258 | Bacteria | 48259 |
| 307 | Ga0209233_1006411 | 3300025261 | Bacteria | 3795 |
| 308 | Ga0209233_1008559 | 3300025261 | Bacteria | 3156 |
| 309 | Ga0209233_1010267 | 3300025261 | Bacteria | 2816 |
| 310 | Ga0209233_1044497 | 3300025261 | Bacteria | 939 |
| 311 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 312 | Ga0209455_1000876 | 3300025272 | Bacteria | 15927 |
| 313 | Ga0209455_1016198 | 3300025272 | Bacteria | 1610 |
| 314 | Ga0209455_1042491 | 3300025272 | Bacteria | 682 |
| 315 | Ga0209673_1021991 | 3300025273 | Bacteria | 2214 |
| 316 | Ga0209130_1074870 | 3300025284 | Bacteria | 557 |
| 317 | Ga0209676_1019122 | 3300025292 | Bacteria | 2366 |
| 318 | Ga0209025_1001792 | 3300025294 | Bacteria | 25500 |
| 319 | Ga0209025_1076221 | 3300025294 | Bacteria | 1163 |
| 320 | Ga0209564_1004581 | 3300025295 | Bacteria | 8370 |
| 321 | Ga0209564_1008808 | 3300025295 | Bacteria | 4914 |
| 322 | Ga0209564_1011604 | 3300025295 | Bacteria | 3930 |
| 323 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 324 | Ga0209758_1001536 | 3300025297 | Bacteria | 26563 |
| 325 | Ga0209758_1005453 | 3300025297 | Bacteria | 9789 |
| 326 | Ga0209758_1009114 | 3300025297 | Bacteria | 6256 |
| 327 | Ga0209758_1016045 | 3300025297 | Bacteria | 3829 |
| 328 | Ga0209758_1149875 | 3300025297 | Bacteria | 593 |
| 329 | Ga0209050_1007640 | 3300025298 | Bacteria | 5995 |
| 330 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 331 | Ga0209256_1032368 | 3300025299 | Bacteria | 1418 |
| 332 | Ga0207426_1006447 | 3300025302 | Bacteria | 5109 |
| 333 | Ga0207426_1013770 | 3300025302 | Bacteria | 2984 |
| 334 | Ga0209051_1013609 | 3300025303 | Bacteria | 3858 |
| 335 | Ga0209257_1005738 | 3300025304 | Bacteria | 8496 |
| 336 | Ga0209257_1009389 | 3300025304 | Bacteria | 5259 |
| 337 | Ga0207697_10121100 | 3300025315 | Bacteria | 1126 |
| 338 | Ga0207697_10212146 | 3300025315 | Bacteria | 853 |
| 339 | Ga0207656_10020184 | 3300025321 | Bacteria | 2646 |
| 340 | Ga0207653_10000615 | 3300025885 | Bacteria | 12418 |
| 341 | Ga0207682_10125361 | 3300025893 | Bacteria | 1143 |
| 342 | Ga0207642_10066517 | 3300025899 | Bacteria | 1698 |
| 343 | Ga0207642_10479441 | 3300025899 | Bacteria | 758 |
| 344 | Ga0207710_10087285 | 3300025900 | Bacteria | 1455 |
| 345 | Ga0207710_10781758 | 3300025900 | Bacteria | 502 |
| 346 | Ga0207688_10046773 | 3300025901 | Bacteria | 2416 |
| 347 | Ga0207680_10101447 | 3300025903 | Bacteria | 1850 |
| 348 | Ga0207680_10619874 | 3300025903 | Bacteria | 774 |
| 349 | Ga0207647_10001122 | 3300025904 | Bacteria | 20595 |
| 350 | Ga0207647_10015165 | 3300025904 | Bacteria | 5292 |
| 351 | Ga0207647_10025233 | 3300025904 | Bacteria | 3909 |
| 352 | Ga0207647_10141757 | 3300025904 | Bacteria | 1409 |
| 353 | Ga0207647_10239185 | 3300025904 | Bacteria | 1043 |
| 354 | Ga0207699_10018621 | 3300025906 | Bacteria | 3684 |
| 355 | Ga0207645_10036859 | 3300025907 | Bacteria | 3140 |
| 356 | Ga0207705_11397978 | 3300025909 | Unclassified | 532 |
| 357 | Ga0207654_10001228 | 3300025911 | Bacteria | 13697 |
| 358 | Ga0207654_10022738 | 3300025911 | Bacteria | 3349 |
| 359 | Ga0207654_10031554 | 3300025911 | Bacteria | 2920 |
| 360 | Ga0207654_10057695 | 3300025911 | Bacteria | 2257 |
| 361 | Ga0207654_10138954 | 3300025911 | Bacteria | 1547 |
| 362 | Ga0207654_10776096 | 3300025911 | Bacteria | 691 |
| 363 | Ga0207707_10000852 | 3300025912 | Bacteria | 29744 |
| 364 | Ga0207707_10046627 | 3300025912 | Bacteria | 3775 |
| 365 | Ga0207707_11451837 | 3300025912 | Bacteria | 545 |
| 366 | Ga0207695_10029722 | 3300025913 | Bacteria | 6030 |
| 367 | Ga0207695_10106162 | 3300025913 | Bacteria | 2795 |
| 368 | Ga0207695_11701507 | 3300025913 | Bacteria | 512 |
| 369 | Ga0207671_10037979 | 3300025914 | Bacteria | 3570 |
| 370 | Ga0207671_10144307 | 3300025914 | Bacteria | 1836 |
| 371 | Ga0207671_10148867 | 3300025914 | Bacteria | 1808 |
| 372 | Ga0207671_10455403 | 3300025914 | Bacteria | 1019 |
| 373 | Ga0207693_10113735 | 3300025915 | Bacteria | 2123 |
| 374 | Ga0207663_10144917 | 3300025916 | Bacteria | 1659 |
| 375 | Ga0207660_10001673 | 3300025917 | Bacteria | 14857 |
| 376 | Ga0207660_10030337 | 3300025917 | Bacteria | 3716 |
| 377 | Ga0207660_10348500 | 3300025917 | Bacteria | 1187 |
| 378 | Ga0207662_10036899 | 3300025918 | Bacteria | 2859 |
| 379 | Ga0207662_10117496 | 3300025918 | Bacteria | 1664 |
| 380 | Ga0207662_10475637 | 3300025918 | Bacteria | 857 |
| 381 | Ga0207657_10007172 | 3300025919 | Bacteria | 11444 |
| 382 | Ga0207657_10021785 | 3300025919 | Bacteria | 6021 |
| 383 | Ga0207657_11041242 | 3300025919 | Bacteria | 627 |
| 384 | Ga0207649_10000225 | 3300025920 | Bacteria | 46073 |
| 385 | Ga0207649_10008280 | 3300025920 | Bacteria | 5666 |
| 386 | Ga0207649_10392450 | 3300025920 | Bacteria | 1037 |
| 387 | Ga0207652_10019841 | 3300025921 | Bacteria | 5534 |
| 388 | Ga0207652_10056877 | 3300025921 | Bacteria | 3368 |
| 389 | Ga0207652_10270156 | 3300025921 | Bacteria | 1534 |
| 390 | Ga0207652_10306724 | 3300025921 | Bacteria | 1433 |
| 391 | Ga0207652_10340398 | 3300025921 | Bacteria | 1354 |
| 392 | Ga0207681_10056349 | 3300025923 | Bacteria | 2681 |
| 393 | Ga0207694_10024573 | 3300025924 | Bacteria | 4576 |
| 394 | Ga0207694_10195777 | 3300025924 | Bacteria | 1643 |
| 395 | Ga0207694_10374321 | 3300025924 | Bacteria | 1181 |
| 396 | Ga0207694_10642783 | 3300025924 | Bacteria | 894 |
| 397 | Ga0207659_10435641 | 3300025926 | Bacteria | 1102 |
| 398 | Ga0207687_10022557 | 3300025927 | Bacteria | 4191 |
| 399 | Ga0207687_10026448 | 3300025927 | Bacteria | 3886 |
| 400 | Ga0207687_10387443 | 3300025927 | Bacteria | 1146 |
| 401 | Ga0207700_10232060 | 3300025928 | Bacteria | 1569 |
| 402 | Ga0207700_10713500 | 3300025928 | Bacteria | 895 |
| 403 | Ga0207664_10429853 | 3300025929 | Bacteria | 1177 |
| 404 | Ga0207644_10097618 | 3300025931 | Bacteria | 2201 |
| 405 | Ga0207644_10324995 | 3300025931 | Bacteria | 1244 |
| 406 | Ga0207644_10451204 | 3300025931 | Bacteria | 1056 |
| 407 | Ga0207690_10003708 | 3300025932 | Bacteria | 9081 |
| 408 | Ga0207690_10482257 | 3300025932 | Bacteria | 1001 |
| 409 | Ga0207706_10188872 | 3300025933 | Bacteria | 1809 |
| 410 | Ga0207706_10275460 | 3300025933 | Bacteria | 1468 |
| 411 | Ga0207706_10937609 | 3300025933 | Bacteria | 730 |
| 412 | Ga0207706_11723743 | 3300025933 | Bacteria | 504 |
| 413 | Ga0207686_10465797 | 3300025934 | Bacteria | 975 |
| 414 | Ga0207686_10478369 | 3300025934 | Bacteria | 963 |
| 415 | Ga0207686_10565079 | 3300025934 | Bacteria | 891 |
| 416 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 417 | Ga0207709_10010467 | 3300025935 | Bacteria | 5105 |
| 418 | Ga0207709_10369141 | 3300025935 | Bacteria | 1089 |
| 419 | Ga0207709_10800936 | 3300025935 | Bacteria | 760 |
| 420 | Ga0207709_11119039 | 3300025935 | Bacteria | 647 |
| 421 | Ga0207670_10586549 | 3300025936 | Bacteria | 914 |
| 422 | Ga0207669_10012958 | 3300025937 | Bacteria | 4122 |
| 423 | Ga0207669_10014655 | 3300025937 | Bacteria | 3935 |
| 424 | Ga0207669_10318367 | 3300025937 | Bacteria | 1189 |
| 425 | Ga0207669_10406698 | 3300025937 | Bacteria | 1068 |
| 426 | Ga0207704_10134129 | 3300025938 | Bacteria | 1720 |
| 427 | Ga0207665_10303621 | 3300025939 | Bacteria | 1194 |
| 428 | Ga0207711_10002918 | 3300025941 | Bacteria | 14991 |
| 429 | Ga0207711_10168495 | 3300025941 | Bacteria | 1986 |
| 430 | Ga0207711_10308548 | 3300025941 | Bacteria | 1461 |
| 431 | Ga0207689_10083686 | 3300025942 | Bacteria | 2623 |
| 432 | Ga0207689_10983329 | 3300025942 | Bacteria | 712 |
| 433 | Ga0207679_10068738 | 3300025945 | Bacteria | 2662 |
| 434 | Ga0207679_10172347 | 3300025945 | Bacteria | 1783 |
| 435 | Ga0207679_10496903 | 3300025945 | Bacteria | 1088 |
| 436 | Ga0207667_10001428 | 3300025949 | Bacteria | 29927 |
| 437 | Ga0207667_10246654 | 3300025949 | Bacteria | 1827 |
| 438 | Ga0207651_10009390 | 3300025960 | Bacteria | 5352 |
| 439 | Ga0207651_10127815 | 3300025960 | Bacteria | 1940 |
| 440 | Ga0207651_10499924 | 3300025960 | Bacteria | 1051 |
| 441 | Ga0207712_10038467 | 3300025961 | Bacteria | 3272 |
| 442 | Ga0207712_10085168 | 3300025961 | Bacteria | 2312 |
| 443 | Ga0207668_10018721 | 3300025972 | Bacteria | 4365 |
| 444 | Ga0207668_10168921 | 3300025972 | Bacteria | 1713 |
| 445 | Ga0207668_10429869 | 3300025972 | Bacteria | 1122 |
| 446 | Ga0207668_10435724 | 3300025972 | Bacteria | 1115 |
| 447 | Ga0207640_10096493 | 3300025981 | Bacteria | 2061 |
| 448 | Ga0207640_10179964 | 3300025981 | Bacteria | 1584 |
| 449 | Ga0207640_11136150 | 3300025981 | Bacteria | 692 |
| 450 | Ga0207658_10079721 | 3300025986 | Bacteria | 2506 |
| 451 | Ga0207658_10138199 | 3300025986 | Bacteria | 1968 |
| 452 | Ga0207658_10667850 | 3300025986 | Bacteria | 938 |
| 453 | Ga0207658_10994499 | 3300025986 | Bacteria | 765 |
| 454 | Ga0207703_10361645 | 3300026035 | Bacteria | 1338 |
| 455 | Ga0207703_10375563 | 3300026035 | Bacteria | 1314 |
| 456 | Ga0207703_10381297 | 3300026035 | Bacteria | 1304 |
| 457 | Ga0207703_11065667 | 3300026035 | Bacteria | 776 |
| 458 | Ga0207703_11594316 | 3300026035 | Bacteria | 628 |
| 459 | Ga0207639_10002313 | 3300026041 | Bacteria | 12790 |
| 460 | Ga0207639_10463625 | 3300026041 | Bacteria | 1152 |
| 461 | Ga0207639_11222663 | 3300026041 | Bacteria | 705 |
| 462 | Ga0207678_10006547 | 3300026067 | Bacteria | 10327 |
| 463 | Ga0207678_10026500 | 3300026067 | Bacteria | 5056 |
| 464 | Ga0207678_10033426 | 3300026067 | Bacteria | 4481 |
| 465 | Ga0207678_10038931 | 3300026067 | Bacteria | 4128 |
| 466 | Ga0207708_10000488 | 3300026075 | Bacteria | 30463 |
| 467 | Ga0207708_10000776 | 3300026075 | Bacteria | 24052 |
| 468 | Ga0207708_10453936 | 3300026075 | Bacteria | 1068 |
| 469 | Ga0207702_10001111 | 3300026078 | Bacteria | 27466 |
| 470 | Ga0207702_10084712 | 3300026078 | Bacteria | 2761 |
| 471 | Ga0207702_10156055 | 3300026078 | Bacteria | 2080 |
| 472 | Ga0207702_10583107 | 3300026078 | Bacteria | 1096 |
| 473 | Ga0207702_11196312 | 3300026078 | Bacteria | 754 |
| 474 | Ga0207641_10070060 | 3300026088 | Bacteria | 3013 |
| 475 | Ga0207641_10190145 | 3300026088 | Bacteria | 1886 |
| 476 | Ga0207648_10046235 | 3300026089 | Bacteria | 3816 |
| 477 | Ga0207648_10365217 | 3300026089 | Bacteria | 1303 |
| 478 | Ga0207676_10011695 | 3300026095 | Bacteria | 6278 |
| 479 | Ga0207676_10781438 | 3300026095 | Bacteria | 930 |
| 480 | Ga0207674_10004426 | 3300026116 | Bacteria | 16895 |
| 481 | Ga0207674_10024383 | 3300026116 | Bacteria | 6467 |
| 482 | Ga0207674_10294377 | 3300026116 | Bacteria | 1572 |
| 483 | Ga0207674_10776492 | 3300026116 | Bacteria | 925 |
| 484 | Ga0207674_11348680 | 3300026116 | Bacteria | 683 |
| 485 | Ga0207675_100000011 | 3300026118 | Bacteria | 143162 |
| 486 | Ga0207675_100001448 | 3300026118 | Bacteria | 23778 |
| 487 | Ga0207675_100015329 | 3300026118 | Bacteria | 7152 |
| 488 | Ga0207675_100179187 | 3300026118 | Bacteria | 2029 |
| 489 | Ga0207675_100185678 | 3300026118 | Bacteria | 1993 |
| 490 | Ga0207675_101564135 | 3300026118 | Bacteria | 680 |
| 491 | Ga0207683_10127155 | 3300026121 | Bacteria | 2291 |
| 492 | Ga0207683_10320560 | 3300026121 | Bacteria | 1420 |
| 493 | Ga0207698_10001209 | 3300026142 | Bacteria | 15067 |
| 494 | Ga0207698_10007060 | 3300026142 | Bacteria | 7035 |
| 495 | Ga0207698_10332780 | 3300026142 | Bacteria | 1427 |
| 496 | Ga0207698_10504526 | 3300026142 | Bacteria | 1178 |
| 497 | Ga0207698_10692885 | 3300026142 | Bacteria | 1013 |
| 498 | Ga0207698_11760656 | 3300026142 | Bacteria | 635 |
| 499 | Ga0209389_1000057 | 3300027296 | Bacteria | 107632 |
| 500 | Ga0209389_1000083 | 3300027296 | Bacteria | 88461 |
| 501 | Ga0209589_1000097 | 3300027357 | Bacteria | 88461 |
| 502 | Ga0209489_100105 | 3300027361 | Bacteria | 118979 |
| 503 | Ga0209489_100226 | 3300027361 | Bacteria | 94384 |
| 504 | Ga0209700_100085 | 3300027363 | Bacteria | 128517 |
| 505 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 506 | Ga0209998_10017440 | 3300027717 | Bacteria | 1517 |
| 507 | Ga0209813_10050410 | 3300027866 | Bacteria | 1299 |
| 508 | Ga0209813_10081341 | 3300027866 | Bacteria | 1072 |
| 509 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 510 | Ga0268266_10118211 | 3300028379 | Bacteria | 2356 |
| 511 | Ga0268266_10338754 | 3300028379 | Bacteria | 1411 |
| 512 | Ga0268266_10379038 | 3300028379 | Bacteria | 1334 |
| 513 | Ga0268266_11535231 | 3300028379 | Bacteria | 641 |
| 514 | Ga0268265_10088412 | 3300028380 | Bacteria | 2468 |
| 515 | Ga0268265_10584428 | 3300028380 | Bacteria | 1065 |
| 516 | Ga0268265_10635914 | 3300028380 | Bacteria | 1024 |
| 517 | Ga0268265_10729956 | 3300028380 | Bacteria | 960 |
| 518 | Ga0268264_10016842 | 3300028381 | Bacteria | 5983 |
| 519 | Ga0268264_10494877 | 3300028381 | Bacteria | 1191 |
| 520 | Ga0307515_10160552 | 3300028794 | Bacteria | 2295 |
| 521 | Ga0265338_10039470 | 3300028800 | Bacteria | 4452 |
| 522 | Ga0307513_10109293 | 3300031456 | Bacteria | 2763 |
| 523 | Ga0307513_10323569 | 3300031456 | Bacteria | 1299 |
| 524 | Ga0307513_10779091 | 3300031456 | Bacteria | 662 |
| 525 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 526 | Ga0307408_100255626 | 3300031548 | Bacteria | 1447 |
| 527 | Ga0307408_101728997 | 3300031548 | Bacteria | 596 |
| 528 | Ga0265342_10088609 | 3300031712 | Bacteria | 1777 |
| 529 | Ga0307413_10675500 | 3300031824 | Bacteria | 855 |
| 530 | Ga0307410_10183088 | 3300031852 | Bacteria | 1587 |
| 531 | Ga0307410_10316307 | 3300031852 | Bacteria | 1237 |
| 532 | Ga0307407_10106184 | 3300031903 | Bacteria | 1754 |
| 533 | Ga0307407_10979182 | 3300031903 | Bacteria | 653 |
| 534 | Ga0307412_10191259 | 3300031911 | Bacteria | 1547 |
| 535 | Ga0307412_11745386 | 3300031911 | Bacteria | 571 |
| 536 | Ga0307412_12173852 | 3300031911 | Bacteria | 516 |
| 537 | Ga0307409_100308180 | 3300031995 | Bacteria | 1476 |
| 538 | Ga0307409_100613927 | 3300031995 | Bacteria | 1076 |
| 539 | Ga0307416_100205968 | 3300032002 | Bacteria | 1871 |
| 540 | Ga0307416_100658552 | 3300032002 | Bacteria | 1133 |
| 541 | Ga0307414_10164251 | 3300032004 | Bacteria | 1768 |
| 542 | Ga0307414_10292212 | 3300032004 | Bacteria | 1374 |
| 543 | Ga0307414_11413989 | 3300032004 | Bacteria | 647 |
| 544 | Ga0307411_10165248 | 3300032005 | Bacteria | 1663 |
| 545 | Ga0307510_10095926 | 3300033180 | Bacteria | 2784 |
| 546 | Ga0307510_10242811 | 3300033180 | Bacteria | 1294 |
| 547 | Ga0373930_0012940 | 3300034816 | Bacteria | 1530 |
| 548 | Ga0373958_0019203 | 3300034819 | Bacteria | 1247 |
| 549 | Ga0373929_0088522 | 3300035085 | Bacteria | 765 |
| 550 | Ga0373940_0006102 | 3300035088 | Bacteria | 2651 |
| 551 | Ga0373931_0020603 | 3300035691 | Bacteria | 3301 |
| 552 | Ga0373931_0850066 | 3300035691 | Bacteria | 611 |
| 553 | Ga0373927_0036186 | 3300035695 | Bacteria | 3211 |
| 554 | Ga0373927_0185409 | 3300035695 | Bacteria | 1365 |
| 555 | Ga0373927_0297143 | 3300035695 | Bacteria | 1063 |
| 556 | Ga0373947_0534655 | 3300035725 | Bacteria | 798 |
| 557 | Ga0373925_0834629 | 3300037068 | Bacteria | 760 |
| 558 | Ga0395900_0000601 | 3300037418 | Bacteria | 49219 |
| 559 | Ga0395898_0010480 | 3300037466 | Bacteria | 9689 |
| 560 | Ga0395898_0094170 | 3300037466 | Bacteria | 2879 |
| 561 | Ga0395898_0111975 | 3300037466 | Bacteria | 2616 |
| 562 | Ga0395905_0047818 | 3300037471 | Bacteria | 4008 |
| 563 | Ga0395905_0192819 | 3300037471 | Bacteria | 1911 |
| 564 | Ga0395905_0277022 | 3300037471 | Bacteria | 1563 |
| 565 | Ga0395905_0461844 | 3300037471 | Bacteria | 1168 |
| 566 | Ga0395905_0516134 | 3300037471 | Bacteria | 1095 |
| 567 | Ga0395905_0540154 | 3300037471 | Bacteria | 1067 |
| 568 | Ga0395905_1037796 | 3300037471 | Bacteria | 723 |
| 569 | Ga0395905_1463445 | 3300037471 | Bacteria | 587 |
| 570 | Ga0436364_0450134 | 3300037853 | Bacteria | 1948 |
| 571 | Ga0436364_0796860 | 3300037853 | Bacteria | 645 |
| 572 | Ga0395901_0021632 | 3300038443 | Bacteria | 6589 |
| 573 | Ga0395901_0284067 | 3300038443 | Bacteria | 1719 |
| 574 | Ga0395901_0477936 | 3300038443 | Bacteria | 1271 |
| 575 | Ga0395901_1256871 | 3300038443 | Bacteria | 704 |
| 576 | Ga0395901_1624262 | 3300038443 | Bacteria | 599 |
| 577 | Ga0436365_0224118 | 3300039437 | Bacteria | 748 |
| 578 | Ga0436365_0396957 | 3300039437 | Bacteria | 1073 |
| 579 | Ga0436365_1268888 | 3300039437 | Bacteria | 1095 |
| 580 | Ga0439436_0076317 | 3300041404 | Bacteria | 933 |
| 581 | Ga0439453_0022803 | 3300041408 | Bacteria | 1138 |
| 582 | Ga0451791_1276388 | 3300041451 | Bacteria | 617 |
| 583 | Ga0451791_1771099 | 3300041451 | Bacteria | 946 |
| 584 | Ga0451793_1615561 | 3300041452 | Bacteria | 831 |
| 585 | Ga0451800_0909938 | 3300041459 | Bacteria | 886 |
| 586 | Ga0451800_1103286 | 3300041459 | Bacteria | 507 |
| 587 | Ga0451807_1108795 | 3300041486 | Bacteria | 579 |
| 588 | Ga0451835_0691213 | 3300041492 | Bacteria | 594 |
| 589 | Ga0451845_0352644 | 3300041501 | Bacteria | 595 |
| 590 | Ga0451851_0269221 | 3300041507 | Bacteria | 1076 |
| 591 | Ga0451853_3654192 | 3300041512 | Bacteria | 610 |
| 592 | Ga0451853_3944585 | 3300041512 | Bacteria | 879 |
| 593 | Ga0439448_0003740 | 3300042005 | Bacteria | 4240 |
| 594 | Ga0439450_015806 | 3300042008 | Bacteria | 1551 |
| 595 | Ga0439450_026906 | 3300042008 | Bacteria | 1271 |
| 596 | Ga0439435_0013209 | 3300042436 | Bacteria | 2015 |
| 597 | Ga0439459_0128012 | 3300042438 | Bacteria | 646 |
| 598 | Ga0466969_0010526 | 3300044656 | Bacteria | 4903 |
| 599 | Ga0466972_0002026 | 3300044658 | Bacteria | 9923 |
| 600 | Ga0466972_0016778 | 3300044658 | Bacteria | 3661 |
| 601 | Ga0453683_0463360 | 3300044673 | Bacteria | 820 |
| 602 | Ga0466965_0005417 | 3300044683 | Bacteria | 5750 |
| 603 | Ga0466965_0088657 | 3300044683 | Bacteria | 1571 |
| 604 | Ga0466965_0141190 | 3300044683 | Bacteria | 1254 |
| 605 | Ga0466965_0360630 | 3300044683 | Bacteria | 797 |
| 606 | Ga0466966_0005947 | 3300044684 | Bacteria | 8051 |
| 607 | Ga0466966_0158724 | 3300044684 | Bacteria | 1377 |
| 608 | Ga0466966_0612220 | 3300044684 | Bacteria | 656 |
| 609 | Ga0466961_0000863 | 3300044693 | Bacteria | 18927 |
| 610 | Ga0466961_0003976 | 3300044693 | Bacteria | 9248 |
| 611 | Ga0466961_0190296 | 3300044693 | Bacteria | 1272 |
| 612 | Ga0466961_0454383 | 3300044693 | Bacteria | 775 |
| 613 | Ga0466963_0008115 | 3300044694 | Bacteria | 6287 |
| 614 | Ga0466963_0085767 | 3300044694 | Bacteria | 2138 |
| 615 | Ga0466963_0636864 | 3300044694 | Bacteria | 753 |
| 616 | Ga0466963_1080777 | 3300044694 | Bacteria | 564 |
| 617 | Ga0466964_0000042 | 3300044706 | Bacteria | 26502 |
| 618 | Ga0466964_0016732 | 3300044706 | Bacteria | 2802 |
| 619 | Ga0466964_0075336 | 3300044706 | Bacteria | 1436 |
| 620 | Ga0466964_0287018 | 3300044706 | Bacteria | 825 |
| 621 | Ga0466964_0354837 | 3300044706 | Bacteria | 754 |
| 622 | Ga0466971_0018497 | 3300044719 | Bacteria | 3086 |
| 623 | Ga0466971_0148221 | 3300044719 | Bacteria | 1094 |
| 624 | Ga0466968_0077952 | 3300044735 | Bacteria | 1452 |
| 625 | Ga0466968_0107151 | 3300044735 | Bacteria | 1253 |
| 626 | Ga0466970_0002328 | 3300044765 | Bacteria | 9184 |
| 627 | Ga0466970_0019044 | 3300044765 | Bacteria | 3557 |
| 628 | Ga0466970_0475220 | 3300044765 | Bacteria | 718 |
| 629 | Ga0466957_0057877 | 3300044842 | Bacteria | 2373 |
| 630 | Ga0466957_0183957 | 3300044842 | Bacteria | 1366 |
| 631 | Ga0466957_0233670 | 3300044842 | Bacteria | 1218 |
| 632 | Ga0466957_0402039 | 3300044842 | Bacteria | 937 |
| 633 | Ga0466960_0127399 | 3300044901 | Bacteria | 1340 |
| 634 | Ga0466959_0000648 | 3300045049 | Bacteria | 20299 |
| 635 | Ga0466959_0014195 | 3300045049 | Bacteria | 5781 |
| 636 | Ga0466959_0479042 | 3300045049 | Bacteria | 842 |
| 637 | Ga0466959_0643465 | 3300045049 | Bacteria | 712 |
| 638 | Ga0466959_0643498 | 3300045049 | Bacteria | 712 |
| 639 | Ga0451576_0618156 | 3300045051 | Bacteria | 1139 |
| 640 | Ga0466958_0000250 | 3300045836 | Bacteria | 20747 |
| 641 | Ga0466958_0002080 | 3300045836 | Bacteria | 9907 |
| 642 | Ga0466958_0030782 | 3300045836 | Bacteria | 3189 |
| 643 | Ga0466967_0004712 | 3300045976 | Bacteria | 9268 |
| 644 | Ga0466967_0005881 | 3300045976 | Bacteria | 8590 |
| 645 | Ga0466967_0055268 | 3300045976 | Bacteria | 3497 |
| 646 | Ga0466967_0084535 | 3300045976 | Bacteria | 2871 |
| 647 | Ga0466967_0281423 | 3300045976 | Bacteria | 1596 |
| 648 | Ga0466967_0937460 | 3300045976 | Bacteria | 861 |
| 649 | Ga0495617_000008 | 3300046452 | Bacteria | 340369 |
| 650 | Ga0495617_040015 | 3300046452 | Bacteria | 1568 |
| 651 | Ga0495617_069919 | 3300046452 | Bacteria | 1155 |
| 652 | Ga0495627_000191 | 3300046453 | Bacteria | 67637 |
| 653 | Ga0495627_009857 | 3300046453 | Bacteria | 3497 |
| 654 | Ga0495592_0022986 | 3300046454 | Bacteria | 4745 |
