F494314

General Info

Members Datasets Scaffolds Average Seq Length
1487 716 1270 140

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10723903|Ga0070658_107239032
Length 149
Sequence MNQAAATATRTVTLEREFAHPPEKVWRALTQPELVAEWLMRNDIKPVVGHRFNFRADPMPGWNGVTDCEVLVAEAPRRLSYTWNASGEEAKTGIKTVVTFTLTPTKAGTLLHMEQSGFRAEHDHDRFFQGAQYGWQKMLGALEGVLSRS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
9 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
12 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
13 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
14 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
15 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
16 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
27 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
28 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
29 2643221583 Caulobacter sp. Root655 Isolate Unclassified
30 2643221584 Caulobacter sp. Root656 Isolate Unclassified
31 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
32 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
33 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
34 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
35 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
36 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
37 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
38 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
42 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
43 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
44 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
45 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
46 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
47 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
48 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
49 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
50 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
51 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
52 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
53 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
54 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
55 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
56 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
57 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
58 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
59 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
60 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
61 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
62 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
63 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
64 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
65 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
66 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
67 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
68 2842711865 Duganella sp. R-73148 Isolate Unclassified
69 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
70 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
71 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
72 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
73 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
74 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
75 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
92 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
97 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
98 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904699407
104 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
105 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
108 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
109 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
110 2922368715
111 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
112 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
113 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
114 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
115 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
116 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
117 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
118 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
119 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
120 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
121 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
122 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
123 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
124 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
125 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
126 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
127 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
128 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
129 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
130 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
131 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
132 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
133 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
134 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
135 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
136 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
137 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
138 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
139 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
140 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
141 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
142 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
143 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
144 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
145 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
146 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
147 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
148 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
149 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
150 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
151 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
152 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
153 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
154 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
155 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
156 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
157 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
158 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
159 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
160 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
161 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
162 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
163 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
164 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
165 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
166 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
167 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
168 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
169 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
170 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
171 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
172 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
173 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
174 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
175 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
176 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
177 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
178 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
179 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
180 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
181 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
182 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
183 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
184 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
185 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
186 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
187 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
188 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
189 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
190 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
191 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
192 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
194 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
195 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
196 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
197 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
202 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
203 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
204 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
205 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
206 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
207 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
208 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
209 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
210 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
211 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
212 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
213 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
214 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
215 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
216 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
217 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
218 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
219 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
220 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
221 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
222 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
223 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
224 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
225 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
226 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
227 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
228 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
229 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
230 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
231 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
232 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
233 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
234 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
235 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
236 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
237 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
238 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
239 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
240 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
241 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
242 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
243 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
244 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
245 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
246 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
247 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
248 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
249 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
250 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
251 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
252 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
253 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
254 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
255 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
256 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
257 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
258 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
259 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
260 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
261 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
262 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
263 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
264 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
265 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
266 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
267 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
268 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
269 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
270 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
271 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
272 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
273 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
274 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
275 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
276 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
277 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
278 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
279 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
282 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
283 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
284 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
285 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
286 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
287 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
288 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
289 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
290 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
291 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
292 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
293 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
294 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
295 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
296 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
297 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
298 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
299 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
300 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
301 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
302 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
303 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
304 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
308 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
311 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
312 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
313 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
314 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
315 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
316 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
317 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
318 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
319 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
320 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
321 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
322 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
323 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
324 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
325 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
326 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
327 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
328 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
329 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
330 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
331 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
334 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
337 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
338 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
341 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
343 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
344 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
345 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
348 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
410 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
411 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
412 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
413 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
414 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
415 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
416 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
420 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
421 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
422 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
423 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
424 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
425 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
426 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
427 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
428 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
429 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
430 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
431 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
432 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
433 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
434 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
435 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
436 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
437 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
438 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
439 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
440 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
441 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
442 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
443 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
444 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
445 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
446 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
447 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
448 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
449 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
450 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
451 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
452 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
453 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
454 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
455 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
456 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
457 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
458 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
459 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
460 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
461 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
462 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
463 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
464 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
465 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
466 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
467 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
468 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
469 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
470 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
471 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
472 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
473 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
474 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
475 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
476 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
477 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
478 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
479 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
480 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
484 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
485 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
486 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
487 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
488 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
489 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
490 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
491 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
492 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
493 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
494 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
495 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
496 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
497 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
498 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
499 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
500 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
501 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
502 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
503 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
504 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
505 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
506 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
507 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
508 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
509 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
510 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
511 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
512 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
513 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
514 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
515 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
516 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
517 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
518 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
519 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
520 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
521 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
522 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
523 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
524 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
525 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
526 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
527 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
528 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
529 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