| 655 | Ga0495592_0098350 | 3300046454 | Bacteria | 2089 |
| 656 | Ga0495603_0076135 | 3300046455 | Bacteria | 1969 |
| 657 | Ga0495590_0000017 | 3300046457 | Bacteria | 216944 |
| 658 | Ga0495590_0012598 | 3300046457 | Bacteria | 3135 |
| 659 | Ga0495590_0034232 | 3300046457 | Bacteria | 1774 |
| 660 | Ga0495590_0086221 | 3300046457 | Bacteria | 1109 |
| 661 | Ga0495591_000091 | 3300046458 | Bacteria | 101618 |
| 662 | Ga0495591_004378 | 3300046458 | Bacteria | 6939 |
| 663 | Ga0495629_0006687 | 3300046459 | Bacteria | 8527 |
| 664 | Ga0495638_0006848 | 3300046460 | Bacteria | 8227 |
| 665 | Ga0495638_0017968 | 3300046460 | Bacteria | 4706 |
| 666 | Ga0495638_0048258 | 3300046460 | Bacteria | 2666 |
| 667 | Ga0495638_0068452 | 3300046460 | Bacteria | 2177 |
| 668 | Ga0495638_0253610 | 3300046460 | Bacteria | 969 |
| 669 | Ga0495651_0008654 | 3300046462 | Bacteria | 7809 |
| 670 | Ga0495651_0148809 | 3300046462 | Bacteria | 1690 |
| 671 | Ga0495653_0237596 | 3300046463 | Bacteria | 1216 |
| 672 | Ga0495650_0000373 | 3300046471 | Bacteria | 78223 |
| 673 | Ga0495650_0014674 | 3300046471 | Bacteria | 4058 |
| 674 | Ga0495582_0226110 | 3300046473 | Bacteria | 1071 |
| 675 | Ga0495605_0000176 | 3300046474 | Bacteria | 80441 |
| 676 | Ga0495605_0000559 | 3300046474 | Bacteria | 30395 |
| 677 | Ga0495605_0004429 | 3300046474 | Bacteria | 8257 |
| 678 | Ga0495605_0014773 | 3300046474 | Bacteria | 4264 |
| 679 | Ga0495605_0039351 | 3300046474 | Bacteria | 2369 |
| 680 | Ga0495605_0122734 | 3300046474 | Bacteria | 1176 |
| 681 | Ga0495605_0262766 | 3300046474 | Bacteria | 736 |
| 682 | Ga0495605_0273266 | 3300046474 | Bacteria | 719 |
| 683 | Ga0495605_0346039 | 3300046474 | Bacteria | 624 |
| 684 | Ga0495639_0316334 | 3300046475 | Bacteria | 780 |
| 685 | Ga0495662_0199942 | 3300046476 | Bacteria | 985 |
| 686 | Ga0495664_0023203 | 3300046477 | Bacteria | 3599 |
| 687 | Ga0495664_0077488 | 3300046477 | Bacteria | 1991 |
| 688 | Ga0495664_0681205 | 3300046477 | Bacteria | 608 |
| 689 | Ga0495584_0000031 | 3300046491 | Bacteria | 100128 |
| 690 | Ga0495584_0001217 | 3300046491 | Bacteria | 15721 |
| 691 | Ga0495584_0087892 | 3300046491 | Bacteria | 1566 |
| 692 | Ga0495584_0112348 | 3300046491 | Bacteria | 1379 |
| 693 | Ga0495584_0152962 | 3300046491 | Bacteria | 1172 |
| 694 | Ga0495585_0006675 | 3300046492 | Bacteria | 7128 |
| 695 | Ga0495585_0011422 | 3300046492 | Bacteria | 5254 |
| 696 | Ga0495585_0013692 | 3300046492 | Bacteria | 4740 |
| 697 | Ga0495585_0015903 | 3300046492 | Bacteria | 4366 |
| 698 | Ga0495585_0065627 | 3300046492 | Bacteria | 1988 |
| 699 | Ga0495585_0065985 | 3300046492 | Bacteria | 1982 |
| 700 | Ga0495585_0098895 | 3300046492 | Bacteria | 1562 |
| 701 | Ga0495585_0107410 | 3300046492 | Bacteria | 1487 |
| 702 | Ga0495585_0174635 | 3300046492 | Bacteria | 1108 |
| 703 | Ga0495585_0225037 | 3300046492 | Bacteria | 945 |
| 704 | Ga0495594_0002735 | 3300046499 | Bacteria | 9146 |
| 705 | Ga0495594_0006022 | 3300046499 | Bacteria | 6225 |
| 706 | Ga0495594_0495824 | 3300046499 | Bacteria | 694 |
| 707 | Ga0495596_0003495 | 3300046500 | Bacteria | 7926 |
| 708 | Ga0495596_0004017 | 3300046500 | Bacteria | 7255 |
| 709 | Ga0495596_0011542 | 3300046500 | Bacteria | 3805 |
| 710 | Ga0495596_0014417 | 3300046500 | Bacteria | 3331 |
| 711 | Ga0495596_0023788 | 3300046500 | Bacteria | 2484 |
| 712 | Ga0495596_0129895 | 3300046500 | Bacteria | 978 |
| 713 | Ga0495596_0226131 | 3300046500 | Bacteria | 726 |
| 714 | Ga0495607_0002229 | 3300046501 | Bacteria | 16025 |
| 715 | Ga0495607_0004696 | 3300046501 | Bacteria | 9996 |
| 716 | Ga0495607_0009255 | 3300046501 | Bacteria | 6688 |
| 717 | Ga0495607_0032829 | 3300046501 | Bacteria | 3164 |
| 718 | Ga0495607_0361002 | 3300046501 | Bacteria | 668 |
| 719 | Ga0495583_0001871 | 3300046506 | Bacteria | 19588 |
| 720 | Ga0495583_0001879 | 3300046506 | Bacteria | 19521 |
| 721 | Ga0495583_0003628 | 3300046506 | Bacteria | 11550 |
| 722 | Ga0495583_0018160 | 3300046506 | Bacteria | 3710 |
| 723 | Ga0495583_0031145 | 3300046506 | Bacteria | 2589 |
| 724 | Ga0495583_0037224 | 3300046506 | Bacteria | 2308 |
| 725 | Ga0495583_0317301 | 3300046506 | Bacteria | 618 |
| 726 | Ga0495606_0004509 | 3300046507 | Bacteria | 13865 |
| 727 | Ga0495606_0006533 | 3300046507 | Bacteria | 10724 |
| 728 | Ga0495606_0021322 | 3300046507 | Bacteria | 4747 |
| 729 | Ga0495606_0046033 | 3300046507 | Bacteria | 2886 |
| 730 | Ga0495606_0070480 | 3300046507 | Bacteria | 2204 |
| 731 | Ga0495606_0176499 | 3300046507 | Bacteria | 1235 |
| 732 | Ga0495606_0220648 | 3300046507 | Bacteria | 1068 |
| 733 | Ga0495606_0251487 | 3300046507 | Bacteria | 980 |
| 734 | Ga0495608_0042890 | 3300046511 | Bacteria | 3024 |
| 735 | Ga0495608_0159363 | 3300046511 | Bacteria | 1435 |
| 736 | Ga0495610_0023569 | 3300046512 | Bacteria | 3341 |
| 737 | Ga0495610_0126098 | 3300046512 | Bacteria | 1116 |
| 738 | Ga0495610_0149709 | 3300046512 | Bacteria | 997 |
| 739 | Ga0495616_0000321 | 3300046513 | Bacteria | 38323 |
| 740 | Ga0495616_0000395 | 3300046513 | Bacteria | 33694 |
| 741 | Ga0495616_0006834 | 3300046513 | Bacteria | 6871 |
| 742 | Ga0495616_0009676 | 3300046513 | Bacteria | 5619 |
| 743 | Ga0495616_0036379 | 3300046513 | Bacteria | 2540 |
| 744 | Ga0495616_0065871 | 3300046513 | Bacteria | 1763 |
| 745 | Ga0495616_0125881 | 3300046513 | Bacteria | 1178 |
| 746 | Ga0495618_0265006 | 3300046514 | Bacteria | 1075 |
| 747 | Ga0495620_0080128 | 3300046515 | Bacteria | 1322 |
| 748 | Ga0495628_0016659 | 3300046516 | Bacteria | 6129 |
| 749 | Ga0495630_1286808 | 3300046517 | Bacteria | 551 |
| 750 | Ga0495631_0000562 | 3300046518 | Bacteria | 24956 |
| 751 | Ga0495631_0004969 | 3300046518 | Bacteria | 7007 |
| 752 | Ga0495631_0009488 | 3300046518 | Bacteria | 4859 |
| 753 | Ga0495631_0012205 | 3300046518 | Bacteria | 4204 |
| 754 | Ga0495631_0034871 | 3300046518 | Bacteria | 2253 |
| 755 | Ga0495631_0063005 | 3300046518 | Bacteria | 1606 |
| 756 | Ga0495631_0067513 | 3300046518 | Bacteria | 1547 |
| 757 | Ga0495631_0201804 | 3300046518 | Bacteria | 850 |
| 758 | Ga0495631_0289937 | 3300046518 | Bacteria | 697 |
| 759 | Ga0495632_0000155 | 3300046519 | Bacteria | 70814 |
| 760 | Ga0495632_0004685 | 3300046519 | Bacteria | 9237 |
| 761 | Ga0495632_0027540 | 3300046519 | Bacteria | 2976 |
| 762 | Ga0495632_0031748 | 3300046519 | Bacteria | 2727 |
| 763 | Ga0495632_0141096 | 3300046519 | Bacteria | 1118 |
| 764 | Ga0495632_0215063 | 3300046519 | Bacteria | 871 |
| 765 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 766 | Ga0495637_0021740 | 3300046520 | Bacteria | 2937 |
| 767 | Ga0495637_0048357 | 3300046520 | Bacteria | 1791 |
| 768 | Ga0495637_0101020 | 3300046520 | Bacteria | 1127 |
| 769 | Ga0495637_0168815 | 3300046520 | Bacteria | 817 |
| 770 | Ga0495643_0002948 | 3300046522 | Bacteria | 12888 |
| 771 | Ga0495643_0003289 | 3300046522 | Bacteria | 11937 |
| 772 | Ga0495643_0007636 | 3300046522 | Bacteria | 6946 |
| 773 | Ga0495643_0007678 | 3300046522 | Bacteria | 6917 |
| 774 | Ga0495643_0027136 | 3300046522 | Bacteria | 3222 |
| 775 | Ga0495643_0085865 | 3300046522 | Bacteria | 1631 |
| 776 | Ga0495643_0122962 | 3300046522 | Bacteria | 1309 |
| 777 | Ga0495643_0138861 | 3300046522 | Bacteria | 1214 |
| 778 | Ga0495643_0140293 | 3300046522 | Bacteria | 1206 |
| 779 | Ga0495643_0358090 | 3300046522 | Bacteria | 652 |
| 780 | Ga0495644_0002176 | 3300046523 | Bacteria | 7874 |
| 781 | Ga0495644_0006276 | 3300046523 | Bacteria | 4616 |
| 782 | Ga0495644_0021326 | 3300046523 | Bacteria | 2472 |
| 783 | Ga0495644_0161325 | 3300046523 | Bacteria | 859 |
| 784 | Ga0495648_0001050 | 3300046524 | Bacteria | 28021 |
| 785 | Ga0495648_0001311 | 3300046524 | Bacteria | 24643 |
| 786 | Ga0495648_0003160 | 3300046524 | Bacteria | 14655 |
| 787 | Ga0495648_0004718 | 3300046524 | Bacteria | 11547 |
| 788 | Ga0495648_0007417 | 3300046524 | Bacteria | 8775 |
| 789 | Ga0495648_0014544 | 3300046524 | Bacteria | 5756 |
| 790 | Ga0495648_0033000 | 3300046524 | Bacteria | 3388 |
| 791 | Ga0495648_0064299 | 3300046524 | Bacteria | 2162 |
| 792 | Ga0495648_0130203 | 3300046524 | Bacteria | 1339 |
| 793 | Ga0495648_0283757 | 3300046524 | Bacteria | 783 |
| 794 | Ga0495648_0293766 | 3300046524 | Bacteria | 764 |
| 795 | Ga0495663_0001136 | 3300046525 | Bacteria | 8582 |
| 796 | Ga0495642_0000617 | 3300046528 | Bacteria | 17917 |
| 797 | Ga0495642_0001753 | 3300046528 | Bacteria | 9354 |
| 798 | Ga0495642_0005805 | 3300046528 | Bacteria | 4733 |
| 799 | Ga0495642_0005858 | 3300046528 | Bacteria | 4716 |
| 800 | Ga0495642_0024677 | 3300046528 | Bacteria | 2379 |
| 801 | Ga0495642_0047458 | 3300046528 | Bacteria | 1759 |
| 802 | Ga0495642_0050520 | 3300046528 | Bacteria | 1710 |
| 803 | Ga0495642_0147126 | 3300046528 | Bacteria | 1018 |
| 804 | Ga0495642_0340403 | 3300046528 | Bacteria | 659 |
| 805 | Ga0495652_0107280 | 3300046529 | Bacteria | 2253 |
| 806 | Ga0495654_0005485 | 3300046530 | Bacteria | 7349 |
| 807 | Ga0495654_0015086 | 3300046530 | Bacteria | 4106 |
| 808 | Ga0495654_0026683 | 3300046530 | Bacteria | 2967 |
| 809 | Ga0495654_0155762 | 3300046530 | Bacteria | 1007 |
| 810 | Ga0495640_0090607 | 3300046533 | Bacteria | 2018 |
| 811 | Ga0495586_0321697 | 3300046535 | Bacteria | 887 |
| 812 | Ga0495587_0049814 | 3300046536 | Bacteria | 2479 |
| 813 | Ga0495587_0063977 | 3300046536 | Bacteria | 2150 |
| 814 | Ga0495598_0114659 | 3300046537 | Bacteria | 907 |
| 815 | Ga0495609_0002370 | 3300046538 | Bacteria | 11617 |
| 816 | Ga0495609_0014233 | 3300046538 | Bacteria | 3744 |
| 817 | Ga0495609_0025650 | 3300046538 | Bacteria | 2701 |
| 818 | Ga0495597_0000698 | 3300046542 | Bacteria | 26850 |
| 819 | Ga0495597_0001066 | 3300046542 | Bacteria | 20915 |
| 820 | Ga0495597_0025540 | 3300046542 | Bacteria | 2719 |
| 821 | Ga0495597_0429615 | 3300046542 | Bacteria | 500 |
| 822 | Ga0495645_0087057 | 3300046543 | Bacteria | 2235 |
| 823 | Ga0495645_0104244 | 3300046543 | Bacteria | 2014 |
| 824 | Ga0495622_0004127 | 3300046557 | Bacteria | 6774 |
| 825 | Ga0495622_0065162 | 3300046557 | Bacteria | 1684 |
| 826 | Ga0495622_0247580 | 3300046557 | Bacteria | 784 |
| 827 | Ga0495633_0002747 | 3300046558 | Bacteria | 12167 |
| 828 | Ga0495633_0007100 | 3300046558 | Bacteria | 6509 |
| 829 | Ga0495667_0110914 | 3300046559 | Bacteria | 1772 |
| 830 | Ga0495656_0009992 | 3300046615 | Bacteria | 3434 |
| 831 | Ga0495656_0012801 | 3300046615 | Bacteria | 3105 |
| 832 | Ga0495668_0000072 | 3300046616 | Bacteria | 167170 |
| 833 | Ga0495668_0000392 | 3300046616 | Bacteria | 57835 |
| 834 | Ga0495668_0001900 | 3300046616 | Bacteria | 18693 |
| 835 | Ga0495668_0003172 | 3300046616 | Bacteria | 12644 |
| 836 | Ga0495668_0007792 | 3300046616 | Bacteria | 6789 |
| 837 | Ga0495668_0010923 | 3300046616 | Bacteria | 5468 |
| 838 | Ga0495668_0013068 | 3300046616 | Bacteria | 4913 |
| 839 | Ga0495668_0050035 | 3300046616 | Bacteria | 2317 |
| 840 | Ga0495668_0310381 | 3300046616 | Bacteria | 865 |
| 841 | Ga0495668_0329580 | 3300046616 | Bacteria | 837 |
| 842 | Ga0495634_0333357 | 3300046642 | Bacteria | 911 |
| 843 | Ga0495611_0000157 | 3300046648 | Bacteria | 48892 |
| 844 | Ga0495611_0010918 | 3300046648 | Bacteria | 3847 |
| 845 | Ga0495611_0302586 | 3300046648 | Bacteria | 737 |
| 846 | Ga0495625_0003433 | 3300046660 | Bacteria | 15802 |
| 847 | Ga0495625_0013337 | 3300046660 | Bacteria | 6607 |
| 848 | Ga0495625_0020065 | 3300046660 | Bacteria | 5166 |
| 849 | Ga0495625_0022295 | 3300046660 | Bacteria | 4859 |
| 850 | Ga0495625_0030150 | 3300046660 | Bacteria | 4050 |
| 851 | Ga0495625_0066928 | 3300046660 | Bacteria | 2529 |
| 852 | Ga0495625_0074593 | 3300046660 | Bacteria | 2376 |
| 853 | Ga0495625_0211301 | 3300046660 | Bacteria | 1275 |
| 854 | Ga0495625_0318202 | 3300046660 | Bacteria | 991 |
| 855 | Ga0495625_0427712 | 3300046660 | Bacteria | 822 |
| 856 | Ga0495635_0062415 | 3300046663 | Bacteria | 2559 |
| 857 | Ga0495661_0001268 | 3300046665 | Bacteria | 21721 |
| 858 | Ga0495661_0004689 | 3300046665 | Bacteria | 9818 |
| 859 | Ga0495661_0004823 | 3300046665 | Bacteria | 9669 |
| 860 | Ga0495661_0013825 | 3300046665 | Bacteria | 5415 |
| 861 | Ga0495661_0070545 | 3300046665 | Bacteria | 2044 |
| 862 | Ga0495661_0073867 | 3300046665 | Bacteria | 1985 |
| 863 | Ga0495661_0087097 | 3300046665 | Bacteria | 1786 |
| 864 | Ga0495661_0131343 | 3300046665 | Bacteria | 1372 |
| 865 | Ga0495661_0140771 | 3300046665 | Bacteria | 1312 |
| 866 | Ga0495661_0176134 | 3300046665 | Bacteria | 1136 |
| 867 | Ga0495661_0407979 | 3300046665 | Bacteria | 660 |
| 868 | Ga0495661_0580908 | 3300046665 | Bacteria | 528 |
| 869 | Ga0495588_0000125 | 3300046674 | Bacteria | 130469 |
| 870 | Ga0495588_0012241 | 3300046674 | Bacteria | 4048 |
| 871 | Ga0495588_0043710 | 3300046674 | Bacteria | 2293 |
| 872 | Ga0495588_0144116 | 3300046674 | Bacteria | 1258 |
| 873 | Ga0495657_0005091 | 3300046675 | Bacteria | 10441 |
| 874 | Ga0495657_0026479 | 3300046675 | Bacteria | 4106 |
| 875 | Ga0495599_0051503 | 3300046678 | Bacteria | 2579 |
| 876 | Ga0495599_0078966 | 3300046678 | Bacteria | 2055 |
| 877 | Ga0495623_0019288 | 3300046679 | Bacteria | 4408 |
| 878 | Ga0495646_0027624 | 3300046680 | Bacteria | 3559 |
| 879 | Ga0495646_0034737 | 3300046680 | Bacteria | 3130 |
| 880 | Ga0495646_0198072 | 3300046680 | Bacteria | 1095 |
| 881 | Ga0495658_0347691 | 3300046683 | Bacteria | 942 |
| 882 | Ga0495658_0768571 | 3300046683 | Bacteria | 617 |
| 883 | Ga0495669_0000221 | 3300046684 | Bacteria | 34153 |
| 884 | Ga0495669_0000490 | 3300046684 | Bacteria | 18204 |
| 885 | Ga0495669_0001365 | 3300046684 | Bacteria | 10068 |
| 886 | Ga0495669_0002151 | 3300046684 | Bacteria | 8092 |
| 887 | Ga0495669_0011625 | 3300046684 | Bacteria | 3741 |
| 888 | Ga0495669_0019029 | 3300046684 | Bacteria | 2961 |
| 889 | Ga0495669_0055884 | 3300046684 | Bacteria | 1778 |
| 890 | Ga0495613_0211902 | 3300046689 | Bacteria | 1362 |
| 891 | Ga0495670_0005238 | 3300046691 | Bacteria | 6381 |
| 892 | Ga0495670_0016973 | 3300046691 | Bacteria | 3578 |
| 893 | Ga0495670_0072728 | 3300046691 | Bacteria | 1742 |
| 894 | Ga0495670_0429695 | 3300046691 | Bacteria | 715 |
| 895 | Ga0495670_0616348 | 3300046691 | Bacteria | 591 |
| 896 | Ga0495671_0000228 | 3300046692 | Bacteria | 48268 |
| 897 | Ga0495671_0016932 | 3300046692 | Bacteria | 3885 |
| 898 | Ga0495671_0023302 | 3300046692 | Bacteria | 3234 |
| 899 | Ga0495671_0155733 | 3300046692 | Bacteria | 1112 |
| 900 | Ga0495671_0319121 | 3300046692 | Bacteria | 746 |
| 901 | Ga0495671_0389704 | 3300046692 | Bacteria | 667 |
| 902 | Ga0495649_0000326 | 3300046694 | Bacteria | 41384 |
| 903 | Ga0495649_0008578 | 3300046694 | Bacteria | 6138 |
| 904 | Ga0495649_0037339 | 3300046694 | Bacteria | 2666 |
| 905 | Ga0495649_0092739 | 3300046694 | Bacteria | 1608 |
| 906 | Ga0495649_0126251 | 3300046694 | Bacteria | 1351 |
| 907 | Ga0495649_0224310 | 3300046694 | Bacteria | 971 |
| 908 | Ga0495649_0579531 | 3300046694 | Bacteria | 554 |
| 909 | Ga0495589_0000171 | 3300046794 | Bacteria | 58991 |
| 910 | Ga0495589_0034475 | 3300046794 | Bacteria | 2540 |
| 911 | Ga0495589_0248457 | 3300046794 | Bacteria | 831 |
| 912 | Ga0495600_0000885 | 3300046809 | Bacteria | 16025 |
| 913 | Ga0495600_0003192 | 3300046809 | Bacteria | 9599 |
| 914 | Ga0495600_0014790 | 3300046809 | Bacteria | 4922 |
| 915 | Ga0495660_0000042 | 3300046810 | Bacteria | 167048 |
| 916 | Ga0495660_0010226 | 3300046810 | Bacteria | 5455 |
| 917 | Ga0495660_0025605 | 3300046810 | Bacteria | 3349 |
| 918 | Ga0495660_0097575 | 3300046810 | Bacteria | 1517 |
| 919 | Ga0495660_0137477 | 3300046810 | Bacteria | 1219 |
| 920 | Ga0495581_0045609 | 3300047315 | Bacteria | 2534 |
| 921 | Ga0495581_0751835 | 3300047315 | Bacteria | 561 |
| 922 | Ga0495604_0001817 | 3300047317 | Bacteria | 17374 |
| 923 | Ga0495636_0138916 | 3300047318 | Bacteria | 1084 |
| 924 | Ga0495674_0083125 | 3300047319 | Bacteria | 2745 |
| 925 | Ga0495674_0319964 | 3300047319 | Bacteria | 1264 |
| 926 | Ga0495674_0557139 | 3300047319 | Bacteria | 912 |
| 927 | Ga0495674_0656737 | 3300047319 | Bacteria | 826 |
| 928 | Ga0495672_0000098 | 3300047320 | Bacteria | 141277 |
| 929 | Ga0495672_0000272 | 3300047320 | Bacteria | 71551 |
| 930 | Ga0495672_0002336 | 3300047320 | Bacteria | 17571 |
| 931 | Ga0495672_0061653 | 3300047320 | Bacteria | 2161 |
| 932 | Ga0495672_0124436 | 3300047320 | Bacteria | 1366 |
| 933 | Ga0495676_0042637 | 3300047321 | Bacteria | 3722 |
| 934 | Ga0495680_0058502 | 3300047322 | Bacteria | 2978 |
| 935 | Ga0495683_0000247 | 3300047323 | Bacteria | 48691 |
| 936 | Ga0495683_0004576 | 3300047323 | Bacteria | 7811 |
| 937 | Ga0495683_0154368 | 3300047323 | Bacteria | 1066 |
| 938 | Ga0495683_0184582 | 3300047323 | Bacteria | 950 |
| 939 | Ga0495683_0201845 | 3300047323 | Bacteria | 896 |
| 940 | Ga0495687_000205 | 3300047443 | Bacteria | 84650 |
| 941 | Ga0495687_000361 | 3300047443 | Bacteria | 56861 |
| 942 | Ga0495687_001653 | 3300047443 | Bacteria | 20049 |
| 943 | Ga0495687_024634 | 3300047443 | Bacteria | 2857 |
| 944 | Ga0495687_030944 | 3300047443 | Bacteria | 2461 |
| 945 | Ga0495687_044228 | 3300047443 | Bacteria | 1937 |
| 946 | Ga0495675_0010677 | 3300047444 | Bacteria | 5744 |
| 947 | Ga0495677_0000268 | 3300047445 | Bacteria | 22890 |
| 948 | Ga0495677_0000736 | 3300047445 | Bacteria | 13209 |
| 949 | Ga0495677_0001492 | 3300047445 | Bacteria | 9409 |
| 950 | Ga0495677_0002652 | 3300047445 | Bacteria | 6992 |
| 951 | Ga0495677_0025976 | 3300047445 | Bacteria | 2124 |
| 952 | Ga0495677_0091742 | 3300047445 | Bacteria | 1145 |
| 953 | Ga0495679_000520 | 3300047446 | Bacteria | 27232 |
| 954 | Ga0495679_007855 | 3300047446 | Bacteria | 4397 |
| 955 | Ga0495685_012776 | 3300047447 | Bacteria | 2844 |
| 956 | Ga0495685_030246 | 3300047447 | Bacteria | 1862 |
| 957 | Ga0495685_054939 | 3300047447 | Bacteria | 1347 |
| 958 | Ga0495685_058342 | 3300047447 | Bacteria | 1303 |
| 959 | Ga0495673_0001726 | 3300047469 | Bacteria | 16686 |
| 960 | Ga0495673_0022834 | 3300047469 | Bacteria | 3058 |
| 961 | Ga0495673_0081414 | 3300047469 | Bacteria | 1341 |
| 962 | Ga0495673_0088619 | 3300047469 | Bacteria | 1268 |
| 963 | Ga0495681_0016978 | 3300047470 | Bacteria | 4059 |
| 964 | Ga0495681_0093492 | 3300047470 | Bacteria | 1324 |
| 965 | Ga0495681_0138575 | 3300047470 | Bacteria | 1030 |
| 966 | Ga0495681_0210887 | 3300047470 | Bacteria | 783 |
| 967 | Ga0495684_0395627 | 3300047471 | Bacteria | 971 |
| 968 | Ga0495686_0000132 | 3300047472 | Bacteria | 151609 |
| 969 | Ga0495686_0000813 | 3300047472 | Bacteria | 40397 |
| 970 | Ga0495686_0005217 | 3300047472 | Bacteria | 10331 |
| 971 | Ga0495686_0017253 | 3300047472 | Bacteria | 4867 |
| 972 | Ga0495686_0018349 | 3300047472 | Bacteria | 4697 |
| 973 | Ga0495686_0029191 | 3300047472 | Bacteria | 3589 |
| 974 | Ga0495686_0067170 | 3300047472 | Bacteria | 2214 |
| 975 | Ga0495686_0086263 | 3300047472 | Bacteria | 1911 |
| 976 | Ga0495686_0106683 | 3300047472 | Bacteria | 1684 |
| 977 | Ga0495686_0171062 | 3300047472 | Bacteria | 1263 |
| 978 | Ga0495686_0274608 | 3300047472 | Bacteria | 939 |
| 979 | Ga0495686_0297197 | 3300047472 | Bacteria | 892 |
| 980 | Ga0495686_0328384 | 3300047472 | Bacteria | 837 |
| 981 | Ga0495593_0049657 | 3300047673 | Bacteria | 2225 |
| 982 | Ga0495602_0102240 | 3300048088 | Bacteria | 2349 |
| 983 | Ga0495602_0219034 | 3300048088 | Bacteria | 1438 |
| 984 | Ga0495602_0326137 | 3300048088 | Bacteria | 1115 |
| 985 | Ga0495614_0090231 | 3300048089 | Bacteria | 1333 |
| 986 | Ga0495626_0000022 | 3300048091 | Bacteria | 216166 |
| 987 | Ga0495626_0002730 | 3300048091 | Bacteria | 11895 |
| 988 | Ga0495626_0003299 | 3300048091 | Bacteria | 10424 |
| 989 | Ga0495626_0004535 | 3300048091 | Bacteria | 8489 |
| 990 | Ga0495626_0019805 | 3300048091 | Bacteria | 3359 |
| 991 | Ga0495626_0061603 | 3300048091 | Bacteria | 1705 |
| 992 | Ga0496100_0026254 | 3300048903 | Bacteria | 3569 |
| 993 | Ga0496100_0122606 | 3300048903 | Bacteria | 1820 |
| 994 | Ga0496100_0151663 | 3300048903 | Bacteria | 1654 |
| 995 | Ga0496100_0355408 | 3300048903 | Bacteria | 1107 |
| 996 | Ga0496100_1471670 | 3300048903 | Bacteria | 538 |
| 997 | Ga0496101_0002682 | 3300048904 | Bacteria | 10928 |
| 998 | Ga0496101_0025630 | 3300048904 | Bacteria | 4092 |
| 999 | Ga0496101_0190014 | 3300048904 | Bacteria | 1584 |
| 1000 | Ga0496101_0290365 | 3300048904 | Bacteria | 1279 |
| 1001 | Ga0496101_0374293 | 3300048904 | Bacteria | 1120 |
| 1002 | Ga0496102_0000407 | 3300048905 | Bacteria | 49858 |
| 1003 | Ga0496102_0025490 | 3300048905 | Bacteria | 5265 |
| 1004 | Ga0496102_0027530 | 3300048905 | Bacteria | 5076 |
| 1005 | Ga0496102_0050758 | 3300048905 | Bacteria | 3778 |
| 1006 | Ga0496102_0069299 | 3300048905 | Bacteria | 3238 |
| 1007 | Ga0496102_0314607 | 3300048905 | Bacteria | 1475 |
| 1008 | Ga0496102_0573436 | 3300048905 | Bacteria | 1051 |
| 1009 | Ga0496102_0778109 | 3300048905 | Bacteria | 880 |
| 1010 | Ga0496103_0010260 | 3300048906 | Bacteria | 5538 |
| 1011 | Ga0496103_0122708 | 3300048906 | Bacteria | 1656 |
| 1012 | Ga0496103_0179539 | 3300048906 | Bacteria | 1360 |
| 1013 | Ga0496104_0002743 | 3300048907 | Bacteria | 15154 |
| 1014 | Ga0496104_0008613 | 3300048907 | Bacteria | 9072 |
| 1015 | Ga0496104_0096651 | 3300048907 | Bacteria | 2826 |
| 1016 | Ga0496104_0318332 | 3300048907 | Bacteria | 1469 |
| 1017 | Ga0496104_0453273 | 3300048907 | Bacteria | 1194 |
| 1018 | Ga0496105_0022571 | 3300048908 | Bacteria | 5098 |
| 1019 | Ga0496105_0077738 | 3300048908 | Bacteria | 2740 |
| 1020 | Ga0496105_0187087 | 3300048908 | Bacteria | 1694 |
| 1021 | Ga0496106_0002352 | 3300048909 | Bacteria | 14089 |
| 1022 | Ga0496106_0039279 | 3300048909 | Bacteria | 3544 |
| 1023 | Ga0496106_0191726 | 3300048909 | Bacteria | 1625 |
| 1024 | Ga0496106_0662479 | 3300048909 | Bacteria | 833 |
| 1025 | Ga0496107_0031053 | 3300048910 | Bacteria | 3810 |
| 1026 | Ga0496107_0263175 | 3300048910 | Bacteria | 1283 |
| 1027 | Ga0496107_0274950 | 3300048910 | Bacteria | 1253 |
| 1028 | Ga0496107_0629798 | 3300048910 | Bacteria | 791 |
| 1029 | Ga0496108_0025878 | 3300048911 | Bacteria | 4839 |
| 1030 | Ga0496108_0135187 | 3300048911 | Bacteria | 2121 |
| 1031 | Ga0496109_0011263 | 3300048912 | Bacteria | 7680 |
| 1032 | Ga0496109_0067539 | 3300048912 | Bacteria | 3276 |
| 1033 | Ga0496109_0162114 | 3300048912 | Bacteria | 2095 |
| 1034 | Ga0496109_0324926 | 3300048912 | Bacteria | 1452 |
| 1035 | Ga0496109_0379043 | 3300048912 | Bacteria | 1336 |
| 1036 | Ga0496109_0451659 | 3300048912 | Bacteria | 1214 |
| 1037 | Ga0496109_0591668 | 3300048912 | Bacteria | 1045 |
| 1038 | Ga0496109_0618826 | 3300048912 | Bacteria | 1019 |
| 1039 | Ga0496110_0013088 | 3300048913 | Bacteria | 6848 |
| 1040 | Ga0496110_0408097 | 3300048913 | Bacteria | 1238 |
| 1041 | Ga0496110_0621877 | 3300048913 | Bacteria | 979 |
| 1042 | Ga0496110_1234785 | 3300048913 | Bacteria | 656 |
| 1043 | Ga0496110_1658599 | 3300048913 | Bacteria | 549 |
| 1044 | Ga0496111_0038573 | 3300048914 | Bacteria | 3424 |
| 1045 | Ga0496111_0107697 | 3300048914 | Bacteria | 2052 |
| 1046 | Ga0496111_0181316 | 3300048914 | Bacteria | 1565 |
| 1047 | Ga0496111_0922865 | 3300048914 | Bacteria | 628 |
| 1048 | Ga0496112_0043463 | 3300048915 | Bacteria | 4399 |
| 1049 | Ga0496112_0205362 | 3300048915 | Bacteria | 1928 |
| 1050 | Ga0496112_1797911 | 3300048915 | Bacteria | 525 |
| 1051 | Ga0496113_0012758 | 3300048916 | Bacteria | 5660 |
| 1052 | Ga0496113_0037873 | 3300048916 | Bacteria | 3542 |
| 1053 | Ga0496113_0168967 | 3300048916 | Bacteria | 1731 |
| 1054 | Ga0496113_0173635 | 3300048916 | Bacteria | 1707 |
| 1055 | Ga0496113_0288695 | 3300048916 | Bacteria | 1312 |
| 1056 | Ga0496114_0577767 | 3300048917 | Bacteria | 992 |
| 1057 | Ga0496114_0760769 | 3300048917 | Bacteria | 846 |
| 1058 | Ga0496115_0101186 | 3300048918 | Bacteria | 2363 |
| 1059 | Ga0496115_0143360 | 3300048918 | Bacteria | 1971 |
| 1060 | Ga0496115_0453185 | 3300048918 | Bacteria | 1036 |
| 1061 | Ga0496116_0312804 | 3300048919 | Bacteria | 740 |
| 1062 | Ga0496117_0124979 | 3300048920 | Bacteria | 1572 |
| 1063 | Ga0496118_0055513 | 3300048921 | Bacteria | 2988 |
| 1064 | Ga0496118_0074666 | 3300048921 | Bacteria | 2422 |
| 1065 | Ga0496118_0188510 | 3300048921 | Bacteria | 1236 |
| 1066 | Ga0496119_0032207 | 3300048922 | Bacteria | 3498 |
| 1067 | Ga0496119_0051790 | 3300048922 | Bacteria | 2519 |
| 1068 | Ga0496119_0141311 | 3300048922 | Bacteria | 1300 |
| 1069 | Ga0496120_0059208 | 3300048923 | Bacteria | 2147 |
| 1070 | Ga0496120_0094446 | 3300048923 | Bacteria | 1592 |
| 1071 | Ga0496120_0314536 | 3300048923 | Bacteria | 713 |
| 1072 | Ga0496121_0018815 | 3300048924 | Bacteria | 6938 |
| 1073 | Ga0496121_0058967 | 3300048924 | Bacteria | 3168 |
| 1074 | Ga0496121_0165932 | 3300048924 | Bacteria | 1609 |
| 1075 | Ga0496121_0338889 | 3300048924 | Bacteria | 1006 |
| 1076 | Ga0496121_0623274 | 3300048924 | Bacteria | 662 |
| 1077 | Ga0496121_0653958 | 3300048924 | Bacteria | 640 |
| 1078 | Ga0496122_0000210 | 3300048925 | Bacteria | 130178 |
| 1079 | Ga0496122_0025373 | 3300048925 | Bacteria | 5148 |
| 1080 | Ga0496122_0112042 | 3300048925 | Bacteria | 1788 |
| 1081 | Ga0496122_0204233 | 3300048925 | Bacteria | 1152 |
| 1082 | Ga0496122_0237101 | 3300048925 | Bacteria | 1032 |
| 1083 | Ga0496122_0351692 | 3300048925 | Bacteria | 769 |
| 1084 | Ga0496123_0000597 | 3300048926 | Bacteria | 61302 |
| 1085 | Ga0496123_0021134 | 3300048926 | Bacteria | 5067 |
| 1086 | Ga0496123_0163662 | 3300048926 | Bacteria | 1183 |
| 1087 | Ga0496123_0165903 | 3300048926 | Bacteria | 1171 |
| 1088 | Ga0496124_0033985 | 3300048927 | Bacteria | 4481 |
| 1089 | Ga0496124_0062397 | 3300048927 | Bacteria | 3119 |
| 1090 | Ga0496124_0092841 | 3300048927 | Bacteria | 2458 |
| 1091 | Ga0496124_0290186 | 3300048927 | Bacteria | 1188 |
| 1092 | Ga0496124_0298430 | 3300048927 | Bacteria | 1165 |
| 1093 | Ga0496124_0314543 | 3300048927 | Bacteria | 1124 |
| 1094 | Ga0496124_0323878 | 3300048927 | Bacteria | 1102 |
| 1095 | Ga0496124_0377707 | 3300048927 | Bacteria | 992 |
| 1096 | Ga0496125_0000789 | 3300048928 | Bacteria | 51669 |
| 1097 | Ga0496125_0019149 | 3300048928 | Bacteria | 6470 |
| 1098 | Ga0496125_0102908 | 3300048928 | Bacteria | 2097 |
| 1099 | Ga0496125_0186359 | 3300048928 | Bacteria | 1376 |
| 1100 | Ga0496125_0196528 | 3300048928 | Bacteria | 1326 |
| 1101 | Ga0496125_0251575 | 3300048928 | Bacteria | 1114 |
| 1102 | Ga0496126_0007753 | 3300048929 | Bacteria | 11705 |
| 1103 | Ga0496126_0040413 | 3300048929 | Bacteria | 4323 |
| 1104 | Ga0496126_0244404 | 3300048929 | Bacteria | 1498 |
| 1105 | Ga0496126_0291332 | 3300048929 | Bacteria | 1350 |
| 1106 | Ga0501308_010491 | 3300049128 | Bacteria | 1030 |
| 1107 | Ga0495678_000153 | 3300049459 | Bacteria | 83461 |
| 1108 | Ga0495678_000284 | 3300049459 | Bacteria | 55655 |
| 1109 | Ga0495678_000358 | 3300049459 | Bacteria | 46919 |
| 1110 | Ga0495678_020907 | 3300049459 | Bacteria | 2889 |
| 1111 | Ga0495682_0002286 | 3300049460 | Bacteria | 9162 |
| 1112 | Ga0495682_0007451 | 3300049460 | Bacteria | 4350 |
| 1113 | Ga0495682_0027231 | 3300049460 | Bacteria | 2120 |
| 1114 | Ga0495682_0034320 | 3300049460 | Bacteria | 1871 |
| 1115 | Ga0495682_0037678 | 3300049460 | Bacteria | 1778 |
| 1116 | Ga0495682_0078332 | 3300049460 | Bacteria | 1189 |
| 1117 | Ga0501033_0237742 | 3300049570 | Bacteria | 1293 |
| 1118 | Ga0501033_0469840 | 3300049570 | Bacteria | 872 |
| 1119 | Ga0501034_0079515 | 3300049571 | Bacteria | 3282 |
| 1120 | Ga0501034_0154474 | 3300049571 | Bacteria | 2269 |
| 1121 | Ga0501034_0184132 | 3300049571 | Bacteria | 2052 |
| 1122 | Ga0501034_0935133 | 3300049571 | Bacteria | 753 |
| 1123 | Ga0501036_0380039 | 3300049572 | Bacteria | 1179 |
| 1124 | Ga0501036_0847803 | 3300049572 | Bacteria | 751 |
| 1125 | Ga0501037_0389711 | 3300049573 | Bacteria | 957 |
| 1126 | Ga0501038_0027401 | 3300049574 | Bacteria | 5069 |
| 1127 | Ga0501038_0478992 | 3300049574 | Bacteria | 954 |
| 1128 | Ga0501039_0061947 | 3300049575 | Bacteria | 2898 |
| 1129 | Ga0501039_1332598 | 3300049575 | Bacteria | 553 |
| 1130 | Ga0501042_0151004 | 3300049578 | Bacteria | 1675 |
| 1131 | Ga0501042_0514848 | 3300049578 | Bacteria | 869 |
| 1132 | Ga0501043_0008172 | 3300049579 | Bacteria | 8255 |
| 1133 | Ga0501046_0104064 | 3300049580 | Bacteria | 2176 |
| 1134 | Ga0501046_0462350 | 3300049580 | Bacteria | 912 |
| 1135 | Ga0501047_0067057 | 3300049581 | Bacteria | 3459 |
| 1136 | Ga0501047_0114526 | 3300049581 | Bacteria | 2578 |
| 1137 | Ga0501048_0354026 | 3300049582 | Bacteria | 1047 |
| 1138 | Ga0501068_0068490 | 3300049584 | Bacteria | 2163 |
| 1139 | Ga0501069_0472408 | 3300049585 | Bacteria | 747 |
| 1140 | Ga0501070_0045404 | 3300049586 | Bacteria | 3654 |
| 1141 | Ga0501070_0889873 | 3300049586 | Bacteria | 695 |
| 1142 | Ga0501071_0715559 | 3300049587 | Bacteria | 771 |
| 1143 | Ga0501072_0081516 | 3300049588 | Bacteria | 2565 |
| 1144 | Ga0501073_0081735 | 3300049589 | Bacteria | 2247 |
| 1145 | Ga0501073_0169957 | 3300049589 | Bacteria | 1509 |
| 1146 | Ga0501073_0744518 | 3300049589 | Unclassified | 676 |
| 1147 | Ga0501075_0610941 | 3300049591 | Bacteria | 832 |
| 1148 | Ga0501076_0398015 | 3300049592 | Bacteria | 1132 |
| 1149 | Ga0501080_0000625 | 3300049742 | Bacteria | 28031 |
| 1150 | Ga0501080_0476877 | 3300049742 | Bacteria | 1116 |
| 1151 | Ga0501080_0830273 | 3300049742 | Bacteria | 809 |
| 1152 | Ga0501083_0046501 | 3300049744 | Bacteria | 2934 |
| 1153 | Ga0501083_0327202 | 3300049744 | Bacteria | 997 |
| 1154 | Ga0501035_0023706 | 3300049822 | Bacteria | 5630 |
| 1155 | Ga0501035_0048282 | 3300049822 | Bacteria | 3818 |
| 1156 | Ga0501035_0175459 | 3300049822 | Bacteria | 1849 |
| 1157 | Ga0501035_0179323 | 3300049822 | Bacteria | 1826 |
| 1158 | Ga0501044_0042648 | 3300049823 | Bacteria | 4718 |
| 1159 | nmdc:mga03683_83226_c1 | 3300050489 | Bacteria | 1385 |
| 1160 | nmdc:mga03n38_160543_c1 | 3300050490 | Bacteria | 1138 |
| 1161 | nmdc:mga03n38_187270_c1 | 3300050490 | Bacteria | 1064 |
| 1162 | nmdc:mga03n38_208976_c1 | 3300050490 | Bacteria | 1014 |
| 1163 | nmdc:mga03n38_945662_c1 | 3300050490 | Bacteria | 508 |
| 1164 | nmdc:mga00v17_6086_c1 | 3300050491 | Bacteria | 6385 |
| 1165 | nmdc:mga00v17_979282_c1 | 3300050491 | Bacteria | 533 |
| 1166 | nmdc:mga0yw44_11432_c1 | 3300050492 | Bacteria | 4582 |
| 1167 | nmdc:mga0yw44_200492_c1 | 3300050492 | Bacteria | 1318 |
| 1168 | nmdc:mga0yw44_617656_c1 | 3300050492 | Bacteria | 737 |
| 1169 | nmdc:mga0yw44_7441_c1 | 3300050492 | Bacteria | 3204 |
| 1170 | nmdc:mga0k408_11559_c1 | 3300050493 | Bacteria | 4810 |
| 1171 | nmdc:mga0k408_168599_c1 | 3300050493 | Bacteria | 1305 |
| 1172 | nmdc:mga0k408_472357_c1 | 3300050493 | Bacteria | 744 |
| 1173 | nmdc:mga06z11_16882_c1 | 3300050494 | Bacteria | 3300 |
| 1174 | nmdc:mga06z11_554987_c1 | 3300050494 | Bacteria | 698 |
| 1175 | nmdc:mga04h51_76342_c1 | 3300050495 | Bacteria | 1181 |
| 1176 | nmdc:mga07m45_27107_c1 | 3300050496 | Bacteria | 3154 |
| 1177 | nmdc:mga07m45_283286_c1 | 3300050496 | Bacteria | 964 |
| 1178 | nmdc:mga07m45_396056_c1 | 3300050496 | Bacteria | 801 |
| 1179 | nmdc:mga07m45_850398_c1 | 3300050496 | Bacteria | 522 |
| 1180 | nmdc:mga07m45_93689_c1 | 3300050496 | Bacteria | 1722 |
| 1181 | nmdc:mga05p37_162409_c1 | 3300050507 | Bacteria | 2728 |
| 1182 | nmdc:mga05p37_241970_c1 | 3300050507 | Bacteria | 2169 |
| 1183 | nmdc:mga05p37_288334_c1 | 3300050507 | Bacteria | 1955 |
| 1184 | nmdc:mga05p37_316594_c1 | 3300050507 | Bacteria | 1848 |
| 1185 | nmdc:mga0qj67_114234_c1 | 3300050509 | Bacteria | 2181 |
| 1186 | nmdc:mga08y16_46869_c1 | 3300050511 | Bacteria | 4525 |
| 1187 | nmdc:mga08y16_585730_c1 | 3300050511 | Bacteria | 1126 |
| 1188 | nmdc:mga08y16_811477_c1 | 3300050511 | Bacteria | 928 |
| 1189 | nmdc:mga08y16_924162_c1 | 3300050511 | Bacteria | 857 |
| 1190 | nmdc:mga0n895_1804916_c1 | 3300050512 | Bacteria | 572 |
| 1191 | nmdc:mga0n895_24920_c1 | 3300050512 | Bacteria | 5645 |
| 1192 | nmdc:mga0a205_100641_c1 | 3300050515 | Bacteria | 2789 |
| 1193 | nmdc:mga0a205_221135_c1 | 3300050515 | Bacteria | 1779 |
| 1194 | nmdc:mga0a205_53341_c1 | 3300050515 | Bacteria | 3902 |
| 1195 | nmdc:mga0sz30_27450_c1 | 3300050516 | Bacteria | 2338 |
| 1196 | Ga0495601_0156943 | 3300053077 | Bacteria | 1486 |
| 1197 | Ga0495601_0665139 | 3300053077 | Bacteria | 666 |
| 1198 | Ga0495601_0674246 | 3300053077 | Bacteria | 661 |
| 1199 | Ga0495612_0047541 | 3300053078 | Bacteria | 1758 |
| 1200 | Ga0500610_0000051 | 3300053079 | Bacteria | 36873 |
| 1201 | Ga0500610_0045062 | 3300053079 | Bacteria | 2289 |
| 1202 | Ga0500610_0324268 | 3300053079 | Bacteria | 666 |
| 1203 | Ga0495655_0036083 | 3300053083 | Bacteria | 1234 |
| 1204 | Ga0495655_0200644 | 3300053083 | Bacteria | 652 |
| 1205 | Ga0495595_0329835 | 3300053084 | Bacteria | 769 |
| 1206 | Ga0495619_0297881 | 3300053085 | Bacteria | 1117 |
| 1207 | Ga0500578_0316687 | 3300053086 | Bacteria | 921 |
| 1208 | Ga0500578_0492995 | 3300053086 | Bacteria | 690 |
| 1209 | Ga0500578_0612008 | 3300053086 | Bacteria | 597 |
| 1210 | Ga0500643_073247 | 3300053087 | Bacteria | 948 |
| 1211 | Ga0500644_0000494 | 3300053088 | Bacteria | 17156 |
| 1212 | Ga0500583_0057412 | 3300053092 | Bacteria | 1828 |
| 1213 | Ga0500566_0001729 | 3300053094 | Bacteria | 12815 |
| 1214 | Ga0500641_0044055 | 3300053096 | Bacteria | 1813 |
| 1215 | Ga0500650_0154485 | 3300053098 | Bacteria | 1060 |
| 1216 | Ga0500556_0003827 | 3300053104 | Bacteria | 4365 |
| 1217 | Ga0500556_0008528 | 3300053104 | Bacteria | 2961 |
| 1218 | Ga0500556_0021993 | 3300053104 | Bacteria | 2065 |
| 1219 | Ga0500556_0299162 | 3300053104 | Bacteria | 629 |
| 1220 | Ga0500557_000103 | 3300053105 | Bacteria | 25870 |
| 1221 | Ga0500562_000898 | 3300053108 | Bacteria | 7232 |
| 1222 | Ga0500562_083454 | 3300053108 | Bacteria | 865 |
| 1223 | Ga0500569_129120 | 3300053109 | Bacteria | 845 |
| 1224 | Ga0500594_0000454 | 3300053118 | Bacteria | 9051 |
| 1225 | Ga0500595_000166 | 3300053119 | Bacteria | 43537 |
| 1226 | Ga0500595_013390 | 3300053119 | Bacteria | 3143 |
| 1227 | Ga0500597_100338 | 3300053120 | Bacteria | 1259 |
| 1228 | Ga0500608_000656 | 3300053122 | Bacteria | 12731 |
| 1229 | Ga0500621_134660 | 3300053126 | Bacteria | 944 |
| 1230 | Ga0500642_0000158 | 3300053130 | Bacteria | 28034 |
| 1231 | Ga0500642_0004110 | 3300053130 | Bacteria | 4500 |
| 1232 | Ga0500642_0062098 | 3300053130 | Bacteria | 1680 |
| 1233 | Ga0500658_0027919 | 3300053134 | Bacteria | 2186 |
| 1234 | Ga0500658_0219776 | 3300053134 | Bacteria | 871 |
| 1235 | Ga0500564_000194 | 3300053138 | Bacteria | 16401 |
| 1236 | Ga0500577_0011382 | 3300053142 | Bacteria | 2652 |
| 1237 | Ga0500604_0031803 | 3300053151 | Bacteria | 1551 |
| 1238 | Ga0500604_0105388 | 3300053151 | Bacteria | 932 |
| 1239 | Ga0500616_0005519 | 3300053153 | Bacteria | 8568 |
| 1240 | Ga0500616_0150291 | 3300053153 | Bacteria | 1079 |
| 1241 | Ga0500619_160311 | 3300053154 | Bacteria | 764 |
| 1242 | Ga0500620_015385 | 3300053155 | Bacteria | 2163 |
| 1243 | Ga0500622_0000735 | 3300053156 | Bacteria | 28572 |
| 1244 | Ga0500622_0141289 | 3300053156 | Bacteria | 1147 |
| 1245 | Ga0500627_0070824 | 3300053158 | Bacteria | 1544 |
| 1246 | Ga0500627_0210435 | 3300053158 | Bacteria | 870 |
| 1247 | Ga0500633_0031677 | 3300053160 | Bacteria | 1711 |
| 1248 | Ga0500638_298233 | 3300053162 | Bacteria | 623 |
| 1249 | Ga0500636_0000948 | 3300053177 | Bacteria | 15635 |
| 1250 | Ga0500636_0234836 | 3300053177 | Bacteria | 946 |
| 1251 | Ga0500611_033299 | 3300053727 | Bacteria | 1083 |
| 1252 | Ga0500625_007215 | 3300053729 | Bacteria | 4810 |
| 1253 | Ga0500645_002001 | 3300053730 | Bacteria | 9564 |
| 1254 | Ga0500645_015053 | 3300053730 | Bacteria | 2457 |
| 1255 | Ga0500609_008489 | 3300053731 | Bacteria | 1386 |
| 1256 | Ga0500596_001610 | 3300053735 | Bacteria | 4580 |
| 1257 | Ga0500601_007608 | 3300053737 | Bacteria | 1202 |
| 1258 | Ga0501084_0574268 | 3300054114 | Bacteria | 953 |
| 1259 | Ga0500661_006131 | 3300055283 | Bacteria | 2242 |
| 1260 | Ga0500661_032570 | 3300055283 | Bacteria | 920 |
| 1261 | Ga0587083_0093604 | 3300059505 | Bacteria | 737 |
| 1262 | Ga0587068_108823 | 3300059641 | Bacteria | 590 |
| 1263 | Ga0587072_152062 | 3300059643 | Bacteria | 559 |
| 1264 | Ga0501082_0017632 | 3300060353 | Bacteria | 6150 |
| 1265 | Ga0501082_0151000 | 3300060353 | Bacteria | 2018 |
| 1266 | Ga0501082_0433037 | 3300060353 | Bacteria | 1149 |
| 1267 | Ga0501082_0668290 | 3300060353 | Bacteria | 909 |
| 1268 | Ga0501082_0768186 | 3300060353 | Bacteria | 843 |
| 1269 | Ga0466962_0007922 | 3300061719 | Bacteria | 5095 |
| 1270 | Ga0466962_0134580 | 3300061719 | Bacteria | 1196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100960234 | Ga0070682_1009602342 | 120 |
| 2 | 3300005344 | Ga0070661_101071932 | Ga0070661_1010719321 | 120 |
| 3 | 3300005455 | Ga0070663_100236397 | Ga0070663_1002363971 | 120 |
| 4 | 3300005548 | Ga0070665_101728303 | Ga0070665_1017283032 | 120 |
| 5 | 3300026067 | Ga0207678_10038931 | Ga0207678_100389315 | 120 |
| 6 | 3300026121 | Ga0207683_10127155 | Ga0207683_101271553 | 120 |
| 7 | 3300028379 | Ga0268266_11535231 | Ga0268266_115352311 | 120 |
| 8 | 3300049571 | Ga0501034_0935133 | Ga0501034_0935133_360_737 | 120 |
| 9 | 3300048910 | Ga0496107_0629798 | Ga0496107_0629798_10_408 | 121 |
| 10 | 3300046680 | Ga0495646_0198072 | Ga0495646_0198072_12_383 | 123 |
| 11 | 3300047472 | Ga0495686_0328384 | Ga0495686_0328384_419_814 | 124 |
| 12 | 3300046542 | Ga0495597_0429615 | Ga0495597_0429615_92_469 | 125 |
| 13 | 3300053142 | Ga0500577_0011382 | Ga0500577_0011382_2211_2609 | 125 |
| 14 | 3300038443 | Ga0395901_1624262 | Ga0395901_1624262_176_577 | 126 |
| 15 | 3300044694 | Ga0466963_0085767 | Ga0466963_0085767_1720_2121 | 126 |
| 16 | 3300044842 | Ga0466957_0057877 | Ga0466957_0057877_1080_1481 | 126 |
| 17 | 3300045976 | Ga0466967_0084535 | Ga0466967_0084535_2331_2732 | 126 |
| 18 | 3300046474 | Ga0495605_0346039 | Ga0495605_0346039_23_424 | 126 |
| 19 | 3300046477 | Ga0495664_0681205 | Ga0495664_0681205_19_420 | 126 |
| 20 | 3300046694 | Ga0495649_0579531 | Ga0495649_0579531_22_402 | 126 |
| 21 | 3300053130 | Ga0500642_0004110 | Ga0500642_0004110_19_399 | 126 |
| 22 | 3300061719 | Ga0466962_0134580 | Ga0466962_0134580_71_472 | 126 |
| 23 | 3300014968 | Ga0157379_10726321 | Ga0157379_107263212 | 127 |
| 24 | iso_pu_bacteria | 8019586578 | 8019597477 | 127 |
| 25 | 3300005457 | Ga0070662_101540312 | Ga0070662_1015403121 | 128 |
| 26 | 3300013307 | Ga0157372_11951914 | Ga0157372_119519141 | 128 |
| 27 | 3300025294 | Ga0209025_1076221 | Ga0209025_10762213 | 128 |
| 28 | 3300025933 | Ga0207706_11723743 | Ga0207706_117237432 | 128 |
| 29 | iso_pu_bacteria | 2517093001 | 2517100742 | 128 |
| 30 | iso_pu_bacteria | 2847930680 | 2847938711 | 128 |
| 31 | iso_pu_bacteria | 2879083081 | 2879088314 | 128 |
| 32 | iso_pu_bacteria | 2906643746 | 2906644914 | 128 |
| 33 | 3300046519 | Ga0495632_0141096 | Ga0495632_0141096_14_424 | 129 |
| 34 | 3300053130 | Ga0500642_0000158 | Ga0500642_0000158_22971_23402 | 129 |
| 35 | 3300005339 | Ga0070660_100408115 | Ga0070660_1004081152 | 130 |
| 36 | 3300041404 | Ga0439436_0076317 | Ga0439436_0076317_27_458 | 130 |
| 37 | 3300053098 | Ga0500650_0154485 | Ga0500650_0154485_168_560 | 130 |
| 38 | 3300053104 | Ga0500556_0003827 | Ga0500556_0003827_1810_2202 | 130 |
| 39 | 3300053108 | Ga0500562_000898 | Ga0500562_000898_5510_5902 | 130 |
| 40 | 3300053153 | Ga0500616_0150291 | Ga0500616_0150291_115_507 | 130 |
| 41 | 3300053730 | Ga0500645_002001 | Ga0500645_002001_417_809 | 130 |
| 42 | iso_pu_bacteria | 2513237104 | 2513718652 | 130 |
| 43 | iso_pu_bacteria | 2767802442 | 2770194824 | 130 |
| 44 | iso_pu_bacteria | 2924762789 | 2924764347 | 130 |
| 45 | iso_pu_bacteria | 2937822353 | 2937828468 | 130 |
| 46 | iso_pu_bacteria | 2987666974 | 2987672807 | 130 |
| 47 | iso_pu_bacteria | 8006926726 | 8006932677 | 130 |
| 48 | 3300009093 | Ga0105240_12083881 | Ga0105240_120838811 | 131 |
| 49 | 3300046452 | Ga0495617_000008 | Ga0495617_000008_211841_212242 | 131 |
| 50 | 3300046453 | Ga0495627_000191 | Ga0495627_000191_5490_5891 | 131 |
| 51 | 3300046455 | Ga0495603_0076135 | Ga0495603_0076135_1190_1591 | 131 |
| 52 | 3300046474 | Ga0495605_0000559 | Ga0495605_0000559_13780_14181 | 131 |
| 53 | 3300046474 | Ga0495605_0273266 | Ga0495605_0273266_293_694 | 131 |
| 54 | 3300046492 | Ga0495585_0015903 | Ga0495585_0015903_2365_2766 | 131 |
| 55 | 3300046492 | Ga0495585_0098895 | Ga0495585_0098895_757_1158 | 131 |
| 56 | 3300046499 | Ga0495594_0006022 | Ga0495594_0006022_71_472 | 131 |
| 57 | 3300046500 | Ga0495596_0023788 | Ga0495596_0023788_627_1028 | 131 |
| 58 | 3300046501 | Ga0495607_0004696 | Ga0495607_0004696_3948_4349 | 131 |
| 59 | 3300046513 | Ga0495616_0000395 | Ga0495616_0000395_22052_22453 | 131 |
| 60 | 3300046513 | Ga0495616_0006834 | Ga0495616_0006834_2000_2401 | 131 |
| 61 | 3300046518 | Ga0495631_0009488 | Ga0495631_0009488_4076_4477 | 131 |
| 62 | 3300046519 | Ga0495632_0000155 | Ga0495632_0000155_10590_10991 | 131 |
| 63 | 3300046523 | Ga0495644_0006276 | Ga0495644_0006276_499_900 | 131 |
| 64 | 3300046524 | Ga0495648_0001050 | Ga0495648_0001050_5544_5945 | 131 |
| 65 | 3300046528 | Ga0495642_0000617 | Ga0495642_0000617_15017_15418 | 131 |