530 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
531 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
532 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
533 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
534 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
535 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
536 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
537 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
538 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
539 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
540 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
541 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
542 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
543 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
544 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
545 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
546 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
547 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
548 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
549 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
550 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
551 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
552 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
553 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
554 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
555 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
556 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
557 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
558 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
559 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
560 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
561 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
562 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
563 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
564 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
565 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
566 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
567 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
568 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
569 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
570 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
571 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
572 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
573 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
574 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
575 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
576 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
577 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
578 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
579 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
580 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
581 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
582 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
583 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
584 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
585 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
586 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
587 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
588 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
589 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
590 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
591 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
592 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
593 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
594 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
595 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
596 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
597 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
598 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
600 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
601 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
613 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
614 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
615 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
616 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
617 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
618 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
619 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
620 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
621 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
622 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
624 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
625 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
626 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
627 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
628 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
629 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
630 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
631 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
632 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
633 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
634 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
635 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
636 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
637 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
638 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
639 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
640 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
641 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
642 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
643 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
644 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
645 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
646 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
647 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
648 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
649 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
650 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
651 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
652 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
653 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
654 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
655 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
656 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
657 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
658 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
659 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
660 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
661 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
662 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
663 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
664 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
665 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
666 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
667 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
668 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
669 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
670 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
671 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
672 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
673 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
674 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
675 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
676 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
677 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
678 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
679 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
680 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
681 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
682 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
683 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
684 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
685 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
686 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
687 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
688 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
689 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
690 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
691 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
692 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
693 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
694 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
695 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
696 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
697 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
698 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
699 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
700 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
701 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
702 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
703 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
704 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
705 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
706 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
707 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
708 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
709 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
710 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
711 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
712 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
713 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
714 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
715 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
716 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 0.27
Isolates 14.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.49
Nodule 11.03
Rhizoplane 5.11
Rhizosphere 64.83
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003943 3300001979 Bacteria 6441
2 JGI24740J21852_10051577 3300001979 Bacteria 1176
3 JGI24739J22299_10074626 3300001989 Bacteria 1050
4 JGI24737J22298_10192393 3300001990 Bacteria 602
5 JGI24738J21930_10016468 3300002075 Bacteria 1561
6 JGI25151J46595_10004677 3300003187 Bacteria 7198
7 JGI25406J46586_10000580 3300003203 Bacteria 17278
8 JGI25153J46596_10006573 3300003215 Bacteria 5862
9 Ga0055525_1000104 3300003759 Bacteria 134560
10 Ga0055542_1000025 3300003762 Bacteria 263538
11 Ga0055529_1000014 3300003763 Bacteria 367283
12 Ga0055524_1021940 3300003775 Bacteria 2101
13 Ga0055531_10010256 3300003794 Bacteria 4683
14 Ga0055543_1003926 3300004625 Bacteria 4202
15 Ga0065165_1000891 3300005262 Bacteria 38572
16 Ga0065165_1001577 3300005262 Bacteria 23479
17 Ga0065165_1002943 3300005262 Bacteria 12977
18 Ga0065165_1012860 3300005262 Bacteria 3374
19 Ga0065165_1059411 3300005262 Bacteria 1052
20 Ga0065165_1115834 3300005262 Bacteria 655
21 Ga0065714_10469235 3300005288 Bacteria 542
22 Ga0065715_10060973 3300005293 Bacteria 823
23 Ga0065715_10792325 3300005293 Bacteria 613
24 Ga0070658_10538913 3300005327 Bacteria 1010
25 Ga0070658_10723903 3300005327 Unclassified 864
26 Ga0070658_11875517 3300005327 Bacteria 518
27 Ga0070676_10376874 3300005328 Bacteria 981
28 Ga0070683_100299943 3300005329 Bacteria 1529
29 Ga0070677_10233329 3300005333 Bacteria 905
30 Ga0068869_100055689 3300005334 Bacteria 2882
31 Ga0068869_100198606 3300005334 Bacteria 1580
32 Ga0068869_100818109 3300005334 Bacteria 802
33 Ga0068869_101428411 3300005334 Bacteria 613
34 Ga0070666_10112021 3300005335 Bacteria 1888
35 Ga0070680_100003117 3300005336 Bacteria 12308
36 Ga0070680_100110465 3300005336 Bacteria 2289
37 Ga0070682_100009795 3300005337 Bacteria 5425
38 Ga0070682_100960234 3300005337 Bacteria 707
39 Ga0070660_100025088 3300005339 Bacteria 4429
40 Ga0070660_100408115 3300005339 Bacteria 1124
41 Ga0070660_101326882 3300005339 Bacteria 611
42 Ga0070689_100000310 3300005340 Bacteria 28390
43 Ga0070691_10000574 3300005341 Bacteria 14032
44 Ga0070691_10013745 3300005341 Bacteria 3714
45 Ga0070687_100020588 3300005343 Bacteria 3087
46 Ga0070687_100786691 3300005343 Bacteria 673
47 Ga0070687_100892480 3300005343 Bacteria 637
48 Ga0070661_100698507 3300005344 Unclassified 826
49 Ga0070661_101071932 3300005344 Bacteria 670
50 Ga0070661_101313280 3300005344 Bacteria 607
51 Ga0070661_101499468 3300005344 Bacteria 569
52 Ga0070692_10196571 3300005345 Bacteria 1178
53 Ga0070668_100029805 3300005347 Bacteria 4146
54 Ga0070668_100030699 3300005347 Bacteria 4088
55 Ga0070669_100001017 3300005353 Bacteria 20430
56 Ga0070669_100224944 3300005353 Bacteria 1485
57 Ga0070671_100006071 3300005355 Bacteria 9625
58 Ga0070671_100016959 3300005355 Bacteria 5890
59 Ga0070674_100013611 3300005356 Bacteria 5034
60 Ga0070674_100115388 3300005356 Bacteria 1980
61 Ga0070674_100267362 3300005356 Bacteria 1350
62 Ga0070673_100291174 3300005364 Bacteria 1435
63 Ga0070688_100940626 3300005365 Bacteria 684
64 Ga0070659_100598933 3300005366 Bacteria 947
65 Ga0070667_100084821 3300005367 Bacteria 2716
66 Ga0070667_100101966 3300005367 Bacteria 2479
67 Ga0070667_100159713 3300005367 Bacteria 1984
68 Ga0070703_10001384 3300005406 Bacteria 7352
69 Ga0070709_10009416 3300005434 Bacteria 5389
70 Ga0070714_100055909 3300005435 Bacteria 3374
71 Ga0070714_100249358 3300005435 Bacteria 1641
72 Ga0070714_100329505 3300005435 Bacteria 1429
73 Ga0070713_100129970 3300005436 Bacteria 2220
74 Ga0070713_100834282 3300005436 Bacteria 885
75 Ga0070701_10137612 3300005438 Bacteria 1393
76 Ga0070711_100007910 3300005439 Bacteria 6482
77 Ga0070705_100002172 3300005440 Bacteria 9965
78 Ga0070700_100002573 3300005441 Bacteria 9275
79 Ga0070700_100052891 3300005441 Bacteria 2533
80 Ga0070700_100177999 3300005441 Bacteria 1478
81 Ga0070708_100040322 3300005445 Bacteria 4089
82 Ga0070663_100007077 3300005455 Bacteria 6806
83 Ga0070663_100059561 3300005455 Bacteria 2744
84 Ga0070663_100088233 3300005455 Bacteria 2293
85 Ga0070663_100143105 3300005455 Bacteria 1827
86 Ga0070663_100236397 3300005455 Bacteria 1441
87 Ga0070663_100268402 3300005455 Bacteria 1356
88 Ga0070663_100420824 3300005455 Bacteria 1096
89 Ga0070678_100750392 3300005456 Bacteria 883
90 Ga0070662_100345002 3300005457 Bacteria 1219
91 Ga0070662_101540312 3300005457 Bacteria 573
92 Ga0070681_10564684 3300005458 Bacteria 1052
93 Ga0068867_100024353 3300005459 Bacteria 4336
94 Ga0068867_101139361 3300005459 Bacteria 714
95 Ga0070707_100325697 3300005468 Bacteria 1493
96 Ga0070707_100915434 3300005468 Bacteria 842
97 Ga0070698_100298207 3300005471 Bacteria 1543
98 Ga0070699_100000444 3300005518 Bacteria 39757
99 Ga0070679_100033410 3300005530 Bacteria 5094
100 Ga0070679_100379775 3300005530 Bacteria 1360
101 Ga0070679_100483287 3300005530 Bacteria 1183
102 Ga0070684_100181505 3300005535 Bacteria 1914
103 Ga0070697_100524187 3300005536 Bacteria 1037
104 Ga0068853_100014406 3300005539 Bacteria 6473
105 Ga0068853_100332127 3300005539 Bacteria 1411
106 Ga0070672_100194422 3300005543 Bacteria 1695
107 Ga0070686_100004627 3300005544 Bacteria 7588
108 Ga0070686_100014576 3300005544 Bacteria 4535
109 Ga0070695_100267172 3300005545 Bacteria 1252
110 Ga0070696_100000123 3300005546 Bacteria 40797
111 Ga0070696_100026755 3300005546 Bacteria 3926
112 Ga0070693_100008394 3300005547 Bacteria 5090
113 Ga0070693_100412584 3300005547 Bacteria 939
114 Ga0070665_100000186 3300005548 Bacteria 110750
115 Ga0070665_100036208 3300005548 Bacteria 4965
116 Ga0070665_100119168 3300005548 Bacteria 2641
117 Ga0070665_100415465 3300005548 Bacteria 1354
118 Ga0070665_100780062 3300005548 Bacteria 969
119 Ga0070665_101028932 3300005548 Bacteria 836
120 Ga0070665_101728303 3300005548 Bacteria 633
121 Ga0070704_100000095 3300005549 Bacteria 30467
122 Ga0070704_101306703 3300005549 Bacteria 664
123 Ga0068855_100002071 3300005563 Bacteria 24841
124 Ga0070664_100248835 3300005564 Bacteria 1597
125 Ga0068857_100003759 3300005577 Bacteria 12760
126 Ga0068857_100402373 3300005577 Bacteria 1274
127 Ga0068856_100123838 3300005614 Bacteria 2588
128 Ga0068856_100157077 3300005614 Bacteria 2285
129 Ga0068856_100468497 3300005614 Bacteria 1280
130 Ga0068856_100570800 3300005614 Bacteria 1152
131 Ga0068856_101683472 3300005614 Bacteria 647
132 Ga0070702_100000980 3300005615 Bacteria 11256
133 Ga0070702_100135943 3300005615 Bacteria 1559
134 Ga0070702_100392834 3300005615 Bacteria 990
135 Ga0068852_100001899 3300005616 Bacteria 14214
136 Ga0068852_100975061 3300005616 Bacteria 866
137 Ga0068859_100000243 3300005617 Bacteria 53580
138 Ga0068859_100001820 3300005617 Bacteria 21717
139 Ga0068859_100457790 3300005617 Bacteria 1372
140 Ga0068864_100379208 3300005618 Bacteria 1340
141 Ga0068866_10053091 3300005718 Bacteria 2071
142 Ga0068866_10620247 3300005718 Bacteria 733
143 Ga0068861_100000133 3300005719 Bacteria 38239
144 Ga0068861_100004883 3300005719 Bacteria 9025
145 Ga0068861_100011940 3300005719 Bacteria 6049
146 Ga0068861_100128229 3300005719 Bacteria 2056
147 Ga0068861_100400345 3300005719 Bacteria 1218
148 Ga0068851_10123075 3300005834 Bacteria 1396
149 Ga0068870_10236720 3300005840 Bacteria 1125
150 Ga0068863_100174025 3300005841 Bacteria 2065
151 Ga0068858_100111947 3300005842 Bacteria 2549
152 Ga0068858_101307606 3300005842 Bacteria 714
153 Ga0068860_100002696 3300005843 Bacteria 18484
154 Ga0068860_100153211 3300005843 Bacteria 2220
155 Ga0068860_101556681 3300005843 Bacteria 683
156 Ga0068862_100087870 3300005844 Bacteria 2703
157 Ga0068862_100160424 3300005844 Bacteria 2007
158 Ga0068862_100597866 3300005844 Bacteria 1059
159 Ga0081538_10023382 3300005981 Bacteria 4445
160 Ga0081539_10000321 3300005985 Bacteria 106887
161 Ga0070717_10093009 3300006028 Bacteria 2548
162 Ga0070717_10696414 3300006028 Bacteria 923
163 Ga0075365_10011522 3300006038 Bacteria 5201
164 Ga0075365_10172325 3300006038 Bacteria 1511
165 Ga0075368_10080960 3300006042 Bacteria 1321
166 Ga0075368_10333237 3300006042 Bacteria 659
167 Ga0075363_100006916 3300006048 Bacteria 5187
168 Ga0075363_100241070 3300006048 Bacteria 1039
169 Ga0075364_10019010 3300006051 Bacteria 4309
170 Ga0075364_10132828 3300006051 Bacteria 1671
171 Ga0075364_10606421 3300006051 Bacteria 748
172 Ga0075432_10013503 3300006058 Bacteria 2774
173 Ga0075432_10082995 3300006058 Bacteria 1164
174 Ga0070716_100008614 3300006173 Bacteria 5068
175 Ga0070716_100266843 3300006173 Bacteria 1174
176 Ga0075362_10075932 3300006177 Bacteria 1542
177 Ga0075362_10150358 3300006177 Bacteria 1117
178 Ga0075362_10190769 3300006177 Bacteria 995
179 Ga0075367_10193645 3300006178 Bacteria 1269
180 Ga0075369_10026088 3300006186 Bacteria 2434
181 Ga0075369_10163813 3300006186 Bacteria 1019
182 Ga0075366_10011171 3300006195 Bacteria 5063
183 Ga0075366_10443400 3300006195 Bacteria 801
184 Ga0075366_10672391 3300006195 Bacteria 643
185 Ga0097621_100051794 3300006237 Bacteria 3342
186 Ga0097621_100605629 3300006237 Bacteria 1002
187 Ga0075370_10079858 3300006353 Bacteria 1879
188 Ga0075370_10135879 3300006353 Bacteria 1436
189 Ga0075370_10374871 3300006353 Bacteria 852
190 Ga0068871_100121011 3300006358 Bacteria 2211
191 Ga0075428_100056272 3300006844 Bacteria 4308
192 Ga0075433_10206341 3300006852 Bacteria 1747
193 Ga0075434_100314498 3300006871 Bacteria 1586
194 Ga0068865_100044915 3300006881 Bacteria 3026
195 Ga0097620_100000243 3300006931 Bacteria 53580
196 Ga0097620_100001820 3300006931 Bacteria 21717
197 Ga0097620_100457744 3300006931 Bacteria 1372
198 Ga0099824_1042955 3300006942 Bacteria 1022
199 Ga0099822_1080690 3300006943 Bacteria 800
200 Ga0099823_1022671 3300006944 Bacteria 5798
201 Ga0099826_10000002 3300006948 Bacteria 1125830
202 Ga0075435_101070598 3300007076 Bacteria 705
203 Ga0099795_10082889 3300007788 Bacteria 1230
204 Ga0105251_10533379 3300009011 Bacteria 551
205 Ga0105240_10093354 3300009093 Bacteria 3673
206 Ga0105240_10154472 3300009093 Bacteria 2731
207 Ga0105240_10506534 3300009093 Bacteria 1342
208 Ga0105240_10995885 3300009093 Bacteria 897
209 Ga0105240_12083881 3300009093 Unclassified 589
210 Ga0111539_10254859 3300009094 Bacteria 2043
211 Ga0111539_10378931 3300009094 Bacteria 1647
212 Ga0105245_10008658 3300009098 Bacteria 8874
213 Ga0105245_10412605 3300009098 Bacteria 1352
214 Ga0105245_11039253 3300009098 Bacteria 864
215 Ga0105247_10012238 3300009101 Bacteria 5155
216 Ga0105247_11127634 3300009101 Bacteria 620
217 Ga0114129_10259791 3300009147 Bacteria 2328
218 Ga0114129_10491158 3300009147 Bacteria 1605
219 Ga0105243_10000213 3300009148 Bacteria 67585
220 Ga0105243_10133638 3300009148 Bacteria 2108
221 Ga0105243_10260542 3300009148 Bacteria 1552
222 Ga0105243_10670767 3300009148 Bacteria 1007
223 Ga0105243_11057650 3300009148 Bacteria 817
224 Ga0105241_10002321 3300009174 Bacteria 14295
225 Ga0105241_10044941 3300009174 Bacteria 3349
226 Ga0105241_10078928 3300009174 Bacteria 2573
227 Ga0105241_10214795 3300009174 Bacteria 1613
228 Ga0105241_10730466 3300009174 Bacteria 906
229 Ga0105241_11593163 3300009174 Bacteria 631
230 Ga0105241_12188428 3300009174 Bacteria 548
231 Ga0105242_10144122 3300009176 Bacteria 2070
232 Ga0105242_10370256 3300009176 Bacteria 1328
233 Ga0105242_10476589 3300009176 Bacteria 1182
234 Ga0105248_10004700 3300009177 Bacteria 15102
235 Ga0105248_10299583 3300009177 Bacteria 1810
236 Ga0105248_10301647 3300009177 Bacteria 1804
237 Ga0105237_10015096 3300009545 Bacteria 8049
238 Ga0105237_10047396 3300009545 Bacteria 4320
239 Ga0105237_10305688 3300009545 Bacteria 1593
240 Ga0105237_10356014 3300009545 Bacteria 1468
241 Ga0105237_11750868 3300009545 Bacteria 629
242 Ga0105238_10023368 3300009551 Bacteria 6301
243 Ga0105238_10098976 3300009551 Bacteria 2900
244 Ga0105238_10102383 3300009551 Bacteria 2845
245 Ga0105249_10006303 3300009553 Bacteria 10307
246 Ga0105249_10018077 3300009553 Bacteria 6266
247 Ga0105239_10142445 3300010375 Bacteria 2672
248 Ga0105239_10153056 3300010375 Bacteria 2574
249 Ga0105239_10321827 3300010375 Bacteria 1744
250 Ga0105239_10338923 3300010375 Bacteria 1697
251 Ga0105239_10923065 3300010375 Bacteria 1002
252 Ga0105239_11365012 3300010375 Bacteria 818
253 Ga0105239_11646180 3300010375 Bacteria 743
254 Ga0105246_10114723 3300011119 Bacteria 1985
255 Ga0157326_1002360 3300012513 Bacteria 2025
256 Ga0157373_10013087 3300013100 Bacteria 6089
257 Ga0157373_11298293 3300013100 Bacteria 551
258 Ga0157371_10005011 3300013102 Bacteria 11350
259 Ga0157370_10292366 3300013104 Bacteria 1505
260 Ga0157369_10170583 3300013105 Bacteria 2293
261 Ga0157369_10768302 3300013105 Bacteria 991
262 Ga0157378_10053233 3300013297 Bacteria 3604
263 Ga0157378_10797810 3300013297 Bacteria 970
264 Ga0157378_12104533 3300013297 Bacteria 615
265 Ga0163162_10026566 3300013306 Bacteria 5723