| 66 | 3300046528 | Ga0495642_0001753 | Ga0495642_0001753_6669_7070 | 131 |
| 67 | 3300046530 | Ga0495654_0005485 | Ga0495654_0005485_340_741 | 131 |
| 68 | 3300046530 | Ga0495654_0026683 | Ga0495654_0026683_378_779 | 131 |
| 69 | 3300046535 | Ga0495586_0321697 | Ga0495586_0321697_302_703 | 131 |
| 70 | 3300046615 | Ga0495656_0012801 | Ga0495656_0012801_1723_2124 | 131 |
| 71 | 3300046616 | Ga0495668_0001900 | Ga0495668_0001900_5666_6067 | 131 |
| 72 | 3300046660 | Ga0495625_0013337 | Ga0495625_0013337_2576_3001 | 131 |
| 73 | 3300046665 | Ga0495661_0004823 | Ga0495661_0004823_3365_3766 | 131 |
| 74 | 3300046674 | Ga0495588_0144116 | Ga0495588_0144116_99_500 | 131 |
| 75 | 3300046684 | Ga0495669_0000490 | Ga0495669_0000490_12883_13284 | 131 |
| 76 | 3300046684 | Ga0495669_0002151 | Ga0495669_0002151_2804_3205 | 131 |
| 77 | 3300046692 | Ga0495671_0000228 | Ga0495671_0000228_13941_14342 | 131 |
| 78 | 3300046794 | Ga0495589_0248457 | Ga0495589_0248457_324_725 | 131 |
| 79 | 3300047315 | Ga0495581_0751835 | Ga0495581_0751835_75_476 | 131 |
| 80 | 3300047445 | Ga0495677_0001492 | Ga0495677_0001492_3275_3676 | 131 |
| 81 | 3300047470 | Ga0495681_0016978 | Ga0495681_0016978_349_774 | 131 |
| 82 | 3300047472 | Ga0495686_0017253 | Ga0495686_0017253_1151_1552 | 131 |
| 83 | 3300048907 | Ga0496104_0453273 | Ga0496104_0453273_632_1048 | 131 |
| 84 | iso_pu_bacteria | 2508501128 | 2509150879 | 131 |
| 85 | iso_pu_bacteria | 2513237092 | 2513623619 | 131 |
| 86 | iso_pu_bacteria | 2617270741 | 2617373292 | 131 |
| 87 | iso_pu_bacteria | 2824679649 | 2824680928 | 131 |
| 88 | iso_pu_bacteria | 2824732956 | 2824734732 | 131 |
| 89 | iso_pu_bacteria | 2824746037 | 2824747695 | 131 |
| 90 | iso_pu_bacteria | 2874612657 | 2874619708 | 131 |
| 91 | iso_pu_bacteria | 2881665667 | 2881667488 | 131 |
| 92 | iso_pu_bacteria | 2908775508 | 2908781750 | 131 |
| 93 | iso_pu_bacteria | 2922393267 | 2922401154 | 131 |
| 94 | iso_pu_bacteria | 3005483717 | 3005487507 | 131 |
| 95 | 3300005548 | Ga0070665_100415465 | Ga0070665_1004154654 | 132 |
| 96 | 3300006944 | Ga0099823_1022671 | Ga0099823_10226714 | 132 |
| 97 | 3300013297 | Ga0157378_12104533 | Ga0157378_121045332 | 132 |
| 98 | 3300025292 | Ga0209676_1019122 | Ga0209676_10191223 | 132 |
| 99 | 3300027296 | Ga0209389_1000057 | Ga0209389_100005741 | 132 |
| 100 | 3300027361 | Ga0209489_100226 | Ga0209489_10022630 | 132 |
| 101 | 3300027363 | Ga0209700_100085 | Ga0209700_10008558 | 132 |
| 102 | 3300028379 | Ga0268266_10338754 | Ga0268266_103387542 | 132 |
| 103 | 3300035695 | Ga0373927_0185409 | Ga0373927_0185409_361_780 | 132 |
| 104 | 3300044658 | Ga0466972_0016778 | Ga0466972_0016778_899_1318 | 132 |
| 105 | 3300044735 | Ga0466968_0107151 | Ga0466968_0107151_421_840 | 132 |
| 106 | 3300045049 | Ga0466959_0643498 | Ga0466959_0643498_137_559 | 132 |
| 107 | 3300047472 | Ga0495686_0000132 | Ga0495686_0000132_13890_14288 | 132 |
| 108 | 3300048923 | Ga0496120_0094446 | Ga0496120_0094446_102_521 | 132 |
| 109 | 3300053092 | Ga0500583_0057412 | Ga0500583_0057412_452_871 | 132 |
| 110 | 3300053134 | Ga0500658_0219776 | Ga0500658_0219776_70_495 | 132 |
| 111 | 3300060353 | Ga0501082_0433037 | Ga0501082_0433037_412_831 | 132 |
| 112 | iso_pu_bacteria | 2503198000 | 2503201118 | 132 |
| 113 | iso_pu_bacteria | 2507262055 | 2507511171 | 132 |
| 114 | iso_pu_bacteria | 2508501009 | 2508544980 | 132 |
| 115 | iso_pu_bacteria | 2508501042 | 2508693716 | 132 |
| 116 | iso_pu_bacteria | 2508501114 | 2509076167 | 132 |
| 117 | iso_pu_bacteria | 2509276022 | 2509395881 | 132 |
| 118 | iso_pu_bacteria | 2510917020 | 2511123448 | 132 |
| 119 | iso_pu_bacteria | 2511231028 | 2511396508 | 132 |
| 120 | iso_pu_bacteria | 2512875016 | 2512931992 | 132 |
| 121 | iso_pu_bacteria | 2513237094 | 2513637320 | 132 |
| 122 | iso_pu_bacteria | 2513237095 | 2513650880 | 132 |
| 123 | iso_pu_bacteria | 2513237098 | 2513676073 | 132 |
| 124 | iso_pu_bacteria | 2513237102 | 2513700469 | 132 |
| 125 | iso_pu_bacteria | 2513237139 | 2513874793 | 132 |
| 126 | iso_pu_bacteria | 2513237161 | 2514010489 | 132 |
| 127 | iso_pu_bacteria | 2515154112 | 2515625263 | 132 |
| 128 | iso_pu_bacteria | 2524023205 | 2524438045 | 132 |
| 129 | iso_pu_bacteria | 2528768022 | 2528849148 | 132 |
| 130 | iso_pu_bacteria | 2588253730 | 2588517867 | 132 |
| 131 | iso_pu_bacteria | 2617270735 | 2617353567 | 132 |
| 132 | iso_pu_bacteria | 2643221545 | 2643748272 | 132 |
| 133 | iso_pu_bacteria | 2643221552 | 2643779085 | 132 |
| 134 | iso_pu_bacteria | 2643221574 | 2643884758 | 132 |
| 135 | iso_pu_bacteria | 2643221583 | 2643925050 | 132 |
| 136 | iso_pu_bacteria | 2643221584 | 2643927652 | 132 |
| 137 | iso_pu_bacteria | 2643221598 | 2644001549 | 132 |
| 138 | iso_pu_bacteria | 2643221691 | 2644508017 | 132 |
| 139 | iso_pu_bacteria | 2643221699 | 2644551070 | 132 |
| 140 | iso_pu_bacteria | 2744054633 | 2745080998 | 132 |
| 141 | iso_pu_bacteria | 2775506902 | 2776272394 | 132 |
| 142 | iso_pu_bacteria | 2775506904 | 2776284334 | 132 |
| 143 | iso_pu_bacteria | 2791355196 | 2793061891 | 132 |
| 144 | iso_pu_bacteria | 2791355197 | 2793073086 | 132 |
| 145 | iso_pu_bacteria | 2802429603 | 2805916794 | 132 |
| 146 | iso_pu_bacteria | 2816332527 | 2818238306 | 132 |
| 147 | iso_pu_bacteria | 2824600985 | 2824603981 | 132 |
| 148 | iso_pu_bacteria | 2824609381 | 2824611562 | 132 |
| 149 | iso_pu_bacteria | 2824617872 | 2824622474 | 132 |
| 150 | iso_pu_bacteria | 2824626560 | 2824630346 | 132 |
| 151 | iso_pu_bacteria | 2824635225 | 2824638326 | 132 |
| 152 | iso_pu_bacteria | 2824644064 | 2824645940 | 132 |
| 153 | iso_pu_bacteria | 2824653114 | 2824655414 | 132 |
| 154 | iso_pu_bacteria | 2824661429 | 2824663280 | 132 |
| 155 | iso_pu_bacteria | 2824671348 | 2824673554 | 132 |
| 156 | iso_pu_bacteria | 2824687955 | 2824690323 | 132 |
| 157 | iso_pu_bacteria | 2824696289 | 2824701267 | 132 |
| 158 | iso_pu_bacteria | 2824704595 | 2824707091 | 132 |
| 159 | iso_pu_bacteria | 2824714736 | 2824716061 | 132 |
| 160 | iso_pu_bacteria | 2824723954 | 2824725917 | 132 |
| 161 | iso_pu_bacteria | 2824753945 | 2824754593 | 132 |
| 162 | iso_pu_bacteria | 2824763712 | 2824765361 | 132 |
| 163 | iso_pu_bacteria | 2824773399 | 2824773460 | 132 |
| 164 | iso_pu_bacteria | 2838122688 | 2838128040 | 132 |
| 165 | iso_pu_bacteria | 2841941048 | 2841943337 | 132 |
| 166 | iso_pu_bacteria | 2841949485 | 2841953934 | 132 |
| 167 | iso_pu_bacteria | 2841966195 | 2841968027 | 132 |
| 168 | iso_pu_bacteria | 2841974524 | 2841981281 | 132 |
| 169 | iso_pu_bacteria | 2841983080 | 2841988136 | 132 |
| 170 | iso_pu_bacteria | 2842711865 | 2842713470 | 132 |
| 171 | iso_pu_bacteria | 2844315083 | 2844316761 | 132 |
| 172 | iso_pu_bacteria | 2847939898 | 2847944091 | 132 |
| 173 | iso_pu_bacteria | 2849076700 | 2849081684 | 132 |
| 174 | iso_pu_bacteria | 2856320880 | 2856326910 | 132 |
| 175 | iso_pu_bacteria | 2857509624 | 2857512336 | 132 |
| 176 | iso_pu_bacteria | 2874590934 | 2874597905 | 132 |
| 177 | iso_pu_bacteria | 2874620515 | 2874626184 | 132 |
| 178 | iso_pu_bacteria | 2874645413 | 2874651433 | 132 |
| 179 | iso_pu_bacteria | 2876363079 | 2876368981 | 132 |
| 180 | iso_pu_bacteria | 2876771140 | 2876776505 | 132 |
| 181 | iso_pu_bacteria | 2876818435 | 2876824905 | 132 |
| 182 | iso_pu_bacteria | 2878738818 | 2878739032 | 132 |
| 183 | iso_pu_bacteria | 2879074833 | 2879081632 | 132 |
| 184 | iso_pu_bacteria | 2879127579 | 2879134193 | 132 |
| 185 | iso_pu_bacteria | 2879142872 | 2879147853 | 132 |
| 186 | iso_pu_bacteria | 2881364244 | 2881365938 | 132 |
| 187 | iso_pu_bacteria | 2885366525 | 2885366788 | 132 |
| 188 | iso_pu_bacteria | 2885374607 | 2885375024 | 132 |
| 189 | iso_pu_bacteria | 2885409591 | 2885415878 | 132 |
| 190 | iso_pu_bacteria | 2888337043 | 2888338978 | 132 |
| 191 | iso_pu_bacteria | 2888378607 | 2888381370 | 132 |
| 192 | iso_pu_bacteria | 2888388044 | 2888389268 | 132 |
| 193 | iso_pu_bacteria | 2888419890 | 2888421790 | 132 |
| 194 | iso_pu_bacteria | 2903448605 | 2903450796 | 132 |
| 195 | iso_pu_bacteria | 2903521522 | 2903527979 | 132 |
| 196 | iso_pu_bacteria | 2903528002 | 2903529709 | 132 |
| 197 | iso_pu_bacteria | 2903727486 | 2903733816 | 132 |
| 198 | iso_pu_bacteria | 2903748898 | 2903756942 | 132 |
| 199 | iso_pu_bacteria | 2903768456 | 2903772444 | 132 |
| 200 | iso_pu_bacteria | 2904666416 | 2904669202 | 132 |
| 201 | iso_pu_bacteria | 2904699407 | 2904705214 | 132 |
| 202 | iso_pu_bacteria | 2904711408 | 2904719398 | 132 |
| 203 | iso_pu_bacteria | 2906602504 | 2906606753 | 132 |
| 204 | iso_pu_bacteria | 2906626472 | 2906627479 | 132 |
| 205 | iso_pu_bacteria | 2908739725 | 2908744432 | 132 |
| 206 | iso_pu_bacteria | 2922368715 | 2922371017 | 132 |
| 207 | iso_pu_bacteria | 2924718760 | 2924719753 | 132 |
| 208 | iso_pu_bacteria | 2924776078 | 2924776394 | 132 |
| 209 | iso_pu_bacteria | 2929615660 | 2929619415 | 132 |
| 210 | iso_pu_bacteria | 2929624759 | 2929628115 | 132 |
| 211 | iso_pu_bacteria | 2932784394 | 2932785714 | 132 |
| 212 | iso_pu_bacteria | 2932794094 | 2932799058 | 132 |
| 213 | iso_pu_bacteria | 2932801729 | 2932808526 | 132 |
| 214 | iso_pu_bacteria | 2932828146 | 2932830778 | 132 |
| 215 | iso_pu_bacteria | 2933577622 | 2933581335 | 132 |
| 216 | iso_pu_bacteria | 2935608549 | 2935612600 | 132 |
| 217 | iso_pu_bacteria | 2935616580 | 2935620825 | 132 |
| 218 | iso_pu_bacteria | 2935630451 | 2935634404 | 132 |
| 219 | iso_pu_bacteria | 2935638405 | 2935639904 | 132 |
| 220 | iso_pu_bacteria | 2935648319 | 2935653503 | 132 |
| 221 | iso_pu_bacteria | 2935656913 | 2935662252 | 132 |
| 222 | iso_pu_bacteria | 2935665750 | 2935667242 | 132 |
| 223 | iso_pu_bacteria | 2935675223 | 2935677679 | 132 |
| 224 | iso_pu_bacteria | 2935684952 | 2935690382 | 132 |
| 225 | iso_pu_bacteria | 2935694250 | 2935697295 | 132 |
| 226 | iso_pu_bacteria | 2935703347 | 2935704998 | 132 |
| 227 | iso_pu_bacteria | 2935713505 | 2935717922 | 132 |
| 228 | iso_pu_bacteria | 2935722832 | 2935726928 | 132 |
| 229 | iso_pu_bacteria | 2935732158 | 2935735698 | 132 |
| 230 | iso_pu_bacteria | 2935741537 | 2935745031 | 132 |
| 231 | iso_pu_bacteria | 2935750917 | 2935755392 | 132 |
| 232 | iso_pu_bacteria | 2935769743 | 2935776163 | 132 |
| 233 | iso_pu_bacteria | 2935777560 | 2935781996 | 132 |
| 234 | iso_pu_bacteria | 2935785616 | 2935792020 | 132 |
| 235 | iso_pu_bacteria | 2935793552 | 2935800330 | 132 |
| 236 | iso_pu_bacteria | 2935801545 | 2935803600 | 132 |
| 237 | iso_pu_bacteria | 2935810662 | 2935811520 | 132 |
| 238 | iso_pu_bacteria | 2935819856 | 2935824089 | 132 |
| 239 | iso_pu_bacteria | 2935827899 | 2935829387 | 132 |
| 240 | iso_pu_bacteria | 2935837841 | 2935842635 | 132 |
| 241 | iso_pu_bacteria | 2935847175 | 2935852764 | 132 |
| 242 | iso_pu_bacteria | 2935855204 | 2935858633 | 132 |
| 243 | iso_pu_bacteria | 2935864058 | 2935866946 | 132 |
| 244 | iso_pu_bacteria | 2935873716 | 2935877076 | 132 |
| 245 | iso_pu_bacteria | 2935883170 | 2935884728 | 132 |
| 246 | iso_pu_bacteria | 2935959822 | 2935961892 | 132 |
| 247 | iso_pu_bacteria | 2935975950 | 2935976804 | 132 |
| 248 | iso_pu_bacteria | 2935984226 | 2935986210 | 132 |
| 249 | iso_pu_bacteria | 2935992306 | 2935995288 | 132 |
| 250 | iso_pu_bacteria | 2936002035 | 2936004175 | 132 |
| 251 | iso_pu_bacteria | 2936011229 | 2936016554 | 132 |
| 252 | iso_pu_bacteria | 2936019824 | 2936025132 | 132 |
| 253 | iso_pu_bacteria | 2936028420 | 2936034029 | 132 |
| 254 | iso_pu_bacteria | 2936037263 | 2936038102 | 132 |
| 255 | iso_pu_bacteria | 2936046547 | 2936052031 | 132 |
| 256 | iso_pu_bacteria | 2936055302 | 2936059804 | 132 |
| 257 | iso_pu_bacteria | 2937877337 | 2937884153 | 132 |
| 258 | iso_pu_bacteria | 2937972304 | 2937979745 | 132 |
| 259 | iso_pu_bacteria | 2940556831 | 2940561327 | 132 |
| 260 | iso_pu_bacteria | 2941507105 | 2941508890 | 132 |
| 261 | iso_pu_bacteria | 2941515067 | 2941516719 | 132 |
| 262 | iso_pu_bacteria | 2941523033 | 2941525187 | 132 |
| 263 | iso_pu_bacteria | 2941531003 | 2941533549 | 132 |
| 264 | iso_pu_bacteria | 2941538514 | 2941544518 | 132 |
| 265 | iso_pu_bacteria | 2958064165 | 2958065302 | 132 |
| 266 | iso_pu_bacteria | 2958084443 | 2958091464 | 132 |
| 267 | iso_pu_bacteria | 2958144490 | 2958147668 | 132 |
| 268 | iso_pu_bacteria | 2963644680 | 2963647216 | 132 |
| 269 | iso_pu_bacteria | 2968016561 | 2968018896 | 132 |
| 270 | iso_pu_bacteria | 2968083720 | 2968087949 | 132 |
| 271 | iso_pu_bacteria | 2970469710 | 2970470931 | 132 |
| 272 | iso_pu_bacteria | 2996348954 | 2996356533 | 132 |
| 273 | iso_pu_bacteria | 3004275668 | 3004282836 | 132 |
| 274 | iso_pu_bacteria | 3005474847 | 3005478529 | 132 |
| 275 | iso_pu_bacteria | 3005506211 | 3005511365 | 132 |
| 276 | iso_pu_bacteria | 3005710791 | 3005712452 | 132 |
| 277 | iso_pu_bacteria | 3005718088 | 3005719526 | 132 |
| 278 | iso_pu_bacteria | 637000159 | 637075087 | 132 |
| 279 | iso_pu_bacteria | 8016511872 | 8016516623 | 132 |
| 280 | iso_pu_bacteria | 8016530956 | 8016537546 | 132 |
| 281 | iso_pu_bacteria | 8016539877 | 8016541816 | 132 |
| 282 | iso_pu_bacteria | 8016548790 | 8016551458 | 132 |
| 283 | iso_pu_bacteria | 8016557553 | 8016559840 | 132 |
| 284 | iso_pu_bacteria | 8016566248 | 8016567202 | 132 |
| 285 | iso_pu_bacteria | 8016575299 | 8016579917 | 132 |
| 286 | iso_pu_bacteria | 8016583857 | 8016588929 | 132 |
| 287 | iso_pu_bacteria | 8016595262 | 8016597781 | 132 |
| 288 | iso_pu_bacteria | 8016603502 | 8016604527 | 132 |
| 289 | iso_pu_bacteria | 8016613128 | 8016620486 | 132 |
| 290 | iso_pu_bacteria | 8016622563 | 8016629495 | 132 |
| 291 | iso_pu_bacteria | 8017057580 | 8017059928 | 132 |
| 292 | iso_pu_bacteria | 8019530166 | 8019537223 | 132 |
| 293 | iso_pu_bacteria | 8019538911 | 8019538935 | 132 |
| 294 | iso_pu_bacteria | 8019547302 | 8019548432 | 132 |
| 295 | iso_pu_bacteria | 8019576017 | 8019579425 | 132 |
| 296 | iso_pu_bacteria | 8019597564 | 8019604203 | 132 |
| 297 | iso_pu_bacteria | 8019608314 | 8019614327 | 132 |
| 298 | iso_pu_bacteria | 8019619141 | 8019624970 | 132 |
| 299 | iso_pu_bacteria | 8019629233 | 8019637211 | 132 |
| 300 | iso_pu_bacteria | 8019648815 | 8019650201 | 132 |
| 301 | iso_pu_bacteria | 8019668869 | 8019674606 | 132 |
| 302 | iso_pu_bacteria | 8019678201 | 8019681495 | 132 |
| 303 | iso_pu_bacteria | 8047673197 | 8047675849 | 132 |
| 304 | iso_pu_bacteria | 8055742211 | 8055749328 | 132 |
| 305 | iso_pu_bacteria | 8056689827 | 8056691734 | 132 |
| 306 | iso_pu_bacteria | 8056967851 | 8056973579 | 132 |
| 307 | 3300005262 | Ga0065165_1000891 | Ga0065165_100089119 | 133 |
| 308 | 3300005327 | Ga0070658_10723903 | Ga0070658_107239032 | 133 |
| 309 | 3300005344 | Ga0070661_100698507 | Ga0070661_1006985072 | 133 |
| 310 | 3300009093 | Ga0105240_10093354 | Ga0105240_100933545 | 133 |
| 311 | 3300009551 | Ga0105238_10098976 | Ga0105238_100989764 | 133 |
| 312 | 3300015262 | Ga0182007_10349436 | Ga0182007_103494361 | 133 |
| 313 | 3300025909 | Ga0207705_11397978 | Ga0207705_113979781 | 133 |
| 314 | 3300025935 | Ga0207709_10800936 | Ga0207709_108009361 | 133 |
| 315 | 3300046452 | Ga0495617_040015 | Ga0495617_040015_595_1008 | 133 |
| 316 | 3300046453 | Ga0495627_009857 | Ga0495627_009857_2123_2536 | 133 |
| 317 | 3300046457 | Ga0495590_0000017 | Ga0495590_0000017_16839_17252 | 133 |
| 318 | 3300046457 | Ga0495590_0012598 | Ga0495590_0012598_388_801 | 133 |
| 319 | 3300046458 | Ga0495591_000091 | Ga0495591_000091_84197_84598 | 133 |
| 320 | 3300046458 | Ga0495591_004378 | Ga0495591_004378_3182_3586 | 133 |
| 321 | 3300046460 | Ga0495638_0068452 | Ga0495638_0068452_42_443 | 133 |
| 322 | 3300046474 | Ga0495605_0004429 | Ga0495605_0004429_1768_2169 | 133 |
| 323 | 3300046474 | Ga0495605_0014773 | Ga0495605_0014773_695_1099 | 133 |
| 324 | 3300046474 | Ga0495605_0039351 | Ga0495605_0039351_530_955 | 133 |
| 325 | 3300046474 | Ga0495605_0122734 | Ga0495605_0122734_226_651 | 133 |
| 326 | 3300046491 | Ga0495584_0001217 | Ga0495584_0001217_9179_9592 | 133 |
| 327 | 3300046491 | Ga0495584_0087892 | Ga0495584_0087892_220_624 | 133 |
| 328 | 3300046492 | Ga0495585_0006675 | Ga0495585_0006675_5717_6130 | 133 |
| 329 | 3300046492 | Ga0495585_0011422 | Ga0495585_0011422_4237_4650 | 133 |
| 330 | 3300046492 | Ga0495585_0013692 | Ga0495585_0013692_426_830 | 133 |
| 331 | 3300046492 | Ga0495585_0065985 | Ga0495585_0065985_458_874 | 133 |
| 332 | 3300046492 | Ga0495585_0225037 | Ga0495585_0225037_99_512 | 133 |
| 333 | 3300046499 | Ga0495594_0002735 | Ga0495594_0002735_5022_5435 | 133 |
| 334 | 3300046500 | Ga0495596_0003495 | Ga0495596_0003495_3872_4285 | 133 |
| 335 | 3300046500 | Ga0495596_0011542 | Ga0495596_0011542_1791_2204 | 133 |
| 336 | 3300046500 | Ga0495596_0014417 | Ga0495596_0014417_1157_1570 | 133 |
| 337 | 3300046500 | Ga0495596_0226131 | Ga0495596_0226131_138_542 | 133 |
| 338 | 3300046501 | Ga0495607_0009255 | Ga0495607_0009255_164_577 | 133 |
| 339 | 3300046501 | Ga0495607_0032829 | Ga0495607_0032829_1706_2110 | 133 |
| 340 | 3300046506 | Ga0495583_0001871 | Ga0495583_0001871_7836_8261 | 133 |
| 341 | 3300046506 | Ga0495583_0003628 | Ga0495583_0003628_2472_2885 | 133 |
| 342 | 3300046506 | Ga0495583_0037224 | Ga0495583_0037224_1868_2272 | 133 |
| 343 | 3300046507 | Ga0495606_0021322 | Ga0495606_0021322_2175_2588 | 133 |
| 344 | 3300046507 | Ga0495606_0070480 | Ga0495606_0070480_1758_2174 | 133 |
| 345 | 3300046512 | Ga0495610_0023569 | Ga0495610_0023569_1183_1584 | 133 |
| 346 | 3300046513 | Ga0495616_0009676 | Ga0495616_0009676_1116_1517 | 133 |
| 347 | 3300046513 | Ga0495616_0036379 | Ga0495616_0036379_1181_1585 | 133 |
| 348 | 3300046513 | Ga0495616_0065871 | Ga0495616_0065871_898_1323 | 133 |
| 349 | 3300046513 | Ga0495616_0125881 | Ga0495616_0125881_564_977 | 133 |
| 350 | 3300046515 | Ga0495620_0080128 | Ga0495620_0080128_237_641 | 133 |
| 351 | 3300046518 | Ga0495631_0000562 | Ga0495631_0000562_13368_13793 | 133 |
| 352 | 3300046518 | Ga0495631_0004969 | Ga0495631_0004969_6014_6427 | 133 |
| 353 | 3300046518 | Ga0495631_0012205 | Ga0495631_0012205_172_585 | 133 |
| 354 | 3300046518 | Ga0495631_0034871 | Ga0495631_0034871_1734_2138 | 133 |
| 355 | 3300046519 | Ga0495632_0027540 | Ga0495632_0027540_954_1355 | 133 |
| 356 | 3300046520 | Ga0495637_0000004 | Ga0495637_0000004_7062_7463 | 133 |
| 357 | 3300046520 | Ga0495637_0021740 | Ga0495637_0021740_897_1301 | 133 |
| 358 | 3300046520 | Ga0495637_0048357 | Ga0495637_0048357_994_1407 | 133 |
| 359 | 3300046523 | Ga0495644_0002176 | Ga0495644_0002176_6587_7000 | 133 |
| 360 | 3300046523 | Ga0495644_0161325 | Ga0495644_0161325_196_597 | 133 |
| 361 | 3300046524 | Ga0495648_0001311 | Ga0495648_0001311_15107_15520 | 133 |
| 362 | 3300046524 | Ga0495648_0004718 | Ga0495648_0004718_5794_6198 | 133 |
| 363 | 3300046524 | Ga0495648_0283757 | Ga0495648_0283757_101_526 | 133 |
| 364 | 3300046528 | Ga0495642_0005805 | Ga0495642_0005805_1021_1434 | 133 |
| 365 | 3300046528 | Ga0495642_0005858 | Ga0495642_0005858_739_1152 | 133 |
| 366 | 3300046528 | Ga0495642_0024677 | Ga0495642_0024677_570_974 | 133 |
| 367 | 3300046530 | Ga0495654_0015086 | Ga0495654_0015086_3644_4069 | 133 |
| 368 | 3300046538 | Ga0495609_0002370 | Ga0495609_0002370_2933_3346 | 133 |
| 369 | 3300046538 | Ga0495609_0014233 | Ga0495609_0014233_3077_3478 | 133 |
| 370 | 3300046538 | Ga0495609_0025650 | Ga0495609_0025650_2102_2515 | 133 |
| 371 | 3300046542 | Ga0495597_0001066 | Ga0495597_0001066_12042_12455 | 133 |
| 372 | 3300046557 | Ga0495622_0247580 | Ga0495622_0247580_142_555 | 133 |
| 373 | 3300046558 | Ga0495633_0002747 | Ga0495633_0002747_9985_10386 | 133 |
| 374 | 3300046616 | Ga0495668_0000392 | Ga0495668_0000392_45914_46339 | 133 |
| 375 | 3300046616 | Ga0495668_0010923 | Ga0495668_0010923_3543_3947 | 133 |
| 376 | 3300046648 | Ga0495611_0000157 | Ga0495611_0000157_39388_39801 | 133 |
| 377 | 3300046648 | Ga0495611_0010918 | Ga0495611_0010918_1619_2032 | 133 |
| 378 | 3300046660 | Ga0495625_0020065 | Ga0495625_0020065_3479_3880 | 133 |
| 379 | 3300046665 | Ga0495661_0013825 | Ga0495661_0013825_4211_4624 | 133 |
| 380 | 3300046665 | Ga0495661_0070545 | Ga0495661_0070545_648_1052 | 133 |
| 381 | 3300046665 | Ga0495661_0073867 | Ga0495661_0073867_1310_1723 | 133 |
| 382 | 3300046665 | Ga0495661_0131343 | Ga0495661_0131343_591_1004 | 133 |
| 383 | 3300046665 | Ga0495661_0140771 | Ga0495661_0140771_666_1091 | 133 |
| 384 | 3300046674 | Ga0495588_0012241 | Ga0495588_0012241_2689_3102 | 133 |
| 385 | 3300046674 | Ga0495588_0043710 | Ga0495588_0043710_481_894 | 133 |
| 386 | 3300046684 | Ga0495669_0001365 | Ga0495669_0001365_9269_9682 | 133 |
| 387 | 3300046684 | Ga0495669_0011625 | Ga0495669_0011625_2324_2728 | 133 |
| 388 | 3300046684 | Ga0495669_0055884 | Ga0495669_0055884_285_698 | 133 |
| 389 | 3300046691 | Ga0495670_0005238 | Ga0495670_0005238_5091_5495 | 133 |
| 390 | 3300046691 | Ga0495670_0016973 | Ga0495670_0016973_171_584 | 133 |
| 391 | 3300046691 | Ga0495670_0429695 | Ga0495670_0429695_13_414 | 133 |
| 392 | 3300046692 | Ga0495671_0016932 | Ga0495671_0016932_2095_2520 | 133 |
| 393 | 3300046692 | Ga0495671_0023302 | Ga0495671_0023302_2767_3168 | 133 |
| 394 | 3300046692 | Ga0495671_0319121 | Ga0495671_0319121_59_463 | 133 |
| 395 | 3300046694 | Ga0495649_0000326 | Ga0495649_0000326_6036_6437 | 133 |
| 396 | 3300046694 | Ga0495649_0037339 | Ga0495649_0037339_2024_2437 | 133 |
| 397 | 3300046794 | Ga0495589_0034475 | Ga0495589_0034475_1824_2228 | 133 |
| 398 | 3300046810 | Ga0495660_0010226 | Ga0495660_0010226_4437_4838 | 133 |
| 399 | 3300046810 | Ga0495660_0025605 | Ga0495660_0025605_2062_2463 | 133 |
| 400 | 3300046810 | Ga0495660_0097575 | Ga0495660_0097575_1030_1443 | 133 |
| 401 | 3300046810 | Ga0495660_0137477 | Ga0495660_0137477_474_887 | 133 |
| 402 | 3300047318 | Ga0495636_0138916 | Ga0495636_0138916_363_776 | 133 |
| 403 | 3300047320 | Ga0495672_0000098 | Ga0495672_0000098_98815_99216 | 133 |
| 404 | 3300047320 | Ga0495672_0061653 | Ga0495672_0061653_1178_1582 | 133 |
| 405 | 3300047323 | Ga0495683_0000247 | Ga0495683_0000247_14342_14743 | 133 |
| 406 | 3300047443 | Ga0495687_044228 | Ga0495687_044228_1409_1810 | 133 |
| 407 | 3300047445 | Ga0495677_0000268 | Ga0495677_0000268_15424_15837 | 133 |
| 408 | 3300047446 | Ga0495679_000520 | Ga0495679_000520_3009_3434 | 133 |
| 409 | 3300047446 | Ga0495679_007855 | Ga0495679_007855_2842_3255 | 133 |
| 410 | 3300047447 | Ga0495685_012776 | Ga0495685_012776_1756_2160 | 133 |
| 411 | 3300047447 | Ga0495685_030246 | Ga0495685_030246_1354_1779 | 133 |
| 412 | 3300047447 | Ga0495685_054939 | Ga0495685_054939_592_993 | 133 |
| 413 | 3300047470 | Ga0495681_0093492 | Ga0495681_0093492_23_448 | 133 |
| 414 | 3300047470 | Ga0495681_0210887 | Ga0495681_0210887_258_674 | 133 |
| 415 | 3300047472 | Ga0495686_0000813 | Ga0495686_0000813_9235_9648 | 133 |
| 416 | 3300047472 | Ga0495686_0171062 | Ga0495686_0171062_641_1054 | 133 |
| 417 | 3300048091 | Ga0495626_0003299 | Ga0495626_0003299_2038_2451 | 133 |
| 418 | 3300048091 | Ga0495626_0004535 | Ga0495626_0004535_6319_6732 | 133 |
| 419 | 3300048091 | Ga0495626_0019805 | Ga0495626_0019805_600_1025 | 133 |
| 420 | 3300048091 | Ga0495626_0061603 | Ga0495626_0061603_1252_1656 | 133 |
| 421 | 3300048905 | Ga0496102_0000407 | Ga0496102_0000407_31400_31813 | 133 |
| 422 | 3300048905 | Ga0496102_0778109 | Ga0496102_0778109_157_570 | 133 |
| 423 | 3300048906 | Ga0496103_0122708 | Ga0496103_0122708_40_453 | 133 |
| 424 | 3300048910 | Ga0496107_0031053 | Ga0496107_0031053_1161_1574 | 133 |
| 425 | 3300048913 | Ga0496110_0013088 | Ga0496110_0013088_2505_2918 | 133 |
| 426 | 3300048913 | Ga0496110_1658599 | Ga0496110_1658599_115_516 | 133 |
| 427 | 3300048914 | Ga0496111_0107697 | Ga0496111_0107697_13_426 | 133 |
| 428 | 3300048924 | Ga0496121_0653958 | Ga0496121_0653958_11_424 | 133 |
| 429 | 3300048925 | Ga0496122_0112042 | Ga0496122_0112042_516_920 | 133 |
| 430 | 3300048925 | Ga0496122_0237101 | Ga0496122_0237101_426_827 | 133 |
| 431 | 3300048927 | Ga0496124_0033985 | Ga0496124_0033985_2895_3296 | 133 |
| 432 | 3300048927 | Ga0496124_0298430 | Ga0496124_0298430_337_741 | 133 |
| 433 | 3300048929 | Ga0496126_0244404 | Ga0496126_0244404_881_1294 | 133 |
| 434 | 3300049459 | Ga0495678_000153 | Ga0495678_000153_67674_68087 | 133 |
| 435 | 3300049459 | Ga0495678_000284 | Ga0495678_000284_47053_47466 | 133 |
| 436 | 3300049459 | Ga0495678_020907 | Ga0495678_020907_572_976 | 133 |
| 437 | 3300049460 | Ga0495682_0002286 | Ga0495682_0002286_6129_6542 | 133 |
| 438 | 3300049460 | Ga0495682_0007451 | Ga0495682_0007451_2676_3089 | 133 |
| 439 | 3300049460 | Ga0495682_0027231 | Ga0495682_0027231_1404_1808 | 133 |
| 440 | 3300049460 | Ga0495682_0034320 | Ga0495682_0034320_732_1157 | 133 |
| 441 | 3300049571 | Ga0501034_0154474 | Ga0501034_0154474_1016_1438 | 133 |
| 442 | 3300049571 | Ga0501034_0184132 | Ga0501034_0184132_832_1254 | 133 |
| 443 | 3300049588 | Ga0501072_0081516 | Ga0501072_0081516_1752_2174 | 133 |
| 444 | 3300049822 | Ga0501035_0023706 | Ga0501035_0023706_1131_1553 | 133 |
| 445 | 3300004625 | Ga0055543_1003926 | Ga0055543_10039264 | 134 |
| 446 | 3300005262 | Ga0065165_1001577 | Ga0065165_100157722 | 134 |
| 447 | 3300005288 | Ga0065714_10469235 | Ga0065714_104692351 | 134 |
| 448 | 3300005293 | Ga0065715_10792325 | Ga0065715_107923251 | 134 |
| 449 | 3300006051 | Ga0075364_10132828 | Ga0075364_101328283 | 134 |
| 450 | 3300006177 | Ga0075362_10190769 | Ga0075362_101907692 | 134 |
| 451 | 3300006186 | Ga0075369_10163813 | Ga0075369_101638131 | 134 |
| 452 | 3300006353 | Ga0075370_10374871 | Ga0075370_103748712 | 134 |
| 453 | 3300009174 | Ga0105241_10730466 | Ga0105241_107304662 | 134 |
| 454 | 3300010375 | Ga0105239_11646180 | Ga0105239_116461802 | 134 |
| 455 | 3300025261 | Ga0209233_1008559 | Ga0209233_10085595 | 134 |
| 456 | 3300025937 | Ga0207669_10406698 | Ga0207669_104066982 | 134 |
| 457 | 3300031456 | Ga0307513_10779091 | Ga0307513_107790912 | 134 |
| 458 | 3300037418 | Ga0395900_0000601 | Ga0395900_0000601_42307_42732 | 134 |
| 459 | 3300037466 | Ga0395898_0010480 | Ga0395898_0010480_2651_3076 | 134 |
| 460 | 3300041459 | Ga0451800_0909938 | Ga0451800_0909938_57_482 | 134 |
| 461 | 3300044658 | Ga0466972_0002026 | Ga0466972_0002026_3008_3433 | 134 |
| 462 | 3300044683 | Ga0466965_0088657 | Ga0466965_0088657_1118_1543 | 134 |
| 463 | 3300045049 | Ga0466959_0479042 | Ga0466959_0479042_52_477 | 134 |
| 464 | 3300045049 | Ga0466959_0643465 | Ga0466959_0643465_140_589 | 134 |
| 465 | 3300046460 | Ga0495638_0253610 | Ga0495638_0253610_395_820 | 134 |
| 466 | 3300046492 | Ga0495585_0065627 | Ga0495585_0065627_1003_1428 | 134 |
| 467 | 3300046512 | Ga0495610_0126098 | Ga0495610_0126098_667_1092 | 134 |
| 468 | 3300046518 | Ga0495631_0289937 | Ga0495631_0289937_31_456 | 134 |
| 469 | 3300046520 | Ga0495637_0101020 | Ga0495637_0101020_179_604 | 134 |
| 470 | 3300046522 | Ga0495643_0027136 | Ga0495643_0027136_242_667 | 134 |
| 471 | 3300046524 | Ga0495648_0003160 | Ga0495648_0003160_12395_12820 | 134 |
| 472 | 3300046530 | Ga0495654_0155762 | Ga0495654_0155762_287_712 | 134 |
| 473 | 3300046542 | Ga0495597_0025540 | Ga0495597_0025540_1135_1560 | 134 |
| 474 | 3300046616 | Ga0495668_0310381 | Ga0495668_0310381_98_523 | 134 |
| 475 | 3300046660 | Ga0495625_0022295 | Ga0495625_0022295_1644_2069 | 134 |
| 476 | 3300046665 | Ga0495661_0407979 | Ga0495661_0407979_196_621 | 134 |
| 477 | 3300047323 | Ga0495683_0154368 | Ga0495683_0154368_494_919 | 134 |
| 478 | 3300047443 | Ga0495687_030944 | Ga0495687_030944_674_1099 | 134 |
| 479 | 3300047469 | Ga0495673_0001726 | Ga0495673_0001726_12139_12564 | 134 |
| 480 | 3300047470 | Ga0495681_0138575 | Ga0495681_0138575_41_466 | 134 |
| 481 | 3300048903 | Ga0496100_1471670 | Ga0496100_1471670_50_475 | 134 |
| 482 | 3300048912 | Ga0496109_0451659 | Ga0496109_0451659_536_961 | 134 |
| 483 | 3300048928 | Ga0496125_0186359 | Ga0496125_0186359_904_1329 | 134 |
| 484 | 3300049570 | Ga0501033_0469840 | Ga0501033_0469840_44_490 | 134 |
| 485 | 3300049579 | Ga0501043_0008172 | Ga0501043_0008172_19_444 | 134 |
| 486 | 3300049586 | Ga0501070_0889873 | Ga0501070_0889873_233_679 | 134 |
| 487 | 3300049589 | Ga0501073_0744518 | Ga0501073_0744518_49_495 | 134 |
| 488 | 3300050492 | nmdc:mga0yw44_617656_c1 | nmdc:mga0yw44_617656_c1_176_601 | 134 |
| 489 | 3300050496 | nmdc:mga07m45_396056_c1 | nmdc:mga07m45_396056_c1_19_444 | 134 |
| 490 | 3300053079 | Ga0500610_0045062 | Ga0500610_0045062_658_1083 | 134 |
| 491 | 3300053083 | Ga0495655_0200644 | Ga0495655_0200644_96_521 | 134 |
| 492 | 3300053086 | Ga0500578_0316687 | Ga0500578_0316687_189_614 | 134 |
| 493 | 3300053088 | Ga0500644_0000494 | Ga0500644_0000494_12684_13109 | 134 |
| 494 | 3300053096 | Ga0500641_0044055 | Ga0500641_0044055_19_444 | 134 |
| 495 | 3300053104 | Ga0500556_0008528 | Ga0500556_0008528_1609_2013 | 134 |
| 496 | 3300053134 | Ga0500658_0027919 | Ga0500658_0027919_971_1396 | 134 |
| 497 | 3300053138 | Ga0500564_000194 | Ga0500564_000194_4056_4481 | 134 |
| 498 | 3300053151 | Ga0500604_0031803 | Ga0500604_0031803_889_1314 | 134 |
| 499 | 3300053151 | Ga0500604_0105388 | Ga0500604_0105388_257_682 | 134 |
| 500 | 3300053153 | Ga0500616_0005519 | Ga0500616_0005519_3311_3715 | 134 |
| 501 | 3300053155 | Ga0500620_015385 | Ga0500620_015385_342_767 | 134 |
| 502 | 3300053158 | Ga0500627_0070824 | Ga0500627_0070824_210_635 | 134 |
| 503 | 3300053158 | Ga0500627_0210435 | Ga0500627_0210435_10_435 | 134 |
| 504 | 3300053727 | Ga0500611_033299 | Ga0500611_033299_542_967 | 134 |
| 505 | 3300055283 | Ga0500661_032570 | Ga0500661_032570_56_481 | 134 |
| 506 | 3300003187 | JGI25151J46595_10004677 | JGI25151J46595_100046775 | 135 |
| 507 | 3300005262 | Ga0065165_1012860 | Ga0065165_10128603 | 135 |
| 508 | 3300005329 | Ga0070683_100299943 | Ga0070683_1002999431 | 135 |
| 509 | 3300005335 | Ga0070666_10112021 | Ga0070666_101120213 | 135 |
| 510 | 3300005367 | Ga0070667_100159713 | Ga0070667_1001597134 | 135 |
| 511 | 3300005434 | Ga0070709_10009416 | Ga0070709_100094166 | 135 |
| 512 | 3300005435 | Ga0070714_100249358 | Ga0070714_1002493583 | 135 |
| 513 | 3300005435 | Ga0070714_100329505 | Ga0070714_1003295053 | 135 |
| 514 | 3300005436 | Ga0070713_100129970 | Ga0070713_1001299702 | 135 |
| 515 | 3300005436 | Ga0070713_100834282 | Ga0070713_1008342822 | 135 |
| 516 | 3300005439 | Ga0070711_100007910 | Ga0070711_1000079106 | 135 |
| 517 | 3300005458 | Ga0070681_10564684 | Ga0070681_105646842 | 135 |
| 518 | 3300005530 | Ga0070679_100379775 | Ga0070679_1003797752 | 135 |
| 519 | 3300005535 | Ga0070684_100181505 | Ga0070684_1001815054 | 135 |
| 520 | 3300005548 | Ga0070665_100036208 | Ga0070665_1000362086 | 135 |
| 521 | 3300005563 | Ga0068855_100002071 | Ga0068855_1000020714 | 135 |
| 522 | 3300005614 | Ga0068856_100123838 | Ga0068856_1001238383 | 135 |
| 523 | 3300005834 | Ga0068851_10123075 | Ga0068851_101230752 | 135 |
| 524 | 3300005843 | Ga0068860_101556681 | Ga0068860_1015566812 | 135 |
| 525 | 3300006028 | Ga0070717_10093009 | Ga0070717_100930093 | 135 |
| 526 | 3300006028 | Ga0070717_10696414 | Ga0070717_106964142 | 135 |
| 527 | 3300006173 | Ga0070716_100266843 | Ga0070716_1002668431 | 135 |
| 528 | 3300006942 | Ga0099824_1042955 | Ga0099824_10429553 | 135 |
| 529 | 3300006943 | Ga0099822_1080690 | Ga0099822_10806901 | 135 |
| 530 | 3300009101 | Ga0105247_11127634 | Ga0105247_111276341 | 135 |
| 531 | 3300009174 | Ga0105241_10044941 | Ga0105241_100449414 | 135 |
| 532 | 3300009545 | Ga0105237_10356014 | Ga0105237_103560142 | 135 |
| 533 | 3300009551 | Ga0105238_10023368 | Ga0105238_100233684 | 135 |
| 534 | 3300010375 | Ga0105239_11365012 | Ga0105239_113650121 | 135 |
| 535 | 3300013105 | Ga0157369_10768302 | Ga0157369_107683023 | 135 |
| 536 | 3300013307 | Ga0157372_10599299 | Ga0157372_105992993 | 135 |
| 537 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001187 | 135 |
| 538 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005187 | 135 |
| 539 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003577 | 135 |
| 540 | 3300021324 | Ga0214545_1019813 | Ga0214545_10198135 | 135 |
| 541 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002188 | 135 |
| 542 | 3300021327 | Ga0214543_1027099 | Ga0214543_10270992 | 135 |
| 543 | 3300025258 | Ga0209129_1000285 | Ga0209129_100028520 | 135 |
| 544 | 3300025284 | Ga0209130_1074870 | Ga0209130_10748701 | 135 |
| 545 | 3300025294 | Ga0209025_1001792 | Ga0209025_100179230 | 135 |
| 546 | 3300025297 | Ga0209758_1016045 | Ga0209758_10160455 | 135 |
| 547 | 3300025315 | Ga0207697_10121100 | Ga0207697_101211003 | 135 |
| 548 | 3300025903 | Ga0207680_10101447 | Ga0207680_101014472 | 135 |
| 549 | 3300025906 | Ga0207699_10018621 | Ga0207699_100186216 | 135 |
| 550 | 3300025911 | Ga0207654_10138954 | Ga0207654_101389543 | 135 |
| 551 | 3300025915 | Ga0207693_10113735 | Ga0207693_101137353 | 135 |
| 552 | 3300025916 | Ga0207663_10144917 | Ga0207663_101449174 | 135 |
| 553 | 3300025921 | Ga0207652_10270156 | Ga0207652_102701562 | 135 |
| 554 | 3300025924 | Ga0207694_10024573 | Ga0207694_100245734 | 135 |
| 555 | 3300025928 | Ga0207700_10232060 | Ga0207700_102320602 | 135 |
| 556 | 3300025928 | Ga0207700_10713500 | Ga0207700_107135002 | 135 |
| 557 | 3300025929 | Ga0207664_10429853 | Ga0207664_104298533 | 135 |
| 558 | 3300025939 | Ga0207665_10303621 | Ga0207665_103036213 | 135 |
| 559 | 3300025949 | Ga0207667_10001428 | Ga0207667_100014284 | 135 |
| 560 | 3300026116 | Ga0207674_10776492 | Ga0207674_107764922 | 135 |
| 561 | 3300027296 | Ga0209389_1000083 | Ga0209389_100008379 | 135 |
| 562 | 3300027357 | Ga0209589_1000097 | Ga0209589_100009779 | 135 |
| 563 | 3300027361 | Ga0209489_100105 | Ga0209489_100105105 | 135 |
| 564 | 3300028380 | Ga0268265_10729956 | Ga0268265_107299562 | 135 |
| 565 | 3300031548 | Ga0307408_101728997 | Ga0307408_1017289972 | 135 |
| 566 | 3300031852 | Ga0307410_10316307 | Ga0307410_103163072 | 135 |
| 567 | 3300031903 | Ga0307407_10106184 | Ga0307407_101061843 | 135 |
| 568 | 3300031911 | Ga0307412_11745386 | Ga0307412_117453861 | 135 |
| 569 | 3300031995 | Ga0307409_100613927 | Ga0307409_1006139272 | 135 |
| 570 | 3300032002 | Ga0307416_100658552 | Ga0307416_1006585523 | 135 |
| 571 | 3300032004 | Ga0307414_10164251 | Ga0307414_101642514 | 135 |
| 572 | 3300032004 | Ga0307414_10292212 | Ga0307414_102922122 | 135 |
| 573 | 3300032005 | Ga0307411_10165248 | Ga0307411_101652482 | 135 |
| 574 | 3300041512 | Ga0451853_3944585 | Ga0451853_3944585_457_864 | 135 |
| 575 | 3300044693 | Ga0466961_0190296 | Ga0466961_0190296_309_737 | 135 |
| 576 | 3300044694 | Ga0466963_0636864 | Ga0466963_0636864_313_741 | 135 |
| 577 | 3300044706 | Ga0466964_0287018 | Ga0466964_0287018_133_561 | 135 |
| 578 | 3300046542 | Ga0495597_0000698 | Ga0495597_0000698_14917_15339 | 135 |
| 579 | 3300046665 | Ga0495661_0001268 | Ga0495661_0001268_12774_13202 | 135 |
| 580 | 3300048927 | Ga0496124_0062397 | Ga0496124_0062397_130_552 | 135 |
| 581 | 3300049571 | Ga0501034_0079515 | Ga0501034_0079515_1681_2109 | 135 |
| 582 | 3300049575 | Ga0501039_0061947 | Ga0501039_0061947_1298_1726 | 135 |
| 583 | 3300049584 | Ga0501068_0068490 | Ga0501068_0068490_1045_1473 | 135 |
| 584 | 3300049589 | Ga0501073_0081735 | Ga0501073_0081735_952_1380 | 135 |
| 585 | 3300049742 | Ga0501080_0000625 | Ga0501080_0000625_5650_6078 | 135 |
| 586 | 3300049744 | Ga0501083_0046501 | Ga0501083_0046501_194_622 | 135 |
| 587 | 3300049822 | Ga0501035_0048282 | Ga0501035_0048282_1313_1741 | 135 |
| 588 | 3300053104 | Ga0500556_0299162 | Ga0500556_0299162_29_436 | 135 |
| 589 | 3300060353 | Ga0501082_0017632 | Ga0501082_0017632_4158_4586 | 135 |
| 590 | 3300001979 | JGI24740J21852_10003943 | JGI24740J21852_100039433 | 136 |
| 591 | 3300001979 | JGI24740J21852_10051577 | JGI24740J21852_100515773 | 136 |
| 592 | 3300001989 | JGI24739J22299_10074626 | JGI24739J22299_100746263 | 136 |
| 593 | 3300001990 | JGI24737J22298_10192393 | JGI24737J22298_101923931 | 136 |
| 594 | 3300002075 | JGI24738J21930_10016468 | JGI24738J21930_100164682 | 136 |
| 595 | 3300003203 | JGI25406J46586_10000580 | JGI25406J46586_1000058013 | 136 |
| 596 | 3300003215 | JGI25153J46596_10006573 | JGI25153J46596_100065737 | 136 |
| 597 | 3300003759 | Ga0055525_1000104 | Ga0055525_100010491 | 136 |
| 598 | 3300003762 | Ga0055542_1000025 | Ga0055542_1000025231 | 136 |
| 599 | 3300003763 | Ga0055529_1000014 | Ga0055529_100001422 | 136 |
| 600 | 3300003775 | Ga0055524_1021940 | Ga0055524_10219404 | 136 |
| 601 | 3300003794 | Ga0055531_10010256 | Ga0055531_100102562 | 136 |
| 602 | 3300005262 | Ga0065165_1002943 | Ga0065165_100294314 | 136 |
| 603 | 3300005262 | Ga0065165_1059411 | Ga0065165_10594112 | 136 |
| 604 | 3300005262 | Ga0065165_1115834 | Ga0065165_11158341 | 136 |
| 605 | 3300005293 | Ga0065715_10060973 | Ga0065715_100609731 | 136 |
| 606 | 3300005327 | Ga0070658_10538913 | Ga0070658_105389132 | 136 |
| 607 | 3300005327 | Ga0070658_11875517 | Ga0070658_118755171 | 136 |
| 608 | 3300005328 | Ga0070676_10376874 | Ga0070676_103768742 | 136 |
| 609 | 3300005333 | Ga0070677_10233329 | Ga0070677_102333292 | 136 |
| 610 | 3300005334 | Ga0068869_100055689 | Ga0068869_1000556893 | 136 |
| 611 | 3300005334 | Ga0068869_100198606 | Ga0068869_1001986061 | 136 |
| 612 | 3300005334 | Ga0068869_100818109 | Ga0068869_1008181091 | 136 |
| 613 | 3300005334 | Ga0068869_101428411 | Ga0068869_1014284111 | 136 |
| 614 | 3300005336 | Ga0070680_100003117 | Ga0070680_1000031175 | 136 |
| 615 | 3300005336 | Ga0070680_100110465 | Ga0070680_1001104652 | 136 |
| 616 | 3300005337 | Ga0070682_100009795 | Ga0070682_1000097953 | 136 |
| 617 | 3300005339 | Ga0070660_100025088 | Ga0070660_1000250884 | 136 |
| 618 | 3300005339 | Ga0070660_101326882 | Ga0070660_1013268821 | 136 |
| 619 | 3300005340 | Ga0070689_100000310 | Ga0070689_10000031020 | 136 |
| 620 | 3300005341 | Ga0070691_10000574 | Ga0070691_1000057414 | 136 |
| 621 | 3300005341 | Ga0070691_10013745 | Ga0070691_100137455 | 136 |
| 622 | 3300005343 | Ga0070687_100020588 | Ga0070687_1000205883 | 136 |
| 623 | 3300005343 | Ga0070687_100786691 | Ga0070687_1007866911 | 136 |
| 624 | 3300005343 | Ga0070687_100892480 | Ga0070687_1008924801 | 136 |
| 625 | 3300005344 | Ga0070661_101313280 | Ga0070661_1013132801 | 136 |
| 626 | 3300005344 | Ga0070661_101499468 | Ga0070661_1014994681 | 136 |
| 627 | 3300005345 | Ga0070692_10196571 | Ga0070692_101965711 | 136 |
| 628 | 3300005347 | Ga0070668_100029805 | Ga0070668_1000298053 | 136 |
| 629 | 3300005347 | Ga0070668_100030699 | Ga0070668_1000306995 | 136 |
| 630 | 3300005353 | Ga0070669_100001017 | Ga0070669_10000101719 | 136 |
| 631 | 3300005353 | Ga0070669_100224944 | Ga0070669_1002249443 | 136 |
| 632 | 3300005355 | Ga0070671_100006071 | Ga0070671_10000607111 | 136 |
| 633 | 3300005355 | Ga0070671_100016959 | Ga0070671_1000169593 | 136 |
| 634 | 3300005356 | Ga0070674_100013611 | Ga0070674_1000136114 | 136 |
| 635 | 3300005356 | Ga0070674_100115388 | Ga0070674_1001153883 | 136 |
| 636 | 3300005356 | Ga0070674_100267362 | Ga0070674_1002673623 | 136 |
| 637 | 3300005364 | Ga0070673_100291174 | Ga0070673_1002911742 | 136 |
| 638 | 3300005365 | Ga0070688_100940626 | Ga0070688_1009406262 | 136 |
| 639 | 3300005366 | Ga0070659_100598933 | Ga0070659_1005989332 | 136 |
| 640 | 3300005367 | Ga0070667_100084821 | Ga0070667_1000848213 | 136 |
| 641 | 3300005367 | Ga0070667_100101966 | Ga0070667_1001019664 | 136 |
| 642 | 3300005406 | Ga0070703_10001384 | Ga0070703_100013847 | 136 |
| 643 | 3300005435 | Ga0070714_100055909 | Ga0070714_1000559092 | 136 |
| 644 | 3300005438 | Ga0070701_10137612 | Ga0070701_101376121 | 136 |
| 645 | 3300005440 | Ga0070705_100002172 | Ga0070705_1000021726 | 136 |
| 646 | 3300005441 | Ga0070700_100002573 | Ga0070700_1000025735 | 136 |
| 647 | 3300005441 | Ga0070700_100052891 | Ga0070700_1000528911 | 136 |
| 648 | 3300005441 | Ga0070700_100177999 | Ga0070700_1001779993 | 136 |
| 649 | 3300005445 | Ga0070708_100040322 | Ga0070708_1000403223 | 136 |
| 650 | 3300005455 | Ga0070663_100007077 | Ga0070663_1000070776 | 136 |
| 651 | 3300005455 | Ga0070663_100059561 | Ga0070663_1000595614 | 136 |
| 652 | 3300005455 | Ga0070663_100088233 | Ga0070663_1000882331 | 136 |
| 653 | 3300005455 | Ga0070663_100143105 | Ga0070663_1001431053 | 136 |
| 654 | 3300005455 | Ga0070663_100268402 | Ga0070663_1002684021 | 136 |
| 655 | 3300005455 | Ga0070663_100420824 | Ga0070663_1004208242 | 136 |
| 656 | 3300005456 | Ga0070678_100750392 | Ga0070678_1007503921 | 136 |
| 657 | 3300005457 | Ga0070662_100345002 | Ga0070662_1003450023 | 136 |
| 658 | 3300005459 | Ga0068867_100024353 | Ga0068867_1000243536 | 136 |
| 659 | 3300005459 | Ga0068867_101139361 | Ga0068867_1011393612 | 136 |
| 660 | 3300005468 | Ga0070707_100325697 | Ga0070707_1003256973 | 136 |
| 661 | 3300005468 | Ga0070707_100915434 | Ga0070707_1009154341 | 136 |
| 662 | 3300005471 | Ga0070698_100298207 | Ga0070698_1002982072 | 136 |
| 663 | 3300005518 | Ga0070699_100000444 | Ga0070699_10000044417 | 136 |
| 664 | 3300005530 | Ga0070679_100033410 | Ga0070679_1000334102 | 136 |
| 665 | 3300005530 | Ga0070679_100483287 | Ga0070679_1004832872 | 136 |
| 666 | 3300005536 | Ga0070697_100524187 | Ga0070697_1005241872 | 136 |
| 667 | 3300005539 | Ga0068853_100014406 | Ga0068853_1000144064 | 136 |
| 668 | 3300005539 | Ga0068853_100332127 | Ga0068853_1003321272 | 136 |
| 669 | 3300005543 | Ga0070672_100194422 | Ga0070672_1001944224 | 136 |
| 670 | 3300005544 | Ga0070686_100004627 | Ga0070686_1000046279 | 136 |