266 Ga0163162_10053372 3300013306 Bacteria 4062
267 Ga0163162_10120108 3300013306 Bacteria 2731
268 Ga0163162_10482770 3300013306 Bacteria 1371
269 Ga0157372_10321704 3300013307 Bacteria 1801
270 Ga0157372_10599299 3300013307 Bacteria 1284
271 Ga0157372_11951914 3300013307 Unclassified 675
272 Ga0157375_10490855 3300013308 Bacteria 1393
273 Ga0157375_11324236 3300013308 Bacteria 847
274 Ga0163163_10047359 3300014325 Bacteria 4226
275 Ga0163163_10376284 3300014325 Bacteria 1477
276 Ga0157380_10056488 3300014326 Bacteria 3122
277 Ga0157380_10081715 3300014326 Bacteria 2644
278 Ga0157380_10960150 3300014326 Bacteria 885
279 Ga0157380_11444586 3300014326 Bacteria 739
280 Ga0157377_10012955 3300014745 Bacteria 4207
281 Ga0157377_10259300 3300014745 Bacteria 1130
282 Ga0157377_10552740 3300014745 Bacteria 813
283 Ga0157379_10032845 3300014968 Bacteria 4627
284 Ga0157379_10091372 3300014968 Bacteria 2731
285 Ga0157379_10223613 3300014968 Bacteria 1706
286 Ga0157379_10726321 3300014968 Bacteria 934
287 Ga0157376_10199919 3300014969 Bacteria 1838
288 Ga0182007_10349436 3300015262 Bacteria 555
289 Ga0163161_10106650 3300017792 Bacteria 2091
290 Ga0163161_10120402 3300017792 Bacteria 1972
291 Ga0214544_1000001 3300021320 Bacteria 783667
292 Ga0214542_1000005 3300021321 Bacteria 389646
293 Ga0214545_1000003 3300021324 Bacteria 720274
294 Ga0214545_1019813 3300021324 Bacteria 5618
295 Ga0214543_1000002 3300021327 Bacteria 712733
296 Ga0214543_1027099 3300021327 Bacteria 2961
297 Ga0209674_115782 3300025226 Bacteria 643
298 Ga0209563_100116 3300025230 Bacteria 134661
299 Ga0209563_102989 3300025230 Bacteria 3633
300 Ga0207425_1009648 3300025245 Bacteria 2391
301 Ga0209677_101529 3300025253 Bacteria 9890
302 Ga0209148_1000011 3300025254 Bacteria 1196503
303 Ga0209148_1000578 3300025254 Bacteria 33857
304 Ga0209148_1020537 3300025254 Bacteria 1084
305 Ga0209148_1026795 3300025254 Bacteria 891
306 Ga0209129_1000285 3300025258 Bacteria 48259
307 Ga0209233_1006411 3300025261 Bacteria 3795
308 Ga0209233_1008559 3300025261 Bacteria 3156
309 Ga0209233_1010267 3300025261 Bacteria 2816
310 Ga0209233_1044497 3300025261 Bacteria 939
311 Ga0209455_1000006 3300025272 Bacteria 1196503
312 Ga0209455_1000876 3300025272 Bacteria 15927
313 Ga0209455_1016198 3300025272 Bacteria 1610
314 Ga0209455_1042491 3300025272 Bacteria 682
315 Ga0209673_1021991 3300025273 Bacteria 2214
316 Ga0209130_1074870 3300025284 Bacteria 557
317 Ga0209676_1019122 3300025292 Bacteria 2366
318 Ga0209025_1001792 3300025294 Bacteria 25500
319 Ga0209025_1076221 3300025294 Bacteria 1163
320 Ga0209564_1004581 3300025295 Bacteria 8370
321 Ga0209564_1008808 3300025295 Bacteria 4914
322 Ga0209564_1011604 3300025295 Bacteria 3930
323 Ga0209758_1000026 3300025297 Bacteria 582706
324 Ga0209758_1001536 3300025297 Bacteria 26563
325 Ga0209758_1005453 3300025297 Bacteria 9789
326 Ga0209758_1009114 3300025297 Bacteria 6256
327 Ga0209758_1016045 3300025297 Bacteria 3829
328 Ga0209758_1149875 3300025297 Bacteria 593
329 Ga0209050_1007640 3300025298 Bacteria 5995
330 Ga0209256_1000007 3300025299 Bacteria 1136599
331 Ga0209256_1032368 3300025299 Bacteria 1418
332 Ga0207426_1006447 3300025302 Bacteria 5109
333 Ga0207426_1013770 3300025302 Bacteria 2984
334 Ga0209051_1013609 3300025303 Bacteria 3858
335 Ga0209257_1005738 3300025304 Bacteria 8496
336 Ga0209257_1009389 3300025304 Bacteria 5259
337 Ga0207697_10121100 3300025315 Bacteria 1126
338 Ga0207697_10212146 3300025315 Bacteria 853
339 Ga0207656_10020184 3300025321 Bacteria 2646
340 Ga0207653_10000615 3300025885 Bacteria 12418
341 Ga0207682_10125361 3300025893 Bacteria 1143
342 Ga0207642_10066517 3300025899 Bacteria 1698
343 Ga0207642_10479441 3300025899 Bacteria 758
344 Ga0207710_10087285 3300025900 Bacteria 1455
345 Ga0207710_10781758 3300025900 Bacteria 502
346 Ga0207688_10046773 3300025901 Bacteria 2416
347 Ga0207680_10101447 3300025903 Bacteria 1850
348 Ga0207680_10619874 3300025903 Bacteria 774
349 Ga0207647_10001122 3300025904 Bacteria 20595
350 Ga0207647_10015165 3300025904 Bacteria 5292
351 Ga0207647_10025233 3300025904 Bacteria 3909
352 Ga0207647_10141757 3300025904 Bacteria 1409
353 Ga0207647_10239185 3300025904 Bacteria 1043
354 Ga0207699_10018621 3300025906 Bacteria 3684
355 Ga0207645_10036859 3300025907 Bacteria 3140
356 Ga0207705_11397978 3300025909 Unclassified 532
357 Ga0207654_10001228 3300025911 Bacteria 13697
358 Ga0207654_10022738 3300025911 Bacteria 3349
359 Ga0207654_10031554 3300025911 Bacteria 2920
360 Ga0207654_10057695 3300025911 Bacteria 2257
361 Ga0207654_10138954 3300025911 Bacteria 1547
362 Ga0207654_10776096 3300025911 Bacteria 691
363 Ga0207707_10000852 3300025912 Bacteria 29744
364 Ga0207707_10046627 3300025912 Bacteria 3775
365 Ga0207707_11451837 3300025912 Bacteria 545
366 Ga0207695_10029722 3300025913 Bacteria 6030
367 Ga0207695_10106162 3300025913 Bacteria 2795
368 Ga0207695_11701507 3300025913 Bacteria 512
369 Ga0207671_10037979 3300025914 Bacteria 3570
370 Ga0207671_10144307 3300025914 Bacteria 1836
371 Ga0207671_10148867 3300025914 Bacteria 1808
372 Ga0207671_10455403 3300025914 Bacteria 1019
373 Ga0207693_10113735 3300025915 Bacteria 2123
374 Ga0207663_10144917 3300025916 Bacteria 1659
375 Ga0207660_10001673 3300025917 Bacteria 14857
376 Ga0207660_10030337 3300025917 Bacteria 3716
377 Ga0207660_10348500 3300025917 Bacteria 1187
378 Ga0207662_10036899 3300025918 Bacteria 2859
379 Ga0207662_10117496 3300025918 Bacteria 1664
380 Ga0207662_10475637 3300025918 Bacteria 857
381 Ga0207657_10007172 3300025919 Bacteria 11444
382 Ga0207657_10021785 3300025919 Bacteria 6021
383 Ga0207657_11041242 3300025919 Bacteria 627
384 Ga0207649_10000225 3300025920 Bacteria 46073
385 Ga0207649_10008280 3300025920 Bacteria 5666
386 Ga0207649_10392450 3300025920 Bacteria 1037
387 Ga0207652_10019841 3300025921 Bacteria 5534
388 Ga0207652_10056877 3300025921 Bacteria 3368
389 Ga0207652_10270156 3300025921 Bacteria 1534
390 Ga0207652_10306724 3300025921 Bacteria 1433
391 Ga0207652_10340398 3300025921 Bacteria 1354
392 Ga0207681_10056349 3300025923 Bacteria 2681
393 Ga0207694_10024573 3300025924 Bacteria 4576
394 Ga0207694_10195777 3300025924 Bacteria 1643
395 Ga0207694_10374321 3300025924 Bacteria 1181
396 Ga0207694_10642783 3300025924 Bacteria 894
397 Ga0207659_10435641 3300025926 Bacteria 1102
398 Ga0207687_10022557 3300025927 Bacteria 4191
399 Ga0207687_10026448 3300025927 Bacteria 3886
400 Ga0207687_10387443 3300025927 Bacteria 1146
401 Ga0207700_10232060 3300025928 Bacteria 1569
402 Ga0207700_10713500 3300025928 Bacteria 895
403 Ga0207664_10429853 3300025929 Bacteria 1177
404 Ga0207644_10097618 3300025931 Bacteria 2201
405 Ga0207644_10324995 3300025931 Bacteria 1244
406 Ga0207644_10451204 3300025931 Bacteria 1056
407 Ga0207690_10003708 3300025932 Bacteria 9081
408 Ga0207690_10482257 3300025932 Bacteria 1001
409 Ga0207706_10188872 3300025933 Bacteria 1809
410 Ga0207706_10275460 3300025933 Bacteria 1468
411 Ga0207706_10937609 3300025933 Bacteria 730
412 Ga0207706_11723743 3300025933 Bacteria 504
413 Ga0207686_10465797 3300025934 Bacteria 975
414 Ga0207686_10478369 3300025934 Bacteria 963
415 Ga0207686_10565079 3300025934 Bacteria 891
416 Ga0207709_10000018 3300025935 Bacteria 431545
417 Ga0207709_10010467 3300025935 Bacteria 5105
418 Ga0207709_10369141 3300025935 Bacteria 1089
419 Ga0207709_10800936 3300025935 Bacteria 760
420 Ga0207709_11119039 3300025935 Bacteria 647
421 Ga0207670_10586549 3300025936 Bacteria 914
422 Ga0207669_10012958 3300025937 Bacteria 4122
423 Ga0207669_10014655 3300025937 Bacteria 3935
424 Ga0207669_10318367 3300025937 Bacteria 1189
425 Ga0207669_10406698 3300025937 Bacteria 1068
426 Ga0207704_10134129 3300025938 Bacteria 1720
427 Ga0207665_10303621 3300025939 Bacteria 1194
428 Ga0207711_10002918 3300025941 Bacteria 14991
429 Ga0207711_10168495 3300025941 Bacteria 1986
430 Ga0207711_10308548 3300025941 Bacteria 1461
431 Ga0207689_10083686 3300025942 Bacteria 2623
432 Ga0207689_10983329 3300025942 Bacteria 712
433 Ga0207679_10068738 3300025945 Bacteria 2662
434 Ga0207679_10172347 3300025945 Bacteria 1783
435 Ga0207679_10496903 3300025945 Bacteria 1088
436 Ga0207667_10001428 3300025949 Bacteria 29927
437 Ga0207667_10246654 3300025949 Bacteria 1827
438 Ga0207651_10009390 3300025960 Bacteria 5352
439 Ga0207651_10127815 3300025960 Bacteria 1940
440 Ga0207651_10499924 3300025960 Bacteria 1051
441 Ga0207712_10038467 3300025961 Bacteria 3272
442 Ga0207712_10085168 3300025961 Bacteria 2312
443 Ga0207668_10018721 3300025972 Bacteria 4365
444 Ga0207668_10168921 3300025972 Bacteria 1713
445 Ga0207668_10429869 3300025972 Bacteria 1122
446 Ga0207668_10435724 3300025972 Bacteria 1115
447 Ga0207640_10096493 3300025981 Bacteria 2061
448 Ga0207640_10179964 3300025981 Bacteria 1584
449 Ga0207640_11136150 3300025981 Bacteria 692
450 Ga0207658_10079721 3300025986 Bacteria 2506
451 Ga0207658_10138199 3300025986 Bacteria 1968
452 Ga0207658_10667850 3300025986 Bacteria 938
453 Ga0207658_10994499 3300025986 Bacteria 765
454 Ga0207703_10361645 3300026035 Bacteria 1338
455 Ga0207703_10375563 3300026035 Bacteria 1314
456 Ga0207703_10381297 3300026035 Bacteria 1304
457 Ga0207703_11065667 3300026035 Bacteria 776
458 Ga0207703_11594316 3300026035 Bacteria 628
459 Ga0207639_10002313 3300026041 Bacteria 12790
460 Ga0207639_10463625 3300026041 Bacteria 1152
461 Ga0207639_11222663 3300026041 Bacteria 705
462 Ga0207678_10006547 3300026067 Bacteria 10327
463 Ga0207678_10026500 3300026067 Bacteria 5056
464 Ga0207678_10033426 3300026067 Bacteria 4481
465 Ga0207678_10038931 3300026067 Bacteria 4128
466 Ga0207708_10000488 3300026075 Bacteria 30463
467 Ga0207708_10000776 3300026075 Bacteria 24052
468 Ga0207708_10453936 3300026075 Bacteria 1068
469 Ga0207702_10001111 3300026078 Bacteria 27466
470 Ga0207702_10084712 3300026078 Bacteria 2761
471 Ga0207702_10156055 3300026078 Bacteria 2080
472 Ga0207702_10583107 3300026078 Bacteria 1096
473 Ga0207702_11196312 3300026078 Bacteria 754
474 Ga0207641_10070060 3300026088 Bacteria 3013
475 Ga0207641_10190145 3300026088 Bacteria 1886
476 Ga0207648_10046235 3300026089 Bacteria 3816
477 Ga0207648_10365217 3300026089 Bacteria 1303
478 Ga0207676_10011695 3300026095 Bacteria 6278
479 Ga0207676_10781438 3300026095 Bacteria 930
480 Ga0207674_10004426 3300026116 Bacteria 16895
481 Ga0207674_10024383 3300026116 Bacteria 6467
482 Ga0207674_10294377 3300026116 Bacteria 1572
483 Ga0207674_10776492 3300026116 Bacteria 925
484 Ga0207674_11348680 3300026116 Bacteria 683
485 Ga0207675_100000011 3300026118 Bacteria 143162
486 Ga0207675_100001448 3300026118 Bacteria 23778
487 Ga0207675_100015329 3300026118 Bacteria 7152
488 Ga0207675_100179187 3300026118 Bacteria 2029
489 Ga0207675_100185678 3300026118 Bacteria 1993
490 Ga0207675_101564135 3300026118 Bacteria 680
491 Ga0207683_10127155 3300026121 Bacteria 2291
492 Ga0207683_10320560 3300026121 Bacteria 1420
493 Ga0207698_10001209 3300026142 Bacteria 15067
494 Ga0207698_10007060 3300026142 Bacteria 7035
495 Ga0207698_10332780 3300026142 Bacteria 1427
496 Ga0207698_10504526 3300026142 Bacteria 1178
497 Ga0207698_10692885 3300026142 Bacteria 1013
498 Ga0207698_11760656 3300026142 Bacteria 635
499 Ga0209389_1000057 3300027296 Bacteria 107632
500 Ga0209389_1000083 3300027296 Bacteria 88461
501 Ga0209589_1000097 3300027357 Bacteria 88461
502 Ga0209489_100105 3300027361 Bacteria 118979
503 Ga0209489_100226 3300027361 Bacteria 94384
504 Ga0209700_100085 3300027363 Bacteria 128517
505 Ga0209282_1000001 3300027666 Bacteria 2450367
506 Ga0209998_10017440 3300027717 Bacteria 1517
507 Ga0209813_10050410 3300027866 Bacteria 1299
508 Ga0209813_10081341 3300027866 Bacteria 1072
509 Ga0268266_10000002 3300028379 Bacteria 3059047
510 Ga0268266_10118211 3300028379 Bacteria 2356
511 Ga0268266_10338754 3300028379 Bacteria 1411
512 Ga0268266_10379038 3300028379 Bacteria 1334
513 Ga0268266_11535231 3300028379 Bacteria 641
514 Ga0268265_10088412 3300028380 Bacteria 2468
515 Ga0268265_10584428 3300028380 Bacteria 1065
516 Ga0268265_10635914 3300028380 Bacteria 1024
517 Ga0268265_10729956 3300028380 Bacteria 960
518 Ga0268264_10016842 3300028381 Bacteria 5983
519 Ga0268264_10494877 3300028381 Bacteria 1191
520 Ga0307515_10160552 3300028794 Bacteria 2295
521 Ga0265338_10039470 3300028800 Bacteria 4452
522 Ga0307513_10109293 3300031456 Bacteria 2763
523 Ga0307513_10323569 3300031456 Bacteria 1299
524 Ga0307513_10779091 3300031456 Bacteria 662
525 Ga0307509_10000013 3300031507 Bacteria 283027
526 Ga0307408_100255626 3300031548 Bacteria 1447
527 Ga0307408_101728997 3300031548 Bacteria 596
528 Ga0265342_10088609 3300031712 Bacteria 1777
529 Ga0307413_10675500 3300031824 Bacteria 855
530 Ga0307410_10183088 3300031852 Bacteria 1587
531 Ga0307410_10316307 3300031852 Bacteria 1237
532 Ga0307407_10106184 3300031903 Bacteria 1754
533 Ga0307407_10979182 3300031903 Bacteria 653
534 Ga0307412_10191259 3300031911 Bacteria 1547
535 Ga0307412_11745386 3300031911 Bacteria 571
536 Ga0307412_12173852 3300031911 Bacteria 516
537 Ga0307409_100308180 3300031995 Bacteria 1476
538 Ga0307409_100613927 3300031995 Bacteria 1076
539 Ga0307416_100205968 3300032002 Bacteria 1871
540 Ga0307416_100658552 3300032002 Bacteria 1133
541 Ga0307414_10164251 3300032004 Bacteria 1768
542 Ga0307414_10292212 3300032004 Bacteria 1374
543 Ga0307414_11413989 3300032004 Bacteria 647
544 Ga0307411_10165248 3300032005 Bacteria 1663
545 Ga0307510_10095926 3300033180 Bacteria 2784
546 Ga0307510_10242811 3300033180 Bacteria 1294
547 Ga0373930_0012940 3300034816 Bacteria 1530
548 Ga0373958_0019203 3300034819 Bacteria 1247
549 Ga0373929_0088522 3300035085 Bacteria 765
550 Ga0373940_0006102 3300035088 Bacteria 2651
551 Ga0373931_0020603 3300035691 Bacteria 3301
552 Ga0373931_0850066 3300035691 Bacteria 611
553 Ga0373927_0036186 3300035695 Bacteria 3211
554 Ga0373927_0185409 3300035695 Bacteria 1365
555 Ga0373927_0297143 3300035695 Bacteria 1063
556 Ga0373947_0534655 3300035725 Bacteria 798
557 Ga0373925_0834629 3300037068 Bacteria 760
558 Ga0395900_0000601 3300037418 Bacteria 49219
559 Ga0395898_0010480 3300037466 Bacteria 9689
560 Ga0395898_0094170 3300037466 Bacteria 2879
561 Ga0395898_0111975 3300037466 Bacteria 2616
562 Ga0395905_0047818 3300037471 Bacteria 4008
563 Ga0395905_0192819 3300037471 Bacteria 1911
564 Ga0395905_0277022 3300037471 Bacteria 1563
565 Ga0395905_0461844 3300037471 Bacteria 1168
566 Ga0395905_0516134 3300037471 Bacteria 1095
567 Ga0395905_0540154 3300037471 Bacteria 1067
568 Ga0395905_1037796 3300037471 Bacteria 723
569 Ga0395905_1463445 3300037471 Bacteria 587
570 Ga0436364_0450134 3300037853 Bacteria 1948
571 Ga0436364_0796860 3300037853 Bacteria 645
572 Ga0395901_0021632 3300038443 Bacteria 6589
573 Ga0395901_0284067 3300038443 Bacteria 1719
574 Ga0395901_0477936 3300038443 Bacteria 1271
575 Ga0395901_1256871 3300038443 Bacteria 704
576 Ga0395901_1624262 3300038443 Bacteria 599
577 Ga0436365_0224118 3300039437 Bacteria 748
578 Ga0436365_0396957 3300039437 Bacteria 1073
579 Ga0436365_1268888 3300039437 Bacteria 1095
580 Ga0439436_0076317 3300041404 Bacteria 933
581 Ga0439453_0022803 3300041408 Bacteria 1138
582 Ga0451791_1276388 3300041451 Bacteria 617
583 Ga0451791_1771099 3300041451 Bacteria 946
584 Ga0451793_1615561 3300041452 Bacteria 831
585 Ga0451800_0909938 3300041459 Bacteria 886
586 Ga0451800_1103286 3300041459 Bacteria 507
587 Ga0451807_1108795 3300041486 Bacteria 579
588 Ga0451835_0691213 3300041492 Bacteria 594
589 Ga0451845_0352644 3300041501 Bacteria 595
590 Ga0451851_0269221 3300041507 Bacteria 1076
591 Ga0451853_3654192 3300041512 Bacteria 610
592 Ga0451853_3944585 3300041512 Bacteria 879
593 Ga0439448_0003740 3300042005 Bacteria 4240
594 Ga0439450_015806 3300042008 Bacteria 1551
595 Ga0439450_026906 3300042008 Bacteria 1271
596 Ga0439435_0013209 3300042436 Bacteria 2015
597 Ga0439459_0128012 3300042438 Bacteria 646
598 Ga0466969_0010526 3300044656 Bacteria 4903
599 Ga0466972_0002026 3300044658 Bacteria 9923
600 Ga0466972_0016778 3300044658 Bacteria 3661
601 Ga0453683_0463360 3300044673 Bacteria 820
602 Ga0466965_0005417 3300044683 Bacteria 5750
603 Ga0466965_0088657 3300044683 Bacteria 1571
604 Ga0466965_0141190 3300044683 Bacteria 1254
605 Ga0466965_0360630 3300044683 Bacteria 797
606 Ga0466966_0005947 3300044684 Bacteria 8051
607 Ga0466966_0158724 3300044684 Bacteria 1377
608 Ga0466966_0612220 3300044684 Bacteria 656
609 Ga0466961_0000863 3300044693 Bacteria 18927
610 Ga0466961_0003976 3300044693 Bacteria 9248
611 Ga0466961_0190296 3300044693 Bacteria 1272
612 Ga0466961_0454383 3300044693 Bacteria 775
613 Ga0466963_0008115 3300044694 Bacteria 6287
614 Ga0466963_0085767 3300044694 Bacteria 2138
615 Ga0466963_0636864 3300044694 Bacteria 753
616 Ga0466963_1080777 3300044694 Bacteria 564
617 Ga0466964_0000042 3300044706 Bacteria 26502
618 Ga0466964_0016732 3300044706 Bacteria 2802
619 Ga0466964_0075336 3300044706 Bacteria 1436
620 Ga0466964_0287018 3300044706 Bacteria 825
621 Ga0466964_0354837 3300044706 Bacteria 754
622 Ga0466971_0018497 3300044719 Bacteria 3086
623 Ga0466971_0148221 3300044719 Bacteria 1094
624 Ga0466968_0077952 3300044735 Bacteria 1452
625 Ga0466968_0107151 3300044735 Bacteria 1253
626 Ga0466970_0002328 3300044765 Bacteria 9184
627 Ga0466970_0019044 3300044765 Bacteria 3557
628 Ga0466970_0475220 3300044765 Bacteria 718
629 Ga0466957_0057877 3300044842 Bacteria 2373
630 Ga0466957_0183957 3300044842 Bacteria 1366
631 Ga0466957_0233670 3300044842 Bacteria 1218
632 Ga0466957_0402039 3300044842 Bacteria 937
633 Ga0466960_0127399 3300044901 Bacteria 1340
634 Ga0466959_0000648 3300045049 Bacteria 20299
635 Ga0466959_0014195 3300045049 Bacteria 5781
636 Ga0466959_0479042 3300045049 Bacteria 842
637 Ga0466959_0643465 3300045049 Bacteria 712
638 Ga0466959_0643498 3300045049 Bacteria 712
639 Ga0451576_0618156 3300045051 Bacteria 1139
640 Ga0466958_0000250 3300045836 Bacteria 20747
641 Ga0466958_0002080 3300045836 Bacteria 9907
642 Ga0466958_0030782 3300045836 Bacteria 3189
643 Ga0466967_0004712 3300045976 Bacteria 9268
644 Ga0466967_0005881 3300045976 Bacteria 8590
645 Ga0466967_0055268 3300045976 Bacteria 3497
646 Ga0466967_0084535 3300045976 Bacteria 2871
647 Ga0466967_0281423 3300045976 Bacteria 1596
648 Ga0466967_0937460 3300045976 Bacteria 861
649 Ga0495617_000008 3300046452 Bacteria 340369
650 Ga0495617_040015 3300046452 Bacteria 1568
651 Ga0495617_069919 3300046452 Bacteria 1155
652 Ga0495627_000191 3300046453 Bacteria 67637
653 Ga0495627_009857 3300046453 Bacteria 3497
654 Ga0495592_0022986 3300046454 Bacteria 4745
655 Ga0495592_0098350 3300046454 Bacteria 2089
656 Ga0495603_0076135 3300046455 Bacteria 1969
657 Ga0495590_0000017 3300046457 Bacteria 216944
658 Ga0495590_0012598 3300046457 Bacteria 3135
659 Ga0495590_0034232 3300046457 Bacteria 1774
660 Ga0495590_0086221 3300046457 Bacteria 1109
661 Ga0495591_000091 3300046458 Bacteria 101618
662 Ga0495591_004378 3300046458 Bacteria 6939
663 Ga0495629_0006687 3300046459 Bacteria 8527
664 Ga0495638_0006848 3300046460 Bacteria 8227
665 Ga0495638_0017968 3300046460 Bacteria 4706
666 Ga0495638_0048258 3300046460 Bacteria 2666
667 Ga0495638_0068452 3300046460 Bacteria 2177
668 Ga0495638_0253610 3300046460 Bacteria 969
669 Ga0495651_0008654 3300046462 Bacteria 7809
670 Ga0495651_0148809 3300046462 Bacteria 1690
671 Ga0495653_0237596 3300046463 Bacteria 1216
672 Ga0495650_0000373 3300046471 Bacteria 78223
673 Ga0495650_0014674 3300046471 Bacteria 4058
674 Ga0495582_0226110 3300046473 Bacteria 1071
675 Ga0495605_0000176 3300046474 Bacteria 80441
676 Ga0495605_0000559 3300046474 Bacteria 30395
677 Ga0495605_0004429 3300046474 Bacteria 8257
678 Ga0495605_0014773 3300046474 Bacteria 4264
679 Ga0495605_0039351 3300046474 Bacteria 2369
680 Ga0495605_0122734 3300046474 Bacteria 1176
681 Ga0495605_0262766 3300046474 Bacteria 736
682 Ga0495605_0273266 3300046474 Bacteria 719
683 Ga0495605_0346039 3300046474 Bacteria 624
684 Ga0495639_0316334 3300046475 Bacteria 780
685 Ga0495662_0199942 3300046476 Bacteria 985
686 Ga0495664_0023203 3300046477 Bacteria 3599
687 Ga0495664_0077488 3300046477 Bacteria 1991
688 Ga0495664_0681205 3300046477 Bacteria 608
689 Ga0495584_0000031 3300046491 Bacteria 100128
690 Ga0495584_0001217 3300046491 Bacteria 15721
691 Ga0495584_0087892 3300046491 Bacteria 1566
692 Ga0495584_0112348 3300046491 Bacteria 1379
693 Ga0495584_0152962 3300046491 Bacteria 1172
694 Ga0495585_0006675 3300046492 Bacteria 7128
695 Ga0495585_0011422 3300046492 Bacteria 5254
696 Ga0495585_0013692 3300046492 Bacteria 4740
697 Ga0495585_0015903 3300046492 Bacteria 4366
698 Ga0495585_0065627 3300046492 Bacteria 1988
699 Ga0495585_0065985 3300046492 Bacteria 1982
700 Ga0495585_0098895 3300046492 Bacteria 1562
701 Ga0495585_0107410 3300046492 Bacteria 1487
702 Ga0495585_0174635 3300046492 Bacteria 1108
703 Ga0495585_0225037 3300046492 Bacteria 945
704 Ga0495594_0002735 3300046499 Bacteria 9146
705 Ga0495594_0006022 3300046499 Bacteria 6225
706 Ga0495594_0495824 3300046499 Bacteria 694
707 Ga0495596_0003495 3300046500 Bacteria 7926
708 Ga0495596_0004017 3300046500 Bacteria 7255
709 Ga0495596_0011542 3300046500 Bacteria 3805
710 Ga0495596_0014417 3300046500 Bacteria 3331
711 Ga0495596_0023788 3300046500 Bacteria 2484
712 Ga0495596_0129895 3300046500 Bacteria 978
713 Ga0495596_0226131 3300046500 Bacteria 726
714 Ga0495607_0002229 3300046501 Bacteria 16025
715 Ga0495607_0004696 3300046501 Bacteria 9996
716 Ga0495607_0009255 3300046501 Bacteria 6688
717 Ga0495607_0032829 3300046501 Bacteria 3164
718 Ga0495607_0361002 3300046501 Bacteria 668
719 Ga0495583_0001871 3300046506 Bacteria 19588
720 Ga0495583_0001879 3300046506 Bacteria 19521
721 Ga0495583_0003628 3300046506 Bacteria 11550
722 Ga0495583_0018160 3300046506 Bacteria 3710
723 Ga0495583_0031145 3300046506 Bacteria 2589
724 Ga0495583_0037224 3300046506 Bacteria 2308
725 Ga0495583_0317301 3300046506 Bacteria 618
726 Ga0495606_0004509 3300046507 Bacteria 13865
727 Ga0495606_0006533 3300046507 Bacteria 10724
728 Ga0495606_0021322 3300046507 Bacteria 4747
729 Ga0495606_0046033 3300046507 Bacteria 2886
730 Ga0495606_0070480 3300046507 Bacteria 2204
731 Ga0495606_0176499 3300046507 Bacteria 1235
732 Ga0495606_0220648 3300046507 Bacteria 1068
733 Ga0495606_0251487 3300046507 Bacteria 980
734 Ga0495608_0042890 3300046511 Bacteria 3024
735 Ga0495608_0159363 3300046511 Bacteria 1435
736 Ga0495610_0023569 3300046512 Bacteria 3341
737 Ga0495610_0126098 3300046512 Bacteria 1116
738 Ga0495610_0149709 3300046512 Bacteria 997
739 Ga0495616_0000321 3300046513 Bacteria 38323
740 Ga0495616_0000395 3300046513 Bacteria 33694
741 Ga0495616_0006834 3300046513 Bacteria 6871
742 Ga0495616_0009676 3300046513 Bacteria 5619
743 Ga0495616_0036379 3300046513 Bacteria 2540
744 Ga0495616_0065871 3300046513 Bacteria 1763
745 Ga0495616_0125881 3300046513 Bacteria 1178
746 Ga0495618_0265006 3300046514 Bacteria 1075
747 Ga0495620_0080128 3300046515 Bacteria 1322
748 Ga0495628_0016659 3300046516 Bacteria 6129
749 Ga0495630_1286808 3300046517 Bacteria 551
750 Ga0495631_0000562 3300046518 Bacteria 24956