| 671 | 3300005544 | Ga0070686_100014576 | Ga0070686_1000145762 | 136 |
| 672 | 3300005545 | Ga0070695_100267172 | Ga0070695_1002671722 | 136 |
| 673 | 3300005546 | Ga0070696_100000123 | Ga0070696_10000012312 | 136 |
| 674 | 3300005546 | Ga0070696_100026755 | Ga0070696_1000267555 | 136 |
| 675 | 3300005547 | Ga0070693_100008394 | Ga0070693_1000083945 | 136 |
| 676 | 3300005547 | Ga0070693_100412584 | Ga0070693_1004125842 | 136 |
| 677 | 3300005548 | Ga0070665_100000186 | Ga0070665_10000018685 | 136 |
| 678 | 3300005548 | Ga0070665_100119168 | Ga0070665_1001191682 | 136 |
| 679 | 3300005548 | Ga0070665_100780062 | Ga0070665_1007800622 | 136 |
| 680 | 3300005548 | Ga0070665_101028932 | Ga0070665_1010289322 | 136 |
| 681 | 3300005549 | Ga0070704_100000095 | Ga0070704_1000000953 | 136 |
| 682 | 3300005549 | Ga0070704_101306703 | Ga0070704_1013067032 | 136 |
| 683 | 3300005564 | Ga0070664_100248835 | Ga0070664_1002488353 | 136 |
| 684 | 3300005577 | Ga0068857_100003759 | Ga0068857_1000037593 | 136 |
| 685 | 3300005577 | Ga0068857_100402373 | Ga0068857_1004023733 | 136 |
| 686 | 3300005614 | Ga0068856_100157077 | Ga0068856_1001570774 | 136 |
| 687 | 3300005614 | Ga0068856_100468497 | Ga0068856_1004684972 | 136 |
| 688 | 3300005614 | Ga0068856_100570800 | Ga0068856_1005708002 | 136 |
| 689 | 3300005614 | Ga0068856_101683472 | Ga0068856_1016834722 | 136 |
| 690 | 3300005615 | Ga0070702_100000980 | Ga0070702_1000009804 | 136 |
| 691 | 3300005615 | Ga0070702_100135943 | Ga0070702_1001359433 | 136 |
| 692 | 3300005615 | Ga0070702_100392834 | Ga0070702_1003928341 | 136 |
| 693 | 3300005616 | Ga0068852_100001899 | Ga0068852_1000018999 | 136 |
| 694 | 3300005616 | Ga0068852_100975061 | Ga0068852_1009750611 | 136 |
| 695 | 3300005617 | Ga0068859_100000243 | Ga0068859_10000024352 | 136 |
| 696 | 3300005617 | Ga0068859_100001820 | Ga0068859_10000182012 | 136 |
| 697 | 3300005617 | Ga0068859_100457790 | Ga0068859_1004577903 | 136 |
| 698 | 3300005618 | Ga0068864_100379208 | Ga0068864_1003792082 | 136 |
| 699 | 3300005718 | Ga0068866_10053091 | Ga0068866_100530913 | 136 |
| 700 | 3300005718 | Ga0068866_10620247 | Ga0068866_106202471 | 136 |
| 701 | 3300005719 | Ga0068861_100000133 | Ga0068861_1000001336 | 136 |
| 702 | 3300005719 | Ga0068861_100004883 | Ga0068861_1000048833 | 136 |
| 703 | 3300005719 | Ga0068861_100011940 | Ga0068861_1000119402 | 136 |
| 704 | 3300005719 | Ga0068861_100128229 | Ga0068861_1001282293 | 136 |
| 705 | 3300005719 | Ga0068861_100400345 | Ga0068861_1004003452 | 136 |
| 706 | 3300005840 | Ga0068870_10236720 | Ga0068870_102367202 | 136 |
| 707 | 3300005841 | Ga0068863_100174025 | Ga0068863_1001740254 | 136 |
| 708 | 3300005842 | Ga0068858_100111947 | Ga0068858_1001119472 | 136 |
| 709 | 3300005842 | Ga0068858_101307606 | Ga0068858_1013076061 | 136 |
| 710 | 3300005843 | Ga0068860_100002696 | Ga0068860_10000269611 | 136 |
| 711 | 3300005843 | Ga0068860_100153211 | Ga0068860_1001532114 | 136 |
| 712 | 3300005844 | Ga0068862_100087870 | Ga0068862_1000878704 | 136 |
| 713 | 3300005844 | Ga0068862_100160424 | Ga0068862_1001604244 | 136 |
| 714 | 3300005844 | Ga0068862_100597866 | Ga0068862_1005978662 | 136 |
| 715 | 3300005981 | Ga0081538_10023382 | Ga0081538_100233824 | 136 |
| 716 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032192 | 136 |
| 717 | 3300006038 | Ga0075365_10011522 | Ga0075365_100115227 | 136 |
| 718 | 3300006038 | Ga0075365_10172325 | Ga0075365_101723253 | 136 |
| 719 | 3300006042 | Ga0075368_10080960 | Ga0075368_100809602 | 136 |
| 720 | 3300006042 | Ga0075368_10333237 | Ga0075368_103332371 | 136 |
| 721 | 3300006048 | Ga0075363_100006916 | Ga0075363_1000069163 | 136 |
| 722 | 3300006048 | Ga0075363_100241070 | Ga0075363_1002410702 | 136 |
| 723 | 3300006051 | Ga0075364_10019010 | Ga0075364_100190103 | 136 |
| 724 | 3300006051 | Ga0075364_10606421 | Ga0075364_106064212 | 136 |
| 725 | 3300006058 | Ga0075432_10013503 | Ga0075432_100135034 | 136 |
| 726 | 3300006058 | Ga0075432_10082995 | Ga0075432_100829953 | 136 |
| 727 | 3300006173 | Ga0070716_100008614 | Ga0070716_1000086147 | 136 |
| 728 | 3300006177 | Ga0075362_10075932 | Ga0075362_100759322 | 136 |
| 729 | 3300006177 | Ga0075362_10150358 | Ga0075362_101503583 | 136 |
| 730 | 3300006178 | Ga0075367_10193645 | Ga0075367_101936452 | 136 |
| 731 | 3300006186 | Ga0075369_10026088 | Ga0075369_100260883 | 136 |
| 732 | 3300006195 | Ga0075366_10011171 | Ga0075366_100111715 | 136 |
| 733 | 3300006195 | Ga0075366_10443400 | Ga0075366_104434002 | 136 |
| 734 | 3300006195 | Ga0075366_10672391 | Ga0075366_106723912 | 136 |
| 735 | 3300006237 | Ga0097621_100051794 | Ga0097621_1000517943 | 136 |
| 736 | 3300006237 | Ga0097621_100605629 | Ga0097621_1006056292 | 136 |
| 737 | 3300006353 | Ga0075370_10079858 | Ga0075370_100798584 | 136 |
| 738 | 3300006353 | Ga0075370_10135879 | Ga0075370_101358793 | 136 |
| 739 | 3300006358 | Ga0068871_100121011 | Ga0068871_1001210112 | 136 |
| 740 | 3300006844 | Ga0075428_100056272 | Ga0075428_1000562722 | 136 |
| 741 | 3300006852 | Ga0075433_10206341 | Ga0075433_102063412 | 136 |
| 742 | 3300006871 | Ga0075434_100314498 | Ga0075434_1003144983 | 136 |
| 743 | 3300006881 | Ga0068865_100044915 | Ga0068865_1000449154 | 136 |
| 744 | 3300006931 | Ga0097620_100000243 | Ga0097620_10000024352 | 136 |
| 745 | 3300006931 | Ga0097620_100001820 | Ga0097620_10000182012 | 136 |
| 746 | 3300006931 | Ga0097620_100457744 | Ga0097620_1004577443 | 136 |
| 747 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002111 | 136 |
| 748 | 3300007076 | Ga0075435_101070598 | Ga0075435_1010705982 | 136 |
| 749 | 3300007788 | Ga0099795_10082889 | Ga0099795_100828891 | 136 |
| 750 | 3300009011 | Ga0105251_10533379 | Ga0105251_105333791 | 136 |
| 751 | 3300009093 | Ga0105240_10154472 | Ga0105240_101544725 | 136 |
| 752 | 3300009093 | Ga0105240_10506534 | Ga0105240_105065343 | 136 |
| 753 | 3300009093 | Ga0105240_10995885 | Ga0105240_109958852 | 136 |
| 754 | 3300009094 | Ga0111539_10254859 | Ga0111539_102548594 | 136 |
| 755 | 3300009094 | Ga0111539_10378931 | Ga0111539_103789312 | 136 |
| 756 | 3300009098 | Ga0105245_10008658 | Ga0105245_100086584 | 136 |
| 757 | 3300009098 | Ga0105245_10412605 | Ga0105245_104126052 | 136 |
| 758 | 3300009098 | Ga0105245_11039253 | Ga0105245_110392532 | 136 |
| 759 | 3300009101 | Ga0105247_10012238 | Ga0105247_100122383 | 136 |
| 760 | 3300009147 | Ga0114129_10259791 | Ga0114129_102597913 | 136 |
| 761 | 3300009147 | Ga0114129_10491158 | Ga0114129_104911582 | 136 |
| 762 | 3300009148 | Ga0105243_10000213 | Ga0105243_1000021366 | 136 |
| 763 | 3300009148 | Ga0105243_10133638 | Ga0105243_101336383 | 136 |
| 764 | 3300009148 | Ga0105243_10260542 | Ga0105243_102605422 | 136 |
| 765 | 3300009148 | Ga0105243_10670767 | Ga0105243_106707672 | 136 |
| 766 | 3300009148 | Ga0105243_11057650 | Ga0105243_110576502 | 136 |
| 767 | 3300009174 | Ga0105241_10002321 | Ga0105241_100023216 | 136 |
| 768 | 3300009174 | Ga0105241_10078928 | Ga0105241_100789284 | 136 |
| 769 | 3300009174 | Ga0105241_10214795 | Ga0105241_102147952 | 136 |
| 770 | 3300009174 | Ga0105241_11593163 | Ga0105241_115931631 | 136 |
| 771 | 3300009174 | Ga0105241_12188428 | Ga0105241_121884281 | 136 |
| 772 | 3300009176 | Ga0105242_10144122 | Ga0105242_101441223 | 136 |
| 773 | 3300009176 | Ga0105242_10370256 | Ga0105242_103702562 | 136 |
| 774 | 3300009176 | Ga0105242_10476589 | Ga0105242_104765893 | 136 |
| 775 | 3300009177 | Ga0105248_10004700 | Ga0105248_1000470014 | 136 |
| 776 | 3300009177 | Ga0105248_10299583 | Ga0105248_102995832 | 136 |
| 777 | 3300009177 | Ga0105248_10301647 | Ga0105248_103016473 | 136 |
| 778 | 3300009545 | Ga0105237_10015096 | Ga0105237_100150967 | 136 |
| 779 | 3300009545 | Ga0105237_10047396 | Ga0105237_100473963 | 136 |
| 780 | 3300009545 | Ga0105237_10305688 | Ga0105237_103056884 | 136 |
| 781 | 3300009545 | Ga0105237_11750868 | Ga0105237_117508682 | 136 |
| 782 | 3300009551 | Ga0105238_10102383 | Ga0105238_101023834 | 136 |
| 783 | 3300009553 | Ga0105249_10006303 | Ga0105249_100063032 | 136 |
| 784 | 3300009553 | Ga0105249_10018077 | Ga0105249_100180776 | 136 |
| 785 | 3300010375 | Ga0105239_10142445 | Ga0105239_101424456 | 136 |
| 786 | 3300010375 | Ga0105239_10153056 | Ga0105239_101530564 | 136 |
| 787 | 3300010375 | Ga0105239_10321827 | Ga0105239_103218273 | 136 |
| 788 | 3300010375 | Ga0105239_10338923 | Ga0105239_103389233 | 136 |
| 789 | 3300010375 | Ga0105239_10923065 | Ga0105239_109230651 | 136 |
| 790 | 3300011119 | Ga0105246_10114723 | Ga0105246_101147232 | 136 |
| 791 | 3300012513 | Ga0157326_1002360 | Ga0157326_10023602 | 136 |
| 792 | 3300013100 | Ga0157373_10013087 | Ga0157373_100130875 | 136 |
| 793 | 3300013100 | Ga0157373_11298293 | Ga0157373_112982932 | 136 |
| 794 | 3300013102 | Ga0157371_10005011 | Ga0157371_1000501113 | 136 |
| 795 | 3300013104 | Ga0157370_10292366 | Ga0157370_102923662 | 136 |
| 796 | 3300013105 | Ga0157369_10170583 | Ga0157369_101705835 | 136 |
| 797 | 3300013297 | Ga0157378_10053233 | Ga0157378_100532333 | 136 |
| 798 | 3300013297 | Ga0157378_10797810 | Ga0157378_107978101 | 136 |
| 799 | 3300013306 | Ga0163162_10026566 | Ga0163162_100265664 | 136 |
| 800 | 3300013306 | Ga0163162_10053372 | Ga0163162_100533726 | 136 |
| 801 | 3300013306 | Ga0163162_10120108 | Ga0163162_101201084 | 136 |
| 802 | 3300013306 | Ga0163162_10482770 | Ga0163162_104827701 | 136 |
| 803 | 3300013307 | Ga0157372_10321704 | Ga0157372_103217043 | 136 |
| 804 | 3300013308 | Ga0157375_10490855 | Ga0157375_104908553 | 136 |
| 805 | 3300013308 | Ga0157375_11324236 | Ga0157375_113242361 | 136 |
| 806 | 3300014325 | Ga0163163_10047359 | Ga0163163_100473595 | 136 |
| 807 | 3300014325 | Ga0163163_10376284 | Ga0163163_103762843 | 136 |
| 808 | 3300014326 | Ga0157380_10056488 | Ga0157380_100564882 | 136 |
| 809 | 3300014326 | Ga0157380_10081715 | Ga0157380_100817152 | 136 |
| 810 | 3300014326 | Ga0157380_10960150 | Ga0157380_109601502 | 136 |
| 811 | 3300014326 | Ga0157380_11444586 | Ga0157380_114445861 | 136 |
| 812 | 3300014745 | Ga0157377_10012955 | Ga0157377_100129552 | 136 |
| 813 | 3300014745 | Ga0157377_10259300 | Ga0157377_102593002 | 136 |
| 814 | 3300014745 | Ga0157377_10552740 | Ga0157377_105527402 | 136 |
| 815 | 3300014968 | Ga0157379_10032845 | Ga0157379_100328454 | 136 |
| 816 | 3300014968 | Ga0157379_10091372 | Ga0157379_100913723 | 136 |
| 817 | 3300014968 | Ga0157379_10223613 | Ga0157379_102236134 | 136 |
| 818 | 3300014969 | Ga0157376_10199919 | Ga0157376_101999193 | 136 |
| 819 | 3300017792 | Ga0163161_10106650 | Ga0163161_101066502 | 136 |
| 820 | 3300017792 | Ga0163161_10120402 | Ga0163161_101204023 | 136 |
| 821 | 3300025226 | Ga0209674_115782 | Ga0209674_1157822 | 136 |
| 822 | 3300025230 | Ga0209563_100116 | Ga0209563_10011647 | 136 |
| 823 | 3300025230 | Ga0209563_102989 | Ga0209563_1029892 | 136 |
| 824 | 3300025245 | Ga0207425_1009648 | Ga0207425_10096484 | 136 |
| 825 | 3300025253 | Ga0209677_101529 | Ga0209677_1015291 | 136 |
| 826 | 3300025254 | Ga0209148_1000011 | Ga0209148_100001124 | 136 |
| 827 | 3300025254 | Ga0209148_1000578 | Ga0209148_100057824 | 136 |
| 828 | 3300025254 | Ga0209148_1020537 | Ga0209148_10205372 | 136 |
| 829 | 3300025254 | Ga0209148_1026795 | Ga0209148_10267951 | 136 |
| 830 | 3300025261 | Ga0209233_1006411 | Ga0209233_10064112 | 136 |
| 831 | 3300025261 | Ga0209233_1010267 | Ga0209233_10102673 | 136 |
| 832 | 3300025261 | Ga0209233_1044497 | Ga0209233_10444971 | 136 |
| 833 | 3300025272 | Ga0209455_1000006 | Ga0209455_10000061170 | 136 |
| 834 | 3300025272 | Ga0209455_1000876 | Ga0209455_10008764 | 136 |
| 835 | 3300025272 | Ga0209455_1016198 | Ga0209455_10161982 | 136 |
| 836 | 3300025272 | Ga0209455_1042491 | Ga0209455_10424912 | 136 |
| 837 | 3300025273 | Ga0209673_1021991 | Ga0209673_10219912 | 136 |
| 838 | 3300025295 | Ga0209564_1004581 | Ga0209564_10045819 | 136 |
| 839 | 3300025295 | Ga0209564_1008808 | Ga0209564_10088083 | 136 |
| 840 | 3300025295 | Ga0209564_1011604 | Ga0209564_10116042 | 136 |
| 841 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026133 | 136 |
| 842 | 3300025297 | Ga0209758_1001536 | Ga0209758_10015366 | 136 |
| 843 | 3300025297 | Ga0209758_1005453 | Ga0209758_10054539 | 136 |
| 844 | 3300025297 | Ga0209758_1009114 | Ga0209758_10091148 | 136 |
| 845 | 3300025297 | Ga0209758_1149875 | Ga0209758_11498752 | 136 |
| 846 | 3300025298 | Ga0209050_1007640 | Ga0209050_10076406 | 136 |
| 847 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007680 | 136 |
| 848 | 3300025299 | Ga0209256_1032368 | Ga0209256_10323682 | 136 |
| 849 | 3300025302 | Ga0207426_1006447 | Ga0207426_10064476 | 136 |
| 850 | 3300025302 | Ga0207426_1013770 | Ga0207426_10137704 | 136 |
| 851 | 3300025303 | Ga0209051_1013609 | Ga0209051_10136092 | 136 |
| 852 | 3300025304 | Ga0209257_1005738 | Ga0209257_10057384 | 136 |
| 853 | 3300025304 | Ga0209257_1009389 | Ga0209257_10093896 | 136 |
| 854 | 3300025315 | Ga0207697_10212146 | Ga0207697_102121462 | 136 |
| 855 | 3300025321 | Ga0207656_10020184 | Ga0207656_100201842 | 136 |
| 856 | 3300025885 | Ga0207653_10000615 | Ga0207653_1000061510 | 136 |
| 857 | 3300025893 | Ga0207682_10125361 | Ga0207682_101253612 | 136 |
| 858 | 3300025899 | Ga0207642_10066517 | Ga0207642_100665173 | 136 |
| 859 | 3300025899 | Ga0207642_10479441 | Ga0207642_104794411 | 136 |
| 860 | 3300025900 | Ga0207710_10087285 | Ga0207710_100872852 | 136 |
| 861 | 3300025900 | Ga0207710_10781758 | Ga0207710_107817581 | 136 |
| 862 | 3300025901 | Ga0207688_10046773 | Ga0207688_100467734 | 136 |
| 863 | 3300025903 | Ga0207680_10619874 | Ga0207680_106198742 | 136 |
| 864 | 3300025904 | Ga0207647_10001122 | Ga0207647_100011226 | 136 |
| 865 | 3300025904 | Ga0207647_10015165 | Ga0207647_100151657 | 136 |
| 866 | 3300025904 | Ga0207647_10025233 | Ga0207647_100252336 | 136 |
| 867 | 3300025904 | Ga0207647_10141757 | Ga0207647_101417572 | 136 |
| 868 | 3300025904 | Ga0207647_10239185 | Ga0207647_102391853 | 136 |
| 869 | 3300025907 | Ga0207645_10036859 | Ga0207645_100368592 | 136 |
| 870 | 3300025911 | Ga0207654_10001228 | Ga0207654_100012285 | 136 |
| 871 | 3300025911 | Ga0207654_10022738 | Ga0207654_100227383 | 136 |
| 872 | 3300025911 | Ga0207654_10031554 | Ga0207654_100315542 | 136 |
| 873 | 3300025911 | Ga0207654_10057695 | Ga0207654_100576954 | 136 |
| 874 | 3300025911 | Ga0207654_10776096 | Ga0207654_107760962 | 136 |
| 875 | 3300025912 | Ga0207707_10000852 | Ga0207707_1000085232 | 136 |
| 876 | 3300025912 | Ga0207707_10046627 | Ga0207707_100466272 | 136 |
| 877 | 3300025912 | Ga0207707_11451837 | Ga0207707_114518371 | 136 |
| 878 | 3300025913 | Ga0207695_10029722 | Ga0207695_100297223 | 136 |
| 879 | 3300025913 | Ga0207695_10106162 | Ga0207695_101061622 | 136 |
| 880 | 3300025913 | Ga0207695_11701507 | Ga0207695_117015071 | 136 |
| 881 | 3300025914 | Ga0207671_10037979 | Ga0207671_100379791 | 136 |
| 882 | 3300025914 | Ga0207671_10144307 | Ga0207671_101443073 | 136 |
| 883 | 3300025914 | Ga0207671_10148867 | Ga0207671_101488673 | 136 |
| 884 | 3300025914 | Ga0207671_10455403 | Ga0207671_104554032 | 136 |
| 885 | 3300025917 | Ga0207660_10001673 | Ga0207660_100016737 | 136 |
| 886 | 3300025917 | Ga0207660_10030337 | Ga0207660_100303371 | 136 |
| 887 | 3300025917 | Ga0207660_10348500 | Ga0207660_103485003 | 136 |
| 888 | 3300025918 | Ga0207662_10036899 | Ga0207662_100368992 | 136 |
| 889 | 3300025918 | Ga0207662_10117496 | Ga0207662_101174962 | 136 |
| 890 | 3300025918 | Ga0207662_10475637 | Ga0207662_104756372 | 136 |
| 891 | 3300025919 | Ga0207657_10007172 | Ga0207657_100071726 | 136 |
| 892 | 3300025919 | Ga0207657_10021785 | Ga0207657_100217855 | 136 |
| 893 | 3300025919 | Ga0207657_11041242 | Ga0207657_110412421 | 136 |
| 894 | 3300025920 | Ga0207649_10000225 | Ga0207649_1000022528 | 136 |
| 895 | 3300025920 | Ga0207649_10008280 | Ga0207649_100082804 | 136 |
| 896 | 3300025920 | Ga0207649_10392450 | Ga0207649_103924502 | 136 |
| 897 | 3300025921 | Ga0207652_10019841 | Ga0207652_100198412 | 136 |
| 898 | 3300025921 | Ga0207652_10056877 | Ga0207652_100568772 | 136 |
| 899 | 3300025921 | Ga0207652_10306724 | Ga0207652_103067241 | 136 |
| 900 | 3300025921 | Ga0207652_10340398 | Ga0207652_103403982 | 136 |
| 901 | 3300025923 | Ga0207681_10056349 | Ga0207681_100563492 | 136 |
| 902 | 3300025924 | Ga0207694_10195777 | Ga0207694_101957774 | 136 |
| 903 | 3300025924 | Ga0207694_10374321 | Ga0207694_103743213 | 136 |
| 904 | 3300025924 | Ga0207694_10642783 | Ga0207694_106427833 | 136 |
| 905 | 3300025926 | Ga0207659_10435641 | Ga0207659_104356412 | 136 |
| 906 | 3300025927 | Ga0207687_10022557 | Ga0207687_100225577 | 136 |
| 907 | 3300025927 | Ga0207687_10026448 | Ga0207687_100264483 | 136 |
| 908 | 3300025927 | Ga0207687_10387443 | Ga0207687_103874431 | 136 |
| 909 | 3300025931 | Ga0207644_10097618 | Ga0207644_100976185 | 136 |
| 910 | 3300025931 | Ga0207644_10324995 | Ga0207644_103249953 | 136 |
| 911 | 3300025931 | Ga0207644_10451204 | Ga0207644_104512042 | 136 |
| 912 | 3300025932 | Ga0207690_10003708 | Ga0207690_100037089 | 136 |
| 913 | 3300025932 | Ga0207690_10482257 | Ga0207690_104822573 | 136 |
| 914 | 3300025933 | Ga0207706_10188872 | Ga0207706_101888722 | 136 |
| 915 | 3300025933 | Ga0207706_10275460 | Ga0207706_102754603 | 136 |
| 916 | 3300025933 | Ga0207706_10937609 | Ga0207706_109376092 | 136 |
| 917 | 3300025934 | Ga0207686_10465797 | Ga0207686_104657972 | 136 |
| 918 | 3300025934 | Ga0207686_10478369 | Ga0207686_104783693 | 136 |
| 919 | 3300025934 | Ga0207686_10565079 | Ga0207686_105650793 | 136 |
| 920 | 3300025935 | Ga0207709_10000018 | Ga0207709_1000001878 | 136 |
| 921 | 3300025935 | Ga0207709_10010467 | Ga0207709_100104677 | 136 |
| 922 | 3300025935 | Ga0207709_10369141 | Ga0207709_103691412 | 136 |
| 923 | 3300025935 | Ga0207709_11119039 | Ga0207709_111190391 | 136 |
| 924 | 3300025936 | Ga0207670_10586549 | Ga0207670_105865492 | 136 |
| 925 | 3300025937 | Ga0207669_10012958 | Ga0207669_100129584 | 136 |
| 926 | 3300025937 | Ga0207669_10014655 | Ga0207669_100146552 | 136 |
| 927 | 3300025937 | Ga0207669_10318367 | Ga0207669_103183673 | 136 |
| 928 | 3300025938 | Ga0207704_10134129 | Ga0207704_101341293 | 136 |
| 929 | 3300025941 | Ga0207711_10002918 | Ga0207711_100029187 | 136 |
| 930 | 3300025941 | Ga0207711_10168495 | Ga0207711_101684952 | 136 |
| 931 | 3300025941 | Ga0207711_10308548 | Ga0207711_103085483 | 136 |
| 932 | 3300025942 | Ga0207689_10083686 | Ga0207689_100836863 | 136 |
| 933 | 3300025942 | Ga0207689_10983329 | Ga0207689_109833291 | 136 |
| 934 | 3300025945 | Ga0207679_10068738 | Ga0207679_100687382 | 136 |
| 935 | 3300025945 | Ga0207679_10172347 | Ga0207679_101723473 | 136 |
| 936 | 3300025945 | Ga0207679_10496903 | Ga0207679_104969032 | 136 |
| 937 | 3300025949 | Ga0207667_10246654 | Ga0207667_102466544 | 136 |
| 938 | 3300025960 | Ga0207651_10009390 | Ga0207651_100093902 | 136 |
| 939 | 3300025960 | Ga0207651_10127815 | Ga0207651_101278153 | 136 |
| 940 | 3300025960 | Ga0207651_10499924 | Ga0207651_104999241 | 136 |
| 941 | 3300025961 | Ga0207712_10038467 | Ga0207712_100384673 | 136 |
| 942 | 3300025961 | Ga0207712_10085168 | Ga0207712_100851684 | 136 |
| 943 | 3300025972 | Ga0207668_10018721 | Ga0207668_100187214 | 136 |
| 944 | 3300025972 | Ga0207668_10168921 | Ga0207668_101689214 | 136 |
| 945 | 3300025972 | Ga0207668_10429869 | Ga0207668_104298691 | 136 |
| 946 | 3300025972 | Ga0207668_10435724 | Ga0207668_104357242 | 136 |
| 947 | 3300025981 | Ga0207640_10096493 | Ga0207640_100964932 | 136 |
| 948 | 3300025981 | Ga0207640_10179964 | Ga0207640_101799642 | 136 |
| 949 | 3300025981 | Ga0207640_11136150 | Ga0207640_111361501 | 136 |
| 950 | 3300025986 | Ga0207658_10079721 | Ga0207658_100797213 | 136 |
| 951 | 3300025986 | Ga0207658_10138199 | Ga0207658_101381993 | 136 |
| 952 | 3300025986 | Ga0207658_10667850 | Ga0207658_106678501 | 136 |
| 953 | 3300025986 | Ga0207658_10994499 | Ga0207658_109944992 | 136 |
| 954 | 3300026035 | Ga0207703_10361645 | Ga0207703_103616453 | 136 |
| 955 | 3300026035 | Ga0207703_10375563 | Ga0207703_103755631 | 136 |
| 956 | 3300026035 | Ga0207703_10381297 | Ga0207703_103812972 | 136 |
| 957 | 3300026035 | Ga0207703_11065667 | Ga0207703_110656671 | 136 |
| 958 | 3300026035 | Ga0207703_11594316 | Ga0207703_115943162 | 136 |
| 959 | 3300026041 | Ga0207639_10002313 | Ga0207639_1000231310 | 136 |
| 960 | 3300026041 | Ga0207639_10463625 | Ga0207639_104636253 | 136 |
| 961 | 3300026041 | Ga0207639_11222663 | Ga0207639_112226632 | 136 |
| 962 | 3300026067 | Ga0207678_10006547 | Ga0207678_100065472 | 136 |
| 963 | 3300026067 | Ga0207678_10026500 | Ga0207678_100265007 | 136 |
| 964 | 3300026067 | Ga0207678_10033426 | Ga0207678_100334263 | 136 |
| 965 | 3300026075 | Ga0207708_10000488 | Ga0207708_1000048817 | 136 |