751 Ga0495631_0004969 3300046518 Bacteria 7007
752 Ga0495631_0009488 3300046518 Bacteria 4859
753 Ga0495631_0012205 3300046518 Bacteria 4204
754 Ga0495631_0034871 3300046518 Bacteria 2253
755 Ga0495631_0063005 3300046518 Bacteria 1606
756 Ga0495631_0067513 3300046518 Bacteria 1547
757 Ga0495631_0201804 3300046518 Bacteria 850
758 Ga0495631_0289937 3300046518 Bacteria 697
759 Ga0495632_0000155 3300046519 Bacteria 70814
760 Ga0495632_0004685 3300046519 Bacteria 9237
761 Ga0495632_0027540 3300046519 Bacteria 2976
762 Ga0495632_0031748 3300046519 Bacteria 2727
763 Ga0495632_0141096 3300046519 Bacteria 1118
764 Ga0495632_0215063 3300046519 Bacteria 871
765 Ga0495637_0000004 3300046520 Bacteria 589740
766 Ga0495637_0021740 3300046520 Bacteria 2937
767 Ga0495637_0048357 3300046520 Bacteria 1791
768 Ga0495637_0101020 3300046520 Bacteria 1127
769 Ga0495637_0168815 3300046520 Bacteria 817
770 Ga0495643_0002948 3300046522 Bacteria 12888
771 Ga0495643_0003289 3300046522 Bacteria 11937
772 Ga0495643_0007636 3300046522 Bacteria 6946
773 Ga0495643_0007678 3300046522 Bacteria 6917
774 Ga0495643_0027136 3300046522 Bacteria 3222
775 Ga0495643_0085865 3300046522 Bacteria 1631
776 Ga0495643_0122962 3300046522 Bacteria 1309
777 Ga0495643_0138861 3300046522 Bacteria 1214
778 Ga0495643_0140293 3300046522 Bacteria 1206
779 Ga0495643_0358090 3300046522 Bacteria 652
780 Ga0495644_0002176 3300046523 Bacteria 7874
781 Ga0495644_0006276 3300046523 Bacteria 4616
782 Ga0495644_0021326 3300046523 Bacteria 2472
783 Ga0495644_0161325 3300046523 Bacteria 859
784 Ga0495648_0001050 3300046524 Bacteria 28021
785 Ga0495648_0001311 3300046524 Bacteria 24643
786 Ga0495648_0003160 3300046524 Bacteria 14655
787 Ga0495648_0004718 3300046524 Bacteria 11547
788 Ga0495648_0007417 3300046524 Bacteria 8775
789 Ga0495648_0014544 3300046524 Bacteria 5756
790 Ga0495648_0033000 3300046524 Bacteria 3388
791 Ga0495648_0064299 3300046524 Bacteria 2162
792 Ga0495648_0130203 3300046524 Bacteria 1339
793 Ga0495648_0283757 3300046524 Bacteria 783
794 Ga0495648_0293766 3300046524 Bacteria 764
795 Ga0495663_0001136 3300046525 Bacteria 8582
796 Ga0495642_0000617 3300046528 Bacteria 17917
797 Ga0495642_0001753 3300046528 Bacteria 9354
798 Ga0495642_0005805 3300046528 Bacteria 4733
799 Ga0495642_0005858 3300046528 Bacteria 4716
800 Ga0495642_0024677 3300046528 Bacteria 2379
801 Ga0495642_0047458 3300046528 Bacteria 1759
802 Ga0495642_0050520 3300046528 Bacteria 1710
803 Ga0495642_0147126 3300046528 Bacteria 1018
804 Ga0495642_0340403 3300046528 Bacteria 659
805 Ga0495652_0107280 3300046529 Bacteria 2253
806 Ga0495654_0005485 3300046530 Bacteria 7349
807 Ga0495654_0015086 3300046530 Bacteria 4106
808 Ga0495654_0026683 3300046530 Bacteria 2967
809 Ga0495654_0155762 3300046530 Bacteria 1007
810 Ga0495640_0090607 3300046533 Bacteria 2018
811 Ga0495586_0321697 3300046535 Bacteria 887
812 Ga0495587_0049814 3300046536 Bacteria 2479
813 Ga0495587_0063977 3300046536 Bacteria 2150
814 Ga0495598_0114659 3300046537 Bacteria 907
815 Ga0495609_0002370 3300046538 Bacteria 11617
816 Ga0495609_0014233 3300046538 Bacteria 3744
817 Ga0495609_0025650 3300046538 Bacteria 2701
818 Ga0495597_0000698 3300046542 Bacteria 26850
819 Ga0495597_0001066 3300046542 Bacteria 20915
820 Ga0495597_0025540 3300046542 Bacteria 2719
821 Ga0495597_0429615 3300046542 Bacteria 500
822 Ga0495645_0087057 3300046543 Bacteria 2235
823 Ga0495645_0104244 3300046543 Bacteria 2014
824 Ga0495622_0004127 3300046557 Bacteria 6774
825 Ga0495622_0065162 3300046557 Bacteria 1684
826 Ga0495622_0247580 3300046557 Bacteria 784
827 Ga0495633_0002747 3300046558 Bacteria 12167
828 Ga0495633_0007100 3300046558 Bacteria 6509
829 Ga0495667_0110914 3300046559 Bacteria 1772
830 Ga0495656_0009992 3300046615 Bacteria 3434
831 Ga0495656_0012801 3300046615 Bacteria 3105
832 Ga0495668_0000072 3300046616 Bacteria 167170
833 Ga0495668_0000392 3300046616 Bacteria 57835
834 Ga0495668_0001900 3300046616 Bacteria 18693
835 Ga0495668_0003172 3300046616 Bacteria 12644
836 Ga0495668_0007792 3300046616 Bacteria 6789
837 Ga0495668_0010923 3300046616 Bacteria 5468
838 Ga0495668_0013068 3300046616 Bacteria 4913
839 Ga0495668_0050035 3300046616 Bacteria 2317
840 Ga0495668_0310381 3300046616 Bacteria 865
841 Ga0495668_0329580 3300046616 Bacteria 837
842 Ga0495634_0333357 3300046642 Bacteria 911
843 Ga0495611_0000157 3300046648 Bacteria 48892
844 Ga0495611_0010918 3300046648 Bacteria 3847
845 Ga0495611_0302586 3300046648 Bacteria 737
846 Ga0495625_0003433 3300046660 Bacteria 15802
847 Ga0495625_0013337 3300046660 Bacteria 6607
848 Ga0495625_0020065 3300046660 Bacteria 5166
849 Ga0495625_0022295 3300046660 Bacteria 4859
850 Ga0495625_0030150 3300046660 Bacteria 4050
851 Ga0495625_0066928 3300046660 Bacteria 2529
852 Ga0495625_0074593 3300046660 Bacteria 2376
853 Ga0495625_0211301 3300046660 Bacteria 1275
854 Ga0495625_0318202 3300046660 Bacteria 991
855 Ga0495625_0427712 3300046660 Bacteria 822
856 Ga0495635_0062415 3300046663 Bacteria 2559
857 Ga0495661_0001268 3300046665 Bacteria 21721
858 Ga0495661_0004689 3300046665 Bacteria 9818
859 Ga0495661_0004823 3300046665 Bacteria 9669
860 Ga0495661_0013825 3300046665 Bacteria 5415
861 Ga0495661_0070545 3300046665 Bacteria 2044
862 Ga0495661_0073867 3300046665 Bacteria 1985
863 Ga0495661_0087097 3300046665 Bacteria 1786
864 Ga0495661_0131343 3300046665 Bacteria 1372
865 Ga0495661_0140771 3300046665 Bacteria 1312
866 Ga0495661_0176134 3300046665 Bacteria 1136
867 Ga0495661_0407979 3300046665 Bacteria 660
868 Ga0495661_0580908 3300046665 Bacteria 528
869 Ga0495588_0000125 3300046674 Bacteria 130469
870 Ga0495588_0012241 3300046674 Bacteria 4048
871 Ga0495588_0043710 3300046674 Bacteria 2293
872 Ga0495588_0144116 3300046674 Bacteria 1258
873 Ga0495657_0005091 3300046675 Bacteria 10441
874 Ga0495657_0026479 3300046675 Bacteria 4106
875 Ga0495599_0051503 3300046678 Bacteria 2579
876 Ga0495599_0078966 3300046678 Bacteria 2055
877 Ga0495623_0019288 3300046679 Bacteria 4408
878 Ga0495646_0027624 3300046680 Bacteria 3559
879 Ga0495646_0034737 3300046680 Bacteria 3130
880 Ga0495646_0198072 3300046680 Bacteria 1095
881 Ga0495658_0347691 3300046683 Bacteria 942
882 Ga0495658_0768571 3300046683 Bacteria 617
883 Ga0495669_0000221 3300046684 Bacteria 34153
884 Ga0495669_0000490 3300046684 Bacteria 18204
885 Ga0495669_0001365 3300046684 Bacteria 10068
886 Ga0495669_0002151 3300046684 Bacteria 8092
887 Ga0495669_0011625 3300046684 Bacteria 3741
888 Ga0495669_0019029 3300046684 Bacteria 2961
889 Ga0495669_0055884 3300046684 Bacteria 1778
890 Ga0495613_0211902 3300046689 Bacteria 1362
891 Ga0495670_0005238 3300046691 Bacteria 6381
892 Ga0495670_0016973 3300046691 Bacteria 3578
893 Ga0495670_0072728 3300046691 Bacteria 1742
894 Ga0495670_0429695 3300046691 Bacteria 715
895 Ga0495670_0616348 3300046691 Bacteria 591
896 Ga0495671_0000228 3300046692 Bacteria 48268
897 Ga0495671_0016932 3300046692 Bacteria 3885
898 Ga0495671_0023302 3300046692 Bacteria 3234
899 Ga0495671_0155733 3300046692 Bacteria 1112
900 Ga0495671_0319121 3300046692 Bacteria 746
901 Ga0495671_0389704 3300046692 Bacteria 667
902 Ga0495649_0000326 3300046694 Bacteria 41384
903 Ga0495649_0008578 3300046694 Bacteria 6138
904 Ga0495649_0037339 3300046694 Bacteria 2666
905 Ga0495649_0092739 3300046694 Bacteria 1608
906 Ga0495649_0126251 3300046694 Bacteria 1351
907 Ga0495649_0224310 3300046694 Bacteria 971
908 Ga0495649_0579531 3300046694 Bacteria 554
909 Ga0495589_0000171 3300046794 Bacteria 58991
910 Ga0495589_0034475 3300046794 Bacteria 2540
911 Ga0495589_0248457 3300046794 Bacteria 831
912 Ga0495600_0000885 3300046809 Bacteria 16025
913 Ga0495600_0003192 3300046809 Bacteria 9599
914 Ga0495600_0014790 3300046809 Bacteria 4922
915 Ga0495660_0000042 3300046810 Bacteria 167048
916 Ga0495660_0010226 3300046810 Bacteria 5455
917 Ga0495660_0025605 3300046810 Bacteria 3349
918 Ga0495660_0097575 3300046810 Bacteria 1517
919 Ga0495660_0137477 3300046810 Bacteria 1219
920 Ga0495581_0045609 3300047315 Bacteria 2534
921 Ga0495581_0751835 3300047315 Bacteria 561
922 Ga0495604_0001817 3300047317 Bacteria 17374
923 Ga0495636_0138916 3300047318 Bacteria 1084
924 Ga0495674_0083125 3300047319 Bacteria 2745
925 Ga0495674_0319964 3300047319 Bacteria 1264
926 Ga0495674_0557139 3300047319 Bacteria 912
927 Ga0495674_0656737 3300047319 Bacteria 826
928 Ga0495672_0000098 3300047320 Bacteria 141277
929 Ga0495672_0000272 3300047320 Bacteria 71551
930 Ga0495672_0002336 3300047320 Bacteria 17571
931 Ga0495672_0061653 3300047320 Bacteria 2161
932 Ga0495672_0124436 3300047320 Bacteria 1366
933 Ga0495676_0042637 3300047321 Bacteria 3722
934 Ga0495680_0058502 3300047322 Bacteria 2978
935 Ga0495683_0000247 3300047323 Bacteria 48691
936 Ga0495683_0004576 3300047323 Bacteria 7811
937 Ga0495683_0154368 3300047323 Bacteria 1066
938 Ga0495683_0184582 3300047323 Bacteria 950
939 Ga0495683_0201845 3300047323 Bacteria 896
940 Ga0495687_000205 3300047443 Bacteria 84650
941 Ga0495687_000361 3300047443 Bacteria 56861
942 Ga0495687_001653 3300047443 Bacteria 20049
943 Ga0495687_024634 3300047443 Bacteria 2857
944 Ga0495687_030944 3300047443 Bacteria 2461
945 Ga0495687_044228 3300047443 Bacteria 1937
946 Ga0495675_0010677 3300047444 Bacteria 5744
947 Ga0495677_0000268 3300047445 Bacteria 22890
948 Ga0495677_0000736 3300047445 Bacteria 13209
949 Ga0495677_0001492 3300047445 Bacteria 9409
950 Ga0495677_0002652 3300047445 Bacteria 6992
951 Ga0495677_0025976 3300047445 Bacteria 2124
952 Ga0495677_0091742 3300047445 Bacteria 1145
953 Ga0495679_000520 3300047446 Bacteria 27232
954 Ga0495679_007855 3300047446 Bacteria 4397
955 Ga0495685_012776 3300047447 Bacteria 2844
956 Ga0495685_030246 3300047447 Bacteria 1862
957 Ga0495685_054939 3300047447 Bacteria 1347
958 Ga0495685_058342 3300047447 Bacteria 1303
959 Ga0495673_0001726 3300047469 Bacteria 16686
960 Ga0495673_0022834 3300047469 Bacteria 3058
961 Ga0495673_0081414 3300047469 Bacteria 1341
962 Ga0495673_0088619 3300047469 Bacteria 1268
963 Ga0495681_0016978 3300047470 Bacteria 4059
964 Ga0495681_0093492 3300047470 Bacteria 1324
965 Ga0495681_0138575 3300047470 Bacteria 1030
966 Ga0495681_0210887 3300047470 Bacteria 783
967 Ga0495684_0395627 3300047471 Bacteria 971
968 Ga0495686_0000132 3300047472 Bacteria 151609
969 Ga0495686_0000813 3300047472 Bacteria 40397
970 Ga0495686_0005217 3300047472 Bacteria 10331
971 Ga0495686_0017253 3300047472 Bacteria 4867
972 Ga0495686_0018349 3300047472 Bacteria 4697
973 Ga0495686_0029191 3300047472 Bacteria 3589
974 Ga0495686_0067170 3300047472 Bacteria 2214
975 Ga0495686_0086263 3300047472 Bacteria 1911
976 Ga0495686_0106683 3300047472 Bacteria 1684
977 Ga0495686_0171062 3300047472 Bacteria 1263
978 Ga0495686_0274608 3300047472 Bacteria 939
979 Ga0495686_0297197 3300047472 Bacteria 892
980 Ga0495686_0328384 3300047472 Bacteria 837
981 Ga0495593_0049657 3300047673 Bacteria 2225
982 Ga0495602_0102240 3300048088 Bacteria 2349
983 Ga0495602_0219034 3300048088 Bacteria 1438
984 Ga0495602_0326137 3300048088 Bacteria 1115
985 Ga0495614_0090231 3300048089 Bacteria 1333
986 Ga0495626_0000022 3300048091 Bacteria 216166
987 Ga0495626_0002730 3300048091 Bacteria 11895
988 Ga0495626_0003299 3300048091 Bacteria 10424
989 Ga0495626_0004535 3300048091 Bacteria 8489
990 Ga0495626_0019805 3300048091 Bacteria 3359
991 Ga0495626_0061603 3300048091 Bacteria 1705
992 Ga0496100_0026254 3300048903 Bacteria 3569
993 Ga0496100_0122606 3300048903 Bacteria 1820
994 Ga0496100_0151663 3300048903 Bacteria 1654
995 Ga0496100_0355408 3300048903 Bacteria 1107
996 Ga0496100_1471670 3300048903 Bacteria 538
997 Ga0496101_0002682 3300048904 Bacteria 10928
998 Ga0496101_0025630 3300048904 Bacteria 4092
999 Ga0496101_0190014 3300048904 Bacteria 1584
1000 Ga0496101_0290365 3300048904 Bacteria 1279
1001 Ga0496101_0374293 3300048904 Bacteria 1120
1002 Ga0496102_0000407 3300048905 Bacteria 49858
1003 Ga0496102_0025490 3300048905 Bacteria 5265
1004 Ga0496102_0027530 3300048905 Bacteria 5076
1005 Ga0496102_0050758 3300048905 Bacteria 3778
1006 Ga0496102_0069299 3300048905 Bacteria 3238
1007 Ga0496102_0314607 3300048905 Bacteria 1475
1008 Ga0496102_0573436 3300048905 Bacteria 1051
1009 Ga0496102_0778109 3300048905 Bacteria 880
1010 Ga0496103_0010260 3300048906 Bacteria 5538
1011 Ga0496103_0122708 3300048906 Bacteria 1656
1012 Ga0496103_0179539 3300048906 Bacteria 1360
1013 Ga0496104_0002743 3300048907 Bacteria 15154
1014 Ga0496104_0008613 3300048907 Bacteria 9072
1015 Ga0496104_0096651 3300048907 Bacteria 2826
1016 Ga0496104_0318332 3300048907 Bacteria 1469
1017 Ga0496104_0453273 3300048907 Bacteria 1194
1018 Ga0496105_0022571 3300048908 Bacteria 5098
1019 Ga0496105_0077738 3300048908 Bacteria 2740
1020 Ga0496105_0187087 3300048908 Bacteria 1694
1021 Ga0496106_0002352 3300048909 Bacteria 14089
1022 Ga0496106_0039279 3300048909 Bacteria 3544
1023 Ga0496106_0191726 3300048909 Bacteria 1625
1024 Ga0496106_0662479 3300048909 Bacteria 833
1025 Ga0496107_0031053 3300048910 Bacteria 3810
1026 Ga0496107_0263175 3300048910 Bacteria 1283
1027 Ga0496107_0274950 3300048910 Bacteria 1253
1028 Ga0496107_0629798 3300048910 Bacteria 791
1029 Ga0496108_0025878 3300048911 Bacteria 4839
1030 Ga0496108_0135187 3300048911 Bacteria 2121
1031 Ga0496109_0011263 3300048912 Bacteria 7680
1032 Ga0496109_0067539 3300048912 Bacteria 3276
1033 Ga0496109_0162114 3300048912 Bacteria 2095
1034 Ga0496109_0324926 3300048912 Bacteria 1452
1035 Ga0496109_0379043 3300048912 Bacteria 1336
1036 Ga0496109_0451659 3300048912 Bacteria 1214
1037 Ga0496109_0591668 3300048912 Bacteria 1045
1038 Ga0496109_0618826 3300048912 Bacteria 1019
1039 Ga0496110_0013088 3300048913 Bacteria 6848
1040 Ga0496110_0408097 3300048913 Bacteria 1238
1041 Ga0496110_0621877 3300048913 Bacteria 979
1042 Ga0496110_1234785 3300048913 Bacteria 656
1043 Ga0496110_1658599 3300048913 Bacteria 549
1044 Ga0496111_0038573 3300048914 Bacteria 3424
1045 Ga0496111_0107697 3300048914 Bacteria 2052
1046 Ga0496111_0181316 3300048914 Bacteria 1565
1047 Ga0496111_0922865 3300048914 Bacteria 628
1048 Ga0496112_0043463 3300048915 Bacteria 4399
1049 Ga0496112_0205362 3300048915 Bacteria 1928
1050 Ga0496112_1797911 3300048915 Bacteria 525
1051 Ga0496113_0012758 3300048916 Bacteria 5660
1052 Ga0496113_0037873 3300048916 Bacteria 3542
1053 Ga0496113_0168967 3300048916 Bacteria 1731
1054 Ga0496113_0173635 3300048916 Bacteria 1707
1055 Ga0496113_0288695 3300048916 Bacteria 1312
1056 Ga0496114_0577767 3300048917 Bacteria 992
1057 Ga0496114_0760769 3300048917 Bacteria 846
1058 Ga0496115_0101186 3300048918 Bacteria 2363
1059 Ga0496115_0143360 3300048918 Bacteria 1971
1060 Ga0496115_0453185 3300048918 Bacteria 1036
1061 Ga0496116_0312804 3300048919 Bacteria 740
1062 Ga0496117_0124979 3300048920 Bacteria 1572
1063 Ga0496118_0055513 3300048921 Bacteria 2988
1064 Ga0496118_0074666 3300048921 Bacteria 2422
1065 Ga0496118_0188510 3300048921 Bacteria 1236
1066 Ga0496119_0032207 3300048922 Bacteria 3498
1067 Ga0496119_0051790 3300048922 Bacteria 2519
1068 Ga0496119_0141311 3300048922 Bacteria 1300
1069 Ga0496120_0059208 3300048923 Bacteria 2147
1070 Ga0496120_0094446 3300048923 Bacteria 1592
1071 Ga0496120_0314536 3300048923 Bacteria 713
1072 Ga0496121_0018815 3300048924 Bacteria 6938
1073 Ga0496121_0058967 3300048924 Bacteria 3168
1074 Ga0496121_0165932 3300048924 Bacteria 1609
1075 Ga0496121_0338889 3300048924 Bacteria 1006
1076 Ga0496121_0623274 3300048924 Bacteria 662
1077 Ga0496121_0653958 3300048924 Bacteria 640
1078 Ga0496122_0000210 3300048925 Bacteria 130178
1079 Ga0496122_0025373 3300048925 Bacteria 5148
1080 Ga0496122_0112042 3300048925 Bacteria 1788
1081 Ga0496122_0204233 3300048925 Bacteria 1152
1082 Ga0496122_0237101 3300048925 Bacteria 1032
1083 Ga0496122_0351692 3300048925 Bacteria 769
1084 Ga0496123_0000597 3300048926 Bacteria 61302
1085 Ga0496123_0021134 3300048926 Bacteria 5067
1086 Ga0496123_0163662 3300048926 Bacteria 1183
1087 Ga0496123_0165903 3300048926 Bacteria 1171
1088 Ga0496124_0033985 3300048927 Bacteria 4481
1089 Ga0496124_0062397 3300048927 Bacteria 3119
1090 Ga0496124_0092841 3300048927 Bacteria 2458
1091 Ga0496124_0290186 3300048927 Bacteria 1188
1092 Ga0496124_0298430 3300048927 Bacteria 1165
1093 Ga0496124_0314543 3300048927 Bacteria 1124
1094 Ga0496124_0323878 3300048927 Bacteria 1102
1095 Ga0496124_0377707 3300048927 Bacteria 992
1096 Ga0496125_0000789 3300048928 Bacteria 51669
1097 Ga0496125_0019149 3300048928 Bacteria 6470
1098 Ga0496125_0102908 3300048928 Bacteria 2097
1099 Ga0496125_0186359 3300048928 Bacteria 1376
1100 Ga0496125_0196528 3300048928 Bacteria 1326
1101 Ga0496125_0251575 3300048928 Bacteria 1114
1102 Ga0496126_0007753 3300048929 Bacteria 11705
1103 Ga0496126_0040413 3300048929 Bacteria 4323
1104 Ga0496126_0244404 3300048929 Bacteria 1498
1105 Ga0496126_0291332 3300048929 Bacteria 1350
1106 Ga0501308_010491 3300049128 Bacteria 1030
1107 Ga0495678_000153 3300049459 Bacteria 83461
1108 Ga0495678_000284 3300049459 Bacteria 55655
1109 Ga0495678_000358 3300049459 Bacteria 46919
1110 Ga0495678_020907 3300049459 Bacteria 2889
1111 Ga0495682_0002286 3300049460 Bacteria 9162
1112 Ga0495682_0007451 3300049460 Bacteria 4350
1113 Ga0495682_0027231 3300049460 Bacteria 2120
1114 Ga0495682_0034320 3300049460 Bacteria 1871
1115 Ga0495682_0037678 3300049460 Bacteria 1778
1116 Ga0495682_0078332 3300049460 Bacteria 1189
1117 Ga0501033_0237742 3300049570 Bacteria 1293
1118 Ga0501033_0469840 3300049570 Bacteria 872
1119 Ga0501034_0079515 3300049571 Bacteria 3282
1120 Ga0501034_0154474 3300049571 Bacteria 2269
1121 Ga0501034_0184132 3300049571 Bacteria 2052
1122 Ga0501034_0935133 3300049571 Bacteria 753
1123 Ga0501036_0380039 3300049572 Bacteria 1179
1124 Ga0501036_0847803 3300049572 Bacteria 751
1125 Ga0501037_0389711 3300049573 Bacteria 957
1126 Ga0501038_0027401 3300049574 Bacteria 5069
1127 Ga0501038_0478992 3300049574 Bacteria 954
1128 Ga0501039_0061947 3300049575 Bacteria 2898
1129 Ga0501039_1332598 3300049575 Bacteria 553
1130 Ga0501042_0151004 3300049578 Bacteria 1675
1131 Ga0501042_0514848 3300049578 Bacteria 869
1132 Ga0501043_0008172 3300049579 Bacteria 8255
1133 Ga0501046_0104064 3300049580 Bacteria 2176
1134 Ga0501046_0462350 3300049580 Bacteria 912
1135 Ga0501047_0067057 3300049581 Bacteria 3459
1136 Ga0501047_0114526 3300049581 Bacteria 2578
1137 Ga0501048_0354026 3300049582 Bacteria 1047
1138 Ga0501068_0068490 3300049584 Bacteria 2163
1139 Ga0501069_0472408 3300049585 Bacteria 747
1140 Ga0501070_0045404 3300049586 Bacteria 3654
1141 Ga0501070_0889873 3300049586 Bacteria 695
1142 Ga0501071_0715559 3300049587 Bacteria 771
1143 Ga0501072_0081516 3300049588 Bacteria 2565
1144 Ga0501073_0081735 3300049589 Bacteria 2247
1145 Ga0501073_0169957 3300049589 Bacteria 1509
1146 Ga0501073_0744518 3300049589 Unclassified 676
1147 Ga0501075_0610941 3300049591 Bacteria 832
1148 Ga0501076_0398015 3300049592 Bacteria 1132
1149 Ga0501080_0000625 3300049742 Bacteria 28031
1150 Ga0501080_0476877 3300049742 Bacteria 1116
1151 Ga0501080_0830273 3300049742 Bacteria 809
1152 Ga0501083_0046501 3300049744 Bacteria 2934
1153 Ga0501083_0327202 3300049744 Bacteria 997
1154 Ga0501035_0023706 3300049822 Bacteria 5630
1155 Ga0501035_0048282 3300049822 Bacteria 3818
1156 Ga0501035_0175459 3300049822 Bacteria 1849
1157 Ga0501035_0179323 3300049822 Bacteria 1826
1158 Ga0501044_0042648 3300049823 Bacteria 4718
1159 nmdc:mga03683_83226_c1 3300050489 Bacteria 1385
1160 nmdc:mga03n38_160543_c1 3300050490 Bacteria 1138
1161 nmdc:mga03n38_187270_c1 3300050490 Bacteria 1064
1162 nmdc:mga03n38_208976_c1 3300050490 Bacteria 1014
1163 nmdc:mga03n38_945662_c1 3300050490 Bacteria 508
1164 nmdc:mga00v17_6086_c1 3300050491 Bacteria 6385
1165 nmdc:mga00v17_979282_c1 3300050491 Bacteria 533
1166 nmdc:mga0yw44_11432_c1 3300050492 Bacteria 4582
1167 nmdc:mga0yw44_200492_c1 3300050492 Bacteria 1318
1168 nmdc:mga0yw44_617656_c1 3300050492 Bacteria 737
1169 nmdc:mga0yw44_7441_c1 3300050492 Bacteria 3204
1170 nmdc:mga0k408_11559_c1 3300050493 Bacteria 4810
1171 nmdc:mga0k408_168599_c1 3300050493 Bacteria 1305
1172 nmdc:mga0k408_472357_c1 3300050493 Bacteria 744
1173 nmdc:mga06z11_16882_c1 3300050494 Bacteria 3300
1174 nmdc:mga06z11_554987_c1 3300050494 Bacteria 698
1175 nmdc:mga04h51_76342_c1 3300050495 Bacteria 1181
1176 nmdc:mga07m45_27107_c1 3300050496 Bacteria 3154
1177 nmdc:mga07m45_283286_c1 3300050496 Bacteria 964
1178 nmdc:mga07m45_396056_c1 3300050496 Bacteria 801
1179 nmdc:mga07m45_850398_c1 3300050496 Bacteria 522
1180 nmdc:mga07m45_93689_c1 3300050496 Bacteria 1722
1181 nmdc:mga05p37_162409_c1 3300050507 Bacteria 2728
1182 nmdc:mga05p37_241970_c1 3300050507 Bacteria 2169
1183 nmdc:mga05p37_288334_c1 3300050507 Bacteria 1955
1184 nmdc:mga05p37_316594_c1 3300050507 Bacteria 1848
1185 nmdc:mga0qj67_114234_c1 3300050509 Bacteria 2181
1186 nmdc:mga08y16_46869_c1 3300050511 Bacteria 4525
1187 nmdc:mga08y16_585730_c1 3300050511 Bacteria 1126
1188 nmdc:mga08y16_811477_c1 3300050511 Bacteria 928
1189 nmdc:mga08y16_924162_c1 3300050511 Bacteria 857
1190 nmdc:mga0n895_1804916_c1 3300050512 Bacteria 572
1191 nmdc:mga0n895_24920_c1 3300050512 Bacteria 5645
1192 nmdc:mga0a205_100641_c1 3300050515 Bacteria 2789
1193 nmdc:mga0a205_221135_c1 3300050515 Bacteria 1779
1194 nmdc:mga0a205_53341_c1 3300050515 Bacteria 3902
1195 nmdc:mga0sz30_27450_c1 3300050516 Bacteria 2338
1196 Ga0495601_0156943 3300053077 Bacteria 1486
1197 Ga0495601_0665139 3300053077 Bacteria 666
1198 Ga0495601_0674246 3300053077 Bacteria 661
1199 Ga0495612_0047541 3300053078 Bacteria 1758
1200 Ga0500610_0000051 3300053079 Bacteria 36873
1201 Ga0500610_0045062 3300053079 Bacteria 2289
1202 Ga0500610_0324268 3300053079 Bacteria 666
1203 Ga0495655_0036083 3300053083 Bacteria 1234
1204 Ga0495655_0200644 3300053083 Bacteria 652
1205 Ga0495595_0329835 3300053084 Bacteria 769
1206 Ga0495619_0297881 3300053085 Bacteria 1117
1207 Ga0500578_0316687 3300053086 Bacteria 921
1208 Ga0500578_0492995 3300053086 Bacteria 690
1209 Ga0500578_0612008 3300053086 Bacteria 597
1210 Ga0500643_073247 3300053087 Bacteria 948
1211 Ga0500644_0000494 3300053088 Bacteria 17156
1212 Ga0500583_0057412 3300053092 Bacteria 1828
1213 Ga0500566_0001729 3300053094 Bacteria 12815
1214 Ga0500641_0044055 3300053096 Bacteria 1813
1215 Ga0500650_0154485 3300053098 Bacteria 1060
1216 Ga0500556_0003827 3300053104 Bacteria 4365
1217 Ga0500556_0008528 3300053104 Bacteria 2961
1218 Ga0500556_0021993 3300053104 Bacteria 2065
1219 Ga0500556_0299162 3300053104 Bacteria 629
1220 Ga0500557_000103 3300053105 Bacteria 25870
1221 Ga0500562_000898 3300053108 Bacteria 7232
1222 Ga0500562_083454 3300053108 Bacteria 865
1223 Ga0500569_129120 3300053109 Bacteria 845
1224 Ga0500594_0000454 3300053118 Bacteria 9051
1225 Ga0500595_000166 3300053119 Bacteria 43537
1226 Ga0500595_013390 3300053119 Bacteria 3143
1227 Ga0500597_100338 3300053120 Bacteria 1259
1228 Ga0500608_000656 3300053122 Bacteria 12731
1229 Ga0500621_134660 3300053126 Bacteria 944
1230 Ga0500642_0000158 3300053130 Bacteria 28034
1231 Ga0500642_0004110 3300053130 Bacteria 4500