| 966 | 3300026075 | Ga0207708_10000776 | Ga0207708_1000077622 | 136 |
| 967 | 3300026075 | Ga0207708_10453936 | Ga0207708_104539361 | 136 |
| 968 | 3300026078 | Ga0207702_10001111 | Ga0207702_1000111129 | 136 |
| 969 | 3300026078 | Ga0207702_10084712 | Ga0207702_100847124 | 136 |
| 970 | 3300026078 | Ga0207702_10156055 | Ga0207702_101560554 | 136 |
| 971 | 3300026078 | Ga0207702_10583107 | Ga0207702_105831072 | 136 |
| 972 | 3300026078 | Ga0207702_11196312 | Ga0207702_111963122 | 136 |
| 973 | 3300026088 | Ga0207641_10070060 | Ga0207641_100700602 | 136 |
| 974 | 3300026088 | Ga0207641_10190145 | Ga0207641_101901452 | 136 |
| 975 | 3300026089 | Ga0207648_10046235 | Ga0207648_100462354 | 136 |
| 976 | 3300026089 | Ga0207648_10365217 | Ga0207648_103652172 | 136 |
| 977 | 3300026095 | Ga0207676_10011695 | Ga0207676_100116956 | 136 |
| 978 | 3300026095 | Ga0207676_10781438 | Ga0207676_107814382 | 136 |
| 979 | 3300026116 | Ga0207674_10004426 | Ga0207674_100044267 | 136 |
| 980 | 3300026116 | Ga0207674_10024383 | Ga0207674_100243838 | 136 |
| 981 | 3300026116 | Ga0207674_10294377 | Ga0207674_102943773 | 136 |
| 982 | 3300026116 | Ga0207674_11348680 | Ga0207674_113486802 | 136 |
| 983 | 3300026118 | Ga0207675_100000011 | Ga0207675_1000000116 | 136 |
| 984 | 3300026118 | Ga0207675_100001448 | Ga0207675_10000144819 | 136 |
| 985 | 3300026118 | Ga0207675_100015329 | Ga0207675_1000153297 | 136 |
| 986 | 3300026118 | Ga0207675_100179187 | Ga0207675_1001791875 | 136 |
| 987 | 3300026118 | Ga0207675_100185678 | Ga0207675_1001856784 | 136 |
| 988 | 3300026118 | Ga0207675_101564135 | Ga0207675_1015641351 | 136 |
| 989 | 3300026121 | Ga0207683_10320560 | Ga0207683_103205602 | 136 |
| 990 | 3300026142 | Ga0207698_10001209 | Ga0207698_1000120910 | 136 |
| 991 | 3300026142 | Ga0207698_10007060 | Ga0207698_100070608 | 136 |
| 992 | 3300026142 | Ga0207698_10332780 | Ga0207698_103327802 | 136 |
| 993 | 3300026142 | Ga0207698_10504526 | Ga0207698_105045263 | 136 |
| 994 | 3300026142 | Ga0207698_10692885 | Ga0207698_106928852 | 136 |
| 995 | 3300026142 | Ga0207698_11760656 | Ga0207698_117606561 | 136 |
| 996 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000011036 | 136 |
| 997 | 3300027717 | Ga0209998_10017440 | Ga0209998_100174402 | 136 |
| 998 | 3300027866 | Ga0209813_10050410 | Ga0209813_100504103 | 136 |
| 999 | 3300027866 | Ga0209813_10081341 | Ga0209813_100813412 | 136 |
| 1000 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021842 | 136 |
| 1001 | 3300028379 | Ga0268266_10118211 | Ga0268266_101182114 | 136 |
| 1002 | 3300028379 | Ga0268266_10379038 | Ga0268266_103790383 | 136 |
| 1003 | 3300028380 | Ga0268265_10088412 | Ga0268265_100884124 | 136 |
| 1004 | 3300028380 | Ga0268265_10584428 | Ga0268265_105844283 | 136 |
| 1005 | 3300028380 | Ga0268265_10635914 | Ga0268265_106359143 | 136 |
| 1006 | 3300028381 | Ga0268264_10016842 | Ga0268264_100168425 | 136 |
| 1007 | 3300028381 | Ga0268264_10494877 | Ga0268264_104948772 | 136 |
| 1008 | 3300028794 | Ga0307515_10160552 | Ga0307515_101605522 | 136 |
| 1009 | 3300028800 | Ga0265338_10039470 | Ga0265338_100394702 | 136 |
| 1010 | 3300031456 | Ga0307513_10109293 | Ga0307513_101092935 | 136 |
| 1011 | 3300031456 | Ga0307513_10323569 | Ga0307513_103235693 | 136 |
| 1012 | 3300031507 | Ga0307509_10000013 | Ga0307509_1000001318 | 136 |
| 1013 | 3300031548 | Ga0307408_100255626 | Ga0307408_1002556263 | 136 |
| 1014 | 3300031712 | Ga0265342_10088609 | Ga0265342_100886091 | 136 |
| 1015 | 3300031824 | Ga0307413_10675500 | Ga0307413_106755001 | 136 |
| 1016 | 3300031852 | Ga0307410_10183088 | Ga0307410_101830883 | 136 |
| 1017 | 3300031903 | Ga0307407_10979182 | Ga0307407_109791822 | 136 |
| 1018 | 3300031911 | Ga0307412_10191259 | Ga0307412_101912592 | 136 |
| 1019 | 3300031911 | Ga0307412_12173852 | Ga0307412_121738521 | 136 |
| 1020 | 3300031995 | Ga0307409_100308180 | Ga0307409_1003081802 | 136 |
| 1021 | 3300032002 | Ga0307416_100205968 | Ga0307416_1002059683 | 136 |
| 1022 | 3300032004 | Ga0307414_11413989 | Ga0307414_114139891 | 136 |
| 1023 | 3300033180 | Ga0307510_10095926 | Ga0307510_100959263 | 136 |
| 1024 | 3300033180 | Ga0307510_10242811 | Ga0307510_102428112 | 136 |
| 1025 | 3300034816 | Ga0373930_0012940 | Ga0373930_0012940_466_897 | 136 |
| 1026 | 3300034819 | Ga0373958_0019203 | Ga0373958_0019203_483_914 | 136 |
| 1027 | 3300035085 | Ga0373929_0088522 | Ga0373929_0088522_15_446 | 136 |
| 1028 | 3300035088 | Ga0373940_0006102 | Ga0373940_0006102_2049_2480 | 136 |
| 1029 | 3300035691 | Ga0373931_0020603 | Ga0373931_0020603_338_769 | 136 |
| 1030 | 3300035691 | Ga0373931_0850066 | Ga0373931_0850066_109_540 | 136 |
| 1031 | 3300035695 | Ga0373927_0036186 | Ga0373927_0036186_2122_2553 | 136 |
| 1032 | 3300035695 | Ga0373927_0297143 | Ga0373927_0297143_217_648 | 136 |
| 1033 | 3300035725 | Ga0373947_0534655 | Ga0373947_0534655_170_601 | 136 |
| 1034 | 3300037068 | Ga0373925_0834629 | Ga0373925_0834629_20_451 | 136 |
| 1035 | 3300037466 | Ga0395898_0094170 | Ga0395898_0094170_416_847 | 136 |
| 1036 | 3300037466 | Ga0395898_0111975 | Ga0395898_0111975_588_1019 | 136 |
| 1037 | 3300037471 | Ga0395905_0047818 | Ga0395905_0047818_451_882 | 136 |
| 1038 | 3300037471 | Ga0395905_0192819 | Ga0395905_0192819_973_1392 | 136 |
| 1039 | 3300037471 | Ga0395905_0277022 | Ga0395905_0277022_495_926 | 136 |
| 1040 | 3300037471 | Ga0395905_0461844 | Ga0395905_0461844_566_997 | 136 |
| 1041 | 3300037471 | Ga0395905_0516134 | Ga0395905_0516134_477_908 | 136 |
| 1042 | 3300037471 | Ga0395905_0540154 | Ga0395905_0540154_95_505 | 136 |
| 1043 | 3300037471 | Ga0395905_1037796 | Ga0395905_1037796_30_461 | 136 |
| 1044 | 3300037471 | Ga0395905_1463445 | Ga0395905_1463445_81_491 | 136 |
| 1045 | 3300037853 | Ga0436364_0450134 | Ga0436364_0450134_531_941 | 136 |
| 1046 | 3300037853 | Ga0436364_0796860 | Ga0436364_0796860_73_504 | 136 |
| 1047 | 3300038443 | Ga0395901_0021632 | Ga0395901_0021632_4520_4933 | 136 |
| 1048 | 3300038443 | Ga0395901_0284067 | Ga0395901_0284067_626_1057 | 136 |
| 1049 | 3300038443 | Ga0395901_0477936 | Ga0395901_0477936_616_1047 | 136 |
| 1050 | 3300038443 | Ga0395901_1256871 | Ga0395901_1256871_91_510 | 136 |
| 1051 | 3300039437 | Ga0436365_0224118 | Ga0436365_0224118_268_699 | 136 |
| 1052 | 3300039437 | Ga0436365_0396957 | Ga0436365_0396957_132_563 | 136 |
| 1053 | 3300039437 | Ga0436365_1268888 | Ga0436365_1268888_238_648 | 136 |
| 1054 | 3300041408 | Ga0439453_0022803 | Ga0439453_0022803_259_690 | 136 |
| 1055 | 3300041451 | Ga0451791_1276388 | Ga0451791_1276388_82_513 | 136 |
| 1056 | 3300041451 | Ga0451791_1771099 | Ga0451791_1771099_486_917 | 136 |
| 1057 | 3300041452 | Ga0451793_1615561 | Ga0451793_1615561_114_545 | 136 |
| 1058 | 3300041459 | Ga0451800_1103286 | Ga0451800_1103286_51_461 | 136 |
| 1059 | 3300041486 | Ga0451807_1108795 | Ga0451807_1108795_108_539 | 136 |
| 1060 | 3300041492 | Ga0451835_0691213 | Ga0451835_0691213_134_565 | 136 |
| 1061 | 3300041501 | Ga0451845_0352644 | Ga0451845_0352644_38_448 | 136 |
| 1062 | 3300041507 | Ga0451851_0269221 | Ga0451851_0269221_501_932 | 136 |
| 1063 | 3300041512 | Ga0451853_3654192 | Ga0451853_3654192_140_571 | 136 |
| 1064 | 3300042005 | Ga0439448_0003740 | Ga0439448_0003740_630_1052 | 136 |
| 1065 | 3300042008 | Ga0439450_015806 | Ga0439450_015806_461_883 | 136 |
| 1066 | 3300042008 | Ga0439450_026906 | Ga0439450_026906_629_1042 | 136 |
| 1067 | 3300042436 | Ga0439435_0013209 | Ga0439435_0013209_472_903 | 136 |
| 1068 | 3300042438 | Ga0439459_0128012 | Ga0439459_0128012_176_589 | 136 |
| 1069 | 3300044656 | Ga0466969_0010526 | Ga0466969_0010526_1707_2138 | 136 |
| 1070 | 3300044673 | Ga0453683_0463360 | Ga0453683_0463360_372_803 | 136 |
| 1071 | 3300044683 | Ga0466965_0005417 | Ga0466965_0005417_4889_5299 | 136 |
| 1072 | 3300044683 | Ga0466965_0141190 | Ga0466965_0141190_603_1034 | 136 |
| 1073 | 3300044683 | Ga0466965_0360630 | Ga0466965_0360630_173_604 | 136 |
| 1074 | 3300044684 | Ga0466966_0005947 | Ga0466966_0005947_3919_4350 | 136 |
| 1075 | 3300044684 | Ga0466966_0158724 | Ga0466966_0158724_687_1100 | 136 |
| 1076 | 3300044684 | Ga0466966_0612220 | Ga0466966_0612220_147_557 | 136 |
| 1077 | 3300044693 | Ga0466961_0000863 | Ga0466961_0000863_14510_14941 | 136 |
| 1078 | 3300044693 | Ga0466961_0003976 | Ga0466961_0003976_3159_3569 | 136 |
| 1079 | 3300044693 | Ga0466961_0454383 | Ga0466961_0454383_212_625 | 136 |
| 1080 | 3300044694 | Ga0466963_0008115 | Ga0466963_0008115_705_1115 | 136 |
| 1081 | 3300044694 | Ga0466963_1080777 | Ga0466963_1080777_75_488 | 136 |
| 1082 | 3300044706 | Ga0466964_0000042 | Ga0466964_0000042_24106_24528 | 136 |
| 1083 | 3300044706 | Ga0466964_0016732 | Ga0466964_0016732_117_527 | 136 |
| 1084 | 3300044706 | Ga0466964_0075336 | Ga0466964_0075336_285_695 | 136 |
| 1085 | 3300044706 | Ga0466964_0354837 | Ga0466964_0354837_48_461 | 136 |
| 1086 | 3300044719 | Ga0466971_0018497 | Ga0466971_0018497_827_1237 | 136 |
| 1087 | 3300044719 | Ga0466971_0148221 | Ga0466971_0148221_95_514 | 136 |
| 1088 | 3300044735 | Ga0466968_0077952 | Ga0466968_0077952_901_1332 | 136 |
| 1089 | 3300044765 | Ga0466970_0002328 | Ga0466970_0002328_4678_5088 | 136 |
| 1090 | 3300044765 | Ga0466970_0019044 | Ga0466970_0019044_1656_2066 | 136 |
| 1091 | 3300044765 | Ga0466970_0475220 | Ga0466970_0475220_224_637 | 136 |
| 1092 | 3300044842 | Ga0466957_0183957 | Ga0466957_0183957_771_1190 | 136 |
| 1093 | 3300044842 | Ga0466957_0233670 | Ga0466957_0233670_561_995 | 136 |
| 1094 | 3300044842 | Ga0466957_0402039 | Ga0466957_0402039_489_899 | 136 |
| 1095 | 3300044901 | Ga0466960_0127399 | Ga0466960_0127399_61_492 | 136 |
| 1096 | 3300045049 | Ga0466959_0000648 | Ga0466959_0000648_18294_18704 | 136 |
| 1097 | 3300045049 | Ga0466959_0014195 | Ga0466959_0014195_1391_1822 | 136 |
| 1098 | 3300045051 | Ga0451576_0618156 | Ga0451576_0618156_349_780 | 136 |
| 1099 | 3300045836 | Ga0466958_0000250 | Ga0466958_0000250_18625_19044 | 136 |
| 1100 | 3300045836 | Ga0466958_0002080 | Ga0466958_0002080_4524_4934 | 136 |
| 1101 | 3300045836 | Ga0466958_0030782 | Ga0466958_0030782_1208_1618 | 136 |
| 1102 | 3300045976 | Ga0466967_0004712 | Ga0466967_0004712_5094_5516 | 136 |
| 1103 | 3300045976 | Ga0466967_0005881 | Ga0466967_0005881_6089_6520 | 136 |
| 1104 | 3300045976 | Ga0466967_0055268 | Ga0466967_0055268_245_655 | 136 |
| 1105 | 3300045976 | Ga0466967_0281423 | Ga0466967_0281423_711_1142 | 136 |
| 1106 | 3300045976 | Ga0466967_0937460 | Ga0466967_0937460_114_545 | 136 |
| 1107 | 3300046452 | Ga0495617_069919 | Ga0495617_069919_273_683 | 136 |
| 1108 | 3300046454 | Ga0495592_0022986 | Ga0495592_0022986_1666_2097 | 136 |
| 1109 | 3300046454 | Ga0495592_0098350 | Ga0495592_0098350_1043_1474 | 136 |
| 1110 | 3300046457 | Ga0495590_0034232 | Ga0495590_0034232_1294_1707 | 136 |
| 1111 | 3300046457 | Ga0495590_0086221 | Ga0495590_0086221_404_835 | 136 |
| 1112 | 3300046459 | Ga0495629_0006687 | Ga0495629_0006687_7731_8162 | 136 |
| 1113 | 3300046460 | Ga0495638_0006848 | Ga0495638_0006848_1535_1966 | 136 |
| 1114 | 3300046460 | Ga0495638_0017968 | Ga0495638_0017968_491_922 | 136 |
| 1115 | 3300046460 | Ga0495638_0048258 | Ga0495638_0048258_1923_2342 | 136 |
| 1116 | 3300046462 | Ga0495651_0008654 | Ga0495651_0008654_3462_3893 | 136 |
| 1117 | 3300046462 | Ga0495651_0148809 | Ga0495651_0148809_490_921 | 136 |
| 1118 | 3300046463 | Ga0495653_0237596 | Ga0495653_0237596_474_905 | 136 |
| 1119 | 3300046471 | Ga0495650_0000373 | Ga0495650_0000373_65279_65689 | 136 |
| 1120 | 3300046471 | Ga0495650_0014674 | Ga0495650_0014674_1569_2000 | 136 |
| 1121 | 3300046473 | Ga0495582_0226110 | Ga0495582_0226110_346_777 | 136 |
| 1122 | 3300046474 | Ga0495605_0000176 | Ga0495605_0000176_4128_4541 | 136 |
| 1123 | 3300046474 | Ga0495605_0262766 | Ga0495605_0262766_166_597 | 136 |
| 1124 | 3300046475 | Ga0495639_0316334 | Ga0495639_0316334_304_735 | 136 |
| 1125 | 3300046476 | Ga0495662_0199942 | Ga0495662_0199942_439_870 | 136 |
| 1126 | 3300046477 | Ga0495664_0023203 | Ga0495664_0023203_1370_1801 | 136 |
| 1127 | 3300046477 | Ga0495664_0077488 | Ga0495664_0077488_585_1016 | 136 |
| 1128 | 3300046491 | Ga0495584_0000031 | Ga0495584_0000031_76349_76762 | 136 |
| 1129 | 3300046491 | Ga0495584_0112348 | Ga0495584_0112348_920_1351 | 136 |
| 1130 | 3300046491 | Ga0495584_0152962 | Ga0495584_0152962_618_1028 | 136 |
| 1131 | 3300046492 | Ga0495585_0107410 | Ga0495585_0107410_985_1395 | 136 |
| 1132 | 3300046492 | Ga0495585_0174635 | Ga0495585_0174635_271_702 | 136 |
| 1133 | 3300046499 | Ga0495594_0495824 | Ga0495594_0495824_105_536 | 136 |
| 1134 | 3300046500 | Ga0495596_0004017 | Ga0495596_0004017_2794_3204 | 136 |
| 1135 | 3300046500 | Ga0495596_0129895 | Ga0495596_0129895_292_723 | 136 |
| 1136 | 3300046501 | Ga0495607_0002229 | Ga0495607_0002229_108_521 | 136 |
| 1137 | 3300046501 | Ga0495607_0361002 | Ga0495607_0361002_61_492 | 136 |
| 1138 | 3300046506 | Ga0495583_0001879 | Ga0495583_0001879_14861_15271 | 136 |
| 1139 | 3300046506 | Ga0495583_0018160 | Ga0495583_0018160_59_469 | 136 |
| 1140 | 3300046506 | Ga0495583_0031145 | Ga0495583_0031145_730_1140 | 136 |
| 1141 | 3300046506 | Ga0495583_0317301 | Ga0495583_0317301_67_498 | 136 |
| 1142 | 3300046507 | Ga0495606_0004509 | Ga0495606_0004509_7932_8345 | 136 |
| 1143 | 3300046507 | Ga0495606_0006533 | Ga0495606_0006533_7676_8107 | 136 |
| 1144 | 3300046507 | Ga0495606_0046033 | Ga0495606_0046033_28_438 | 136 |
| 1145 | 3300046507 | Ga0495606_0176499 | Ga0495606_0176499_716_1147 | 136 |
| 1146 | 3300046507 | Ga0495606_0220648 | Ga0495606_0220648_175_606 | 136 |
| 1147 | 3300046507 | Ga0495606_0251487 | Ga0495606_0251487_431_862 | 136 |
| 1148 | 3300046511 | Ga0495608_0042890 | Ga0495608_0042890_296_727 | 136 |
| 1149 | 3300046511 | Ga0495608_0159363 | Ga0495608_0159363_852_1283 | 136 |
| 1150 | 3300046512 | Ga0495610_0149709 | Ga0495610_0149709_339_770 | 136 |
| 1151 | 3300046513 | Ga0495616_0000321 | Ga0495616_0000321_34106_34537 | 136 |
| 1152 | 3300046514 | Ga0495618_0265006 | Ga0495618_0265006_359_790 | 136 |
| 1153 | 3300046516 | Ga0495628_0016659 | Ga0495628_0016659_4176_4607 | 136 |
| 1154 | 3300046517 | Ga0495630_1286808 | Ga0495630_1286808_60_491 | 136 |
| 1155 | 3300046518 | Ga0495631_0063005 | Ga0495631_0063005_987_1397 | 136 |
| 1156 | 3300046518 | Ga0495631_0067513 | Ga0495631_0067513_787_1206 | 136 |
| 1157 | 3300046518 | Ga0495631_0201804 | Ga0495631_0201804_321_734 | 136 |
| 1158 | 3300046519 | Ga0495632_0004685 | Ga0495632_0004685_8048_8479 | 136 |
| 1159 | 3300046519 | Ga0495632_0031748 | Ga0495632_0031748_349_780 | 136 |
| 1160 | 3300046519 | Ga0495632_0215063 | Ga0495632_0215063_422_835 | 136 |
| 1161 | 3300046520 | Ga0495637_0168815 | Ga0495637_0168815_169_618 | 136 |
| 1162 | 3300046522 | Ga0495643_0002948 | Ga0495643_0002948_12368_12781 | 136 |
| 1163 | 3300046522 | Ga0495643_0003289 | Ga0495643_0003289_10230_10640 | 136 |
| 1164 | 3300046522 | Ga0495643_0007636 | Ga0495643_0007636_5613_6023 | 136 |
| 1165 | 3300046522 | Ga0495643_0007678 | Ga0495643_0007678_3050_3484 | 136 |
| 1166 | 3300046522 | Ga0495643_0085865 | Ga0495643_0085865_911_1321 | 136 |
| 1167 | 3300046522 | Ga0495643_0122962 | Ga0495643_0122962_354_785 | 136 |
| 1168 | 3300046522 | Ga0495643_0138861 | Ga0495643_0138861_678_1109 | 136 |
| 1169 | 3300046522 | Ga0495643_0140293 | Ga0495643_0140293_464_895 | 136 |
| 1170 | 3300046522 | Ga0495643_0358090 | Ga0495643_0358090_141_572 | 136 |
| 1171 | 3300046523 | Ga0495644_0021326 | Ga0495644_0021326_557_988 | 136 |
| 1172 | 3300046524 | Ga0495648_0007417 | Ga0495648_0007417_4129_4539 | 136 |
| 1173 | 3300046524 | Ga0495648_0014544 | Ga0495648_0014544_3255_3686 | 136 |
| 1174 | 3300046524 | Ga0495648_0033000 | Ga0495648_0033000_1763_2194 | 136 |
| 1175 | 3300046524 | Ga0495648_0064299 | Ga0495648_0064299_1213_1644 | 136 |
| 1176 | 3300046524 | Ga0495648_0130203 | Ga0495648_0130203_412_822 | 136 |
| 1177 | 3300046524 | Ga0495648_0293766 | Ga0495648_0293766_235_645 | 136 |
| 1178 | 3300046525 | Ga0495663_0001136 | Ga0495663_0001136_4128_4538 | 136 |
| 1179 | 3300046528 | Ga0495642_0047458 | Ga0495642_0047458_401_835 | 136 |
| 1180 | 3300046528 | Ga0495642_0050520 | Ga0495642_0050520_323_754 | 136 |
| 1181 | 3300046528 | Ga0495642_0147126 | Ga0495642_0147126_68_478 | 136 |
| 1182 | 3300046528 | Ga0495642_0340403 | Ga0495642_0340403_20_451 | 136 |
| 1183 | 3300046529 | Ga0495652_0107280 | Ga0495652_0107280_634_1065 | 136 |
| 1184 | 3300046533 | Ga0495640_0090607 | Ga0495640_0090607_547_978 | 136 |
| 1185 | 3300046536 | Ga0495587_0049814 | Ga0495587_0049814_450_881 | 136 |
| 1186 | 3300046536 | Ga0495587_0063977 | Ga0495587_0063977_439_849 | 136 |
| 1187 | 3300046537 | Ga0495598_0114659 | Ga0495598_0114659_104_535 | 136 |
| 1188 | 3300046543 | Ga0495645_0087057 | Ga0495645_0087057_1649_2080 | 136 |
| 1189 | 3300046543 | Ga0495645_0104244 | Ga0495645_0104244_1057_1488 | 136 |
| 1190 | 3300046557 | Ga0495622_0004127 | Ga0495622_0004127_1794_2204 | 136 |
| 1191 | 3300046557 | Ga0495622_0065162 | Ga0495622_0065162_297_728 | 136 |
| 1192 | 3300046558 | Ga0495633_0007100 | Ga0495633_0007100_3211_3621 | 136 |
| 1193 | 3300046559 | Ga0495667_0110914 | Ga0495667_0110914_634_1065 | 136 |
| 1194 | 3300046615 | Ga0495656_0009992 | Ga0495656_0009992_2416_2847 | 136 |
| 1195 | 3300046616 | Ga0495668_0000072 | Ga0495668_0000072_163149_163559 | 136 |
| 1196 | 3300046616 | Ga0495668_0003172 | Ga0495668_0003172_10362_10793 | 136 |
| 1197 | 3300046616 | Ga0495668_0007792 | Ga0495668_0007792_3714_4145 | 136 |
| 1198 | 3300046616 | Ga0495668_0013068 | Ga0495668_0013068_542_973 | 136 |
| 1199 | 3300046616 | Ga0495668_0050035 | Ga0495668_0050035_1519_1950 | 136 |
| 1200 | 3300046616 | Ga0495668_0329580 | Ga0495668_0329580_121_552 | 136 |
| 1201 | 3300046642 | Ga0495634_0333357 | Ga0495634_0333357_454_885 | 136 |
| 1202 | 3300046648 | Ga0495611_0302586 | Ga0495611_0302586_231_641 | 136 |
| 1203 | 3300046660 | Ga0495625_0003433 | Ga0495625_0003433_6821_7234 | 136 |
| 1204 | 3300046660 | Ga0495625_0030150 | Ga0495625_0030150_770_1189 | 136 |
| 1205 | 3300046660 | Ga0495625_0066928 | Ga0495625_0066928_245_655 | 136 |
| 1206 | 3300046660 | Ga0495625_0074593 | Ga0495625_0074593_1226_1636 | 136 |
| 1207 | 3300046660 | Ga0495625_0211301 | Ga0495625_0211301_684_1094 | 136 |
| 1208 | 3300046660 | Ga0495625_0318202 | Ga0495625_0318202_153_584 | 136 |
| 1209 | 3300046660 | Ga0495625_0427712 | Ga0495625_0427712_173_604 | 136 |
| 1210 | 3300046663 | Ga0495635_0062415 | Ga0495635_0062415_1421_1852 | 136 |
| 1211 | 3300046665 | Ga0495661_0004689 | Ga0495661_0004689_3470_3901 | 136 |
| 1212 | 3300046665 | Ga0495661_0087097 | Ga0495661_0087097_1292_1705 | 136 |
| 1213 | 3300046665 | Ga0495661_0176134 | Ga0495661_0176134_449_868 | 136 |
| 1214 | 3300046665 | Ga0495661_0580908 | Ga0495661_0580908_27_437 | 136 |
| 1215 | 3300046674 | Ga0495588_0000125 | Ga0495588_0000125_55286_55699 | 136 |
| 1216 | 3300046675 | Ga0495657_0005091 | Ga0495657_0005091_4649_5080 | 136 |
| 1217 | 3300046675 | Ga0495657_0026479 | Ga0495657_0026479_332_763 | 136 |
| 1218 | 3300046678 | Ga0495599_0051503 | Ga0495599_0051503_1699_2130 | 136 |
| 1219 | 3300046678 | Ga0495599_0078966 | Ga0495599_0078966_890_1321 | 136 |
| 1220 | 3300046679 | Ga0495623_0019288 | Ga0495623_0019288_564_995 | 136 |
| 1221 | 3300046680 | Ga0495646_0027624 | Ga0495646_0027624_3106_3537 | 136 |
| 1222 | 3300046680 | Ga0495646_0034737 | Ga0495646_0034737_467_898 | 136 |
| 1223 | 3300046683 | Ga0495658_0347691 | Ga0495658_0347691_50_481 | 136 |
| 1224 | 3300046683 | Ga0495658_0768571 | Ga0495658_0768571_136_567 | 136 |
| 1225 | 3300046684 | Ga0495669_0000221 | Ga0495669_0000221_21891_22301 | 136 |
| 1226 | 3300046684 | Ga0495669_0019029 | Ga0495669_0019029_190_621 | 136 |
| 1227 | 3300046689 | Ga0495613_0211902 | Ga0495613_0211902_446_877 | 136 |
| 1228 | 3300046691 | Ga0495670_0072728 | Ga0495670_0072728_205_636 | 136 |
| 1229 | 3300046691 | Ga0495670_0616348 | Ga0495670_0616348_71_481 | 136 |
| 1230 | 3300046692 | Ga0495671_0155733 | Ga0495671_0155733_284_715 | 136 |
| 1231 | 3300046692 | Ga0495671_0389704 | Ga0495671_0389704_107_517 | 136 |
| 1232 | 3300046694 | Ga0495649_0008578 | Ga0495649_0008578_517_948 | 136 |
| 1233 | 3300046694 | Ga0495649_0092739 | Ga0495649_0092739_444_854 | 136 |
| 1234 | 3300046694 | Ga0495649_0126251 | Ga0495649_0126251_562_975 | 136 |
| 1235 | 3300046694 | Ga0495649_0224310 | Ga0495649_0224310_331_762 | 136 |
| 1236 | 3300046794 | Ga0495589_0000171 | Ga0495589_0000171_4506_4919 | 136 |
| 1237 | 3300046809 | Ga0495600_0000885 | Ga0495600_0000885_4001_4411 | 136 |
| 1238 | 3300046809 | Ga0495600_0003192 | Ga0495600_0003192_2784_3215 | 136 |
| 1239 | 3300046809 | Ga0495600_0014790 | Ga0495600_0014790_3349_3780 | 136 |