1232 Ga0500642_0062098 3300053130 Bacteria 1680
1233 Ga0500658_0027919 3300053134 Bacteria 2186
1234 Ga0500658_0219776 3300053134 Bacteria 871
1235 Ga0500564_000194 3300053138 Bacteria 16401
1236 Ga0500577_0011382 3300053142 Bacteria 2652
1237 Ga0500604_0031803 3300053151 Bacteria 1551
1238 Ga0500604_0105388 3300053151 Bacteria 932
1239 Ga0500616_0005519 3300053153 Bacteria 8568
1240 Ga0500616_0150291 3300053153 Bacteria 1079
1241 Ga0500619_160311 3300053154 Bacteria 764
1242 Ga0500620_015385 3300053155 Bacteria 2163
1243 Ga0500622_0000735 3300053156 Bacteria 28572
1244 Ga0500622_0141289 3300053156 Bacteria 1147
1245 Ga0500627_0070824 3300053158 Bacteria 1544
1246 Ga0500627_0210435 3300053158 Bacteria 870
1247 Ga0500633_0031677 3300053160 Bacteria 1711
1248 Ga0500638_298233 3300053162 Bacteria 623
1249 Ga0500636_0000948 3300053177 Bacteria 15635
1250 Ga0500636_0234836 3300053177 Bacteria 946
1251 Ga0500611_033299 3300053727 Bacteria 1083
1252 Ga0500625_007215 3300053729 Bacteria 4810
1253 Ga0500645_002001 3300053730 Bacteria 9564
1254 Ga0500645_015053 3300053730 Bacteria 2457
1255 Ga0500609_008489 3300053731 Bacteria 1386
1256 Ga0500596_001610 3300053735 Bacteria 4580
1257 Ga0500601_007608 3300053737 Bacteria 1202
1258 Ga0501084_0574268 3300054114 Bacteria 953
1259 Ga0500661_006131 3300055283 Bacteria 2242
1260 Ga0500661_032570 3300055283 Bacteria 920
1261 Ga0587083_0093604 3300059505 Bacteria 737
1262 Ga0587068_108823 3300059641 Bacteria 590
1263 Ga0587072_152062 3300059643 Bacteria 559
1264 Ga0501082_0017632 3300060353 Bacteria 6150
1265 Ga0501082_0151000 3300060353 Bacteria 2018
1266 Ga0501082_0433037 3300060353 Bacteria 1149
1267 Ga0501082_0668290 3300060353 Bacteria 909
1268 Ga0501082_0768186 3300060353 Bacteria 843
1269 Ga0466962_0007922 3300061719 Bacteria 5095
1270 Ga0466962_0134580 3300061719 Bacteria 1196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100960234 Ga0070682_1009602342 120
2 3300005344 Ga0070661_101071932 Ga0070661_1010719321 120
3 3300005455 Ga0070663_100236397 Ga0070663_1002363971 120
4 3300005548 Ga0070665_101728303 Ga0070665_1017283032 120
5 3300026067 Ga0207678_10038931 Ga0207678_100389315 120
6 3300026121 Ga0207683_10127155 Ga0207683_101271553 120
7 3300028379 Ga0268266_11535231 Ga0268266_115352311 120
8 3300049571 Ga0501034_0935133 Ga0501034_0935133_360_737 120
9 3300048910 Ga0496107_0629798 Ga0496107_0629798_10_408 121
10 3300046680 Ga0495646_0198072 Ga0495646_0198072_12_383 123
11 3300047472 Ga0495686_0328384 Ga0495686_0328384_419_814 124
12 3300046542 Ga0495597_0429615 Ga0495597_0429615_92_469 125
13 3300053142 Ga0500577_0011382 Ga0500577_0011382_2211_2609 125
14 3300038443 Ga0395901_1624262 Ga0395901_1624262_176_577 126
15 3300044694 Ga0466963_0085767 Ga0466963_0085767_1720_2121 126
16 3300044842 Ga0466957_0057877 Ga0466957_0057877_1080_1481 126
17 3300045976 Ga0466967_0084535 Ga0466967_0084535_2331_2732 126
18 3300046474 Ga0495605_0346039 Ga0495605_0346039_23_424 126
19 3300046477 Ga0495664_0681205 Ga0495664_0681205_19_420 126
20 3300046694 Ga0495649_0579531 Ga0495649_0579531_22_402 126
21 3300053130 Ga0500642_0004110 Ga0500642_0004110_19_399 126
22 3300061719 Ga0466962_0134580 Ga0466962_0134580_71_472 126
23 3300014968 Ga0157379_10726321 Ga0157379_107263212 127
24 iso_pu_bacteria 8019586578 8019597477 127
25 3300005457 Ga0070662_101540312 Ga0070662_1015403121 128
26 3300013307 Ga0157372_11951914 Ga0157372_119519141 128
27 3300025294 Ga0209025_1076221 Ga0209025_10762213 128
28 3300025933 Ga0207706_11723743 Ga0207706_117237432 128
29 iso_pu_bacteria 2517093001 2517100742 128
30 iso_pu_bacteria 2847930680 2847938711 128
31 iso_pu_bacteria 2879083081 2879088314 128
32 iso_pu_bacteria 2906643746 2906644914 128
33 3300046519 Ga0495632_0141096 Ga0495632_0141096_14_424 129
34 3300053130 Ga0500642_0000158 Ga0500642_0000158_22971_23402 129
35 3300005339 Ga0070660_100408115 Ga0070660_1004081152 130
36 3300041404 Ga0439436_0076317 Ga0439436_0076317_27_458 130
37 3300053098 Ga0500650_0154485 Ga0500650_0154485_168_560 130
38 3300053104 Ga0500556_0003827 Ga0500556_0003827_1810_2202 130
39 3300053108 Ga0500562_000898 Ga0500562_000898_5510_5902 130
40 3300053153 Ga0500616_0150291 Ga0500616_0150291_115_507 130
41 3300053730 Ga0500645_002001 Ga0500645_002001_417_809 130
42 iso_pu_bacteria 2513237104 2513718652 130
43 iso_pu_bacteria 2767802442 2770194824 130
44 iso_pu_bacteria 2924762789 2924764347 130
45 iso_pu_bacteria 2937822353 2937828468 130
46 iso_pu_bacteria 2987666974 2987672807 130
47 iso_pu_bacteria 8006926726 8006932677 130
48 3300009093 Ga0105240_12083881 Ga0105240_120838811 131
49 3300046452 Ga0495617_000008 Ga0495617_000008_211841_212242 131
50 3300046453 Ga0495627_000191 Ga0495627_000191_5490_5891 131
51 3300046455 Ga0495603_0076135 Ga0495603_0076135_1190_1591 131
52 3300046474 Ga0495605_0000559 Ga0495605_0000559_13780_14181 131
53 3300046474 Ga0495605_0273266 Ga0495605_0273266_293_694 131
54 3300046492 Ga0495585_0015903 Ga0495585_0015903_2365_2766 131
55 3300046492 Ga0495585_0098895 Ga0495585_0098895_757_1158 131
56 3300046499 Ga0495594_0006022 Ga0495594_0006022_71_472 131
57 3300046500 Ga0495596_0023788 Ga0495596_0023788_627_1028 131
58 3300046501 Ga0495607_0004696 Ga0495607_0004696_3948_4349 131
59 3300046513 Ga0495616_0000395 Ga0495616_0000395_22052_22453 131
60 3300046513 Ga0495616_0006834 Ga0495616_0006834_2000_2401 131
61 3300046518 Ga0495631_0009488 Ga0495631_0009488_4076_4477 131
62 3300046519 Ga0495632_0000155 Ga0495632_0000155_10590_10991 131
63 3300046523 Ga0495644_0006276 Ga0495644_0006276_499_900 131
64 3300046524 Ga0495648_0001050 Ga0495648_0001050_5544_5945 131
65 3300046528 Ga0495642_0000617 Ga0495642_0000617_15017_15418 131
66 3300046528 Ga0495642_0001753 Ga0495642_0001753_6669_7070 131
67 3300046530 Ga0495654_0005485 Ga0495654_0005485_340_741 131
68 3300046530 Ga0495654_0026683 Ga0495654_0026683_378_779 131
69 3300046535 Ga0495586_0321697 Ga0495586_0321697_302_703 131
70 3300046615 Ga0495656_0012801 Ga0495656_0012801_1723_2124 131
71 3300046616 Ga0495668_0001900 Ga0495668_0001900_5666_6067 131
72 3300046660 Ga0495625_0013337 Ga0495625_0013337_2576_3001 131
73 3300046665 Ga0495661_0004823 Ga0495661_0004823_3365_3766 131
74 3300046674 Ga0495588_0144116 Ga0495588_0144116_99_500 131
75 3300046684 Ga0495669_0000490 Ga0495669_0000490_12883_13284 131
76 3300046684 Ga0495669_0002151 Ga0495669_0002151_2804_3205 131
77 3300046692 Ga0495671_0000228 Ga0495671_0000228_13941_14342 131
78 3300046794 Ga0495589_0248457 Ga0495589_0248457_324_725 131
79 3300047315 Ga0495581_0751835 Ga0495581_0751835_75_476 131
80 3300047445 Ga0495677_0001492 Ga0495677_0001492_3275_3676 131
81 3300047470 Ga0495681_0016978 Ga0495681_0016978_349_774 131
82 3300047472 Ga0495686_0017253 Ga0495686_0017253_1151_1552 131
83 3300048907 Ga0496104_0453273 Ga0496104_0453273_632_1048 131
84 iso_pu_bacteria 2508501128 2509150879 131
85 iso_pu_bacteria 2513237092 2513623619 131
86 iso_pu_bacteria 2617270741 2617373292 131
87 iso_pu_bacteria 2824679649 2824680928 131
88 iso_pu_bacteria 2824732956 2824734732 131
89 iso_pu_bacteria 2824746037 2824747695 131
90 iso_pu_bacteria 2874612657 2874619708 131
91 iso_pu_bacteria 2881665667 2881667488 131
92 iso_pu_bacteria 2908775508 2908781750 131
93 iso_pu_bacteria 2922393267 2922401154 131
94 iso_pu_bacteria 3005483717 3005487507 131
95 3300005548 Ga0070665_100415465 Ga0070665_1004154654 132
96 3300006944 Ga0099823_1022671 Ga0099823_10226714 132
97 3300013297 Ga0157378_12104533 Ga0157378_121045332 132
98 3300025292 Ga0209676_1019122 Ga0209676_10191223 132
99 3300027296 Ga0209389_1000057 Ga0209389_100005741 132
100 3300027361 Ga0209489_100226 Ga0209489_10022630 132
101 3300027363 Ga0209700_100085 Ga0209700_10008558 132
102 3300028379 Ga0268266_10338754 Ga0268266_103387542 132
103 3300035695 Ga0373927_0185409 Ga0373927_0185409_361_780 132
104 3300044658 Ga0466972_0016778 Ga0466972_0016778_899_1318 132
105 3300044735 Ga0466968_0107151 Ga0466968_0107151_421_840 132
106 3300045049 Ga0466959_0643498 Ga0466959_0643498_137_559 132
107 3300047472 Ga0495686_0000132 Ga0495686_0000132_13890_14288 132
108 3300048923 Ga0496120_0094446 Ga0496120_0094446_102_521 132
109 3300053092 Ga0500583_0057412 Ga0500583_0057412_452_871 132
110 3300053134 Ga0500658_0219776 Ga0500658_0219776_70_495 132
111 3300060353 Ga0501082_0433037 Ga0501082_0433037_412_831 132
112 iso_pu_bacteria 2503198000 2503201118 132
113 iso_pu_bacteria 2507262055 2507511171 132
114 iso_pu_bacteria 2508501009 2508544980 132
115 iso_pu_bacteria 2508501042 2508693716 132
116 iso_pu_bacteria 2508501114 2509076167 132
117 iso_pu_bacteria 2509276022 2509395881 132
118 iso_pu_bacteria 2510917020 2511123448 132
119 iso_pu_bacteria 2511231028 2511396508 132
120 iso_pu_bacteria 2512875016 2512931992 132
121 iso_pu_bacteria 2513237094 2513637320 132
122 iso_pu_bacteria 2513237095 2513650880 132
123 iso_pu_bacteria 2513237098 2513676073 132
124 iso_pu_bacteria 2513237102 2513700469 132
125 iso_pu_bacteria 2513237139 2513874793 132
126 iso_pu_bacteria 2513237161 2514010489 132
127 iso_pu_bacteria 2515154112 2515625263 132
128 iso_pu_bacteria 2524023205 2524438045 132
129 iso_pu_bacteria 2528768022 2528849148 132
130 iso_pu_bacteria 2588253730 2588517867 132
131 iso_pu_bacteria 2617270735 2617353567 132
132 iso_pu_bacteria 2643221545 2643748272 132
133 iso_pu_bacteria 2643221552 2643779085 132
134 iso_pu_bacteria 2643221574 2643884758 132
135 iso_pu_bacteria 2643221583 2643925050 132
136 iso_pu_bacteria 2643221584 2643927652 132
137 iso_pu_bacteria 2643221598 2644001549 132
138 iso_pu_bacteria 2643221691 2644508017 132
139 iso_pu_bacteria 2643221699 2644551070 132
140 iso_pu_bacteria 2744054633 2745080998 132
141 iso_pu_bacteria 2775506902 2776272394 132
142 iso_pu_bacteria 2775506904 2776284334 132
143 iso_pu_bacteria 2791355196 2793061891 132
144 iso_pu_bacteria 2791355197 2793073086 132
145 iso_pu_bacteria 2802429603 2805916794 132
146 iso_pu_bacteria 2816332527 2818238306 132
147 iso_pu_bacteria 2824600985 2824603981 132
148 iso_pu_bacteria 2824609381 2824611562 132
149 iso_pu_bacteria 2824617872 2824622474 132
150 iso_pu_bacteria 2824626560 2824630346 132
151 iso_pu_bacteria 2824635225 2824638326 132
152 iso_pu_bacteria 2824644064 2824645940 132
153 iso_pu_bacteria 2824653114 2824655414 132
154 iso_pu_bacteria 2824661429 2824663280 132
155 iso_pu_bacteria 2824671348 2824673554 132
156 iso_pu_bacteria 2824687955 2824690323 132
157 iso_pu_bacteria 2824696289 2824701267 132
158 iso_pu_bacteria 2824704595 2824707091 132
159 iso_pu_bacteria 2824714736 2824716061 132
160 iso_pu_bacteria 2824723954 2824725917 132
161 iso_pu_bacteria 2824753945 2824754593 132
162 iso_pu_bacteria 2824763712 2824765361 132
163 iso_pu_bacteria 2824773399 2824773460 132
164 iso_pu_bacteria 2838122688 2838128040 132
165 iso_pu_bacteria 2841941048 2841943337 132
166 iso_pu_bacteria 2841949485 2841953934 132
167 iso_pu_bacteria 2841966195 2841968027 132
168 iso_pu_bacteria 2841974524 2841981281 132
169 iso_pu_bacteria 2841983080 2841988136 132
170 iso_pu_bacteria 2842711865 2842713470 132
171 iso_pu_bacteria 2844315083 2844316761 132
172 iso_pu_bacteria 2847939898 2847944091 132
173 iso_pu_bacteria 2849076700 2849081684 132
174 iso_pu_bacteria 2856320880 2856326910 132
175 iso_pu_bacteria 2857509624 2857512336 132
176 iso_pu_bacteria 2874590934 2874597905 132
177 iso_pu_bacteria 2874620515 2874626184 132
178 iso_pu_bacteria 2874645413 2874651433 132
179 iso_pu_bacteria 2876363079 2876368981 132
180 iso_pu_bacteria 2876771140 2876776505 132
181 iso_pu_bacteria 2876818435 2876824905 132
182 iso_pu_bacteria 2878738818 2878739032 132
183 iso_pu_bacteria 2879074833 2879081632 132
184 iso_pu_bacteria 2879127579 2879134193 132
185 iso_pu_bacteria 2879142872 2879147853 132
186 iso_pu_bacteria 2881364244 2881365938 132
187 iso_pu_bacteria 2885366525 2885366788 132
188 iso_pu_bacteria 2885374607 2885375024 132
189 iso_pu_bacteria 2885409591 2885415878 132
190 iso_pu_bacteria 2888337043 2888338978 132
191 iso_pu_bacteria 2888378607 2888381370 132
192 iso_pu_bacteria 2888388044 2888389268 132
193 iso_pu_bacteria 2888419890 2888421790 132
194 iso_pu_bacteria 2903448605 2903450796 132
195 iso_pu_bacteria 2903521522 2903527979 132
196 iso_pu_bacteria 2903528002 2903529709 132
197 iso_pu_bacteria 2903727486 2903733816 132
198 iso_pu_bacteria 2903748898 2903756942 132
199 iso_pu_bacteria 2903768456 2903772444 132
200 iso_pu_bacteria 2904666416 2904669202 132
201 iso_pu_bacteria 2904699407 2904705214 132
202 iso_pu_bacteria 2904711408 2904719398 132
203 iso_pu_bacteria 2906602504 2906606753 132
204 iso_pu_bacteria 2906626472 2906627479 132
205 iso_pu_bacteria 2908739725 2908744432 132
206 iso_pu_bacteria 2922368715 2922371017 132
207 iso_pu_bacteria 2924718760 2924719753 132
208 iso_pu_bacteria 2924776078 2924776394 132
209 iso_pu_bacteria 2929615660 2929619415 132
210 iso_pu_bacteria 2929624759 2929628115 132
211 iso_pu_bacteria 2932784394 2932785714 132
212 iso_pu_bacteria 2932794094 2932799058 132
213 iso_pu_bacteria 2932801729 2932808526 132
214 iso_pu_bacteria 2932828146 2932830778 132
215 iso_pu_bacteria 2933577622 2933581335 132
216 iso_pu_bacteria 2935608549 2935612600 132
217 iso_pu_bacteria 2935616580 2935620825 132
218 iso_pu_bacteria 2935630451 2935634404 132
219 iso_pu_bacteria 2935638405 2935639904 132
220 iso_pu_bacteria 2935648319 2935653503 132
221 iso_pu_bacteria 2935656913 2935662252 132
222 iso_pu_bacteria 2935665750 2935667242 132
223 iso_pu_bacteria 2935675223 2935677679 132
224 iso_pu_bacteria 2935684952 2935690382 132
225 iso_pu_bacteria 2935694250 2935697295 132
226 iso_pu_bacteria 2935703347 2935704998 132
227 iso_pu_bacteria 2935713505 2935717922 132
228 iso_pu_bacteria 2935722832 2935726928 132
229 iso_pu_bacteria 2935732158 2935735698 132
230 iso_pu_bacteria 2935741537 2935745031 132
231 iso_pu_bacteria 2935750917 2935755392 132
232 iso_pu_bacteria 2935769743 2935776163 132
233 iso_pu_bacteria 2935777560 2935781996 132
234 iso_pu_bacteria 2935785616 2935792020 132
235 iso_pu_bacteria 2935793552 2935800330 132
236 iso_pu_bacteria 2935801545 2935803600 132
237 iso_pu_bacteria 2935810662 2935811520 132
238 iso_pu_bacteria 2935819856 2935824089 132
239 iso_pu_bacteria 2935827899 2935829387 132
240 iso_pu_bacteria 2935837841 2935842635 132
241 iso_pu_bacteria 2935847175 2935852764 132
242 iso_pu_bacteria 2935855204 2935858633 132
243 iso_pu_bacteria 2935864058 2935866946 132
244 iso_pu_bacteria 2935873716 2935877076 132
245 iso_pu_bacteria 2935883170 2935884728 132
246 iso_pu_bacteria 2935959822 2935961892 132
247 iso_pu_bacteria 2935975950 2935976804 132
248 iso_pu_bacteria 2935984226 2935986210 132
249 iso_pu_bacteria 2935992306 2935995288 132
250 iso_pu_bacteria 2936002035 2936004175 132
251 iso_pu_bacteria 2936011229 2936016554 132
252 iso_pu_bacteria 2936019824 2936025132 132
253 iso_pu_bacteria 2936028420 2936034029 132
254 iso_pu_bacteria 2936037263 2936038102 132
255 iso_pu_bacteria 2936046547 2936052031 132
256 iso_pu_bacteria 2936055302 2936059804 132
257 iso_pu_bacteria 2937877337 2937884153 132
258 iso_pu_bacteria 2937972304 2937979745 132
259 iso_pu_bacteria 2940556831 2940561327 132
260 iso_pu_bacteria 2941507105 2941508890 132
261 iso_pu_bacteria 2941515067 2941516719 132
262 iso_pu_bacteria 2941523033 2941525187 132
263 iso_pu_bacteria 2941531003 2941533549 132
264 iso_pu_bacteria 2941538514 2941544518 132
265 iso_pu_bacteria 2958064165 2958065302 132
266 iso_pu_bacteria 2958084443 2958091464 132
267 iso_pu_bacteria 2958144490 2958147668 132
268 iso_pu_bacteria 2963644680 2963647216 132
269 iso_pu_bacteria 2968016561 2968018896 132
270 iso_pu_bacteria 2968083720 2968087949 132
271 iso_pu_bacteria 2970469710 2970470931 132
272 iso_pu_bacteria 2996348954 2996356533 132
273 iso_pu_bacteria 3004275668 3004282836 132
274 iso_pu_bacteria 3005474847 3005478529 132
275 iso_pu_bacteria 3005506211 3005511365 132
276 iso_pu_bacteria 3005710791 3005712452 132
277 iso_pu_bacteria 3005718088 3005719526 132
278 iso_pu_bacteria 637000159 637075087 132
279 iso_pu_bacteria 8016511872 8016516623 132
280 iso_pu_bacteria 8016530956 8016537546 132
281 iso_pu_bacteria 8016539877 8016541816 132
282 iso_pu_bacteria 8016548790 8016551458 132
283 iso_pu_bacteria 8016557553 8016559840 132
284 iso_pu_bacteria 8016566248 8016567202 132
285 iso_pu_bacteria 8016575299 8016579917 132
286 iso_pu_bacteria 8016583857 8016588929 132
287 iso_pu_bacteria 8016595262 8016597781 132
288 iso_pu_bacteria 8016603502 8016604527 132
289 iso_pu_bacteria 8016613128 8016620486 132
290 iso_pu_bacteria 8016622563 8016629495 132
291 iso_pu_bacteria 8017057580 8017059928 132
292 iso_pu_bacteria 8019530166 8019537223 132
293 iso_pu_bacteria 8019538911 8019538935 132
294 iso_pu_bacteria 8019547302 8019548432 132
295 iso_pu_bacteria 8019576017 8019579425 132
296 iso_pu_bacteria 8019597564 8019604203 132
297 iso_pu_bacteria 8019608314 8019614327 132
298 iso_pu_bacteria 8019619141 8019624970 132
299 iso_pu_bacteria 8019629233 8019637211 132
300 iso_pu_bacteria 8019648815 8019650201 132
301 iso_pu_bacteria 8019668869 8019674606 132
302 iso_pu_bacteria 8019678201 8019681495 132
303 iso_pu_bacteria 8047673197 8047675849 132
304 iso_pu_bacteria 8055742211 8055749328 132
305 iso_pu_bacteria 8056689827 8056691734 132
306 iso_pu_bacteria 8056967851 8056973579 132
307 3300005262 Ga0065165_1000891 Ga0065165_100089119 133
308 3300005327 Ga0070658_10723903 Ga0070658_107239032 133
309 3300005344 Ga0070661_100698507 Ga0070661_1006985072 133
310 3300009093 Ga0105240_10093354 Ga0105240_100933545 133
311 3300009551 Ga0105238_10098976 Ga0105238_100989764 133
312 3300015262 Ga0182007_10349436 Ga0182007_103494361 133
313 3300025909 Ga0207705_11397978 Ga0207705_113979781 133
314 3300025935 Ga0207709_10800936 Ga0207709_108009361 133
315 3300046452 Ga0495617_040015 Ga0495617_040015_595_1008 133
316 3300046453 Ga0495627_009857 Ga0495627_009857_2123_2536 133
317 3300046457 Ga0495590_0000017 Ga0495590_0000017_16839_17252 133
318 3300046457 Ga0495590_0012598 Ga0495590_0012598_388_801 133
319 3300046458 Ga0495591_000091 Ga0495591_000091_84197_84598 133
320 3300046458 Ga0495591_004378 Ga0495591_004378_3182_3586 133
321 3300046460 Ga0495638_0068452 Ga0495638_0068452_42_443 133
322 3300046474 Ga0495605_0004429 Ga0495605_0004429_1768_2169 133
323 3300046474 Ga0495605_0014773 Ga0495605_0014773_695_1099 133
324 3300046474 Ga0495605_0039351 Ga0495605_0039351_530_955 133
325 3300046474 Ga0495605_0122734 Ga0495605_0122734_226_651 133
326 3300046491 Ga0495584_0001217 Ga0495584_0001217_9179_9592 133
327 3300046491 Ga0495584_0087892 Ga0495584_0087892_220_624 133
328 3300046492 Ga0495585_0006675 Ga0495585_0006675_5717_6130 133
329 3300046492 Ga0495585_0011422 Ga0495585_0011422_4237_4650 133
330 3300046492 Ga0495585_0013692 Ga0495585_0013692_426_830 133
331 3300046492 Ga0495585_0065985 Ga0495585_0065985_458_874 133
332 3300046492 Ga0495585_0225037 Ga0495585_0225037_99_512 133
333 3300046499 Ga0495594_0002735 Ga0495594_0002735_5022_5435 133
334 3300046500 Ga0495596_0003495 Ga0495596_0003495_3872_4285 133
335 3300046500 Ga0495596_0011542 Ga0495596_0011542_1791_2204 133
336 3300046500 Ga0495596_0014417 Ga0495596_0014417_1157_1570 133
337 3300046500 Ga0495596_0226131 Ga0495596_0226131_138_542 133
338 3300046501 Ga0495607_0009255 Ga0495607_0009255_164_577 133
339 3300046501 Ga0495607_0032829 Ga0495607_0032829_1706_2110 133
340 3300046506 Ga0495583_0001871 Ga0495583_0001871_7836_8261 133
341 3300046506 Ga0495583_0003628 Ga0495583_0003628_2472_2885 133
342 3300046506 Ga0495583_0037224 Ga0495583_0037224_1868_2272 133
343 3300046507 Ga0495606_0021322 Ga0495606_0021322_2175_2588 133
344 3300046507 Ga0495606_0070480 Ga0495606_0070480_1758_2174 133
345 3300046512 Ga0495610_0023569 Ga0495610_0023569_1183_1584 133
346 3300046513 Ga0495616_0009676 Ga0495616_0009676_1116_1517 133
347 3300046513 Ga0495616_0036379 Ga0495616_0036379_1181_1585 133
348 3300046513 Ga0495616_0065871 Ga0495616_0065871_898_1323 133
349 3300046513 Ga0495616_0125881 Ga0495616_0125881_564_977 133
350 3300046515 Ga0495620_0080128 Ga0495620_0080128_237_641 133
351 3300046518 Ga0495631_0000562 Ga0495631_0000562_13368_13793 133
352 3300046518 Ga0495631_0004969 Ga0495631_0004969_6014_6427 133
353 3300046518 Ga0495631_0012205 Ga0495631_0012205_172_585 133
354 3300046518 Ga0495631_0034871 Ga0495631_0034871_1734_2138 133
355 3300046519 Ga0495632_0027540 Ga0495632_0027540_954_1355 133
356 3300046520 Ga0495637_0000004 Ga0495637_0000004_7062_7463 133
357 3300046520 Ga0495637_0021740 Ga0495637_0021740_897_1301 133
358 3300046520 Ga0495637_0048357 Ga0495637_0048357_994_1407 133
359 3300046523 Ga0495644_0002176 Ga0495644_0002176_6587_7000 133
360 3300046523 Ga0495644_0161325 Ga0495644_0161325_196_597 133
361 3300046524 Ga0495648_0001311 Ga0495648_0001311_15107_15520 133
362 3300046524 Ga0495648_0004718 Ga0495648_0004718_5794_6198 133
363 3300046524 Ga0495648_0283757 Ga0495648_0283757_101_526 133
364 3300046528 Ga0495642_0005805 Ga0495642_0005805_1021_1434 133
365 3300046528 Ga0495642_0005858 Ga0495642_0005858_739_1152 133
366 3300046528 Ga0495642_0024677 Ga0495642_0024677_570_974 133
367 3300046530 Ga0495654_0015086 Ga0495654_0015086_3644_4069 133
368 3300046538 Ga0495609_0002370 Ga0495609_0002370_2933_3346 133
369 3300046538 Ga0495609_0014233 Ga0495609_0014233_3077_3478 133
370 3300046538 Ga0495609_0025650 Ga0495609_0025650_2102_2515 133
371 3300046542 Ga0495597_0001066 Ga0495597_0001066_12042_12455 133
372 3300046557 Ga0495622_0247580 Ga0495622_0247580_142_555 133
373 3300046558 Ga0495633_0002747 Ga0495633_0002747_9985_10386 133
374 3300046616 Ga0495668_0000392 Ga0495668_0000392_45914_46339 133
375 3300046616 Ga0495668_0010923 Ga0495668_0010923_3543_3947 133
376 3300046648 Ga0495611_0000157 Ga0495611_0000157_39388_39801 133
377 3300046648 Ga0495611_0010918 Ga0495611_0010918_1619_2032 133
378 3300046660 Ga0495625_0020065 Ga0495625_0020065_3479_3880 133
379 3300046665 Ga0495661_0013825 Ga0495661_0013825_4211_4624 133
380 3300046665 Ga0495661_0070545 Ga0495661_0070545_648_1052 133
381 3300046665 Ga0495661_0073867 Ga0495661_0073867_1310_1723 133
382 3300046665 Ga0495661_0131343 Ga0495661_0131343_591_1004 133
383 3300046665 Ga0495661_0140771 Ga0495661_0140771_666_1091 133
384 3300046674 Ga0495588_0012241 Ga0495588_0012241_2689_3102 133
385 3300046674 Ga0495588_0043710 Ga0495588_0043710_481_894 133
386 3300046684 Ga0495669_0001365 Ga0495669_0001365_9269_9682 133
387 3300046684 Ga0495669_0011625 Ga0495669_0011625_2324_2728 133
388 3300046684 Ga0495669_0055884 Ga0495669_0055884_285_698 133
389 3300046691 Ga0495670_0005238 Ga0495670_0005238_5091_5495 133
390 3300046691 Ga0495670_0016973 Ga0495670_0016973_171_584 133
391 3300046691 Ga0495670_0429695 Ga0495670_0429695_13_414 133
392 3300046692 Ga0495671_0016932 Ga0495671_0016932_2095_2520 133
393 3300046692 Ga0495671_0023302 Ga0495671_0023302_2767_3168 133
394 3300046692 Ga0495671_0319121 Ga0495671_0319121_59_463 133
395 3300046694 Ga0495649_0000326 Ga0495649_0000326_6036_6437 133
396 3300046694 Ga0495649_0037339 Ga0495649_0037339_2024_2437 133
397 3300046794 Ga0495589_0034475 Ga0495589_0034475_1824_2228 133
398 3300046810 Ga0495660_0010226 Ga0495660_0010226_4437_4838 133
399 3300046810 Ga0495660_0025605 Ga0495660_0025605_2062_2463 133
400 3300046810 Ga0495660_0097575 Ga0495660_0097575_1030_1443 133
401 3300046810 Ga0495660_0137477 Ga0495660_0137477_474_887 133
402 3300047318 Ga0495636_0138916 Ga0495636_0138916_363_776 133
403 3300047320 Ga0495672_0000098 Ga0495672_0000098_98815_99216 133
404 3300047320 Ga0495672_0061653 Ga0495672_0061653_1178_1582 133
405 3300047323 Ga0495683_0000247 Ga0495683_0000247_14342_14743 133
406 3300047443 Ga0495687_044228 Ga0495687_044228_1409_1810 133
407 3300047445 Ga0495677_0000268 Ga0495677_0000268_15424_15837 133
408 3300047446 Ga0495679_000520 Ga0495679_000520_3009_3434 133
409 3300047446 Ga0495679_007855 Ga0495679_007855_2842_3255 133
410 3300047447 Ga0495685_012776 Ga0495685_012776_1756_2160 133
411 3300047447 Ga0495685_030246 Ga0495685_030246_1354_1779 133
412 3300047447 Ga0495685_054939 Ga0495685_054939_592_993 133
413 3300047470 Ga0495681_0093492 Ga0495681_0093492_23_448 133
414 3300047470 Ga0495681_0210887 Ga0495681_0210887_258_674 133
415 3300047472 Ga0495686_0000813 Ga0495686_0000813_9235_9648 133
416 3300047472 Ga0495686_0171062 Ga0495686_0171062_641_1054 133
417 3300048091 Ga0495626_0003299 Ga0495626_0003299_2038_2451 133
418 3300048091 Ga0495626_0004535 Ga0495626_0004535_6319_6732 133
419 3300048091 Ga0495626_0019805 Ga0495626_0019805_600_1025 133
420 3300048091 Ga0495626_0061603 Ga0495626_0061603_1252_1656 133
421 3300048905 Ga0496102_0000407 Ga0496102_0000407_31400_31813 133
422 3300048905 Ga0496102_0778109 Ga0496102_0778109_157_570 133
423 3300048906 Ga0496103_0122708 Ga0496103_0122708_40_453 133
424 3300048910 Ga0496107_0031053 Ga0496107_0031053_1161_1574 133
425 3300048913 Ga0496110_0013088 Ga0496110_0013088_2505_2918 133
426 3300048913 Ga0496110_1658599 Ga0496110_1658599_115_516 133
427 3300048914 Ga0496111_0107697 Ga0496111_0107697_13_426 133
428 3300048924 Ga0496121_0653958 Ga0496121_0653958_11_424 133
429 3300048925 Ga0496122_0112042 Ga0496122_0112042_516_920 133
430 3300048925 Ga0496122_0237101 Ga0496122_0237101_426_827 133
431 3300048927 Ga0496124_0033985 Ga0496124_0033985_2895_3296 133
432 3300048927 Ga0496124_0298430 Ga0496124_0298430_337_741 133
433 3300048929 Ga0496126_0244404 Ga0496126_0244404_881_1294 133
434 3300049459 Ga0495678_000153 Ga0495678_000153_67674_68087 133
435 3300049459 Ga0495678_000284 Ga0495678_000284_47053_47466 133
436 3300049459 Ga0495678_020907 Ga0495678_020907_572_976 133
437 3300049460 Ga0495682_0002286 Ga0495682_0002286_6129_6542 133
438 3300049460 Ga0495682_0007451 Ga0495682_0007451_2676_3089 133
439 3300049460 Ga0495682_0027231 Ga0495682_0027231_1404_1808 133
440 3300049460 Ga0495682_0034320 Ga0495682_0034320_732_1157 133
441 3300049571 Ga0501034_0154474 Ga0501034_0154474_1016_1438 133
442 3300049571 Ga0501034_0184132 Ga0501034_0184132_832_1254 133
443 3300049588 Ga0501072_0081516 Ga0501072_0081516_1752_2174 133
444 3300049822 Ga0501035_0023706 Ga0501035_0023706_1131_1553 133
445 3300004625 Ga0055543_1003926 Ga0055543_10039264 134
446 3300005262 Ga0065165_1001577 Ga0065165_100157722 134
447 3300005288 Ga0065714_10469235 Ga0065714_104692351 134
448 3300005293 Ga0065715_10792325 Ga0065715_107923251 134
449 3300006051 Ga0075364_10132828 Ga0075364_101328283 134
450 3300006177 Ga0075362_10190769 Ga0075362_101907692 134
451 3300006186 Ga0075369_10163813 Ga0075369_101638131 134
452 3300006353 Ga0075370_10374871 Ga0075370_103748712 134
453 3300009174 Ga0105241_10730466 Ga0105241_107304662 134
454 3300010375 Ga0105239_11646180 Ga0105239_116461802 134
455 3300025261 Ga0209233_1008559 Ga0209233_10085595 134
456 3300025937 Ga0207669_10406698 Ga0207669_104066982 134
457 3300031456 Ga0307513_10779091 Ga0307513_107790912 134
458 3300037418 Ga0395900_0000601 Ga0395900_0000601_42307_42732 134
459 3300037466 Ga0395898_0010480 Ga0395898_0010480_2651_3076 134
460 3300041459 Ga0451800_0909938 Ga0451800_0909938_57_482 134
461 3300044658 Ga0466972_0002026 Ga0466972_0002026_3008_3433 134
462 3300044683 Ga0466965_0088657 Ga0466965_0088657_1118_1543 134
463 3300045049 Ga0466959_0479042 Ga0466959_0479042_52_477 134
464 3300045049 Ga0466959_0643465 Ga0466959_0643465_140_589 134
465 3300046460 Ga0495638_0253610 Ga0495638_0253610_395_820 134
466 3300046492 Ga0495585_0065627 Ga0495585_0065627_1003_1428 134
467 3300046512 Ga0495610_0126098 Ga0495610_0126098_667_1092 134
468 3300046518 Ga0495631_0289937 Ga0495631_0289937_31_456 134
469 3300046520 Ga0495637_0101020 Ga0495637_0101020_179_604 134
470 3300046522 Ga0495643_0027136 Ga0495643_0027136_242_667 134
471 3300046524 Ga0495648_0003160 Ga0495648_0003160_12395_12820 134
472 3300046530 Ga0495654_0155762 Ga0495654_0155762_287_712 134
473 3300046542 Ga0495597_0025540 Ga0495597_0025540_1135_1560 134
474 3300046616 Ga0495668_0310381 Ga0495668_0310381_98_523 134
475 3300046660 Ga0495625_0022295 Ga0495625_0022295_1644_2069 134
476 3300046665 Ga0495661_0407979 Ga0495661_0407979_196_621 134
477 3300047323 Ga0495683_0154368 Ga0495683_0154368_494_919 134
478 3300047443 Ga0495687_030944 Ga0495687_030944_674_1099 134
479 3300047469 Ga0495673_0001726 Ga0495673_0001726_12139_12564 134
480 3300047470 Ga0495681_0138575 Ga0495681_0138575_41_466 134
481 3300048903 Ga0496100_1471670 Ga0496100_1471670_50_475 134
482 3300048912 Ga0496109_0451659 Ga0496109_0451659_536_961 134
483 3300048928 Ga0496125_0186359 Ga0496125_0186359_904_1329 134
484 3300049570 Ga0501033_0469840 Ga0501033_0469840_44_490 134
485 3300049579 Ga0501043_0008172 Ga0501043_0008172_19_444 134
486 3300049586 Ga0501070_0889873 Ga0501070_0889873_233_679 134
487 3300049589 Ga0501073_0744518 Ga0501073_0744518_49_495 134
488 3300050492 nmdc:mga0yw44_617656_c1 nmdc:mga0yw44_617656_c1_176_601 134
489 3300050496 nmdc:mga07m45_396056_c1 nmdc:mga07m45_396056_c1_19_444 134
490 3300053079 Ga0500610_0045062 Ga0500610_0045062_658_1083 134
491 3300053083 Ga0495655_0200644 Ga0495655_0200644_96_521 134
492 3300053086 Ga0500578_0316687 Ga0500578_0316687_189_614 134
493 3300053088 Ga0500644_0000494 Ga0500644_0000494_12684_13109 134
494 3300053096 Ga0500641_0044055 Ga0500641_0044055_19_444 134
495 3300053104 Ga0500556_0008528 Ga0500556_0008528_1609_2013 134
496 3300053134 Ga0500658_0027919 Ga0500658_0027919_971_1396 134
497 3300053138 Ga0500564_000194 Ga0500564_000194_4056_4481 134
498 3300053151 Ga0500604_0031803 Ga0500604_0031803_889_1314 134
499 3300053151 Ga0500604_0105388 Ga0500604_0105388_257_682 134
500 3300053153 Ga0500616_0005519 Ga0500616_0005519_3311_3715 134
501 3300053155 Ga0500620_015385 Ga0500620_015385_342_767 134
502 3300053158 Ga0500627_0070824 Ga0500627_0070824_210_635 134
503 3300053158 Ga0500627_0210435 Ga0500627_0210435_10_435 134
504 3300053727 Ga0500611_033299 Ga0500611_033299_542_967 134
505 3300055283 Ga0500661_032570 Ga0500661_032570_56_481 134
506 3300003187 JGI25151J46595_10004677 JGI25151J46595_100046775 135
507 3300005262 Ga0065165_1012860 Ga0065165_10128603 135
508 3300005329 Ga0070683_100299943 Ga0070683_1002999431 135
509 3300005335 Ga0070666_10112021 Ga0070666_101120213 135
510 3300005367 Ga0070667_100159713 Ga0070667_1001597134 135
511 3300005434 Ga0070709_10009416 Ga0070709_100094166 135
512 3300005435 Ga0070714_100249358 Ga0070714_1002493583 135
513 3300005435 Ga0070714_100329505 Ga0070714_1003295053 135
514 3300005436 Ga0070713_100129970 Ga0070713_1001299702 135
515 3300005436 Ga0070713_100834282 Ga0070713_1008342822 135
516 3300005439 Ga0070711_100007910 Ga0070711_1000079106 135
517 3300005458 Ga0070681_10564684 Ga0070681_105646842 135
518 3300005530 Ga0070679_100379775 Ga0070679_1003797752 135
519 3300005535 Ga0070684_100181505 Ga0070684_1001815054 135
520 3300005548 Ga0070665_100036208 Ga0070665_1000362086 135
521 3300005563 Ga0068855_100002071 Ga0068855_1000020714 135
522 3300005614 Ga0068856_100123838 Ga0068856_1001238383 135
523 3300005834 Ga0068851_10123075 Ga0068851_101230752 135
524 3300005843 Ga0068860_101556681 Ga0068860_1015566812 135
525 3300006028 Ga0070717_10093009 Ga0070717_100930093 135
526 3300006028 Ga0070717_10696414 Ga0070717_106964142 135
527 3300006173 Ga0070716_100266843 Ga0070716_1002668431 135
528 3300006942 Ga0099824_1042955 Ga0099824_10429553 135
529 3300006943 Ga0099822_1080690 Ga0099822_10806901 135
530 3300009101 Ga0105247_11127634 Ga0105247_111276341 135
531 3300009174 Ga0105241_10044941 Ga0105241_100449414 135
532 3300009545 Ga0105237_10356014 Ga0105237_103560142 135
533 3300009551 Ga0105238_10023368 Ga0105238_100233684 135
534 3300010375 Ga0105239_11365012 Ga0105239_113650121 135
535 3300013105 Ga0157369_10768302 Ga0157369_107683023 135
536 3300013307 Ga0157372_10599299 Ga0157372_105992993 135
537 3300021320 Ga0214544_1000001 Ga0214544_1000001187 135
538 3300021321 Ga0214542_1000005 Ga0214542_1000005187 135
539 3300021324 Ga0214545_1000003 Ga0214545_1000003577 135
540 3300021324 Ga0214545_1019813 Ga0214545_10198135 135
541 3300021327 Ga0214543_1000002 Ga0214543_1000002188 135
542 3300021327 Ga0214543_1027099 Ga0214543_10270992 135
543 3300025258 Ga0209129_1000285 Ga0209129_100028520 135
544 3300025284 Ga0209130_1074870 Ga0209130_10748701 135
545 3300025294 Ga0209025_1001792 Ga0209025_100179230 135
546 3300025297 Ga0209758_1016045 Ga0209758_10160455 135
547 3300025315 Ga0207697_10121100 Ga0207697_101211003 135
548 3300025903 Ga0207680_10101447 Ga0207680_101014472 135
549 3300025906 Ga0207699_10018621 Ga0207699_100186216 135
550 3300025911 Ga0207654_10138954 Ga0207654_101389543 135
551 3300025915 Ga0207693_10113735 Ga0207693_101137353 135
552 3300025916 Ga0207663_10144917 Ga0207663_101449174 135
553 3300025921 Ga0207652_10270156 Ga0207652_102701562 135
554 3300025924 Ga0207694_10024573 Ga0207694_100245734 135
555 3300025928 Ga0207700_10232060 Ga0207700_102320602 135
556 3300025928 Ga0207700_10713500 Ga0207700_107135002 135
557 3300025929 Ga0207664_10429853 Ga0207664_104298533 135
558 3300025939 Ga0207665_10303621 Ga0207665_103036213 135
559 3300025949 Ga0207667_10001428 Ga0207667_100014284 135
560 3300026116 Ga0207674_10776492 Ga0207674_107764922 135
561 3300027296 Ga0209389_1000083 Ga0209389_100008379 135
562 3300027357 Ga0209589_1000097 Ga0209589_100009779 135
563 3300027361 Ga0209489_100105 Ga0209489_100105105 135
564 3300028380 Ga0268265_10729956 Ga0268265_107299562 135
565 3300031548 Ga0307408_101728997 Ga0307408_1017289972 135
566 3300031852 Ga0307410_10316307 Ga0307410_103163072 135
567 3300031903 Ga0307407_10106184 Ga0307407_101061843 135
568 3300031911 Ga0307412_11745386 Ga0307412_117453861 135
569 3300031995 Ga0307409_100613927 Ga0307409_1006139272 135
570 3300032002 Ga0307416_100658552 Ga0307416_1006585523 135
571 3300032004 Ga0307414_10164251 Ga0307414_101642514 135
572 3300032004 Ga0307414_10292212 Ga0307414_102922122 135
573 3300032005 Ga0307411_10165248 Ga0307411_101652482 135
574 3300041512 Ga0451853_3944585 Ga0451853_3944585_457_864 135
575 3300044693 Ga0466961_0190296 Ga0466961_0190296_309_737 135
576 3300044694 Ga0466963_0636864 Ga0466963_0636864_313_741 135
577 3300044706 Ga0466964_0287018 Ga0466964_0287018_133_561 135
578 3300046542 Ga0495597_0000698 Ga0495597_0000698_14917_15339 135
579 3300046665 Ga0495661_0001268 Ga0495661_0001268_12774_13202 135
580 3300048927 Ga0496124_0062397 Ga0496124_0062397_130_552 135
581 3300049571 Ga0501034_0079515 Ga0501034_0079515_1681_2109 135
582 3300049575 Ga0501039_0061947 Ga0501039_0061947_1298_1726 135
583 3300049584 Ga0501068_0068490 Ga0501068_0068490_1045_1473 135
584 3300049589 Ga0501073_0081735 Ga0501073_0081735_952_1380 135
585 3300049742 Ga0501080_0000625 Ga0501080_0000625_5650_6078 135
586 3300049744 Ga0501083_0046501 Ga0501083_0046501_194_622 135
587 3300049822 Ga0501035_0048282 Ga0501035_0048282_1313_1741 135
588 3300053104 Ga0500556_0299162 Ga0500556_0299162_29_436 135
589 3300060353 Ga0501082_0017632 Ga0501082_0017632_4158_4586 135
590 3300001979 JGI24740J21852_10003943 JGI24740J21852_100039433 136
591 3300001979 JGI24740J21852_10051577 JGI24740J21852_100515773 136
592 3300001989 JGI24739J22299_10074626 JGI24739J22299_100746263 136
593 3300001990 JGI24737J22298_10192393 JGI24737J22298_101923931 136
594 3300002075 JGI24738J21930_10016468 JGI24738J21930_100164682 136
595 3300003203 JGI25406J46586_10000580 JGI25406J46586_1000058013 136
596 3300003215 JGI25153J46596_10006573 JGI25153J46596_100065737 136
597 3300003759 Ga0055525_1000104 Ga0055525_100010491 136
598 3300003762 Ga0055542_1000025 Ga0055542_1000025231 136
599 3300003763 Ga0055529_1000014 Ga0055529_100001422 136
600 3300003775 Ga0055524_1021940 Ga0055524_10219404 136
601 3300003794 Ga0055531_10010256 Ga0055531_100102562 136
602 3300005262 Ga0065165_1002943 Ga0065165_100294314 136
603 3300005262 Ga0065165_1059411 Ga0065165_10594112 136
604 3300005262 Ga0065165_1115834 Ga0065165_11158341 136
605 3300005293 Ga0065715_10060973 Ga0065715_100609731 136
606 3300005327 Ga0070658_10538913 Ga0070658_105389132 136
607 3300005327 Ga0070658_11875517 Ga0070658_118755171 136
608 3300005328 Ga0070676_10376874 Ga0070676_103768742 136
609 3300005333 Ga0070677_10233329 Ga0070677_102333292 136
610 3300005334 Ga0068869_100055689 Ga0068869_1000556893 136
611 3300005334 Ga0068869_100198606 Ga0068869_1001986061 136
612 3300005334 Ga0068869_100818109 Ga0068869_1008181091 136
613 3300005334 Ga0068869_101428411 Ga0068869_1014284111 136
614 3300005336 Ga0070680_100003117 Ga0070680_1000031175 136
615 3300005336 Ga0070680_100110465 Ga0070680_1001104652 136
616 3300005337 Ga0070682_100009795 Ga0070682_1000097953 136
617 3300005339 Ga0070660_100025088 Ga0070660_1000250884 136
618 3300005339 Ga0070660_101326882 Ga0070660_1013268821 136
619 3300005340 Ga0070689_100000310 Ga0070689_10000031020 136
620 3300005341 Ga0070691_10000574 Ga0070691_1000057414 136
621 3300005341 Ga0070691_10013745 Ga0070691_100137455 136
622 3300005343 Ga0070687_100020588 Ga0070687_1000205883 136
623 3300005343 Ga0070687_100786691 Ga0070687_1007866911 136
624 3300005343 Ga0070687_100892480 Ga0070687_1008924801 136
625 3300005344 Ga0070661_101313280 Ga0070661_1013132801 136
626 3300005344 Ga0070661_101499468 Ga0070661_1014994681 136
627 3300005345 Ga0070692_10196571 Ga0070692_101965711 136
628 3300005347 Ga0070668_100029805 Ga0070668_1000298053 136
629 3300005347 Ga0070668_100030699 Ga0070668_1000306995 136
630 3300005353 Ga0070669_100001017 Ga0070669_10000101719 136
631 3300005353 Ga0070669_100224944 Ga0070669_1002249443 136
632 3300005355 Ga0070671_100006071 Ga0070671_10000607111 136
633 3300005355 Ga0070671_100016959 Ga0070671_1000169593 136
634 3300005356 Ga0070674_100013611 Ga0070674_1000136114 136
635 3300005356 Ga0070674_100115388 Ga0070674_1001153883 136
636 3300005356 Ga0070674_100267362 Ga0070674_1002673623 136
637 3300005364 Ga0070673_100291174 Ga0070673_1002911742 136
638 3300005365 Ga0070688_100940626 Ga0070688_1009406262 136
639 3300005366 Ga0070659_100598933 Ga0070659_1005989332 136
640 3300005367 Ga0070667_100084821 Ga0070667_1000848213 136
641 3300005367 Ga0070667_100101966 Ga0070667_1001019664 136
642 3300005406 Ga0070703_10001384 Ga0070703_100013847 136
643 3300005435 Ga0070714_100055909 Ga0070714_1000559092 136
644 3300005438 Ga0070701_10137612 Ga0070701_101376121 136
645 3300005440 Ga0070705_100002172 Ga0070705_1000021726 136
646 3300005441 Ga0070700_100002573 Ga0070700_1000025735 136
647 3300005441 Ga0070700_100052891 Ga0070700_1000528911 136
648 3300005441 Ga0070700_100177999 Ga0070700_1001779993 136
649 3300005445 Ga0070708_100040322 Ga0070708_1000403223 136
650 3300005455 Ga0070663_100007077 Ga0070663_1000070776 136
651 3300005455 Ga0070663_100059561 Ga0070663_1000595614 136
652 3300005455 Ga0070663_100088233 Ga0070663_1000882331 136
653 3300005455 Ga0070663_100143105 Ga0070663_1001431053 136
654 3300005455 Ga0070663_100268402 Ga0070663_1002684021 136
655 3300005455 Ga0070663_100420824 Ga0070663_1004208242 136
656 3300005456 Ga0070678_100750392 Ga0070678_1007503921 136
657 3300005457 Ga0070662_100345002 Ga0070662_1003450023 136
658 3300005459 Ga0068867_100024353 Ga0068867_1000243536 136
659 3300005459 Ga0068867_101139361 Ga0068867_1011393612 136
660 3300005468 Ga0070707_100325697 Ga0070707_1003256973 136
661 3300005468 Ga0070707_100915434 Ga0070707_1009154341 136
662 3300005471 Ga0070698_100298207 Ga0070698_1002982072 136
663 3300005518 Ga0070699_100000444 Ga0070699_10000044417 136
664 3300005530 Ga0070679_100033410 Ga0070679_1000334102 136
665 3300005530 Ga0070679_100483287 Ga0070679_1004832872 136
666 3300005536 Ga0070697_100524187 Ga0070697_1005241872 136
667 3300005539 Ga0068853_100014406 Ga0068853_1000144064 136
668 3300005539 Ga0068853_100332127 Ga0068853_1003321272 136
669 3300005543 Ga0070672_100194422 Ga0070672_1001944224 136
670 3300005544 Ga0070686_100004627 Ga0070686_1000046279 136
671 3300005544 Ga0070686_100014576 Ga0070686_1000145762 136
672 3300005545 Ga0070695_100267172 Ga0070695_1002671722 136
673 3300005546 Ga0070696_100000123 Ga0070696_10000012312 136
674 3300005546 Ga0070696_100026755 Ga0070696_1000267555 136
675 3300005547 Ga0070693_100008394 Ga0070693_1000083945 136
676 3300005547 Ga0070693_100412584 Ga0070693_1004125842 136
677 3300005548 Ga0070665_100000186 Ga0070665_10000018685 136
678 3300005548 Ga0070665_100119168 Ga0070665_1001191682 136
679 3300005548 Ga0070665_100780062 Ga0070665_1007800622 136
680 3300005548 Ga0070665_101028932 Ga0070665_1010289322 136
681 3300005549 Ga0070704_100000095 Ga0070704_1000000953 136
682 3300005549 Ga0070704_101306703 Ga0070704_1013067032 136
683 3300005564 Ga0070664_100248835 Ga0070664_1002488353 136
684 3300005577 Ga0068857_100003759 Ga0068857_1000037593 136
685 3300005577 Ga0068857_100402373 Ga0068857_1004023733 136
686 3300005614 Ga0068856_100157077 Ga0068856_1001570774 136
687 3300005614 Ga0068856_100468497 Ga0068856_1004684972 136
688 3300005614 Ga0068856_100570800 Ga0068856_1005708002 136
689 3300005614 Ga0068856_101683472 Ga0068856_1016834722 136
690 3300005615 Ga0070702_100000980 Ga0070702_1000009804 136
691 3300005615 Ga0070702_100135943 Ga0070702_1001359433 136
692 3300005615 Ga0070702_100392834 Ga0070702_1003928341 136
693 3300005616 Ga0068852_100001899 Ga0068852_1000018999 136
694 3300005616 Ga0068852_100975061 Ga0068852_1009750611 136
695 3300005617 Ga0068859_100000243 Ga0068859_10000024352 136
696 3300005617 Ga0068859_100001820 Ga0068859_10000182012 136
697 3300005617 Ga0068859_100457790 Ga0068859_1004577903 136
698 3300005618 Ga0068864_100379208 Ga0068864_1003792082 136
699 3300005718 Ga0068866_10053091 Ga0068866_100530913 136
700 3300005718 Ga0068866_10620247 Ga0068866_106202471 136
701 3300005719 Ga0068861_100000133 Ga0068861_1000001336 136
702 3300005719 Ga0068861_100004883 Ga0068861_1000048833 136
703 3300005719 Ga0068861_100011940 Ga0068861_1000119402 136
704 3300005719 Ga0068861_100128229 Ga0068861_1001282293 136
705 3300005719 Ga0068861_100400345 Ga0068861_1004003452 136
706 3300005840 Ga0068870_10236720 Ga0068870_102367202 136
707 3300005841 Ga0068863_100174025 Ga0068863_1001740254 136
708 3300005842 Ga0068858_100111947 Ga0068858_1001119472 136
709 3300005842 Ga0068858_101307606 Ga0068858_1013076061 136
710 3300005843 Ga0068860_100002696 Ga0068860_10000269611 136
711 3300005843 Ga0068860_100153211 Ga0068860_1001532114 136
712 3300005844 Ga0068862_100087870 Ga0068862_1000878704 136
713 3300005844 Ga0068862_100160424 Ga0068862_1001604244 136
714 3300005844 Ga0068862_100597866 Ga0068862_1005978662 136
715 3300005981 Ga0081538_10023382 Ga0081538_100233824 136
716 3300005985 Ga0081539_10000321 Ga0081539_1000032192 136
717 3300006038 Ga0075365_10011522 Ga0075365_100115227 136
718 3300006038 Ga0075365_10172325 Ga0075365_101723253 136
719 3300006042 Ga0075368_10080960 Ga0075368_100809602 136
720 3300006042 Ga0075368_10333237 Ga0075368_103332371 136
721 3300006048 Ga0075363_100006916 Ga0075363_1000069163 136
722 3300006048 Ga0075363_100241070 Ga0075363_1002410702 136
723 3300006051 Ga0075364_10019010 Ga0075364_100190103 136
724 3300006051 Ga0075364_10606421 Ga0075364_106064212 136
725 3300006058 Ga0075432_10013503 Ga0075432_100135034 136
726 3300006058 Ga0075432_10082995 Ga0075432_100829953 136
727 3300006173 Ga0070716_100008614 Ga0070716_1000086147 136
728 3300006177 Ga0075362_10075932 Ga0075362_100759322 136
729 3300006177 Ga0075362_10150358 Ga0075362_101503583 136
730 3300006178 Ga0075367_10193645 Ga0075367_101936452 136
731 3300006186 Ga0075369_10026088 Ga0075369_100260883 136
732 3300006195 Ga0075366_10011171 Ga0075366_100111715 136
733 3300006195 Ga0075366_10443400 Ga0075366_104434002 136
734 3300006195 Ga0075366_10672391 Ga0075366_106723912 136
735 3300006237 Ga0097621_100051794 Ga0097621_1000517943 136
736 3300006237 Ga0097621_100605629 Ga0097621_1006056292 136
737 3300006353 Ga0075370_10079858 Ga0075370_100798584 136
738 3300006353 Ga0075370_10135879 Ga0075370_101358793 136
739 3300006358 Ga0068871_100121011 Ga0068871_1001210112 136
740 3300006844 Ga0075428_100056272 Ga0075428_1000562722 136
741 3300006852 Ga0075433_10206341 Ga0075433_102063412 136
742 3300006871 Ga0075434_100314498 Ga0075434_1003144983 136
743 3300006881 Ga0068865_100044915 Ga0068865_1000449154 136
744 3300006931 Ga0097620_100000243 Ga0097620_10000024352 136
745 3300006931 Ga0097620_100001820 Ga0097620_10000182012 136
746 3300006931 Ga0097620_100457744 Ga0097620_1004577443 136
747 3300006948 Ga0099826_10000002 Ga0099826_10000002111 136
748 3300007076 Ga0075435_101070598 Ga0075435_1010705982 136
749 3300007788 Ga0099795_10082889 Ga0099795_100828891 136
750 3300009011 Ga0105251_10533379 Ga0105251_105333791 136
751 3300009093 Ga0105240_10154472 Ga0105240_101544725 136
752 3300009093 Ga0105240_10506534 Ga0105240_105065343 136
753 3300009093 Ga0105240_10995885 Ga0105240_109958852 136
754 3300009094 Ga0111539_10254859 Ga0111539_102548594 136
755 3300009094 Ga0111539_10378931 Ga0111539_103789312 136
756 3300009098 Ga0105245_10008658 Ga0105245_100086584 136
757 3300009098 Ga0105245_10412605 Ga0105245_104126052 136
758 3300009098 Ga0105245_11039253 Ga0105245_110392532 136
759 3300009101 Ga0105247_10012238 Ga0105247_100122383 136
760 3300009147 Ga0114129_10259791 Ga0114129_102597913 136
761 3300009147 Ga0114129_10491158 Ga0114129_104911582 136
762 3300009148 Ga0105243_10000213 Ga0105243_1000021366 136
763 3300009148 Ga0105243_10133638 Ga0105243_101336383 136
764 3300009148 Ga0105243_10260542 Ga0105243_102605422 136
765 3300009148 Ga0105243_10670767 Ga0105243_106707672 136
766 3300009148 Ga0105243_11057650 Ga0105243_110576502 136
767 3300009174 Ga0105241_10002321 Ga0105241_100023216 136
768 3300009174 Ga0105241_10078928 Ga0105241_100789284 136
769 3300009174 Ga0105241_10214795 Ga0105241_102147952 136
770 3300009174 Ga0105241_11593163 Ga0105241_115931631 136
771 3300009174 Ga0105241_12188428 Ga0105241_121884281 136
772 3300009176 Ga0105242_10144122 Ga0105242_101441223 136
773 3300009176 Ga0105242_10370256 Ga0105242_103702562 136
774 3300009176 Ga0105242_10476589 Ga0105242_104765893 136
775 3300009177 Ga0105248_10004700 Ga0105248_1000470014 136
776 3300009177 Ga0105248_10299583 Ga0105248_102995832 136
777 3300009177 Ga0105248_10301647 Ga0105248_103016473 136
778 3300009545 Ga0105237_10015096 Ga0105237_100150967 136
779 3300009545 Ga0105237_10047396 Ga0105237_100473963 136
780 3300009545 Ga0105237_10305688 Ga0105237_103056884 136
781 3300009545 Ga0105237_11750868 Ga0105237_117508682 136
782 3300009551 Ga0105238_10102383 Ga0105238_101023834 136
783 3300009553 Ga0105249_10006303 Ga0105249_100063032 136
784 3300009553 Ga0105249_10018077 Ga0105249_100180776 136
785 3300010375 Ga0105239_10142445 Ga0105239_101424456 136
786 3300010375 Ga0105239_10153056 Ga0105239_101530564 136
787 3300010375 Ga0105239_10321827 Ga0105239_103218273 136
788 3300010375 Ga0105239_10338923 Ga0105239_103389233 136
789 3300010375 Ga0105239_10923065 Ga0105239_109230651 136
790 3300011119 Ga0105246_10114723 Ga0105246_101147232 136
791 3300012513 Ga0157326_1002360 Ga0157326_10023602 136
792 3300013100 Ga0157373_10013087 Ga0157373_100130875 136
793 3300013100 Ga0157373_11298293 Ga0157373_112982932 136
794 3300013102 Ga0157371_10005011 Ga0157371_1000501113 136
795 3300013104 Ga0157370_10292366 Ga0157370_102923662 136
796 3300013105 Ga0157369_10170583 Ga0157369_101705835 136
797 3300013297 Ga0157378_10053233 Ga0157378_100532333 136
798 3300013297 Ga0157378_10797810 Ga0157378_107978101 136
799 3300013306 Ga0163162_10026566 Ga0163162_100265664 136
800 3300013306 Ga0163162_10053372 Ga0163162_100533726 136
801 3300013306 Ga0163162_10120108 Ga0163162_101201084 136
802 3300013306 Ga0163162_10482770 Ga0163162_104827701 136
803 3300013307 Ga0157372_10321704 Ga0157372_103217043 136
804 3300013308 Ga0157375_10490855 Ga0157375_104908553 136
805 3300013308 Ga0157375_11324236 Ga0157375_113242361 136
806 3300014325 Ga0163163_10047359 Ga0163163_100473595 136
807 3300014325 Ga0163163_10376284 Ga0163163_103762843 136
808 3300014326 Ga0157380_10056488 Ga0157380_100564882 136
809 3300014326 Ga0157380_10081715 Ga0157380_100817152 136
810 3300014326 Ga0157380_10960150 Ga0157380_109601502 136
811 3300014326 Ga0157380_11444586 Ga0157380_114445861 136
812 3300014745 Ga0157377_10012955 Ga0157377_100129552 136
813 3300014745 Ga0157377_10259300 Ga0157377_102593002 136
814 3300014745 Ga0157377_10552740 Ga0157377_105527402 136
815 3300014968 Ga0157379_10032845 Ga0157379_100328454 136
816 3300014968 Ga0157379_10091372 Ga0157379_100913723 136
817 3300014968 Ga0157379_10223613 Ga0157379_102236134 136
818 3300014969 Ga0157376_10199919 Ga0157376_101999193 136
819 3300017792 Ga0163161_10106650 Ga0163161_101066502 136
820 3300017792 Ga0163161_10120402 Ga0163161_101204023 136
821 3300025226 Ga0209674_115782 Ga0209674_1157822 136
822 3300025230 Ga0209563_100116 Ga0209563_10011647 136
823 3300025230 Ga0209563_102989 Ga0209563_1029892 136
824 3300025245 Ga0207425_1009648 Ga0207425_10096484 136
825 3300025253 Ga0209677_101529 Ga0209677_1015291 136
826 3300025254 Ga0209148_1000011 Ga0209148_100001124 136
827 3300025254 Ga0209148_1000578 Ga0209148_100057824 136
828 3300025254 Ga0209148_1020537 Ga0209148_10205372 136
829 3300025254 Ga0209148_1026795 Ga0209148_10267951 136
830 3300025261 Ga0209233_1006411 Ga0209233_10064112 136
831 3300025261 Ga0209233_1010267 Ga0209233_10102673 136
832 3300025261 Ga0209233_1044497 Ga0209233_10444971 136
833 3300025272 Ga0209455_1000006 Ga0209455_10000061170 136
834 3300025272 Ga0209455_1000876 Ga0209455_10008764 136
835 3300025272 Ga0209455_1016198 Ga0209455_10161982 136
836 3300025272 Ga0209455_1042491 Ga0209455_10424912 136
837 3300025273 Ga0209673_1021991 Ga0209673_10219912 136
838 3300025295 Ga0209564_1004581 Ga0209564_10045819 136
839 3300025295 Ga0209564_1008808 Ga0209564_10088083 136
840 3300025295 Ga0209564_1011604 Ga0209564_10116042 136
841 3300025297 Ga0209758_1000026 Ga0209758_1000026133 136
842 3300025297 Ga0209758_1001536 Ga0209758_10015366 136
843 3300025297 Ga0209758_1005453 Ga0209758_10054539 136
844 3300025297 Ga0209758_1009114 Ga0209758_10091148 136
845 3300025297 Ga0209758_1149875 Ga0209758_11498752 136
846 3300025298 Ga0209050_1007640 Ga0209050_10076406 136
847 3300025299 Ga0209256_1000007 Ga0209256_1000007680 136
848 3300025299 Ga0209256_1032368 Ga0209256_10323682 136
849 3300025302 Ga0207426_1006447 Ga0207426_10064476 136
850 3300025302 Ga0207426_1013770 Ga0207426_10137704 136
851 3300025303 Ga0209051_1013609 Ga0209051_10136092 136
852 3300025304 Ga0209257_1005738 Ga0209257_10057384 136
853 3300025304 Ga0209257_1009389 Ga0209257_10093896 136
854 3300025315 Ga0207697_10212146 Ga0207697_102121462 136
855 3300025321 Ga0207656_10020184 Ga0207656_100201842 136
856 3300025885 Ga0207653_10000615 Ga0207653_1000061510 136
857 3300025893 Ga0207682_10125361 Ga0207682_101253612 136
858 3300025899 Ga0207642_10066517 Ga0207642_100665173 136
859 3300025899 Ga0207642_10479441 Ga0207642_104794411 136
860 3300025900 Ga0207710_10087285 Ga0207710_100872852 136
861 3300025900 Ga0207710_10781758 Ga0207710_107817581 136
862 3300025901 Ga0207688_10046773 Ga0207688_100467734 136
863 3300025903 Ga0207680_10619874 Ga0207680_106198742 136
864 3300025904 Ga0207647_10001122 Ga0207647_100011226 136
865 3300025904 Ga0207647_10015165 Ga0207647_100151657 136
866 3300025904 Ga0207647_10025233 Ga0207647_100252336 136
867 3300025904 Ga0207647_10141757 Ga0207647_101417572 136
868 3300025904 Ga0207647_10239185 Ga0207647_102391853 136
869 3300025907 Ga0207645_10036859 Ga0207645_100368592 136
870 3300025911 Ga0207654_10001228 Ga0207654_100012285 136
871 3300025911 Ga0207654_10022738 Ga0207654_100227383 136
872 3300025911 Ga0207654_10031554 Ga0207654_100315542 136
873 3300025911 Ga0207654_10057695 Ga0207654_100576954 136
874 3300025911 Ga0207654_10776096 Ga0207654_107760962 136
875 3300025912 Ga0207707_10000852 Ga0207707_1000085232 136
876 3300025912 Ga0207707_10046627 Ga0207707_100466272 136
877 3300025912 Ga0207707_11451837 Ga0207707_114518371 136
878 3300025913 Ga0207695_10029722 Ga0207695_100297223 136
879 3300025913 Ga0207695_10106162 Ga0207695_101061622 136
880 3300025913 Ga0207695_11701507 Ga0207695_117015071 136
881 3300025914 Ga0207671_10037979 Ga0207671_100379791 136
882 3300025914 Ga0207671_10144307 Ga0207671_101443073 136
883 3300025914 Ga0207671_10148867 Ga0207671_101488673 136
884 3300025914 Ga0207671_10455403 Ga0207671_104554032 136
885 3300025917 Ga0207660_10001673 Ga0207660_100016737 136
886 3300025917 Ga0207660_10030337 Ga0207660_100303371 136
887 3300025917 Ga0207660_10348500 Ga0207660_103485003 136
888 3300025918 Ga0207662_10036899 Ga0207662_100368992 136
889 3300025918 Ga0207662_10117496 Ga0207662_101174962 136
890 3300025918 Ga0207662_10475637 Ga0207662_104756372 136
891 3300025919 Ga0207657_10007172 Ga0207657_100071726 136
892 3300025919 Ga0207657_10021785 Ga0207657_100217855 136
893 3300025919 Ga0207657_11041242 Ga0207657_110412421 136
894 3300025920 Ga0207649_10000225 Ga0207649_1000022528 136
895 3300025920 Ga0207649_10008280 Ga0207649_100082804 136
896 3300025920 Ga0207649_10392450 Ga0207649_103924502 136
897 3300025921 Ga0207652_10019841 Ga0207652_100198412 136
898 3300025921 Ga0207652_10056877 Ga0207652_100568772 136
899 3300025921 Ga0207652_10306724 Ga0207652_103067241 136
900 3300025921 Ga0207652_10340398 Ga0207652_103403982 136
901 3300025923 Ga0207681_10056349 Ga0207681_100563492 136
902 3300025924 Ga0207694_10195777 Ga0207694_101957774 136
903 3300025924 Ga0207694_10374321 Ga0207694_103743213 136
904 3300025924 Ga0207694_10642783 Ga0207694_106427833 136
905 3300025926 Ga0207659_10435641 Ga0207659_104356412 136
906 3300025927 Ga0207687_10022557 Ga0207687_100225577 136
907 3300025927 Ga0207687_10026448 Ga0207687_100264483 136
908 3300025927 Ga0207687_10387443 Ga0207687_103874431 136
909 3300025931 Ga0207644_10097618 Ga0207644_100976185 136
910 3300025931 Ga0207644_10324995 Ga0207644_103249953 136
911 3300025931 Ga0207644_10451204 Ga0207644_104512042 136
912 3300025932 Ga0207690_10003708 Ga0207690_100037089 136
913 3300025932 Ga0207690_10482257 Ga0207690_104822573 136
914 3300025933 Ga0207706_10188872 Ga0207706_101888722 136
915 3300025933 Ga0207706_10275460 Ga0207706_102754603 136
916 3300025933 Ga0207706_10937609 Ga0207706_109376092 136
917 3300025934 Ga0207686_10465797 Ga0207686_104657972 136
918 3300025934 Ga0207686_10478369 Ga0207686_104783693 136
919 3300025934 Ga0207686_10565079 Ga0207686_105650793 136
920 3300025935 Ga0207709_10000018 Ga0207709_1000001878 136
921 3300025935 Ga0207709_10010467 Ga0207709_100104677 136
922 3300025935 Ga0207709_10369141 Ga0207709_103691412 136
923 3300025935 Ga0207709_11119039 Ga0207709_111190391 136
924 3300025936 Ga0207670_10586549 Ga0207670_105865492 136
925 3300025937 Ga0207669_10012958 Ga0207669_100129584 136
926 3300025937 Ga0207669_10014655 Ga0207669_100146552 136
927 3300025937 Ga0207669_10318367 Ga0207669_103183673 136
928 3300025938 Ga0207704_10134129 Ga0207704_101341293 136
929 3300025941 Ga0207711_10002918 Ga0207711_100029187 136
930 3300025941 Ga0207711_10168495 Ga0207711_101684952 136
931 3300025941 Ga0207711_10308548 Ga0207711_103085483 136
932 3300025942 Ga0207689_10083686 Ga0207689_100836863 136
933 3300025942 Ga0207689_10983329 Ga0207689_109833291 136
934 3300025945 Ga0207679_10068738 Ga0207679_100687382 136
935 3300025945 Ga0207679_10172347 Ga0207679_101723473 136
936 3300025945 Ga0207679_10496903 Ga0207679_104969032 136
937 3300025949 Ga0207667_10246654 Ga0207667_102466544 136
938 3300025960 Ga0207651_10009390 Ga0207651_100093902 136
939 3300025960 Ga0207651_10127815 Ga0207651_101278153 136
940 3300025960 Ga0207651_10499924 Ga0207651_104999241 136
941 3300025961 Ga0207712_10038467 Ga0207712_100384673 136
942 3300025961 Ga0207712_10085168 Ga0207712_100851684 136
943 3300025972 Ga0207668_10018721 Ga0207668_100187214 136
944 3300025972 Ga0207668_10168921 Ga0207668_101689214 136
945 3300025972 Ga0207668_10429869 Ga0207668_104298691 136
946 3300025972 Ga0207668_10435724 Ga0207668_104357242 136
947 3300025981 Ga0207640_10096493 Ga0207640_100964932 136
948 3300025981 Ga0207640_10179964 Ga0207640_101799642 136
949 3300025981 Ga0207640_11136150 Ga0207640_111361501 136
950 3300025986 Ga0207658_10079721 Ga0207658_100797213 136
951 3300025986 Ga0207658_10138199 Ga0207658_101381993 136
952 3300025986 Ga0207658_10667850 Ga0207658_106678501 136
953 3300025986 Ga0207658_10994499 Ga0207658_109944992 136
954 3300026035 Ga0207703_10361645 Ga0207703_103616453 136
955 3300026035 Ga0207703_10375563 Ga0207703_103755631 136
956 3300026035 Ga0207703_10381297 Ga0207703_103812972 136
957 3300026035 Ga0207703_11065667 Ga0207703_110656671 136
958 3300026035 Ga0207703_11594316 Ga0207703_115943162 136
959 3300026041 Ga0207639_10002313 Ga0207639_1000231310 136
960 3300026041 Ga0207639_10463625 Ga0207639_104636253 136
961 3300026041 Ga0207639_11222663 Ga0207639_112226632 136
962 3300026067 Ga0207678_10006547 Ga0207678_100065472 136
963 3300026067 Ga0207678_10026500 Ga0207678_100265007 136
964 3300026067 Ga0207678_10033426 Ga0207678_100334263 136
965 3300026075 Ga0207708_10000488 Ga0207708_1000048817 136
966 3300026075 Ga0207708_10000776 Ga0207708_1000077622 136
967 3300026075 Ga0207708_10453936 Ga0207708_104539361 136
968 3300026078 Ga0207702_10001111 Ga0207702_1000111129 136
969 3300026078 Ga0207702_10084712 Ga0207702_100847124 136
970 3300026078 Ga0207702_10156055 Ga0207702_101560554 136
971 3300026078 Ga0207702_10583107 Ga0207702_105831072 136
972 3300026078 Ga0207702_11196312 Ga0207702_111963122 136
973 3300026088 Ga0207641_10070060 Ga0207641_100700602 136
974 3300026088 Ga0207641_10190145 Ga0207641_101901452 136
975 3300026089 Ga0207648_10046235 Ga0207648_100462354 136
976 3300026089 Ga0207648_10365217 Ga0207648_103652172 136
977 3300026095 Ga0207676_10011695 Ga0207676_100116956 136
978 3300026095 Ga0207676_10781438 Ga0207676_107814382 136
979 3300026116 Ga0207674_10004426 Ga0207674_100044267 136
980 3300026116 Ga0207674_10024383 Ga0207674_100243838 136
981 3300026116 Ga0207674_10294377 Ga0207674_102943773 136
982 3300026116 Ga0207674_11348680 Ga0207674_113486802 136
983 3300026118 Ga0207675_100000011 Ga0207675_1000000116 136
984 3300026118 Ga0207675_100001448 Ga0207675_10000144819 136
985 3300026118 Ga0207675_100015329 Ga0207675_1000153297 136
986 3300026118 Ga0207675_100179187 Ga0207675_1001791875 136
987 3300026118 Ga0207675_100185678 Ga0207675_1001856784 136
988 3300026118 Ga0207675_101564135 Ga0207675_1015641351 136
989 3300026121 Ga0207683_10320560 Ga0207683_103205602 136
990 3300026142 Ga0207698_10001209 Ga0207698_1000120910 136
991 3300026142 Ga0207698_10007060 Ga0207698_100070608 136
992 3300026142 Ga0207698_10332780 Ga0207698_103327802 136
993 3300026142 Ga0207698_10504526 Ga0207698_105045263 136
994 3300026142 Ga0207698_10692885 Ga0207698_106928852 136
995 3300026142 Ga0207698_11760656 Ga0207698_117606561 136
996 3300027666 Ga0209282_1000001 Ga0209282_10000011036 136
997 3300027717 Ga0209998_10017440 Ga0209998_100174402 136
998 3300027866 Ga0209813_10050410 Ga0209813_100504103 136
999 3300027866 Ga0209813_10081341 Ga0209813_100813412 136
1000 3300028379 Ga0268266_10000002 Ga0268266_100000021842 136
1001 3300028379 Ga0268266_10118211 Ga0268266_101182114 136
1002 3300028379 Ga0268266_10379038 Ga0268266_103790383 136
1003 3300028380 Ga0268265_10088412 Ga0268265_100884124 136
1004 3300028380 Ga0268265_10584428 Ga0268265_105844283 136
1005 3300028380 Ga0268265_10635914 Ga0268265_106359143 136
1006 3300028381 Ga0268264_10016842 Ga0268264_100168425 136
1007 3300028381 Ga0268264_10494877 Ga0268264_104948772 136
1008 3300028794 Ga0307515_10160552 Ga0307515_101605522 136
1009 3300028800 Ga0265338_10039470 Ga0265338_100394702 136
1010 3300031456 Ga0307513_10109293 Ga0307513_101092935 136
1011 3300031456 Ga0307513_10323569 Ga0307513_103235693 136
1012 3300031507 Ga0307509_10000013 Ga0307509_1000001318 136
1013 3300031548 Ga0307408_100255626 Ga0307408_1002556263 136
1014 3300031712 Ga0265342_10088609 Ga0265342_100886091 136
1015 3300031824 Ga0307413_10675500 Ga0307413_106755001 136
1016 3300031852 Ga0307410_10183088 Ga0307410_101830883 136
1017 3300031903 Ga0307407_10979182 Ga0307407_109791822 136
1018 3300031911 Ga0307412_10191259 Ga0307412_101912592 136
1019 3300031911 Ga0307412_12173852 Ga0307412_121738521 136
1020 3300031995 Ga0307409_100308180 Ga0307409_1003081802 136
1021 3300032002 Ga0307416_100205968 Ga0307416_1002059683 136
1022 3300032004 Ga0307414_11413989 Ga0307414_114139891 136
1023 3300033180 Ga0307510_10095926 Ga0307510_100959263 136
1024 3300033180 Ga0307510_10242811 Ga0307510_102428112 136
1025 3300034816 Ga0373930_0012940 Ga0373930_0012940_466_897 136
1026 3300034819 Ga0373958_0019203 Ga0373958_0019203_483_914 136
1027 3300035085 Ga0373929_0088522 Ga0373929_0088522_15_446 136
1028 3300035088 Ga0373940_0006102 Ga0373940_0006102_2049_2480 136
1029 3300035691 Ga0373931_0020603 Ga0373931_0020603_338_769 136
1030 3300035691 Ga0373931_0850066 Ga0373931_0850066_109_540 136
1031 3300035695 Ga0373927_0036186 Ga0373927_0036186_2122_2553 136
1032 3300035695 Ga0373927_0297143 Ga0373927_0297143_217_648 136
1033 3300035725 Ga0373947_0534655 Ga0373947_0534655_170_601 136
1034 3300037068 Ga0373925_0834629 Ga0373925_0834629_20_451 136
1035 3300037466 Ga0395898_0094170 Ga0395898_0094170_416_847 136
1036 3300037466 Ga0395898_0111975 Ga0395898_0111975_588_1019 136
1037 3300037471 Ga0395905_0047818 Ga0395905_0047818_451_882 136
1038 3300037471 Ga0395905_0192819 Ga0395905_0192819_973_1392 136
1039 3300037471 Ga0395905_0277022 Ga0395905_0277022_495_926 136
1040 3300037471 Ga0395905_0461844 Ga0395905_0461844_566_997 136
1041 3300037471 Ga0395905_0516134 Ga0395905_0516134_477_908 136
1042 3300037471 Ga0395905_0540154 Ga0395905_0540154_95_505 136
1043 3300037471 Ga0395905_1037796 Ga0395905_1037796_30_461 136
1044 3300037471 Ga0395905_1463445 Ga0395905_1463445_81_491 136
1045 3300037853 Ga0436364_0450134 Ga0436364_0450134_531_941 136
1046 3300037853 Ga0436364_0796860 Ga0436364_0796860_73_504 136
1047 3300038443 Ga0395901_0021632 Ga0395901_0021632_4520_4933 136
1048 3300038443 Ga0395901_0284067 Ga0395901_0284067_626_1057 136
1049 3300038443 Ga0395901_0477936 Ga0395901_0477936_616_1047 136
1050 3300038443 Ga0395901_1256871 Ga0395901_1256871_91_510 136
1051 3300039437 Ga0436365_0224118 Ga0436365_0224118_268_699 136
1052 3300039437 Ga0436365_0396957 Ga0436365_0396957_132_563 136
1053 3300039437 Ga0436365_1268888 Ga0436365_1268888_238_648 136
1054 3300041408 Ga0439453_0022803 Ga0439453_0022803_259_690 136
1055 3300041451 Ga0451791_1276388 Ga0451791_1276388_82_513 136
1056 3300041451 Ga0451791_1771099 Ga0451791_1771099_486_917 136
1057 3300041452 Ga0451793_1615561 Ga0451793_1615561_114_545 136
1058 3300041459 Ga0451800_1103286 Ga0451800_1103286_51_461 136
1059 3300041486 Ga0451807_1108795 Ga0451807_1108795_108_539 136
1060 3300041492 Ga0451835_0691213 Ga0451835_0691213_134_565 136
1061 3300041501 Ga0451845_0352644 Ga0451845_0352644_38_448 136
1062 3300041507 Ga0451851_0269221 Ga0451851_0269221_501_932 136
1063 3300041512 Ga0451853_3654192 Ga0451853_3654192_140_571 136
1064 3300042005 Ga0439448_0003740 Ga0439448_0003740_630_1052 136
1065 3300042008 Ga0439450_015806 Ga0439450_015806_461_883 136
1066 3300042008 Ga0439450_026906 Ga0439450_026906_629_1042 136
1067 3300042436 Ga0439435_0013209 Ga0439435_0013209_472_903 136
1068 3300042438 Ga0439459_0128012 Ga0439459_0128012_176_589 136
1069 3300044656 Ga0466969_0010526 Ga0466969_0010526_1707_2138 136
1070 3300044673 Ga0453683_0463360 Ga0453683_0463360_372_803 136
1071 3300044683 Ga0466965_0005417 Ga0466965_0005417_4889_5299 136
1072 3300044683 Ga0466965_0141190 Ga0466965_0141190_603_1034 136
1073 3300044683 Ga0466965_0360630 Ga0466965_0360630_173_604 136
1074 3300044684 Ga0466966_0005947 Ga0466966_0005947_3919_4350 136
1075 3300044684 Ga0466966_0158724 Ga0466966_0158724_687_1100 136
1076 3300044684 Ga0466966_0612220 Ga0466966_0612220_147_557 136
1077 3300044693 Ga0466961_0000863 Ga0466961_0000863_14510_14941 136
1078 3300044693 Ga0466961_0003976 Ga0466961_0003976_3159_3569 136
1079 3300044693 Ga0466961_0454383 Ga0466961_0454383_212_625 136
1080 3300044694 Ga0466963_0008115 Ga0466963_0008115_705_1115 136
1081 3300044694 Ga0466963_1080777 Ga0466963_1080777_75_488 136
1082 3300044706 Ga0466964_0000042 Ga0466964_0000042_24106_24528 136
1083 3300044706 Ga0466964_0016732 Ga0466964_0016732_117_527 136
1084 3300044706 Ga0466964_0075336 Ga0466964_0075336_285_695 136
1085 3300044706 Ga0466964_0354837 Ga0466964_0354837_48_461 136
1086 3300044719 Ga0466971_0018497 Ga0466971_0018497_827_1237 136
1087 3300044719 Ga0466971_0148221 Ga0466971_0148221_95_514 136
1088 3300044735 Ga0466968_0077952 Ga0466968_0077952_901_1332 136
1089 3300044765 Ga0466970_0002328 Ga0466970_0002328_4678_5088 136
1090 3300044765 Ga0466970_0019044 Ga0466970_0019044_1656_2066 136
1091 3300044765 Ga0466970_0475220 Ga0466970_0475220_224_637 136
1092 3300044842 Ga0466957_0183957 Ga0466957_0183957_771_1190 136
1093 3300044842 Ga0466957_0233670 Ga0466957_0233670_561_995 136
1094 3300044842 Ga0466957_0402039 Ga0466957_0402039_489_899 136
1095 3300044901 Ga0466960_0127399 Ga0466960_0127399_61_492 136
1096 3300045049 Ga0466959_0000648 Ga0466959_0000648_18294_18704 136
1097 3300045049 Ga0466959_0014195 Ga0466959_0014195_1391_1822 136
1098 3300045051 Ga0451576_0618156 Ga0451576_0618156_349_780 136
1099 3300045836 Ga0466958_0000250 Ga0466958_0000250_18625_19044 136
1100 3300045836 Ga0466958_0002080 Ga0466958_0002080_4524_4934 136
1101 3300045836 Ga0466958_0030782 Ga0466958_0030782_1208_1618 136
1102 3300045976 Ga0466967_0004712 Ga0466967_0004712_5094_5516 136
1103 3300045976 Ga0466967_0005881 Ga0466967_0005881_6089_6520 136
1104 3300045976 Ga0466967_0055268 Ga0466967_0055268_245_655 136
1105 3300045976 Ga0466967_0281423 Ga0466967_0281423_711_1142 136
1106 3300045976 Ga0466967_0937460 Ga0466967_0937460_114_545 136
1107 3300046452 Ga0495617_069919 Ga0495617_069919_273_683 136
1108 3300046454 Ga0495592_0022986 Ga0495592_0022986_1666_2097 136
1109 3300046454 Ga0495592_0098350 Ga0495592_0098350_1043_1474 136
1110 3300046457 Ga0495590_0034232 Ga0495590_0034232_1294_1707 136
1111 3300046457 Ga0495590_0086221 Ga0495590_0086221_404_835 136
1112 3300046459 Ga0495629_0006687 Ga0495629_0006687_7731_8162 136
1113 3300046460 Ga0495638_0006848 Ga0495638_0006848_1535_1966 136
1114 3300046460 Ga0495638_0017968 Ga0495638_0017968_491_922 136
1115 3300046460 Ga0495638_0048258 Ga0495638_0048258_1923_2342 136
1116 3300046462 Ga0495651_0008654 Ga0495651_0008654_3462_3893 136
1117 3300046462 Ga0495651_0148809 Ga0495651_0148809_490_921 136
1118 3300046463 Ga0495653_0237596 Ga0495653_0237596_474_905 136
1119 3300046471 Ga0495650_0000373 Ga0495650_0000373_65279_65689 136
1120 3300046471 Ga0495650_0014674 Ga0495650_0014674_1569_2000 136
1121 3300046473 Ga0495582_0226110 Ga0495582_0226110_346_777 136
1122 3300046474 Ga0495605_0000176 Ga0495605_0000176_4128_4541 136
1123 3300046474 Ga0495605_0262766 Ga0495605_0262766_166_597 136
1124 3300046475 Ga0495639_0316334 Ga0495639_0316334_304_735 136
1125 3300046476 Ga0495662_0199942 Ga0495662_0199942_439_870 136
1126 3300046477 Ga0495664_0023203 Ga0495664_0023203_1370_1801 136
1127 3300046477 Ga0495664_0077488 Ga0495664_0077488_585_1016 136
1128 3300046491 Ga0495584_0000031 Ga0495584_0000031_76349_76762 136
1129 3300046491 Ga0495584_0112348 Ga0495584_0112348_920_1351 136
1130 3300046491 Ga0495584_0152962 Ga0495584_0152962_618_1028 136
1131 3300046492 Ga0495585_0107410 Ga0495585_0107410_985_1395 136
1132 3300046492 Ga0495585_0174635 Ga0495585_0174635_271_702 136
1133 3300046499 Ga0495594_0495824 Ga0495594_0495824_105_536 136
1134 3300046500 Ga0495596_0004017 Ga0495596_0004017_2794_3204 136
1135 3300046500 Ga0495596_0129895 Ga0495596_0129895_292_723 136
1136 3300046501 Ga0495607_0002229 Ga0495607_0002229_108_521 136
1137 3300046501 Ga0495607_0361002 Ga0495607_0361002_61_492 136
1138 3300046506 Ga0495583_0001879 Ga0495583_0001879_14861_15271 136
1139 3300046506 Ga0495583_0018160 Ga0495583_0018160_59_469 136
1140 3300046506 Ga0495583_0031145 Ga0495583_0031145_730_1140 136
1141 3300046506 Ga0495583_0317301 Ga0495583_0317301_67_498 136
1142 3300046507 Ga0495606_0004509 Ga0495606_0004509_7932_8345 136
1143 3300046507 Ga0495606_0006533 Ga0495606_0006533_7676_8107 136
1144 3300046507 Ga0495606_0046033 Ga0495606_0046033_28_438 136
1145 3300046507 Ga0495606_0176499 Ga0495606_0176499_716_1147 136
1146 3300046507 Ga0495606_0220648 Ga0495606_0220648_175_606 136
1147 3300046507 Ga0495606_0251487 Ga0495606_0251487_431_862 136
1148 3300046511 Ga0495608_0042890 Ga0495608_0042890_296_727 136
1149 3300046511 Ga0495608_0159363 Ga0495608_0159363_852_1283 136
1150 3300046512 Ga0495610_0149709 Ga0495610_0149709_339_770 136
1151 3300046513 Ga0495616_0000321 Ga0495616_0000321_34106_34537 136
1152 3300046514 Ga0495618_0265006 Ga0495618_0265006_359_790 136
1153 3300046516 Ga0495628_0016659 Ga0495628_0016659_4176_4607 136
1154 3300046517 Ga0495630_1286808 Ga0495630_1286808_60_491 136
1155 3300046518 Ga0495631_0063005 Ga0495631_0063005_987_1397 136
1156 3300046518 Ga0495631_0067513 Ga0495631_0067513_787_1206 136
1157 3300046518 Ga0495631_0201804 Ga0495631_0201804_321_734 136
1158 3300046519 Ga0495632_0004685 Ga0495632_0004685_8048_8479 136
1159 3300046519 Ga0495632_0031748 Ga0495632_0031748_349_780 136
1160 3300046519 Ga0495632_0215063 Ga0495632_0215063_422_835 136
1161 3300046520 Ga0495637_0168815 Ga0495637_0168815_169_618 136
1162 3300046522 Ga0495643_0002948 Ga0495643_0002948_12368_12781 136
1163 3300046522 Ga0495643_0003289 Ga0495643_0003289_10230_10640 136
1164 3300046522 Ga0495643_0007636 Ga0495643_0007636_5613_6023 136
1165 3300046522 Ga0495643_0007678 Ga0495643_0007678_3050_3484 136
1166 3300046522 Ga0495643_0085865 Ga0495643_0085865_911_1321 136
1167 3300046522 Ga0495643_0122962 Ga0495643_0122962_354_785 136
1168 3300046522 Ga0495643_0138861 Ga0495643_0138861_678_1109 136
1169 3300046522 Ga0495643_0140293 Ga0495643_0140293_464_895 136
1170 3300046522 Ga0495643_0358090 Ga0495643_0358090_141_572 136
1171 3300046523 Ga0495644_0021326 Ga0495644_0021326_557_988 136
1172 3300046524 Ga0495648_0007417 Ga0495648_0007417_4129_4539 136
1173 3300046524 Ga0495648_0014544 Ga0495648_0014544_3255_3686 136
1174 3300046524 Ga0495648_0033000 Ga0495648_0033000_1763_2194 136
1175 3300046524 Ga0495648_0064299 Ga0495648_0064299_1213_1644 136
1176 3300046524 Ga0495648_0130203 Ga0495648_0130203_412_822 136
1177 3300046524 Ga0495648_0293766 Ga0495648_0293766_235_645 136
1178 3300046525 Ga0495663_0001136 Ga0495663_0001136_4128_4538 136
1179 3300046528 Ga0495642_0047458 Ga0495642_0047458_401_835 136
1180 3300046528 Ga0495642_0050520 Ga0495642_0050520_323_754 136
1181 3300046528 Ga0495642_0147126 Ga0495642_0147126_68_478 136
1182 3300046528 Ga0495642_0340403 Ga0495642_0340403_20_451 136
1183 3300046529 Ga0495652_0107280 Ga0495652_0107280_634_1065 136
1184 3300046533 Ga0495640_0090607 Ga0495640_0090607_547_978 136
1185 3300046536 Ga0495587_0049814 Ga0495587_0049814_450_881 136
1186 3300046536 Ga0495587_0063977 Ga0495587_0063977_439_849 136
1187 3300046537 Ga0495598_0114659 Ga0495598_0114659_104_535 136
1188 3300046543 Ga0495645_0087057 Ga0495645_0087057_1649_2080 136
1189 3300046543 Ga0495645_0104244 Ga0495645_0104244_1057_1488 136
1190 3300046557 Ga0495622_0004127 Ga0495622_0004127_1794_2204 136
1191 3300046557 Ga0495622_0065162 Ga0495622_0065162_297_728 136
1192 3300046558 Ga0495633_0007100 Ga0495633_0007100_3211_3621 136
1193 3300046559 Ga0495667_0110914 Ga0495667_0110914_634_1065 136
1194 3300046615 Ga0495656_0009992 Ga0495656_0009992_2416_2847 136
1195 3300046616 Ga0495668_0000072 Ga0495668_0000072_163149_163559 136
1196 3300046616 Ga0495668_0003172 Ga0495668_0003172_10362_10793 136
1197 3300046616 Ga0495668_0007792 Ga0495668_0007792_3714_4145 136
1198 3300046616 Ga0495668_0013068 Ga0495668_0013068_542_973 136
1199 3300046616 Ga0495668_0050035 Ga0495668_0050035_1519_1950 136
1200 3300046616 Ga0495668_0329580 Ga0495668_0329580_121_552 136
1201 3300046642 Ga0495634_0333357 Ga0495634_0333357_454_885 136
1202 3300046648 Ga0495611_0302586 Ga0495611_0302586_231_641 136
1203 3300046660 Ga0495625_0003433 Ga0495625_0003433_6821_7234 136
1204 3300046660 Ga0495625_0030150 Ga0495625_0030150_770_1189 136
1205 3300046660 Ga0495625_0066928 Ga0495625_0066928_245_655 136
1206 3300046660 Ga0495625_0074593 Ga0495625_0074593_1226_1636 136
1207 3300046660 Ga0495625_0211301 Ga0495625_0211301_684_1094 136
1208 3300046660 Ga0495625_0318202 Ga0495625_0318202_153_584 136
1209 3300046660 Ga0495625_0427712 Ga0495625_0427712_173_604 136
1210 3300046663 Ga0495635_0062415 Ga0495635_0062415_1421_1852 136
1211 3300046665 Ga0495661_0004689 Ga0495661_0004689_3470_3901 136
1212 3300046665 Ga0495661_0087097 Ga0495661_0087097_1292_1705 136
1213 3300046665 Ga0495661_0176134 Ga0495661_0176134_449_868 136
1214 3300046665 Ga0495661_0580908 Ga0495661_0580908_27_437 136
1215 3300046674 Ga0495588_0000125 Ga0495588_0000125_55286_55699 136
1216 3300046675 Ga0495657_0005091 Ga0495657_0005091_4649_5080 136
1217 3300046675 Ga0495657_0026479 Ga0495657_0026479_332_763 136
1218 3300046678 Ga0495599_0051503 Ga0495599_0051503_1699_2130 136
1219 3300046678 Ga0495599_0078966 Ga0495599_0078966_890_1321 136
1220 3300046679 Ga0495623_0019288 Ga0495623_0019288_564_995 136
1221 3300046680 Ga0495646_0027624 Ga0495646_0027624_3106_3537 136
1222 3300046680 Ga0495646_0034737 Ga0495646_0034737_467_898 136
1223 3300046683 Ga0495658_0347691 Ga0495658_0347691_50_481 136
1224 3300046683 Ga0495658_0768571 Ga0495658_0768571_136_567 136
1225 3300046684 Ga0495669_0000221 Ga0495669_0000221_21891_22301 136
1226 3300046684 Ga0495669_0019029 Ga0495669_0019029_190_621 136
1227 3300046689 Ga0495613_0211902 Ga0495613_0211902_446_877 136
1228 3300046691 Ga0495670_0072728 Ga0495670_0072728_205_636 136
1229 3300046691 Ga0495670_0616348 Ga0495670_0616348_71_481 136
1230 3300046692 Ga0495671_0155733 Ga0495671_0155733_284_715 136
1231 3300046692 Ga0495671_0389704 Ga0495671_0389704_107_517 136
1232 3300046694 Ga0495649_0008578 Ga0495649_0008578_517_948 136
1233 3300046694 Ga0495649_0092739 Ga0495649_0092739_444_854 136
1234 3300046694 Ga0495649_0126251 Ga0495649_0126251_562_975 136
1235 3300046694 Ga0495649_0224310 Ga0495649_0224310_331_762 136
1236 3300046794 Ga0495589_0000171 Ga0495589_0000171_4506_4919 136
1237 3300046809 Ga0495600_0000885 Ga0495600_0000885_4001_4411 136
1238 3300046809 Ga0495600_0003192 Ga0495600_0003192_2784_3215 136
1239 3300046809 Ga0495600_0014790 Ga0495600_0014790_3349_3780 136
1240 3300046810 Ga0495660_0000042 Ga0495660_0000042_163886_164299 136
1241 3300047315 Ga0495581_0045609 Ga0495581_0045609_703_1134 136
1242 3300047317 Ga0495604_0001817 Ga0495604_0001817_13508_13939 136
1243 3300047319 Ga0495674_0083125 Ga0495674_0083125_1779_2210 136
1244 3300047319 Ga0495674_0319964 Ga0495674_0319964_102_533 136
1245 3300047319 Ga0495674_0557139 Ga0495674_0557139_24_455 136
1246 3300047319 Ga0495674_0656737 Ga0495674_0656737_25_456 136
1247 3300047320 Ga0495672_0000272 Ga0495672_0000272_10358_10789 136
1248 3300047320 Ga0495672_0002336 Ga0495672_0002336_15424_15837 136
1249 3300047320 Ga0495672_0124436 Ga0495672_0124436_91_522 136
1250 3300047321 Ga0495676_0042637 Ga0495676_0042637_1163_1594 136
1251 3300047322 Ga0495680_0058502 Ga0495680_0058502_1970_2401 136
1252 3300047323 Ga0495683_0004576 Ga0495683_0004576_1962_2372 136
1253 3300047323 Ga0495683_0184582 Ga0495683_0184582_232_645 136
1254 3300047323 Ga0495683_0201845 Ga0495683_0201845_432_842 136
1255 3300047443 Ga0495687_000205 Ga0495687_000205_76113_76526 136
1256 3300047443 Ga0495687_000361 Ga0495687_000361_31076_31489 136
1257 3300047443 Ga0495687_001653 Ga0495687_001653_13503_13913 136
1258 3300047443 Ga0495687_024634 Ga0495687_024634_810_1241 136
1259 3300047444 Ga0495675_0010677 Ga0495675_0010677_2070_2501 136
1260 3300047445 Ga0495677_0000736 Ga0495677_0000736_1288_1698 136
1261 3300047445 Ga0495677_0002652 Ga0495677_0002652_188_601 136
1262 3300047445 Ga0495677_0025976 Ga0495677_0025976_992_1405 136
1263 3300047445 Ga0495677_0091742 Ga0495677_0091742_501_911 136
1264 3300047447 Ga0495685_058342 Ga0495685_058342_44_463 136
1265 3300047469 Ga0495673_0022834 Ga0495673_0022834_1867_2298 136
1266 3300047469 Ga0495673_0081414 Ga0495673_0081414_759_1190 136
1267 3300047469 Ga0495673_0088619 Ga0495673_0088619_174_605 136
1268 3300047471 Ga0495684_0395627 Ga0495684_0395627_340_771 136
1269 3300047472 Ga0495686_0005217 Ga0495686_0005217_6506_6937 136
1270 3300047472 Ga0495686_0018349 Ga0495686_0018349_3713_4144 136
1271 3300047472 Ga0495686_0029191 Ga0495686_0029191_2292_2723 136
1272 3300047472 Ga0495686_0067170 Ga0495686_0067170_1721_2152 136
1273 3300047472 Ga0495686_0086263 Ga0495686_0086263_1120_1551 136
1274 3300047472 Ga0495686_0106683 Ga0495686_0106683_1202_1633 136
1275 3300047472 Ga0495686_0274608 Ga0495686_0274608_467_898 136
1276 3300047472 Ga0495686_0297197 Ga0495686_0297197_321_752 136
1277 3300047673 Ga0495593_0049657 Ga0495593_0049657_506_937 136
1278 3300048088 Ga0495602_0102240 Ga0495602_0102240_473_904 136
1279 3300048088 Ga0495602_0219034 Ga0495602_0219034_562_993 136
1280 3300048088 Ga0495602_0326137 Ga0495602_0326137_494_913 136
1281 3300048089 Ga0495614_0090231 Ga0495614_0090231_536_955 136
1282 3300048091 Ga0495626_0000022 Ga0495626_0000022_75752_76165 136
1283 3300048091 Ga0495626_0002730 Ga0495626_0002730_1590_2015 136
1284 3300048903 Ga0496100_0026254 Ga0496100_0026254_1920_2351 136
1285 3300048903 Ga0496100_0122606 Ga0496100_0122606_951_1382 136
1286 3300048903 Ga0496100_0151663 Ga0496100_0151663_838_1269 136
1287 3300048903 Ga0496100_0355408 Ga0496100_0355408_389_820 136
1288 3300048904 Ga0496101_0002682 Ga0496101_0002682_6189_6620 136
1289 3300048904 Ga0496101_0025630 Ga0496101_0025630_658_1089 136
1290 3300048904 Ga0496101_0190014 Ga0496101_0190014_341_772 136
1291 3300048904 Ga0496101_0290365 Ga0496101_0290365_76_507 136
1292 3300048904 Ga0496101_0374293 Ga0496101_0374293_327_758 136
1293 3300048905 Ga0496102_0025490 Ga0496102_0025490_1239_1670 136
1294 3300048905 Ga0496102_0027530 Ga0496102_0027530_3576_4007 136
1295 3300048905 Ga0496102_0050758 Ga0496102_0050758_2032_2463 136
1296 3300048905 Ga0496102_0069299 Ga0496102_0069299_907_1356 136
1297 3300048905 Ga0496102_0314607 Ga0496102_0314607_854_1285 136
1298 3300048905 Ga0496102_0573436 Ga0496102_0573436_543_974 136
1299 3300048906 Ga0496103_0010260 Ga0496103_0010260_4859_5290 136
1300 3300048906 Ga0496103_0179539 Ga0496103_0179539_844_1275 136
1301 3300048907 Ga0496104_0002743 Ga0496104_0002743_10940_11371 136
1302 3300048907 Ga0496104_0008613 Ga0496104_0008613_77_508 136
1303 3300048907 Ga0496104_0096651 Ga0496104_0096651_1582_2013 136
1304 3300048907 Ga0496104_0318332 Ga0496104_0318332_929_1360 136
1305 3300048908 Ga0496105_0022571 Ga0496105_0022571_1066_1497 136
1306 3300048908 Ga0496105_0077738 Ga0496105_0077738_743_1174 136
1307 3300048908 Ga0496105_0187087 Ga0496105_0187087_489_920 136
1308 3300048909 Ga0496106_0002352 Ga0496106_0002352_4786_5217 136
1309 3300048909 Ga0496106_0039279 Ga0496106_0039279_403_834 136
1310 3300048909 Ga0496106_0191726 Ga0496106_0191726_834_1283 136
1311 3300048909 Ga0496106_0662479 Ga0496106_0662479_199_630 136
1312 3300048910 Ga0496107_0263175 Ga0496107_0263175_536_967 136
1313 3300048910 Ga0496107_0274950 Ga0496107_0274950_461_892 136
1314 3300048911 Ga0496108_0025878 Ga0496108_0025878_796_1227 136
1315 3300048911 Ga0496108_0135187 Ga0496108_0135187_234_665 136
1316 3300048912 Ga0496109_0011263 Ga0496109_0011263_5903_6334 136
1317 3300048912 Ga0496109_0067539 Ga0496109_0067539_675_1106 136
1318 3300048912 Ga0496109_0162114 Ga0496109_0162114_1255_1686 136
1319 3300048912 Ga0496109_0324926 Ga0496109_0324926_845_1276 136
1320 3300048912 Ga0496109_0379043 Ga0496109_0379043_382_792 136
1321 3300048912 Ga0496109_0591668 Ga0496109_0591668_29_460 136
1322 3300048912 Ga0496109_0618826 Ga0496109_0618826_258_707 136
1323 3300048913 Ga0496110_0408097 Ga0496110_0408097_535_966 136
1324 3300048913 Ga0496110_0621877 Ga0496110_0621877_181_612 136
1325 3300048913 Ga0496110_1234785 Ga0496110_1234785_85_516 136
1326 3300048914 Ga0496111_0038573 Ga0496111_0038573_1744_2193 136
1327 3300048914 Ga0496111_0181316 Ga0496111_0181316_332_763 136
1328 3300048914 Ga0496111_0922865 Ga0496111_0922865_104_535 136
1329 3300048915 Ga0496112_0043463 Ga0496112_0043463_1981_2412 136
1330 3300048915 Ga0496112_0205362 Ga0496112_0205362_981_1412 136
1331 3300048915 Ga0496112_1797911 Ga0496112_1797911_76_507 136
1332 3300048916 Ga0496113_0012758 Ga0496113_0012758_4262_4693 136
1333 3300048916 Ga0496113_0037873 Ga0496113_0037873_821_1252 136
1334 3300048916 Ga0496113_0168967 Ga0496113_0168967_361_792 136
1335 3300048916 Ga0496113_0173635 Ga0496113_0173635_724_1155 136
1336 3300048916 Ga0496113_0288695 Ga0496113_0288695_156_587 136
1337 3300048917 Ga0496114_0577767 Ga0496114_0577767_171_602 136
1338 3300048917 Ga0496114_0760769 Ga0496114_0760769_47_478 136
1339 3300048918 Ga0496115_0101186 Ga0496115_0101186_523_954 136
1340 3300048918 Ga0496115_0143360 Ga0496115_0143360_226_657 136
1341 3300048918 Ga0496115_0453185 Ga0496115_0453185_44_475 136
1342 3300048919 Ga0496116_0312804 Ga0496116_0312804_133_564 136
1343 3300048920 Ga0496117_0124979 Ga0496117_0124979_394_804 136
1344 3300048921 Ga0496118_0055513 Ga0496118_0055513_507_938 136
1345 3300048921 Ga0496118_0074666 Ga0496118_0074666_1444_1875 136
1346 3300048921 Ga0496118_0188510 Ga0496118_0188510_517_927 136
1347 3300048922 Ga0496119_0032207 Ga0496119_0032207_2024_2455 136
1348 3300048922 Ga0496119_0051790 Ga0496119_0051790_605_1036 136
1349 3300048922 Ga0496119_0141311 Ga0496119_0141311_592_1002 136
1350 3300048923 Ga0496120_0059208 Ga0496120_0059208_1471_1902 136
1351 3300048923 Ga0496120_0314536 Ga0496120_0314536_54_485 136
1352 3300048924 Ga0496121_0018815 Ga0496121_0018815_1375_1806 136
1353 3300048924 Ga0496121_0058967 Ga0496121_0058967_656_1087 136
1354 3300048924 Ga0496121_0165932 Ga0496121_0165932_136_546 136
1355 3300048924 Ga0496121_0338889 Ga0496121_0338889_533_964 136
1356 3300048924 Ga0496121_0623274 Ga0496121_0623274_169_600 136
1357 3300048925 Ga0496122_0000210 Ga0496122_0000210_94214_94645 136
1358 3300048925 Ga0496122_0025373 Ga0496122_0025373_817_1227 136
1359 3300048925 Ga0496122_0204233 Ga0496122_0204233_113_544 136
1360 3300048925 Ga0496122_0351692 Ga0496122_0351692_35_466 136
1361 3300048926 Ga0496123_0000597 Ga0496123_0000597_32691_33122 136
1362 3300048926 Ga0496123_0021134 Ga0496123_0021134_2019_2429 136
1363 3300048926 Ga0496123_0163662 Ga0496123_0163662_209_640 136
1364 3300048926 Ga0496123_0165903 Ga0496123_0165903_468_899 136
1365 3300048927 Ga0496124_0092841 Ga0496124_0092841_335_766 136
1366 3300048927 Ga0496124_0290186 Ga0496124_0290186_219_650 136
1367 3300048927 Ga0496124_0314543 Ga0496124_0314543_431_844 136
1368 3300048927 Ga0496124_0323878 Ga0496124_0323878_543_953 136
1369 3300048927 Ga0496124_0377707 Ga0496124_0377707_51_482 136
1370 3300048928 Ga0496125_0000789 Ga0496125_0000789_3628_4059 136
1371 3300048928 Ga0496125_0019149 Ga0496125_0019149_2554_2964 136
1372 3300048928 Ga0496125_0102908 Ga0496125_0102908_1605_2015 136
1373 3300048928 Ga0496125_0196528 Ga0496125_0196528_184_615 136
1374 3300048928 Ga0496125_0251575 Ga0496125_0251575_522_953 136
1375 3300048929 Ga0496126_0007753 Ga0496126_0007753_8008_8439 136
1376 3300048929 Ga0496126_0040413 Ga0496126_0040413_331_762 136
1377 3300048929 Ga0496126_0291332 Ga0496126_0291332_594_1025 136
1378 3300049128 Ga0501308_010491 Ga0501308_010491_509_922 136
1379 3300049459 Ga0495678_000358 Ga0495678_000358_9703_10134 136
1380 3300049460 Ga0495682_0037678 Ga0495682_0037678_890_1321 136
1381 3300049460 Ga0495682_0078332 Ga0495682_0078332_572_1003 136
1382 3300049570 Ga0501033_0237742 Ga0501033_0237742_304_735 136
1383 3300049572 Ga0501036_0380039 Ga0501036_0380039_358_789 136
1384 3300049572 Ga0501036_0847803 Ga0501036_0847803_195_626 136
1385 3300049573 Ga0501037_0389711 Ga0501037_0389711_391_822 136
1386 3300049574 Ga0501038_0027401 Ga0501038_0027401_476_907 136
1387 3300049574 Ga0501038_0478992 Ga0501038_0478992_212_643 136
1388 3300049575 Ga0501039_1332598 Ga0501039_1332598_19_450 136
1389 3300049578 Ga0501042_0151004 Ga0501042_0151004_904_1335 136
1390 3300049578 Ga0501042_0514848 Ga0501042_0514848_251_682 136
1391 3300049580 Ga0501046_0104064 Ga0501046_0104064_167_598 136
1392 3300049580 Ga0501046_0462350 Ga0501046_0462350_368_799 136
1393 3300049581 Ga0501047_0067057 Ga0501047_0067057_2625_3035 136
1394 3300049581 Ga0501047_0114526 Ga0501047_0114526_1390_1821 136
1395 3300049582 Ga0501048_0354026 Ga0501048_0354026_598_1029 136
1396 3300049585 Ga0501069_0472408 Ga0501069_0472408_81_512 136
1397 3300049586 Ga0501070_0045404 Ga0501070_0045404_1160_1570 136
1398 3300049587 Ga0501071_0715559 Ga0501071_0715559_40_471 136
1399 3300049589 Ga0501073_0169957 Ga0501073_0169957_235_645 136
1400 3300049591 Ga0501075_0610941 Ga0501075_0610941_86_517 136
1401 3300049592 Ga0501076_0398015 Ga0501076_0398015_565_996 136
1402 3300049742 Ga0501080_0476877 Ga0501080_0476877_39_449 136
1403 3300049742 Ga0501080_0830273 Ga0501080_0830273_202_633 136
1404 3300049744 Ga0501083_0327202 Ga0501083_0327202_331_762 136
1405 3300049822 Ga0501035_0175459 Ga0501035_0175459_28_459 136
1406 3300049822 Ga0501035_0179323 Ga0501035_0179323_874_1305 136
1407 3300049823 Ga0501044_0042648 Ga0501044_0042648_3023_3433 136
1408 3300050489 nmdc:mga03683_83226_c1 nmdc:mga03683_83226_c1_437_868 136
1409 3300050490 nmdc:mga03n38_160543_c1 nmdc:mga03n38_160543_c1_255_686 136
1410 3300050490 nmdc:mga03n38_187270_c1 nmdc:mga03n38_187270_c1_308_754 136
1411 3300050490 nmdc:mga03n38_208976_c1 nmdc:mga03n38_208976_c1_259_690 136
1412 3300050490 nmdc:mga03n38_945662_c1 nmdc:mga03n38_945662_c1_21_452 136
1413 3300050491 nmdc:mga00v17_6086_c1 nmdc:mga00v17_6086_c1_82_513 136
1414 3300050491 nmdc:mga00v17_979282_c1 nmdc:mga00v17_979282_c1_29_460 136
1415 3300050492 nmdc:mga0yw44_11432_c1 nmdc:mga0yw44_11432_c1_982_1413 136
1416 3300050492 nmdc:mga0yw44_200492_c1 nmdc:mga0yw44_200492_c1_444_875 136
1417 3300050492 nmdc:mga0yw44_7441_c1 nmdc:mga0yw44_7441_c1_2246_2677 136
1418 3300050493 nmdc:mga0k408_11559_c1 nmdc:mga0k408_11559_c1_1881_2312 136
1419 3300050493 nmdc:mga0k408_168599_c1 nmdc:mga0k408_168599_c1_614_1045 136
1420 3300050493 nmdc:mga0k408_472357_c1 nmdc:mga0k408_472357_c1_137_583 136
1421 3300050494 nmdc:mga06z11_16882_c1 nmdc:mga06z11_16882_c1_2704_3135 136
1422 3300050494 nmdc:mga06z11_554987_c1 nmdc:mga06z11_554987_c1_186_617 136
1423 3300050495 nmdc:mga04h51_76342_c1 nmdc:mga04h51_76342_c1_319_750 136
1424 3300050496 nmdc:mga07m45_27107_c1 nmdc:mga07m45_27107_c1_2399_2830 136
1425 3300050496 nmdc:mga07m45_283286_c1 nmdc:mga07m45_283286_c1_274_705 136
1426 3300050496 nmdc:mga07m45_850398_c1 nmdc:mga07m45_850398_c1_22_432 136
1427 3300050496 nmdc:mga07m45_93689_c1 nmdc:mga07m45_93689_c1_1071_1502 136
1428 3300050507 nmdc:mga05p37_162409_c1 nmdc:mga05p37_162409_c1_1741_2172 136
1429 3300050507 nmdc:mga05p37_241970_c1 nmdc:mga05p37_241970_c1_206_637 136
1430 3300050507 nmdc:mga05p37_288334_c1 nmdc:mga05p37_288334_c1_980_1411 136
1431 3300050507 nmdc:mga05p37_316594_c1 nmdc:mga05p37_316594_c1_229_660 136
1432 3300050509 nmdc:mga0qj67_114234_c1 nmdc:mga0qj67_114234_c1_1498_1929 136
1433 3300050511 nmdc:mga08y16_46869_c1 nmdc:mga08y16_46869_c1_3558_3989 136
1434 3300050511 nmdc:mga08y16_585730_c1 nmdc:mga08y16_585730_c1_318_764 136
1435 3300050511 nmdc:mga08y16_811477_c1 nmdc:mga08y16_811477_c1_174_605 136
1436 3300050511 nmdc:mga08y16_924162_c1 nmdc:mga08y16_924162_c1_188_619 136
1437 3300050512 nmdc:mga0n895_1804916_c1 nmdc:mga0n895_1804916_c1_41_490 136
1438 3300050512 nmdc:mga0n895_24920_c1 nmdc:mga0n895_24920_c1_2812_3243 136
1439 3300050515 nmdc:mga0a205_100641_c1 nmdc:mga0a205_100641_c1_1830_2261 136
1440 3300050515 nmdc:mga0a205_221135_c1 nmdc:mga0a205_221135_c1_164_595 136
1441 3300050515 nmdc:mga0a205_53341_c1 nmdc:mga0a205_53341_c1_1127_1573 136
1442 3300050516 nmdc:mga0sz30_27450_c1 nmdc:mga0sz30_27450_c1_920_1366 136
1443 3300053077 Ga0495601_0156943 Ga0495601_0156943_333_764 136
1444 3300053077 Ga0495601_0665139 Ga0495601_0665139_113_544 136
1445 3300053077 Ga0495601_0674246 Ga0495601_0674246_11_442 136
1446 3300053078 Ga0495612_0047541 Ga0495612_0047541_385_816 136
1447 3300053079 Ga0500610_0000051 Ga0500610_0000051_12662_13072 136
1448 3300053079 Ga0500610_0324268 Ga0500610_0324268_71_481 136
1449 3300053083 Ga0495655_0036083 Ga0495655_0036083_503_934 136
1450 3300053084 Ga0495595_0329835 Ga0495595_0329835_142_573 136
1451 3300053085 Ga0495619_0297881 Ga0495619_0297881_361_792 136
1452 3300053086 Ga0500578_0492995 Ga0500578_0492995_126_557 136
1453 3300053086 Ga0500578_0612008 Ga0500578_0612008_38_469 136
1454 3300053087 Ga0500643_073247 Ga0500643_073247_30_440 136
1455 3300053094 Ga0500566_0001729 Ga0500566_0001729_8095_8526 136
1456 3300053104 Ga0500556_0021993 Ga0500556_0021993_425_856 136
1457 3300053105 Ga0500557_000103 Ga0500557_000103_460_891 136
1458 3300053108 Ga0500562_083454 Ga0500562_083454_89_520 136
1459 3300053109 Ga0500569_129120 Ga0500569_129120_163_594 136
1460 3300053118 Ga0500594_0000454 Ga0500594_0000454_3656_4087 136
1461 3300053119 Ga0500595_000166 Ga0500595_000166_23191_23601 136
1462 3300053119 Ga0500595_013390 Ga0500595_013390_2266_2697 136
1463 3300053120 Ga0500597_100338 Ga0500597_100338_347_778 136
1464 3300053122 Ga0500608_000656 Ga0500608_000656_7332_7763 136
1465 3300053126 Ga0500621_134660 Ga0500621_134660_312_743 136
1466 3300053130 Ga0500642_0062098 Ga0500642_0062098_429_860 136
1467 3300053154 Ga0500619_160311 Ga0500619_160311_264_695 136
1468 3300053156 Ga0500622_0000735 Ga0500622_0000735_13550_13981 136
1469 3300053156 Ga0500622_0141289 Ga0500622_0141289_229_660 136
1470 3300053160 Ga0500633_0031677 Ga0500633_0031677_60_491 136
1471 3300053162 Ga0500638_298233 Ga0500638_298233_175_606 136
1472 3300053177 Ga0500636_0000948 Ga0500636_0000948_12639_13049 136
1473 3300053177 Ga0500636_0234836 Ga0500636_0234836_70_501 136
1474 3300053729 Ga0500625_007215 Ga0500625_007215_2938_3369 136
1475 3300053730 Ga0500645_015053 Ga0500645_015053_49_480 136
1476 3300053731 Ga0500609_008489 Ga0500609_008489_79_510 136
1477 3300053735 Ga0500596_001610 Ga0500596_001610_624_1034 136
1478 3300053737 Ga0500601_007608 Ga0500601_007608_227_658 136
1479 3300054114 Ga0501084_0574268 Ga0501084_0574268_221_652 136
1480 3300055283 Ga0500661_006131 Ga0500661_006131_1526_1957 136
1481 3300059505 Ga0587083_0093604 Ga0587083_0093604_90_512 136
1482 3300059641 Ga0587068_108823 Ga0587068_108823_30_452 136
1483 3300059643 Ga0587072_152062 Ga0587072_152062_31_453 136
1484 3300060353 Ga0501082_0151000 Ga0501082_0151000_150_581 136
1485 3300060353 Ga0501082_0668290 Ga0501082_0668290_152_583 136
1486 3300060353 Ga0501082_0768186 Ga0501082_0768186_199_630 136
1487 3300061719 Ga0466962_0007922 Ga0466962_0007922_1726_2136 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

19

147

0.9

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

9

143

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9711 9 136
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8964 10 134
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.8932 6 132
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8908 9 132
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8828 8 134
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9442 6 136 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8908 9 132 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8734 1 132 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8611 12 134 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8609 9 134 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1G2W9P3-F1-model_v4 Polyketide cyclase 0.9937 8 136
AF-A0A529I9X2-F1-model_v4 deleted 0.9912 17 110
AF-A0A6N6JIT5-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9806 9 133
AF-A0A537U521-F1-model_v4 Polyketide cyclase 0.9794 1 101
AF-A0A537Q1Z8-F1-model_v4 Polyketide cyclase 0.9779 1 133

Feature Viewer

pLDDT pTM Quality
94.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map