| 1240 | 3300046810 | Ga0495660_0000042 | Ga0495660_0000042_163886_164299 | 136 |
| 1241 | 3300047315 | Ga0495581_0045609 | Ga0495581_0045609_703_1134 | 136 |
| 1242 | 3300047317 | Ga0495604_0001817 | Ga0495604_0001817_13508_13939 | 136 |
| 1243 | 3300047319 | Ga0495674_0083125 | Ga0495674_0083125_1779_2210 | 136 |
| 1244 | 3300047319 | Ga0495674_0319964 | Ga0495674_0319964_102_533 | 136 |
| 1245 | 3300047319 | Ga0495674_0557139 | Ga0495674_0557139_24_455 | 136 |
| 1246 | 3300047319 | Ga0495674_0656737 | Ga0495674_0656737_25_456 | 136 |
| 1247 | 3300047320 | Ga0495672_0000272 | Ga0495672_0000272_10358_10789 | 136 |
| 1248 | 3300047320 | Ga0495672_0002336 | Ga0495672_0002336_15424_15837 | 136 |
| 1249 | 3300047320 | Ga0495672_0124436 | Ga0495672_0124436_91_522 | 136 |
| 1250 | 3300047321 | Ga0495676_0042637 | Ga0495676_0042637_1163_1594 | 136 |
| 1251 | 3300047322 | Ga0495680_0058502 | Ga0495680_0058502_1970_2401 | 136 |
| 1252 | 3300047323 | Ga0495683_0004576 | Ga0495683_0004576_1962_2372 | 136 |
| 1253 | 3300047323 | Ga0495683_0184582 | Ga0495683_0184582_232_645 | 136 |
| 1254 | 3300047323 | Ga0495683_0201845 | Ga0495683_0201845_432_842 | 136 |
| 1255 | 3300047443 | Ga0495687_000205 | Ga0495687_000205_76113_76526 | 136 |
| 1256 | 3300047443 | Ga0495687_000361 | Ga0495687_000361_31076_31489 | 136 |
| 1257 | 3300047443 | Ga0495687_001653 | Ga0495687_001653_13503_13913 | 136 |
| 1258 | 3300047443 | Ga0495687_024634 | Ga0495687_024634_810_1241 | 136 |
| 1259 | 3300047444 | Ga0495675_0010677 | Ga0495675_0010677_2070_2501 | 136 |
| 1260 | 3300047445 | Ga0495677_0000736 | Ga0495677_0000736_1288_1698 | 136 |
| 1261 | 3300047445 | Ga0495677_0002652 | Ga0495677_0002652_188_601 | 136 |
| 1262 | 3300047445 | Ga0495677_0025976 | Ga0495677_0025976_992_1405 | 136 |
| 1263 | 3300047445 | Ga0495677_0091742 | Ga0495677_0091742_501_911 | 136 |
| 1264 | 3300047447 | Ga0495685_058342 | Ga0495685_058342_44_463 | 136 |
| 1265 | 3300047469 | Ga0495673_0022834 | Ga0495673_0022834_1867_2298 | 136 |
| 1266 | 3300047469 | Ga0495673_0081414 | Ga0495673_0081414_759_1190 | 136 |
| 1267 | 3300047469 | Ga0495673_0088619 | Ga0495673_0088619_174_605 | 136 |
| 1268 | 3300047471 | Ga0495684_0395627 | Ga0495684_0395627_340_771 | 136 |
| 1269 | 3300047472 | Ga0495686_0005217 | Ga0495686_0005217_6506_6937 | 136 |
| 1270 | 3300047472 | Ga0495686_0018349 | Ga0495686_0018349_3713_4144 | 136 |
| 1271 | 3300047472 | Ga0495686_0029191 | Ga0495686_0029191_2292_2723 | 136 |
| 1272 | 3300047472 | Ga0495686_0067170 | Ga0495686_0067170_1721_2152 | 136 |
| 1273 | 3300047472 | Ga0495686_0086263 | Ga0495686_0086263_1120_1551 | 136 |
| 1274 | 3300047472 | Ga0495686_0106683 | Ga0495686_0106683_1202_1633 | 136 |
| 1275 | 3300047472 | Ga0495686_0274608 | Ga0495686_0274608_467_898 | 136 |
| 1276 | 3300047472 | Ga0495686_0297197 | Ga0495686_0297197_321_752 | 136 |
| 1277 | 3300047673 | Ga0495593_0049657 | Ga0495593_0049657_506_937 | 136 |
| 1278 | 3300048088 | Ga0495602_0102240 | Ga0495602_0102240_473_904 | 136 |
| 1279 | 3300048088 | Ga0495602_0219034 | Ga0495602_0219034_562_993 | 136 |
| 1280 | 3300048088 | Ga0495602_0326137 | Ga0495602_0326137_494_913 | 136 |
| 1281 | 3300048089 | Ga0495614_0090231 | Ga0495614_0090231_536_955 | 136 |
| 1282 | 3300048091 | Ga0495626_0000022 | Ga0495626_0000022_75752_76165 | 136 |
| 1283 | 3300048091 | Ga0495626_0002730 | Ga0495626_0002730_1590_2015 | 136 |
| 1284 | 3300048903 | Ga0496100_0026254 | Ga0496100_0026254_1920_2351 | 136 |
| 1285 | 3300048903 | Ga0496100_0122606 | Ga0496100_0122606_951_1382 | 136 |
| 1286 | 3300048903 | Ga0496100_0151663 | Ga0496100_0151663_838_1269 | 136 |
| 1287 | 3300048903 | Ga0496100_0355408 | Ga0496100_0355408_389_820 | 136 |
| 1288 | 3300048904 | Ga0496101_0002682 | Ga0496101_0002682_6189_6620 | 136 |
| 1289 | 3300048904 | Ga0496101_0025630 | Ga0496101_0025630_658_1089 | 136 |
| 1290 | 3300048904 | Ga0496101_0190014 | Ga0496101_0190014_341_772 | 136 |
| 1291 | 3300048904 | Ga0496101_0290365 | Ga0496101_0290365_76_507 | 136 |
| 1292 | 3300048904 | Ga0496101_0374293 | Ga0496101_0374293_327_758 | 136 |
| 1293 | 3300048905 | Ga0496102_0025490 | Ga0496102_0025490_1239_1670 | 136 |
| 1294 | 3300048905 | Ga0496102_0027530 | Ga0496102_0027530_3576_4007 | 136 |
| 1295 | 3300048905 | Ga0496102_0050758 | Ga0496102_0050758_2032_2463 | 136 |
| 1296 | 3300048905 | Ga0496102_0069299 | Ga0496102_0069299_907_1356 | 136 |
| 1297 | 3300048905 | Ga0496102_0314607 | Ga0496102_0314607_854_1285 | 136 |
| 1298 | 3300048905 | Ga0496102_0573436 | Ga0496102_0573436_543_974 | 136 |
| 1299 | 3300048906 | Ga0496103_0010260 | Ga0496103_0010260_4859_5290 | 136 |
| 1300 | 3300048906 | Ga0496103_0179539 | Ga0496103_0179539_844_1275 | 136 |
| 1301 | 3300048907 | Ga0496104_0002743 | Ga0496104_0002743_10940_11371 | 136 |
| 1302 | 3300048907 | Ga0496104_0008613 | Ga0496104_0008613_77_508 | 136 |
| 1303 | 3300048907 | Ga0496104_0096651 | Ga0496104_0096651_1582_2013 | 136 |
| 1304 | 3300048907 | Ga0496104_0318332 | Ga0496104_0318332_929_1360 | 136 |
| 1305 | 3300048908 | Ga0496105_0022571 | Ga0496105_0022571_1066_1497 | 136 |
| 1306 | 3300048908 | Ga0496105_0077738 | Ga0496105_0077738_743_1174 | 136 |
| 1307 | 3300048908 | Ga0496105_0187087 | Ga0496105_0187087_489_920 | 136 |
| 1308 | 3300048909 | Ga0496106_0002352 | Ga0496106_0002352_4786_5217 | 136 |
| 1309 | 3300048909 | Ga0496106_0039279 | Ga0496106_0039279_403_834 | 136 |
| 1310 | 3300048909 | Ga0496106_0191726 | Ga0496106_0191726_834_1283 | 136 |
| 1311 | 3300048909 | Ga0496106_0662479 | Ga0496106_0662479_199_630 | 136 |
| 1312 | 3300048910 | Ga0496107_0263175 | Ga0496107_0263175_536_967 | 136 |
| 1313 | 3300048910 | Ga0496107_0274950 | Ga0496107_0274950_461_892 | 136 |
| 1314 | 3300048911 | Ga0496108_0025878 | Ga0496108_0025878_796_1227 | 136 |
| 1315 | 3300048911 | Ga0496108_0135187 | Ga0496108_0135187_234_665 | 136 |
| 1316 | 3300048912 | Ga0496109_0011263 | Ga0496109_0011263_5903_6334 | 136 |
| 1317 | 3300048912 | Ga0496109_0067539 | Ga0496109_0067539_675_1106 | 136 |
| 1318 | 3300048912 | Ga0496109_0162114 | Ga0496109_0162114_1255_1686 | 136 |
| 1319 | 3300048912 | Ga0496109_0324926 | Ga0496109_0324926_845_1276 | 136 |
| 1320 | 3300048912 | Ga0496109_0379043 | Ga0496109_0379043_382_792 | 136 |
| 1321 | 3300048912 | Ga0496109_0591668 | Ga0496109_0591668_29_460 | 136 |
| 1322 | 3300048912 | Ga0496109_0618826 | Ga0496109_0618826_258_707 | 136 |
| 1323 | 3300048913 | Ga0496110_0408097 | Ga0496110_0408097_535_966 | 136 |
| 1324 | 3300048913 | Ga0496110_0621877 | Ga0496110_0621877_181_612 | 136 |
| 1325 | 3300048913 | Ga0496110_1234785 | Ga0496110_1234785_85_516 | 136 |
| 1326 | 3300048914 | Ga0496111_0038573 | Ga0496111_0038573_1744_2193 | 136 |
| 1327 | 3300048914 | Ga0496111_0181316 | Ga0496111_0181316_332_763 | 136 |
| 1328 | 3300048914 | Ga0496111_0922865 | Ga0496111_0922865_104_535 | 136 |
| 1329 | 3300048915 | Ga0496112_0043463 | Ga0496112_0043463_1981_2412 | 136 |
| 1330 | 3300048915 | Ga0496112_0205362 | Ga0496112_0205362_981_1412 | 136 |
| 1331 | 3300048915 | Ga0496112_1797911 | Ga0496112_1797911_76_507 | 136 |
| 1332 | 3300048916 | Ga0496113_0012758 | Ga0496113_0012758_4262_4693 | 136 |
| 1333 | 3300048916 | Ga0496113_0037873 | Ga0496113_0037873_821_1252 | 136 |
| 1334 | 3300048916 | Ga0496113_0168967 | Ga0496113_0168967_361_792 | 136 |
| 1335 | 3300048916 | Ga0496113_0173635 | Ga0496113_0173635_724_1155 | 136 |
| 1336 | 3300048916 | Ga0496113_0288695 | Ga0496113_0288695_156_587 | 136 |
| 1337 | 3300048917 | Ga0496114_0577767 | Ga0496114_0577767_171_602 | 136 |
| 1338 | 3300048917 | Ga0496114_0760769 | Ga0496114_0760769_47_478 | 136 |
| 1339 | 3300048918 | Ga0496115_0101186 | Ga0496115_0101186_523_954 | 136 |
| 1340 | 3300048918 | Ga0496115_0143360 | Ga0496115_0143360_226_657 | 136 |
| 1341 | 3300048918 | Ga0496115_0453185 | Ga0496115_0453185_44_475 | 136 |
| 1342 | 3300048919 | Ga0496116_0312804 | Ga0496116_0312804_133_564 | 136 |
| 1343 | 3300048920 | Ga0496117_0124979 | Ga0496117_0124979_394_804 | 136 |
| 1344 | 3300048921 | Ga0496118_0055513 | Ga0496118_0055513_507_938 | 136 |
| 1345 | 3300048921 | Ga0496118_0074666 | Ga0496118_0074666_1444_1875 | 136 |
| 1346 | 3300048921 | Ga0496118_0188510 | Ga0496118_0188510_517_927 | 136 |
| 1347 | 3300048922 | Ga0496119_0032207 | Ga0496119_0032207_2024_2455 | 136 |
| 1348 | 3300048922 | Ga0496119_0051790 | Ga0496119_0051790_605_1036 | 136 |
| 1349 | 3300048922 | Ga0496119_0141311 | Ga0496119_0141311_592_1002 | 136 |
| 1350 | 3300048923 | Ga0496120_0059208 | Ga0496120_0059208_1471_1902 | 136 |
| 1351 | 3300048923 | Ga0496120_0314536 | Ga0496120_0314536_54_485 | 136 |
| 1352 | 3300048924 | Ga0496121_0018815 | Ga0496121_0018815_1375_1806 | 136 |
| 1353 | 3300048924 | Ga0496121_0058967 | Ga0496121_0058967_656_1087 | 136 |
| 1354 | 3300048924 | Ga0496121_0165932 | Ga0496121_0165932_136_546 | 136 |
| 1355 | 3300048924 | Ga0496121_0338889 | Ga0496121_0338889_533_964 | 136 |
| 1356 | 3300048924 | Ga0496121_0623274 | Ga0496121_0623274_169_600 | 136 |
| 1357 | 3300048925 | Ga0496122_0000210 | Ga0496122_0000210_94214_94645 | 136 |
| 1358 | 3300048925 | Ga0496122_0025373 | Ga0496122_0025373_817_1227 | 136 |
| 1359 | 3300048925 | Ga0496122_0204233 | Ga0496122_0204233_113_544 | 136 |
| 1360 | 3300048925 | Ga0496122_0351692 | Ga0496122_0351692_35_466 | 136 |
| 1361 | 3300048926 | Ga0496123_0000597 | Ga0496123_0000597_32691_33122 | 136 |
| 1362 | 3300048926 | Ga0496123_0021134 | Ga0496123_0021134_2019_2429 | 136 |
| 1363 | 3300048926 | Ga0496123_0163662 | Ga0496123_0163662_209_640 | 136 |
| 1364 | 3300048926 | Ga0496123_0165903 | Ga0496123_0165903_468_899 | 136 |
| 1365 | 3300048927 | Ga0496124_0092841 | Ga0496124_0092841_335_766 | 136 |
| 1366 | 3300048927 | Ga0496124_0290186 | Ga0496124_0290186_219_650 | 136 |
| 1367 | 3300048927 | Ga0496124_0314543 | Ga0496124_0314543_431_844 | 136 |
| 1368 | 3300048927 | Ga0496124_0323878 | Ga0496124_0323878_543_953 | 136 |
| 1369 | 3300048927 | Ga0496124_0377707 | Ga0496124_0377707_51_482 | 136 |
| 1370 | 3300048928 | Ga0496125_0000789 | Ga0496125_0000789_3628_4059 | 136 |
| 1371 | 3300048928 | Ga0496125_0019149 | Ga0496125_0019149_2554_2964 | 136 |
| 1372 | 3300048928 | Ga0496125_0102908 | Ga0496125_0102908_1605_2015 | 136 |
| 1373 | 3300048928 | Ga0496125_0196528 | Ga0496125_0196528_184_615 | 136 |
| 1374 | 3300048928 | Ga0496125_0251575 | Ga0496125_0251575_522_953 | 136 |
| 1375 | 3300048929 | Ga0496126_0007753 | Ga0496126_0007753_8008_8439 | 136 |
| 1376 | 3300048929 | Ga0496126_0040413 | Ga0496126_0040413_331_762 | 136 |
| 1377 | 3300048929 | Ga0496126_0291332 | Ga0496126_0291332_594_1025 | 136 |
| 1378 | 3300049128 | Ga0501308_010491 | Ga0501308_010491_509_922 | 136 |
| 1379 | 3300049459 | Ga0495678_000358 | Ga0495678_000358_9703_10134 | 136 |
| 1380 | 3300049460 | Ga0495682_0037678 | Ga0495682_0037678_890_1321 | 136 |
| 1381 | 3300049460 | Ga0495682_0078332 | Ga0495682_0078332_572_1003 | 136 |
| 1382 | 3300049570 | Ga0501033_0237742 | Ga0501033_0237742_304_735 | 136 |
| 1383 | 3300049572 | Ga0501036_0380039 | Ga0501036_0380039_358_789 | 136 |
| 1384 | 3300049572 | Ga0501036_0847803 | Ga0501036_0847803_195_626 | 136 |
| 1385 | 3300049573 | Ga0501037_0389711 | Ga0501037_0389711_391_822 | 136 |
| 1386 | 3300049574 | Ga0501038_0027401 | Ga0501038_0027401_476_907 | 136 |
| 1387 | 3300049574 | Ga0501038_0478992 | Ga0501038_0478992_212_643 | 136 |
| 1388 | 3300049575 | Ga0501039_1332598 | Ga0501039_1332598_19_450 | 136 |
| 1389 | 3300049578 | Ga0501042_0151004 | Ga0501042_0151004_904_1335 | 136 |
| 1390 | 3300049578 | Ga0501042_0514848 | Ga0501042_0514848_251_682 | 136 |
| 1391 | 3300049580 | Ga0501046_0104064 | Ga0501046_0104064_167_598 | 136 |
| 1392 | 3300049580 | Ga0501046_0462350 | Ga0501046_0462350_368_799 | 136 |
| 1393 | 3300049581 | Ga0501047_0067057 | Ga0501047_0067057_2625_3035 | 136 |
| 1394 | 3300049581 | Ga0501047_0114526 | Ga0501047_0114526_1390_1821 | 136 |
| 1395 | 3300049582 | Ga0501048_0354026 | Ga0501048_0354026_598_1029 | 136 |
| 1396 | 3300049585 | Ga0501069_0472408 | Ga0501069_0472408_81_512 | 136 |
| 1397 | 3300049586 | Ga0501070_0045404 | Ga0501070_0045404_1160_1570 | 136 |
| 1398 | 3300049587 | Ga0501071_0715559 | Ga0501071_0715559_40_471 | 136 |
| 1399 | 3300049589 | Ga0501073_0169957 | Ga0501073_0169957_235_645 | 136 |
| 1400 | 3300049591 | Ga0501075_0610941 | Ga0501075_0610941_86_517 | 136 |
| 1401 | 3300049592 | Ga0501076_0398015 | Ga0501076_0398015_565_996 | 136 |
| 1402 | 3300049742 | Ga0501080_0476877 | Ga0501080_0476877_39_449 | 136 |
| 1403 | 3300049742 | Ga0501080_0830273 | Ga0501080_0830273_202_633 | 136 |
| 1404 | 3300049744 | Ga0501083_0327202 | Ga0501083_0327202_331_762 | 136 |
| 1405 | 3300049822 | Ga0501035_0175459 | Ga0501035_0175459_28_459 | 136 |
| 1406 | 3300049822 | Ga0501035_0179323 | Ga0501035_0179323_874_1305 | 136 |
| 1407 | 3300049823 | Ga0501044_0042648 | Ga0501044_0042648_3023_3433 | 136 |
| 1408 | 3300050489 | nmdc:mga03683_83226_c1 | nmdc:mga03683_83226_c1_437_868 | 136 |
| 1409 | 3300050490 | nmdc:mga03n38_160543_c1 | nmdc:mga03n38_160543_c1_255_686 | 136 |
| 1410 | 3300050490 | nmdc:mga03n38_187270_c1 | nmdc:mga03n38_187270_c1_308_754 | 136 |
| 1411 | 3300050490 | nmdc:mga03n38_208976_c1 | nmdc:mga03n38_208976_c1_259_690 | 136 |
| 1412 | 3300050490 | nmdc:mga03n38_945662_c1 | nmdc:mga03n38_945662_c1_21_452 | 136 |
| 1413 | 3300050491 | nmdc:mga00v17_6086_c1 | nmdc:mga00v17_6086_c1_82_513 | 136 |
| 1414 | 3300050491 | nmdc:mga00v17_979282_c1 | nmdc:mga00v17_979282_c1_29_460 | 136 |
| 1415 | 3300050492 | nmdc:mga0yw44_11432_c1 | nmdc:mga0yw44_11432_c1_982_1413 | 136 |
| 1416 | 3300050492 | nmdc:mga0yw44_200492_c1 | nmdc:mga0yw44_200492_c1_444_875 | 136 |
| 1417 | 3300050492 | nmdc:mga0yw44_7441_c1 | nmdc:mga0yw44_7441_c1_2246_2677 | 136 |
| 1418 | 3300050493 | nmdc:mga0k408_11559_c1 | nmdc:mga0k408_11559_c1_1881_2312 | 136 |
| 1419 | 3300050493 | nmdc:mga0k408_168599_c1 | nmdc:mga0k408_168599_c1_614_1045 | 136 |
| 1420 | 3300050493 | nmdc:mga0k408_472357_c1 | nmdc:mga0k408_472357_c1_137_583 | 136 |
| 1421 | 3300050494 | nmdc:mga06z11_16882_c1 | nmdc:mga06z11_16882_c1_2704_3135 | 136 |
| 1422 | 3300050494 | nmdc:mga06z11_554987_c1 | nmdc:mga06z11_554987_c1_186_617 | 136 |
| 1423 | 3300050495 | nmdc:mga04h51_76342_c1 | nmdc:mga04h51_76342_c1_319_750 | 136 |
| 1424 | 3300050496 | nmdc:mga07m45_27107_c1 | nmdc:mga07m45_27107_c1_2399_2830 | 136 |
| 1425 | 3300050496 | nmdc:mga07m45_283286_c1 | nmdc:mga07m45_283286_c1_274_705 | 136 |
| 1426 | 3300050496 | nmdc:mga07m45_850398_c1 | nmdc:mga07m45_850398_c1_22_432 | 136 |
| 1427 | 3300050496 | nmdc:mga07m45_93689_c1 | nmdc:mga07m45_93689_c1_1071_1502 | 136 |
| 1428 | 3300050507 | nmdc:mga05p37_162409_c1 | nmdc:mga05p37_162409_c1_1741_2172 | 136 |
| 1429 | 3300050507 | nmdc:mga05p37_241970_c1 | nmdc:mga05p37_241970_c1_206_637 | 136 |
| 1430 | 3300050507 | nmdc:mga05p37_288334_c1 | nmdc:mga05p37_288334_c1_980_1411 | 136 |
| 1431 | 3300050507 | nmdc:mga05p37_316594_c1 | nmdc:mga05p37_316594_c1_229_660 | 136 |
| 1432 | 3300050509 | nmdc:mga0qj67_114234_c1 | nmdc:mga0qj67_114234_c1_1498_1929 | 136 |
| 1433 | 3300050511 | nmdc:mga08y16_46869_c1 | nmdc:mga08y16_46869_c1_3558_3989 | 136 |
| 1434 | 3300050511 | nmdc:mga08y16_585730_c1 | nmdc:mga08y16_585730_c1_318_764 | 136 |
| 1435 | 3300050511 | nmdc:mga08y16_811477_c1 | nmdc:mga08y16_811477_c1_174_605 | 136 |
| 1436 | 3300050511 | nmdc:mga08y16_924162_c1 | nmdc:mga08y16_924162_c1_188_619 | 136 |
| 1437 | 3300050512 | nmdc:mga0n895_1804916_c1 | nmdc:mga0n895_1804916_c1_41_490 | 136 |
| 1438 | 3300050512 | nmdc:mga0n895_24920_c1 | nmdc:mga0n895_24920_c1_2812_3243 | 136 |
| 1439 | 3300050515 | nmdc:mga0a205_100641_c1 | nmdc:mga0a205_100641_c1_1830_2261 | 136 |
| 1440 | 3300050515 | nmdc:mga0a205_221135_c1 | nmdc:mga0a205_221135_c1_164_595 | 136 |
| 1441 | 3300050515 | nmdc:mga0a205_53341_c1 | nmdc:mga0a205_53341_c1_1127_1573 | 136 |
| 1442 | 3300050516 | nmdc:mga0sz30_27450_c1 | nmdc:mga0sz30_27450_c1_920_1366 | 136 |
| 1443 | 3300053077 | Ga0495601_0156943 | Ga0495601_0156943_333_764 | 136 |
| 1444 | 3300053077 | Ga0495601_0665139 | Ga0495601_0665139_113_544 | 136 |
| 1445 | 3300053077 | Ga0495601_0674246 | Ga0495601_0674246_11_442 | 136 |
| 1446 | 3300053078 | Ga0495612_0047541 | Ga0495612_0047541_385_816 | 136 |
| 1447 | 3300053079 | Ga0500610_0000051 | Ga0500610_0000051_12662_13072 | 136 |
| 1448 | 3300053079 | Ga0500610_0324268 | Ga0500610_0324268_71_481 | 136 |
| 1449 | 3300053083 | Ga0495655_0036083 | Ga0495655_0036083_503_934 | 136 |
| 1450 | 3300053084 | Ga0495595_0329835 | Ga0495595_0329835_142_573 | 136 |
| 1451 | 3300053085 | Ga0495619_0297881 | Ga0495619_0297881_361_792 | 136 |
| 1452 | 3300053086 | Ga0500578_0492995 | Ga0500578_0492995_126_557 | 136 |
| 1453 | 3300053086 | Ga0500578_0612008 | Ga0500578_0612008_38_469 | 136 |
| 1454 | 3300053087 | Ga0500643_073247 | Ga0500643_073247_30_440 | 136 |
| 1455 | 3300053094 | Ga0500566_0001729 | Ga0500566_0001729_8095_8526 | 136 |
| 1456 | 3300053104 | Ga0500556_0021993 | Ga0500556_0021993_425_856 | 136 |
| 1457 | 3300053105 | Ga0500557_000103 | Ga0500557_000103_460_891 | 136 |
| 1458 | 3300053108 | Ga0500562_083454 | Ga0500562_083454_89_520 | 136 |
| 1459 | 3300053109 | Ga0500569_129120 | Ga0500569_129120_163_594 | 136 |
| 1460 | 3300053118 | Ga0500594_0000454 | Ga0500594_0000454_3656_4087 | 136 |
| 1461 | 3300053119 | Ga0500595_000166 | Ga0500595_000166_23191_23601 | 136 |
| 1462 | 3300053119 | Ga0500595_013390 | Ga0500595_013390_2266_2697 | 136 |
| 1463 | 3300053120 | Ga0500597_100338 | Ga0500597_100338_347_778 | 136 |
| 1464 | 3300053122 | Ga0500608_000656 | Ga0500608_000656_7332_7763 | 136 |
| 1465 | 3300053126 | Ga0500621_134660 | Ga0500621_134660_312_743 | 136 |
| 1466 | 3300053130 | Ga0500642_0062098 | Ga0500642_0062098_429_860 | 136 |
| 1467 | 3300053154 | Ga0500619_160311 | Ga0500619_160311_264_695 | 136 |
| 1468 | 3300053156 | Ga0500622_0000735 | Ga0500622_0000735_13550_13981 | 136 |
| 1469 | 3300053156 | Ga0500622_0141289 | Ga0500622_0141289_229_660 | 136 |
| 1470 | 3300053160 | Ga0500633_0031677 | Ga0500633_0031677_60_491 | 136 |
| 1471 | 3300053162 | Ga0500638_298233 | Ga0500638_298233_175_606 | 136 |
| 1472 | 3300053177 | Ga0500636_0000948 | Ga0500636_0000948_12639_13049 | 136 |
| 1473 | 3300053177 | Ga0500636_0234836 | Ga0500636_0234836_70_501 | 136 |
| 1474 | 3300053729 | Ga0500625_007215 | Ga0500625_007215_2938_3369 | 136 |
| 1475 | 3300053730 | Ga0500645_015053 | Ga0500645_015053_49_480 | 136 |
| 1476 | 3300053731 | Ga0500609_008489 | Ga0500609_008489_79_510 | 136 |
| 1477 | 3300053735 | Ga0500596_001610 | Ga0500596_001610_624_1034 | 136 |
| 1478 | 3300053737 | Ga0500601_007608 | Ga0500601_007608_227_658 | 136 |
| 1479 | 3300054114 | Ga0501084_0574268 | Ga0501084_0574268_221_652 | 136 |
| 1480 | 3300055283 | Ga0500661_006131 | Ga0500661_006131_1526_1957 | 136 |
| 1481 | 3300059505 | Ga0587083_0093604 | Ga0587083_0093604_90_512 | 136 |
| 1482 | 3300059641 | Ga0587068_108823 | Ga0587068_108823_30_452 | 136 |
| 1483 | 3300059643 | Ga0587072_152062 | Ga0587072_152062_31_453 | 136 |
| 1484 | 3300060353 | Ga0501082_0151000 | Ga0501082_0151000_150_581 | 136 |
| 1485 | 3300060353 | Ga0501082_0668290 | Ga0501082_0668290_152_583 | 136 |
| 1486 | 3300060353 | Ga0501082_0768186 | Ga0501082_0768186_199_630 | 136 |
| 1487 | 3300061719 | Ga0466962_0007922 | Ga0466962_0007922_1726_2136 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.9711 | 9 | 136 |
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8964 | 10 | 134 |
| 1xn5-assembly1.cif.gz_A | solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 | 0.8932 | 6 | 132 |
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.8908 | 9 | 132 |
| 8es5-assembly1.cif.gz_B | aha1 domain protein from pseudomonas aeruginosa | 0.8828 | 8 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q63F00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9442 | 6 | 136 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8908 | 9 | 132 | 3.30.530.20 |
| 2luzA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8734 | 1 | 132 | 3.30.530.20 |
| af_O53773_104_241_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8611 | 12 | 134 | 3.30.530.20 |
| af_Q8T2R4_3_145_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8609 | 9 | 134 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G2W9P3-F1-model_v4 | Polyketide cyclase | 0.9937 | 8 | 136 |
|
| AF-A0A529I9X2-F1-model_v4 | deleted | 0.9912 | 17 | 110 |
|
| AF-A0A6N6JIT5-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9806 | 9 | 133 |
|
| AF-A0A537U521-F1-model_v4 | Polyketide cyclase | 0.9794 | 1 | 101 |
|
| AF-A0A537Q1Z8-F1-model_v4 | Polyketide cyclase | 0.9779 | 1 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar