F494285

General Info

Members Datasets Scaffolds Average Seq Length
1482 474 1482 115

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_131389_c1|nmdc:mga06z11_131389_c1_131_544
Length 137
Sequence VGSGWSEEGELMAALAKKPHEAQDGRLDGNDGNTASDLGFYDLRLYVAGQTPKSMTAFANLKRICEEHLAGQYRIEVIDLLKEPQLARGDQILALPTLVRKLPEPIKKIIGDLSNTERTLVGLDLRPRVARDGDGDM

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
224 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
228 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
282 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
283 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
284 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
285 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
376 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
377 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
378 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
403 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
404 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
405 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
406 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
407 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
408 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
409 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
410 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
411 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
412 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
413 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
414 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
415 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
416 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
417 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
418 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
419 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
420 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
421 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
422 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
423 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
424 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
425 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
426 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
427 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
428 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
429 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
430 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
431 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
437 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
438 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
439 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
440 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
445 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
463 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
464 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
465 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
474 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0.07
Rhizoplane 2.02
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_4028819 2162886006 Unclassified 921
2 SwRhRL2b_contig_859156 2162886007 Bacteria 1669
3 MBSR1b_contig_5926467 2162886012 Bacteria 1770
4 JGI24737J22298_10068766 3300001990 Bacteria 1059
5 JGI25152J39213_1000688 3300002773 Bacteria 17638
6 JGI25150J39212_1000029 3300002774 Bacteria 103974
7 JGI25151J46595_10000003 3300003187 Bacteria 715330
8 JGI25153J46596_10000111 3300003215 Bacteria 92915
9 rootL2_10272735 3300003322 Bacteria 1248
10 rootH1_10274450 3300003323 Bacteria 2588
11 Ga0058861_11747774 3300004800 Bacteria 2318
12 Ga0065714_10076656 3300005288 Bacteria 2769
13 Ga0065704_10090549 3300005289 Bacteria 2774
14 Ga0065704_10102668 3300005289 Unclassified 2193
15 Ga0065704_10144240 3300005289 Unclassified 1488
16 Ga0065712_10002629 3300005290 Unclassified 4414
17 Ga0065712_10507318 3300005290 Unclassified 645
18 Ga0065715_10029450 3300005293 Bacteria 1192
19 Ga0065715_10098309 3300005293 Unclassified 3566
20 Ga0065715_10100912 3300005293 Bacteria 3256
21 Ga0065715_10402779 3300005293 Unclassified 879
22 Ga0065715_10520636 3300005293 Unclassified 764
23 Ga0065715_10649427 3300005293 Unclassified 679
24 Ga0065715_10720190 3300005293 Unclassified 638
25 Ga0065707_10003692 3300005295 Unclassified 3602
26 Ga0065707_10006030 3300005295 Bacteria 4774
27 Ga0065707_10018320 3300005295 Bacteria 2240
28 Ga0070658_10438120 3300005327 Bacteria 1125
29 Ga0070658_10817412 3300005327 Bacteria 810
30 Ga0070676_11030037 3300005328 Bacteria 619
31 Ga0070676_11557249 3300005328 Unclassified 510
32 Ga0070683_100173834 3300005329 Bacteria 2045
33 Ga0070683_100516004 3300005329 Unclassified 1142
34 Ga0070683_102347483 3300005329 Bacteria 511
35 Ga0070690_100051342 3300005330 Unclassified 2632
36 Ga0070690_100077793 3300005330 Bacteria 2166
37 Ga0070690_100644009 3300005330 Bacteria 809
38 Ga0070690_100885827 3300005330 Unclassified 697
39 Ga0070670_100138167 3300005331 Bacteria 2106
40 Ga0070670_100253761 3300005331 Bacteria 1532
41 Ga0070670_100339317 3300005331 Bacteria 1319
42 Ga0070670_100522332 3300005331 Unclassified 1057
43 Ga0070670_101254211 3300005331 Unclassified 678
44 Ga0070677_10027751 3300005333 Bacteria 2134
45 Ga0070677_10655552 3300005333 Unclassified 587
46 Ga0068869_100034338 3300005334 Bacteria 3587
47 Ga0068869_100488929 3300005334 Unclassified 1026
48 Ga0068869_100615077 3300005334 Bacteria 919
49 Ga0068869_100618833 3300005334 Bacteria 916
50 Ga0068869_101726184 3300005334 Unclassified 559
51 Ga0068869_101905403 3300005334 Unclassified 533
52 Ga0070666_10046823 3300005335 Bacteria 2902
53 Ga0070666_10160492 3300005335 Unclassified 1571
54 Ga0070666_10340793 3300005335 Bacteria 1071
55 Ga0070666_10533187 3300005335 Bacteria 853
56 Ga0070666_10645146 3300005335 Unclassified 774
57 Ga0070666_11390719 3300005335 Unclassified 524
58 Ga0070680_100107690 3300005336 Bacteria 2318
59 Ga0070682_100003243 3300005337 Bacteria 9028
60 Ga0070682_100004023 3300005337 Bacteria 8169
61 Ga0070682_100007313 3300005337 Bacteria 6227
62 Ga0070682_100519050 3300005337 Unclassified 926
63 Ga0068868_100012556 3300005338 Bacteria 6194
64 Ga0068868_100661322 3300005338 Unclassified 931
65 Ga0068868_100770503 3300005338 Bacteria 866
66 Ga0068868_101650872 3300005338 Unclassified 603
67 Ga0070660_100108132 3300005339 Unclassified 2210
68 Ga0070660_100189137 3300005339 Bacteria 1667
69 Ga0070660_100319579 3300005339 Unclassified 1275
70 Ga0070689_100042806 3300005340 Bacteria 3478
71 Ga0070689_100125393 3300005340 Bacteria 2054
72 Ga0070689_100149304 3300005340 Bacteria 1884
73 Ga0070689_100265605 3300005340 Bacteria 1419
74 Ga0070689_100410462 3300005340 Unclassified 1146
75 Ga0070689_101036632 3300005340 Bacteria 731
76 Ga0070689_101501104 3300005340 Unclassified 610
77 Ga0070691_10194282 3300005341 Bacteria 1063
78 Ga0070691_10370922 3300005341 Bacteria 800
79 Ga0070687_100096543 3300005343 Unclassified 1646
80 Ga0070687_101495390 3300005343 Unclassified 507
81 Ga0070661_100268374 3300005344 Unclassified 1321
82 Ga0070692_10012785 3300005345 Bacteria 3898
83 Ga0070692_10013264 3300005345 Bacteria 3838
84 Ga0070692_10050877 3300005345 Bacteria 2153
85 Ga0070692_10264422 3300005345 Unclassified 1035
86 Ga0070692_10337572 3300005345 Bacteria 932
87 Ga0070692_10433657 3300005345 Bacteria 837
88 Ga0070692_10487586 3300005345 Unclassified 796
89 Ga0070668_100406092 3300005347 Bacteria 1164
90 Ga0070669_100006231 3300005353 Bacteria 8614
91 Ga0070675_100041913 3300005354 Unclassified 3739
92 Ga0070675_100321553 3300005354 Bacteria 1367
93 Ga0070675_101555855 3300005354 Unclassified 610
94 Ga0070675_102142719 3300005354 Bacteria 515
95 Ga0070671_100060167 3300005355 Bacteria 3162
96 Ga0070671_100269878 3300005355 Unclassified 1446
97 Ga0070671_100362852 3300005355 Bacteria 1237
98 Ga0070671_100677124 3300005355 Unclassified 894
99 Ga0070671_101598815 3300005355 Unclassified 578
100 Ga0070674_100185681 3300005356 Bacteria 1596
101 Ga0070674_101530658 3300005356 Unclassified 600
102 Ga0070673_100024795 3300005364 Bacteria 4403
103 Ga0070673_100100149 3300005364 Bacteria 2385
104 Ga0070673_100100271 3300005364 Bacteria 2384
105 Ga0070673_100158066 3300005364 Bacteria 1925
106 Ga0070673_100439294 3300005364 Bacteria 1172
107 Ga0070688_100216997 3300005365 Unclassified 1346
108 Ga0070688_100572203 3300005365 Bacteria 861
109 Ga0070659_100068418 3300005366 Bacteria 2816
110 Ga0070659_100333075 3300005366 Bacteria 1271
111 Ga0070659_100472087 3300005366 Unclassified 1066
112 Ga0070667_100000005 3300005367 Bacteria 347268
113 Ga0070667_100263315 3300005367 Bacteria 1544
114 Ga0070667_101676777 3300005367 Unclassified 598
115 Ga0070703_10002822 3300005406 Bacteria 4977
116 Ga0070709_10013306 3300005434 Bacteria 4622
117 Ga0070709_10076194 3300005434 Bacteria 2178
118 Ga0070714_100029717 3300005435 Bacteria 4545
119 Ga0070714_101644267 3300005435 Unclassified 627
120 Ga0070713_100008030 3300005436 Bacteria 7459
121 Ga0070713_100020936 3300005436 Bacteria 5022
122 Ga0070713_100043883 3300005436 Unclassified 3658
123 Ga0070713_100353757 3300005436 Unclassified 1363
124 Ga0070713_101256272 3300005436 Bacteria 717
125 Ga0070710_10179285 3300005437 Bacteria 1325
126 Ga0070701_10030762 3300005438 Bacteria 2658
127 Ga0070701_10152057 3300005438 Bacteria 1334
128 Ga0070701_10696198 3300005438 Bacteria 683
129 Ga0070701_10750366 3300005438 Unclassified 661
130 Ga0070711_100054278 3300005439 Bacteria 2765
131 Ga0070711_100143104 3300005439 Bacteria 1795
132 Ga0070711_100249578 3300005439 Unclassified 1391
133 Ga0070711_100295116 3300005439 Bacteria 1287
134 Ga0070711_100357648 3300005439 Bacteria 1175
135 Ga0070711_100473993 3300005439 Unclassified 1028
136 Ga0070711_101637585 3300005439 Bacteria 563
137 Ga0070705_100002412 3300005440 Bacteria 9405
138 Ga0070705_100013552 3300005440 Bacteria 4173
139 Ga0070705_100130731 3300005440 Bacteria 1637
140 Ga0070705_100145152 3300005440 Unclassified 1567
141 Ga0070705_100153628 3300005440 Bacteria 1530
142 Ga0070705_100196042 3300005440 Unclassified 1381
143 Ga0070705_100610419 3300005440 Bacteria 845
144 Ga0070705_100626372 3300005440 Unclassified 836
145 Ga0070705_101916729 3300005440 Unclassified 504
146 Ga0070700_100004564 3300005441 Bacteria 7245
147 Ga0070700_100019588 3300005441 Bacteria 3908
148 Ga0070700_100046598 3300005441 Unclassified 2679
149 Ga0070700_100298797 3300005441 Unclassified 1174
150 Ga0070700_101219317 3300005441 Bacteria 629
151 Ga0070700_101771090 3300005441 Unclassified 531
152 Ga0070694_100004873 3300005444 Bacteria 8082
153 Ga0070694_100013478 3300005444 Bacteria 5106
154 Ga0070694_100019668 3300005444 Bacteria 4297
155 Ga0070694_100164111 3300005444 Unclassified 1632
156 Ga0070694_100221671 3300005444 Unclassified 1419
157 Ga0070694_100229535 3300005444 Bacteria 1396
158 Ga0070694_100491006 3300005444 Bacteria 976
159 Ga0070694_100741551 3300005444 Bacteria 801
160 Ga0070694_100813722 3300005444 Unclassified 767
161 Ga0070694_100937108 3300005444 Bacteria 716
162 Ga0070694_101182447 3300005444 Unclassified 640
163 Ga0070694_101415001 3300005444 Unclassified 587
164 Ga0070708_100092854 3300005445 Bacteria 2750
165 Ga0070708_100137560 3300005445 Bacteria 2264
166 Ga0070708_100284225 3300005445 Unclassified 1557
167 Ga0070708_100368257 3300005445 Unclassified 1355
168 Ga0070663_100000210 3300005455 Bacteria 29262
169 Ga0070663_101037906 3300005455 Unclassified 714
170 Ga0070678_100122300 3300005456 Bacteria 2054
171 Ga0070678_100137934 3300005456 Bacteria 1948
172 Ga0070678_100167517 3300005456 Bacteria 1786
173 Ga0070678_101682184 3300005456 Unclassified 597
174 Ga0070678_102045544 3300005456 Unclassified 542
175 Ga0070662_100044676 3300005457 Bacteria 3174
176 Ga0070662_100593930 3300005457 Bacteria 931
177 Ga0070681_10006697 3300005458 Bacteria 11209
178 Ga0070681_10019243 3300005458 Bacteria 6831
179 Ga0070681_10093059 3300005458 Bacteria 2963
180 Ga0070681_10163416 3300005458 Bacteria 2150
181 Ga0070681_10515435 3300005458 Bacteria 1109
182 Ga0070681_10642445 3300005458 Bacteria 976
183 Ga0068867_100030715 3300005459 Bacteria 3876
184 Ga0068867_100093381 3300005459 Bacteria 2287
185 Ga0068867_100162774 3300005459 Bacteria 1760
186 Ga0068867_100284480 3300005459 Unclassified 1357
187 Ga0068867_100850527 3300005459 Bacteria 817
188 Ga0068867_101067614 3300005459 Bacteria 736
189 Ga0068867_101600892 3300005459 Unclassified 609
190 Ga0068867_101743219 3300005459 Bacteria 585
191 Ga0068867_101761204 3300005459 Unclassified 582
192 Ga0070685_10749380 3300005466 Unclassified 716
193 Ga0070706_100000250 3300005467 Bacteria 65288
194 Ga0070706_100013681 3300005467 Bacteria 7502
195 Ga0070706_100043443 3300005467 Bacteria 4153
196 Ga0070706_100248056 3300005467 Unclassified 1662
197 Ga0070706_100586089 3300005467 Bacteria 1037
198 Ga0070706_101511210 3300005467 Unclassified 614
199 Ga0070707_100002026 3300005468 Bacteria 19377
200 Ga0070707_100065847 3300005468 Bacteria 3481
201 Ga0070707_100166738 3300005468 Bacteria 2146
202 Ga0070707_100352294 3300005468 Bacteria 1430
203 Ga0070698_100002337 3300005471 Bacteria 20953
204 Ga0070698_100020402 3300005471 Bacteria 6946
205 Ga0070698_100371550 3300005471 Bacteria 1362
206 Ga0070698_100418803 3300005471 Unclassified 1274
207 Ga0070698_101719913 3300005471 Bacteria 580
208 Ga0070699_100000012 3300005518 Bacteria 246521
209 Ga0070699_100016852 3300005518 Bacteria 6273
210 Ga0070699_100055893 3300005518 Bacteria 3417
211 Ga0070699_100078449 3300005518 Archaea 2876
212 Ga0070699_100223394 3300005518 Unclassified 1679
213 Ga0070699_100274553 3300005518 Bacteria 1509
214 Ga0070699_100382107 3300005518 Bacteria 1271
215 Ga0070699_100388654 3300005518 Bacteria 1261
216 Ga0070699_100871073 3300005518 Bacteria 825
217 Ga0070684_100319557 3300005535 Unclassified 1426
218 Ga0070684_100471665 3300005535 Bacteria 1161
219 Ga0070697_100001942 3300005536 Bacteria 15820
220 Ga0070697_100085712 3300005536 Bacteria 2599
221 Ga0070697_100092667 3300005536 Bacteria 2500
222 Ga0070697_100152281 3300005536 Bacteria 1949
223 Ga0070697_100158855 3300005536 Bacteria 1909
224 Ga0070697_101066501 3300005536 Unclassified 719
225 Ga0068853_100117977 3300005539 Bacteria 2364
226 Ga0068853_100227672 3300005539 Unclassified 1704
227 Ga0068853_100273079 3300005539 Bacteria 1557
228 Ga0068853_101549870 3300005539 Unclassified 642
229 Ga0068853_101658324 3300005539 Unclassified 620
230 Ga0068853_101683413 3300005539 Unclassified 615
231 Ga0070672_100040436 3300005543 Bacteria 3577
232 Ga0070672_100446856 3300005543 Bacteria 1113
233 Ga0070686_100015451 3300005544 Bacteria 4423
234 Ga0070686_100247208 3300005544 Bacteria 1301
235 Ga0070686_101380743 3300005544 Unclassified 590
236 Ga0070686_101707684 3300005544 Unclassified 534
237 Ga0070695_100029869 3300005545 Bacteria 3390
238 Ga0070695_100092873 3300005545 Bacteria 2018
239 Ga0070695_100096015 3300005545 Bacteria 1988
240 Ga0070695_100108432 3300005545 Bacteria 1880
241 Ga0070695_100184161 3300005545 Bacteria 1482
242 Ga0070695_100220069 3300005545 Bacteria 1367
243 Ga0070695_100514629 3300005545 Unclassified 928
244 Ga0070695_101199579 3300005545 Bacteria 624
245 Ga0070696_100037801 3300005546 Bacteria 3330
246 Ga0070696_100078684 3300005546 Bacteria 2332
247 Ga0070696_100124444 3300005546 Bacteria 1869
248 Ga0070696_100294506 3300005546 Bacteria 1241
249 Ga0070696_101090907 3300005546 Bacteria 671
250 Ga0070696_101400975 3300005546 Bacteria 596
251 Ga0070696_101752780 3300005546 Bacteria 536
252 Ga0070693_100004656 3300005547 Bacteria 6514
253 Ga0070693_100005417 3300005547 Bacteria 6125
254 Ga0070693_100042851 3300005547 Bacteria 2553
255 Ga0070693_100048071 3300005547 Bacteria 2429
256 Ga0070693_100066892 3300005547 Bacteria 2104
257 Ga0070693_100068397 3300005547 Bacteria 2084
258 Ga0070693_100072169 3300005547 Bacteria 2036
259 Ga0070693_100160345 3300005547 Bacteria 1432
260 Ga0070693_100265603 3300005547 Bacteria 1143
261 Ga0070693_100312656 3300005547 Bacteria 1063
262 Ga0070693_100814402 3300005547 Unclassified 693
263 Ga0070693_101333460 3300005547 Bacteria 556
264 Ga0070665_100385874 3300005548 Bacteria 1408
265 Ga0070665_101630959 3300005548 Unclassified 653
266 Ga0070704_100045762 3300005549 Bacteria 3046
267 Ga0070704_100057210 3300005549 Bacteria 2772
268 Ga0070704_100060754 3300005549 Bacteria 2701
269 Ga0070704_100122341 3300005549 Bacteria 2002
270 Ga0070704_100144385 3300005549 Unclassified 1863
271 Ga0070704_100240056 3300005549 Bacteria 1482
272 Ga0070704_100320226 3300005549 Bacteria 1299
273 Ga0070704_100499816 3300005549 Bacteria 1055
274 Ga0070704_100676199 3300005549 Bacteria 913
275 Ga0068855_100079053 3300005563 Bacteria 3815
276 Ga0068855_100235046 3300005563 Unclassified 2050
277 Ga0068855_101557801 3300005563 Unclassified 677
278 Ga0068855_102362097 3300005563 Bacteria 531
279 Ga0068855_102588902 3300005563 Unclassified 503
280 Ga0070664_100050050 3300005564 Bacteria 3535
281 Ga0070664_100147198 3300005564 Bacteria 2077
282 Ga0070664_100194953 3300005564 Bacteria 1806
283 Ga0070664_100330348 3300005564 Unclassified 1383
284 Ga0070664_100411881 3300005564 Bacteria 1237
285 Ga0070664_100511873 3300005564 Bacteria 1107
286 Ga0068857_100008955 3300005577 Bacteria 8672
287 Ga0068857_100015247 3300005577 Bacteria 6708
288 Ga0068857_100073529 3300005577 Bacteria 3046
289 Ga0068857_100084026 3300005577 Bacteria 2845
290 Ga0068857_100175930 3300005577 Bacteria 1947
291 Ga0068857_100415498 3300005577 Unclassified 1253
292 Ga0068857_100503328 3300005577 Bacteria 1137
293 Ga0068857_100655164 3300005577 Unclassified 995
294 Ga0068857_101599633 3300005577 Unclassified 636
295 Ga0068854_100041418 3300005578 Bacteria 3254
296 Ga0068854_100111833 3300005578 Bacteria 2061
297 Ga0068854_100341034 3300005578 Unclassified 1224
298 Ga0068854_100400651 3300005578 Bacteria 1135
299 Ga0068854_100416451 3300005578 Bacteria 1115
300 Ga0068854_100587271 3300005578 Unclassified 949
301 Ga0068854_100640833 3300005578 Viruses 911
302 Ga0068854_101031413 3300005578 Unclassified 730
303 Ga0068854_102022763 3300005578 Unclassified 531
304 Ga0068856_100012621 3300005614 Bacteria 8179
305 Ga0068856_100042701 3300005614 Bacteria 4461
306 Ga0068856_100069494 3300005614 Bacteria 3483
307 Ga0068856_100191809 3300005614 Bacteria 2057
308 Ga0070702_100012823 3300005615 Unclassified 4217
309 Ga0070702_100066498 3300005615 Bacteria 2114
310 Ga0070702_100070012 3300005615 Bacteria 2069
311 Ga0070702_100082972 3300005615 Bacteria 1924
312 Ga0070702_100173220 3300005615 Bacteria 1406
313 Ga0070702_100385897 3300005615 Unclassified 997
314 Ga0070702_100717072 3300005615 Unclassified 764
315 Ga0068852_100020623 3300005616 Bacteria 5242
316 Ga0068852_100512949 3300005616 Unclassified 1195
317 Ga0068852_100576037 3300005616 Bacteria 1128
318 Ga0068852_101075634 3300005616 Bacteria 824
319 Ga0068852_101093714 3300005616 Bacteria 817
320 Ga0068859_100010723 3300005617 Bacteria 9223
321 Ga0068859_100037836 3300005617 Bacteria 4842
322 Ga0068859_100053033 3300005617 Bacteria 4078
323 Ga0068859_100103711 3300005617 Bacteria 2902
324 Ga0068859_100132806 3300005617 Unclassified 2561
325 Ga0068859_100142052 3300005617 Bacteria 2474
326 Ga0068859_100167073 3300005617 Bacteria 2280
327 Ga0068859_100294539 3300005617 Bacteria 1716
328 Ga0068859_100380124 3300005617 Bacteria 1508
329 Ga0068859_100401164 3300005617 Bacteria 1467
330 Ga0068859_100563704 3300005617 Bacteria 1233
331 Ga0068859_100848074 3300005617 Bacteria 1000
332 Ga0068859_100933268 3300005617 Unclassified 952
333 Ga0068859_101004137 3300005617 Bacteria 916
334 Ga0068859_101080701 3300005617 Bacteria 882
335 Ga0068859_101906871 3300005617 Bacteria 656
336 Ga0068859_102143208 3300005617 Unclassified 617
337 Ga0068864_100006038 3300005618 Bacteria 9946
338 Ga0068864_100067551 3300005618 Bacteria 3104
339 Ga0068864_100402774 3300005618 Unclassified 1300
340 Ga0068864_100407953 3300005618 Bacteria 1292
341 Ga0068864_101054402 3300005618 Bacteria 808
342 Ga0068866_10071181 3300005718 Bacteria 1838
343 Ga0068866_10104172 3300005718 Bacteria 1571
344 Ga0068866_10869875 3300005718 Unclassified 632
345 Ga0068861_100130894 3300005719 Bacteria 2036
346 Ga0068861_100312655 3300005719 Unclassified 1365
347 Ga0068861_100639481 3300005719 Bacteria 981
348 Ga0068861_100726362 3300005719 Unclassified 925
349 Ga0068851_10001358 3300005834 Bacteria 10679
350 Ga0068851_10025195 3300005834 Bacteria 2917
351 Ga0068851_10040164 3300005834 Bacteria 2351
352 Ga0068851_10208635 3300005834 Unclassified 1093
353 Ga0068870_10006593 3300005840 Bacteria 5128
354 Ga0068870_10011207 3300005840 Unclassified 4148
355 Ga0068870_10061387 3300005840 Unclassified 2021
356 Ga0068870_10105110 3300005840 Bacteria 1603
357 Ga0068870_10268254 3300005840 Unclassified 1065
358 Ga0068870_11201221 3300005840 Unclassified 549
359 Ga0068863_100005605 3300005841 Bacteria 12339
360 Ga0068863_100012454 3300005841 Bacteria 8211
361 Ga0068863_100046714 3300005841 Bacteria 4110
362 Ga0068863_100048330 3300005841 Unclassified 4035
363 Ga0068863_100066935 3300005841 Bacteria 3398
364 Ga0068863_100891448 3300005841 Bacteria 889
365 Ga0068863_101786968 3300005841 Bacteria 624
366 Ga0068858_100037811 3300005842 Bacteria 4476
367 Ga0068858_100120385 3300005842 Bacteria 2454
368 Ga0068858_100195143 3300005842 Bacteria 1913
369 Ga0068858_100218134 3300005842 Bacteria 1806
370 Ga0068858_100269751 3300005842 Bacteria 1619
371 Ga0068858_100377375 3300005842 Bacteria 1360
372 Ga0068858_100406120 3300005842 Bacteria 1309
373 Ga0068858_100423528 3300005842 Bacteria 1280
374 Ga0068858_100486278 3300005842 Unclassified 1192
375 Ga0068858_100910523 3300005842 Unclassified 860
376 Ga0068858_102391757 3300005842 Unclassified 522
377 Ga0068860_100004514 3300005843 Bacteria 14204
378 Ga0068860_100061657 3300005843 Bacteria 3563
379 Ga0068860_100074625 3300005843 Unclassified 3225
380 Ga0068860_100133407 3300005843 Bacteria 2384
381 Ga0068860_100184278 3300005843 Bacteria 2018
382 Ga0068860_100312423 3300005843 Bacteria 1541
383 Ga0068860_100498043 3300005843 Bacteria 1216
384 Ga0068860_100542151 3300005843 Unclassified 1165
385 Ga0068860_101337475 3300005843 Bacteria 737
386 Ga0068862_100108122 3300005844 Unclassified 2439
387 Ga0068862_100521314 3300005844 Unclassified 1131
388 Ga0068862_100860043 3300005844 Unclassified 889
389 Ga0068862_101015777 3300005844 Unclassified 821
390 Ga0081455_10021596 3300005937 Bacteria 6033
391 Ga0081539_10016029 3300005985 Bacteria 5390
392 Ga0081539_10027789 3300005985 Unclassified 3575
393 Ga0081539_10047406 3300005985 Bacteria 2454
394 Ga0070717_10265865 3300006028 Bacteria 1518
395 Ga0070717_10350918 3300006028 Bacteria 1319
396 Ga0070717_10977157 3300006028 Unclassified 771
397 Ga0075365_10287425 3300006038 Unclassified 1157
398 Ga0075368_10008168 3300006042 Bacteria 3719
399 Ga0075368_10187031 3300006042 Bacteria 874
400 Ga0075364_10006340 3300006051 Bacteria 6951
401 Ga0075432_10445350 3300006058 Unclassified 567
402 Ga0070715_10295620 3300006163 Bacteria 864
403 Ga0070716_100006865 3300006173 Bacteria 5582
404 Ga0070716_100283473 3300006173 Bacteria 1144
405 Ga0070716_100483907 3300006173 Bacteria 909
406 Ga0070712_100122890 3300006175 Bacteria 1956
407 Ga0070712_100271318 3300006175 Unclassified 1363
408 Ga0070712_100335243 3300006175 Unclassified 1233
409 Ga0070712_100438752 3300006175 Bacteria 1085
410 Ga0070712_100821580 3300006175 Bacteria 798
411 Ga0070712_101135254 3300006175 Bacteria 679
412 Ga0075367_10040931 3300006178 Bacteria 2707
413 Ga0075366_10025466 3300006195 Bacteria 3456
414 Ga0097621_100000225 3300006237 Bacteria 37800
415 Ga0097621_100284772 3300006237 Bacteria 1456
416 Ga0097621_100292296 3300006237 Unclassified 1437
417 Ga0097621_101018727 3300006237 Bacteria 775
418 Ga0068871_100000307 3300006358 Bacteria 34112
419 Ga0068871_100010219 3300006358 Bacteria 6837
420 Ga0068871_100010943 3300006358 Bacteria 6645
421 Ga0068871_100069801 3300006358 Bacteria 2886
422 Ga0068871_100160198 3300006358 Bacteria 1924
423 Ga0068871_100280233 3300006358 Bacteria 1458
424 Ga0075428_100017222 3300006844 Bacteria 7985
425 Ga0075428_100029102 3300006844 Bacteria 6112
426 Ga0075428_100049240 3300006844 Bacteria 4623
427 Ga0075428_100114702 3300006844 Bacteria 2935
428 Ga0075428_100139696 3300006844 Unclassified 2634
429 Ga0075428_100246043 3300006844 Unclassified 1928
430 Ga0075428_100399753 3300006844 Bacteria 1473
431 Ga0075430_100063229 3300006846 Bacteria 3109
432 Ga0075430_100099955 3300006846 Unclassified 2423
433 Ga0075430_100126789 3300006846 Bacteria 2128
434 Ga0075430_100885312 3300006846 Unclassified 736
435 Ga0075431_100001499 3300006847 Bacteria 21616
436 Ga0075431_100023477 3300006847 Bacteria 6310
437 Ga0075431_100035491 3300006847 Bacteria 5134
438 Ga0075431_100036946 3300006847 Bacteria 5031
439 Ga0075431_100962349 3300006847 Unclassified 822
440 Ga0075431_101676873 3300006847 Unclassified 593
441 Ga0075433_10001699 3300006852 Bacteria 16423
442 Ga0075433_10012120 3300006852 Bacteria 6954
443 Ga0075433_10016584 3300006852 Bacteria 6076
444 Ga0075433_10019978 3300006852 Bacteria 5595
445 Ga0075433_10040574 3300006852 Bacteria 4030
446 Ga0075433_10041993 3300006852 Bacteria 3966
447 Ga0075433_10043066 3300006852 Bacteria 3918
448 Ga0075433_10515010 3300006852 Archaea 1052
449 Ga0075433_11329130 3300006852 Bacteria 622
450 Ga0075434_100024652 3300006871 Bacteria 5882
451 Ga0075434_100046671 3300006871 Unclassified 4298
452 Ga0075434_100093946 3300006871 Bacteria 3003
453 Ga0075434_100211827 3300006871 Bacteria 1958
454 Ga0075434_100246544 3300006871 Bacteria 1806
455 Ga0075434_100426526 3300006871 Unclassified 1347
456 Ga0075434_100490932 3300006871 Bacteria 1249
457 Ga0075434_100769296 3300006871 Bacteria 979
458 Ga0075434_100829760 3300006871 Bacteria 940
459 Ga0075434_100920597 3300006871 Unclassified 889
460 Ga0075429_100160274 3300006880 Bacteria 1970
461 Ga0075429_100192505 3300006880 Unclassified 1786
462 Ga0075429_100421960 3300006880 Bacteria 1168
463 Ga0075429_100496837 3300006880 Unclassified 1069
464 Ga0075429_100914767 3300006880 Unclassified 768
465 Ga0068865_100405526 3300006881 Bacteria 1117
466 Ga0068865_100785309 3300006881 Bacteria 820
467 Ga0068865_101826935 3300006881 Bacteria 549
468 Ga0075436_100025078 3300006914 Bacteria 4100
469 Ga0075436_100032565 3300006914 Bacteria 3593
470 Ga0075436_100043993 3300006914 Unclassified 3079
471 Ga0075436_100092593 3300006914 Bacteria 2101
472 Ga0097620_100010723 3300006931 Bacteria 9223
473 Ga0097620_100037831 3300006931 Bacteria 4842
474 Ga0097620_100053034 3300006931 Bacteria 4078
475 Ga0097620_100103701 3300006931 Bacteria 2902
476 Ga0097620_100132805 3300006931 Unclassified 2561
477 Ga0097620_100142049 3300006931 Bacteria 2474
478 Ga0097620_100167073 3300006931 Bacteria 2280
479 Ga0097620_100294552 3300006931 Bacteria 1716
480 Ga0097620_100380135 3300006931 Bacteria 1508
481 Ga0097620_100401202 3300006931 Bacteria 1467
482 Ga0097620_100563653 3300006931 Bacteria 1233
483 Ga0097620_100633948 3300006931 Bacteria 1161
484 Ga0097620_100848130 3300006931 Bacteria 1000
485 Ga0097620_100933284 3300006931 Unclassified 952
486 Ga0097620_101004310 3300006931 Bacteria 916
487 Ga0097620_101080817 3300006931 Bacteria 882
488 Ga0097620_101898590 3300006931 Unclassified 658
489 Ga0097620_101906626 3300006931 Bacteria 656
490 Ga0097620_102143148 3300006931 Unclassified 617
491 Ga0075435_100026093 3300007076 Bacteria 4554
492 Ga0075435_100036054 3300007076 Bacteria 3928
493 Ga0075435_100938015 3300007076 Bacteria 755
494 Ga0075435_101021246 3300007076 Bacteria 722
495 Ga0075435_101190363 3300007076 Unclassified 667
496 Ga0075435_101773620 3300007076 Unclassified 542
497 Ga0099794_10118826 3300007265 Bacteria 1328
498 Ga0099794_10206644 3300007265 Bacteria 1006
499 Ga0099794_10609591 3300007265 Unclassified 578
500 Ga0105251_10218149 3300009011 Bacteria 859
501 Ga0105251_10345093 3300009011 Unclassified 679
502 Ga0105251_10488431 3300009011 Unclassified 574
503 Ga0105240_10000115 3300009093 Bacteria 165594
504 Ga0105240_10034031 3300009093 Bacteria 6577
505 Ga0105240_10069492 3300009093 Bacteria 4359
506 Ga0105240_10117898 3300009093 Bacteria 3200
507 Ga0105240_10385766 3300009093 Bacteria 1581
508 Ga0105240_10487977 3300009093 Unclassified 1372
509 Ga0105240_11824021 3300009093 Unclassified 634
510 Ga0105240_12053947 3300009093 Unclassified 594
511 Ga0111539_10033847 3300009094 Bacteria 6200
512 Ga0111539_10098755 3300009094 Bacteria 3429
513 Ga0111539_10394927 3300009094 Bacteria 1611
514 Ga0111539_10471347 3300009094 Bacteria 1462
515 Ga0111539_13035490 3300009094 Bacteria 542
516 Ga0105245_10005352 3300009098 Bacteria 11273
517 Ga0105245_10060430 3300009098 Bacteria 3413
518 Ga0105245_10138781 3300009098 Bacteria 2288
519 Ga0105245_10144476 3300009098 Bacteria 2244
520 Ga0105245_10207569 3300009098 Bacteria 1884
521 Ga0105245_10984089 3300009098 Bacteria 887
522 Ga0105245_12516065 3300009098 Unclassified 568
523 Ga0105245_12598837 3300009098 Unclassified 559
524 Ga0105247_10022526 3300009101 Bacteria 3794
525 Ga0105247_10087475 3300009101 Unclassified 1973
526 Ga0105247_10104972 3300009101 Bacteria 1811
527 Ga0105247_10128587 3300009101 Bacteria 1649
528 Ga0105247_10462232 3300009101 Unclassified 917
529 Ga0105247_10651063 3300009101 Bacteria 787
530 Ga0105247_10942886 3300009101 Unclassified 670
531 Ga0105247_11445255 3300009101 Bacteria 558
532 Ga0114129_10028076 3300009147 Bacteria 7972
533 Ga0114129_10183182 3300009147 Bacteria 2848
534 Ga0114129_10198896 3300009147 Bacteria 2716
535 Ga0114129_10211130 3300009147 Bacteria 2624
536 Ga0114129_10409043 3300009147 Bacteria 1787
537 Ga0114129_10429875 3300009147 Unclassified 1735
538 Ga0114129_10893029 3300009147 Unclassified 1127
539 Ga0114129_11169266 3300009147 Bacteria 960
540 Ga0114129_12438319 3300009147 Unclassified 626
541 Ga0114129_12611933 3300009147 Unclassified 603
542 Ga0105243_10042170 3300009148 Bacteria 3571
543 Ga0105243_10083569 3300009148 Bacteria 2612
544 Ga0105243_10165738 3300009148 Bacteria 1909
545 Ga0105243_10206265 3300009148 Bacteria 1727
546 Ga0105243_10325217 3300009148 Unclassified 1403
547 Ga0105243_10583534 3300009148 Bacteria 1073
548 Ga0105243_11375570 3300009148 Bacteria 726
549 Ga0105243_11378469 3300009148 Unclassified 725
550 Ga0105243_11900037 3300009148 Unclassified 628
551 Ga0105243_12784933 3300009148 Unclassified 529
552 Ga0105241_10017892 3300009174 Bacteria 5211
553 Ga0105241_10036247 3300009174 Bacteria 3711
554 Ga0105241_10066355 3300009174 Unclassified 2790
555 Ga0105241_10070230 3300009174 Bacteria 2717
556 Ga0105241_10100939 3300009174 Unclassified 2294
557 Ga0105241_10165285 3300009174 Bacteria 1823
558 Ga0105241_10259041 3300009174 Bacteria 1478
559 Ga0105241_10437316 3300009174 Bacteria 1155
560 Ga0105241_10637083 3300009174 Bacteria 967
561 Ga0105241_10783109 3300009174 Unclassified 877
562 Ga0105241_11201872 3300009174 Unclassified 718
563 Ga0105241_11242018 3300009174 Bacteria 707
564 Ga0105241_11278555 3300009174 Bacteria 698
565 Ga0105241_11371373 3300009174 Bacteria 676
566 Ga0105241_11693467 3300009174 Unclassified 614
567 Ga0105241_11888218 3300009174 Unclassified 585
568 Ga0105241_12606950 3300009174 Unclassified 508
569 Ga0105242_10019893 3300009176 Bacteria 5259
570 Ga0105242_10039349 3300009176 Bacteria 3805
571 Ga0105242_10044056 3300009176 Unclassified 3612
572 Ga0105242_10082006 3300009176 Bacteria 2698
573 Ga0105242_10226434 3300009176 Bacteria 1674
574 Ga0105242_10289648 3300009176 Bacteria 1490
575 Ga0105242_11749764 3300009176 Bacteria 659
576 Ga0105248_10000526 3300009177 Bacteria 43619
577 Ga0105248_10001687 3300009177 Bacteria 24588
578 Ga0105248_10007159 3300009177 Bacteria 12238
579 Ga0105248_10012433 3300009177 Bacteria 9389
580 Ga0105248_10132054 3300009177 Bacteria 2817
581 Ga0105248_10162973 3300009177 Bacteria 2514
582 Ga0105248_10165652 3300009177 Bacteria 2492
583 Ga0105248_10273169 3300009177 Bacteria 1903
584 Ga0105248_10541889 3300009177 Bacteria 1313
585 Ga0105248_10747236 3300009177 Bacteria 1104
586 Ga0105248_10833417 3300009177 Bacteria 1041
587 Ga0105248_10928377 3300009177 Bacteria 983
588 Ga0105248_10967744 3300009177 Unclassified 961
589 Ga0105248_11161977 3300009177 Unclassified 872
590 Ga0105248_11863139 3300009177 Bacteria 682
591 Ga0105237_10000199 3300009545 Bacteria 85277
592 Ga0105237_10000267 3300009545 Bacteria 73368
593 Ga0105237_10034465 3300009545 Bacteria 5125
594 Ga0105237_10073724 3300009545 Bacteria 3405
595 Ga0105237_10670830 3300009545 Bacteria 1043
596 Ga0105237_10742590 3300009545 Unclassified 988
597 Ga0105237_11079792 3300009545 Bacteria 809
598 Ga0105238_10134093 3300009551 Bacteria 2454
599 Ga0105238_10371069 3300009551 Unclassified 1421
600 Ga0105238_10876843 3300009551 Unclassified 915
601 Ga0105238_10885960 3300009551 Unclassified 910
602 Ga0105238_11145396 3300009551 Bacteria 801
603 Ga0105238_11217588 3300009551 Unclassified 778
604 Ga0105238_11405881 3300009551 Bacteria 725
605 Ga0105249_10001397 3300009553 Bacteria 21114
606 Ga0105249_10026072 3300009553 Bacteria 5265
607 Ga0105249_10033730 3300009553 Bacteria 4636
608 Ga0105249_10352646 3300009553 Bacteria 1491
609 Ga0105249_11336763 3300009553 Bacteria 788
610 Ga0105239_10009785 3300010375 Bacteria 10775
611 Ga0105239_10043429 3300010375 Bacteria 4927
612 Ga0105239_10266243 3300010375 Bacteria 1927
613 Ga0105239_10346058 3300010375 Bacteria 1678
614 Ga0105239_10429067 3300010375 Bacteria 1498
615 Ga0105239_10606063 3300010375 Bacteria 1249
616 Ga0105239_10757128 3300010375 Unclassified 1112
617 Ga0105239_11045922 3300010375 Bacteria 939
618 Ga0105239_12546674 3300010375 Unclassified 596
619 Ga0105246_10056903 3300011119 Bacteria 2704
620 Ga0105246_10103030 3300011119 Bacteria 2082
621 Ga0105246_10121579 3300011119 Bacteria 1936
622 Ga0105246_10221170 3300011119 Unclassified 1484
623 Ga0105246_10253466 3300011119 Bacteria 1398
624 Ga0105246_10491734 3300011119 Bacteria 1040
625 Ga0105246_12100915 3300011119 Unclassified 547
626 Ga0157373_10005529 3300013100 Bacteria 9474
627 Ga0157373_10688777 3300013100 Unclassified 748
628 Ga0157373_10855604 3300013100 Unclassified 673
629 Ga0157373_10987687 3300013100 Bacteria 628
630 Ga0157373_11064080 3300013100 Bacteria 606
631 Ga0157371_10292213 3300013102 Bacteria 1179
632 Ga0157370_10061502 3300013104 Bacteria 3564
633 Ga0157369_10987187 3300013105 Unclassified 862
634 Ga0157374_10004474 3300013296 Bacteria 11733
635 Ga0157374_10087667 3300013296 Unclassified 2963
636 Ga0157374_10129570 3300013296 Bacteria 2441
637 Ga0157374_10487709 3300013296 Bacteria 1236
638 Ga0157374_10762675 3300013296 Unclassified 982
639 Ga0157374_10775355 3300013296 Bacteria 974
640 Ga0157374_10821593 3300013296 Unclassified 946
641 Ga0157378_10000134 3300013297 Bacteria 70195
642 Ga0157378_10001025 3300013297 Bacteria 25546
643 Ga0157378_10006067 3300013297 Bacteria 10588
644 Ga0157378_10016886 3300013297 Bacteria 6397
645 Ga0157378_10028267 3300013297 Bacteria 4945
646 Ga0157378_10286858 3300013297 Bacteria 1589
647 Ga0157378_10332340 3300013297 Bacteria 1479
648 Ga0157378_11096721 3300013297 Bacteria 833
649 Ga0157378_12475754 3300013297 Bacteria 571
650 Ga0163162_10036150 3300013306 Bacteria 4921
651 Ga0163162_10159868 3300013306 Bacteria 2374
652 Ga0163162_10177363 3300013306 Bacteria 2256
653 Ga0163162_10204692 3300013306 Bacteria 2103
654 Ga0163162_10433584 3300013306 Unclassified 1446
655 Ga0163162_10640359 3300013306 Bacteria 1187
656 Ga0163162_12088802 3300013306 Bacteria 650
657 Ga0163162_12273109 3300013306 Bacteria 623
658 Ga0163162_13443810 3300013306 Bacteria 504
659 Ga0157372_10033757 3300013307 Bacteria 5622
660 Ga0157372_10063742 3300013307 Bacteria 4134
661 Ga0157372_10617125 3300013307 Bacteria 1264
662 Ga0157372_10928710 3300013307 Bacteria 1009
663 Ga0157372_10995488 3300013307 Bacteria 971
664 Ga0157375_10063629 3300013308 Bacteria 3671
665 Ga0157375_10184622 3300013308 Bacteria 2238
666 Ga0157375_10571993 3300013308 Bacteria 1291
667 Ga0157375_11273242 3300013308 Unclassified 864
668 Ga0157375_11547612 3300013308 Bacteria 783
669 Ga0157375_11647074 3300013308 Unclassified 759
670 Ga0163163_10013740 3300014325 Bacteria 7420
671 Ga0163163_10275846 3300014325 Unclassified 1732
672 Ga0163163_10386954 3300014325 Bacteria 1456
673 Ga0163163_10524960 3300014325 Unclassified 1246
674 Ga0163163_10681317 3300014325 Bacteria 1092
675 Ga0157380_11474538 3300014326 Bacteria 733
676 Ga0157380_11604021 3300014326 Unclassified 706
677 Ga0157380_11856561 3300014326 Unclassified 662
678 Ga0157380_12077935 3300014326 Unclassified 631
679 Ga0157377_10110423 3300014745 Bacteria 1652
680 Ga0157377_11200216 3300014745 Unclassified 587
681 Ga0157379_10041034 3300014968 Bacteria 4131
682 Ga0157379_10056516 3300014968 Bacteria 3506
683 Ga0157379_11286772 3300014968 Unclassified 706
684 Ga0157376_10174223 3300014969 Bacteria 1961
685 Ga0157376_10571476 3300014969 Bacteria 1121
686 Ga0182005_1069317 3300015265 Bacteria 967
687 Ga0182005_1226343 3300015265 Unclassified 571
688 Ga0163161_10599060 3300017792 Bacteria 908
689 Ga0213872_10038558 3300021361 Bacteria 2181
690 Ga0213872_10402689 3300021361 Unclassified 555
691 Ga0213876_10033164 3300021384 Unclassified 2722
692 Ga0213876_10235349 3300021384 Bacteria 973
693 Ga0213875_10207652 3300021388 Unclassified 922
694 Ga0207697_10040232 3300025315 Bacteria 1920
695 Ga0207697_10246407 3300025315 Unclassified 790
696 Ga0207697_10339566 3300025315 Bacteria 667
697 Ga0207656_10001285 3300025321 Bacteria 8249
698 Ga0207656_10069665 3300025321 Bacteria 1560
699 Ga0207653_10008038 3300025885 Bacteria 3287
700 Ga0207692_10303072 3300025898 Unclassified 973
701 Ga0207642_10039866 3300025899 Unclassified 2045
702 Ga0207642_10071929 3300025899 Bacteria 1649
703 Ga0207642_10175858 3300025899 Bacteria 1162
704 Ga0207710_10153409 3300025900 Bacteria 1118
705 Ga0207710_10224905 3300025900 Unclassified 933
706 Ga0207688_10451664 3300025901 Bacteria 801
707 Ga0207688_10494503 3300025901 Bacteria 765
708 Ga0207680_10158828 3300025903 Bacteria 1514
709 Ga0207680_10463775 3300025903 Unclassified 900
710 Ga0207647_10039267 3300025904 Unclassified 2988
711 Ga0207647_10100743 3300025904 Bacteria 1714
712 Ga0207647_10435298 3300025904 Bacteria 736
713 Ga0207699_10013633 3300025906 Bacteria 4167
714 Ga0207699_10374128 3300025906 Unclassified 1010
715 Ga0207645_10016652 3300025907 Bacteria 4863
716 Ga0207645_10727293 3300025907 Bacteria 675
717 Ga0207643_10009386 3300025908 Bacteria 5256
718 Ga0207643_10015617 3300025908 Unclassified 4134
719 Ga0207643_10054092 3300025908 Bacteria 2281
720 Ga0207705_10005099 3300025909 Bacteria 9846
721 Ga0207684_10000093 3300025910 Bacteria 166136
722 Ga0207684_10070701 3300025910 Bacteria 2966
723 Ga0207684_10097238 3300025910 Unclassified 2513
724 Ga0207654_10006238 3300025911 Bacteria 5993
725 Ga0207654_10030858 3300025911 Unclassified 2946
726 Ga0207654_10033202 3300025911 Unclassified 2859
727 Ga0207654_10193335 3300025911 Bacteria 1335
728 Ga0207654_10397047 3300025911 Unclassified 958
729 Ga0207654_11182204 3300025911 Unclassified 557
730 Ga0207707_10071835 3300025912 Bacteria 3016
731 Ga0207707_10086108 3300025912 Bacteria 2746
732 Ga0207707_10549170 3300025912 Bacteria 982
733 Ga0207695_10000116 3300025913 Bacteria 239510
734 Ga0207695_10068401 3300025913 Bacteria 3639
735 Ga0207695_10112749 3300025913 Bacteria 2696
736 Ga0207695_10351958 3300025913 Bacteria 1360
737 Ga0207695_10386215 3300025913 Unclassified 1285
738 Ga0207695_10528397 3300025913 Bacteria 1061
739 Ga0207695_11342815 3300025913 Unclassified 595
740 Ga0207671_10000687 3300025914 Bacteria 43812
741 Ga0207671_10009579 3300025914 Bacteria 8077
742 Ga0207671_10308134 3300025914 Unclassified 1251
743 Ga0207671_10392020 3300025914 Unclassified 1104
744 Ga0207671_11049111 3300025914 Bacteria 641
745 Ga0207693_10137841 3300025915 Unclassified 1919
746 Ga0207693_10147312 3300025915 Bacteria 1851
747 Ga0207693_10173714 3300025915 Unclassified 1696
748 Ga0207693_10521423 3300025915 Bacteria 927
749 Ga0207663_10116336 3300025916 Bacteria 1823
750 Ga0207663_10271478 3300025916 Bacteria 1256
751 Ga0207663_10437271 3300025916 Bacteria 1007
752 Ga0207663_11164161 3300025916 Unclassified 620
753 Ga0207660_10062012 3300025917 Bacteria 2693
754 Ga0207660_10670720 3300025917 Bacteria 845
755 Ga0207660_11299572 3300025917 Bacteria 591
756 Ga0207662_10015810 3300025918 Bacteria 4251
757 Ga0207662_10180372 3300025918 Bacteria 1358
758 Ga0207662_10871880 3300025918 Unclassified 636
759 Ga0207657_10131020 3300025919 Unclassified 2055
760 Ga0207657_10302159 3300025919 Bacteria 1267
761 Ga0207649_10054868 3300025920 Unclassified 2482
762 Ga0207649_10501640 3300025920 Bacteria 923
763 Ga0207652_10016862 3300025921 Bacteria 5971
764 Ga0207646_10014742 3300025922 Bacteria 7405
765 Ga0207646_10119154 3300025922 Unclassified 2371
766 Ga0207646_10164839 3300025922 Bacteria 2000
767 Ga0207646_10301513 3300025922 Bacteria 1447
768 Ga0207681_10008337 3300025923 Bacteria 6338
769 Ga0207681_10256526 3300025923 Bacteria 1367
770 Ga0207681_10276707 3300025923 Bacteria 1320
771 Ga0207694_10078555 3300025924 Bacteria 2587
772 Ga0207694_10883458 3300025924 Bacteria 756
773 Ga0207694_11051298 3300025924 Unclassified 689
774 Ga0207694_11103630 3300025924 Bacteria 671
775 Ga0207650_10076903 3300025925 Bacteria 2522
776 Ga0207650_11217278 3300025925 Unclassified 641
777 Ga0207687_10011493 3300025927 Bacteria 5786
778 Ga0207687_10108394 3300025927 Bacteria 2056
779 Ga0207687_10111742 3300025927 Bacteria 2029
780 Ga0207687_10189967 3300025927 Bacteria 1598
781 Ga0207687_10620108 3300025927 Unclassified 913
782 Ga0207687_11933906 3300025927 Unclassified 504
783 Ga0207700_10021700 3300025928 Bacteria 4390
784 Ga0207700_10031595 3300025928 Unclassified 3764
785 Ga0207700_10273025 3300025928 Unclassified 1452
786 Ga0207700_10958822 3300025928 Bacteria 766
787 Ga0207700_11126299 3300025928 Bacteria 701
788 Ga0207664_10007641 3300025929 Bacteria 7499
789 Ga0207644_10075526 3300025931 Bacteria 2476
790 Ga0207644_10326688 3300025931 Bacteria 1241
791 Ga0207644_11818946 3300025931 Bacteria 510
792 Ga0207690_10107500 3300025932 Bacteria 2004
793 Ga0207690_10295129 3300025932 Bacteria 1267
794 Ga0207706_10081965 3300025933 Bacteria 2835
795 Ga0207706_10231877 3300025933 Bacteria 1615
796 Ga0207706_10643447 3300025933 Bacteria 908
797 Ga0207706_11720772 3300025933 Unclassified 504
798 Ga0207686_10008369 3300025934 Bacteria 5583
799 Ga0207686_10043950 3300025934 Bacteria 2740
800 Ga0207686_10118681 3300025934 Bacteria 1797
801 Ga0207686_10203774 3300025934 Unclassified 1418
802 Ga0207709_10020878 3300025935 Unclassified 3700
803 Ga0207709_10140481 3300025935 Bacteria 1659
804 Ga0207709_10255958 3300025935 Bacteria 1281
805 Ga0207709_10465775 3300025935 Bacteria 980
806 Ga0207709_10556024 3300025935 Unclassified 903
807 Ga0207709_10909052 3300025935 Bacteria 716
808 Ga0207709_11292147 3300025935 Unclassified 603
809 Ga0207670_10002947 3300025936 Bacteria 8989
810 Ga0207670_10026837 3300025936 Bacteria 3634
811 Ga0207670_10309090 3300025936 Unclassified 1240
812 Ga0207670_10309892 3300025936 Unclassified 1239
813 Ga0207670_10379222 3300025936 Unclassified 1126
814 Ga0207670_10636984 3300025936 Unclassified 878
815 Ga0207670_10751891 3300025936 Unclassified 810
816 Ga0207669_11515946 3300025937 Bacteria 572
817 Ga0207669_11895116 3300025937 Unclassified 509
818 Ga0207704_10047829 3300025938 Bacteria 2560
819 Ga0207704_10912573 3300025938 Unclassified 739
820 Ga0207665_10159013 3300025939 Bacteria 1624
821 Ga0207665_10206078 3300025939 Bacteria 1435
822 Ga0207665_10315360 3300025939 Bacteria 1172
823 Ga0207691_10023578 3300025940 Bacteria 5794
824 Ga0207691_10916000 3300025940 Unclassified 733
825 Ga0207711_10002710 3300025941 Bacteria 15632
826 Ga0207711_10013418 3300025941 Bacteria 6806
827 Ga0207711_10023161 3300025941 Bacteria 5198
828 Ga0207711_10046701 3300025941 Bacteria 3700
829 Ga0207711_10082965 3300025941 Bacteria 2803
830 Ga0207711_10110981 3300025941 Bacteria 2439
831 Ga0207711_10207379 3300025941 Bacteria 1790
832 Ga0207711_10280547 3300025941 Bacteria 1534
833 Ga0207711_10310859 3300025941 Bacteria 1455
834 Ga0207711_11102282 3300025941 Unclassified 735
835 Ga0207711_11132236 3300025941 Unclassified 724
836 Ga0207689_10028761 3300025942 Bacteria 4648
837 Ga0207689_10082032 3300025942 Bacteria 2651
838 Ga0207689_10341305 3300025942 Bacteria 1244
839 Ga0207689_10352077 3300025942 Unclassified 1224
840 Ga0207689_10543049 3300025942 Unclassified 976
841 Ga0207689_11131425 3300025942 Unclassified 660
842 Ga0207689_11232138 3300025942 Bacteria 629
843 Ga0207661_10419604 3300025944 Unclassified 1215
844 Ga0207661_12100559 3300025944 Bacteria 511
845 Ga0207679_10111021 3300025945 Bacteria 2164
846 Ga0207679_10188536 3300025945 Unclassified 1712
847 Ga0207679_10193396 3300025945 Bacteria 1693
848 Ga0207679_10379759 3300025945 Unclassified 1238
849 Ga0207679_10764036 3300025945 Bacteria 880
850 Ga0207679_11898487 3300025945 Unclassified 543
851 Ga0207667_10019013 3300025949 Bacteria 7681
852 Ga0207651_10004480 3300025960 Bacteria 7047
853 Ga0207651_10152772 3300025960 Bacteria 1800
854 Ga0207651_10261897 3300025960 Bacteria 1420
855 Ga0207651_10382519 3300025960 Bacteria 1193
856 Ga0207651_10417887 3300025960 Unclassified 1144
857 Ga0207651_11058865 3300025960 Bacteria 726
858 Ga0207712_10010118 3300025961 Bacteria 5980
859 Ga0207712_10016699 3300025961 Bacteria 4757
860 Ga0207668_10541687 3300025972 Bacteria 1007
861 Ga0207640_10023432 3300025981 Unclassified 3710
862 Ga0207640_10057844 3300025981 Bacteria 2552
863 Ga0207640_10104686 3300025981 Bacteria 1992
864 Ga0207640_10232017 3300025981 Bacteria 1420
865 Ga0207640_10473881 3300025981 Viruses 1037
866 Ga0207658_10000006 3300025986 Bacteria 392309
867 Ga0207658_10055939 3300025986 Bacteria 2926
868 Ga0207658_10532878 3300025986 Unclassified 1049
869 Ga0207658_10598570 3300025986 Bacteria 990
870 Ga0207658_11054775 3300025986 Unclassified 742
871 Ga0207677_10279485 3300026023 Bacteria 1370
872 Ga0207677_10650231 3300026023 Unclassified 930
873 Ga0207677_10744261 3300026023 Bacteria 873
874 Ga0207677_11085731 3300026023 Unclassified 729
875 Ga0207703_10048207 3300026035 Bacteria 3438
876 Ga0207703_10053925 3300026035 Unclassified 3269
877 Ga0207703_10065351 3300026035 Bacteria 2989
878 Ga0207703_10119227 3300026035 Bacteria 2263
879 Ga0207703_10124130 3300026035 Bacteria 2220
880 Ga0207703_10209739 3300026035 Bacteria 1736
881 Ga0207703_10230529 3300026035 Bacteria 1660
882 Ga0207703_10255608 3300026035 Bacteria 1581
883 Ga0207703_10366934 3300026035 Bacteria 1329
884 Ga0207703_10557492 3300026035 Bacteria 1081
885 Ga0207703_10774688 3300026035 Bacteria 915
886 Ga0207703_11367214 3300026035 Unclassified 681
887 Ga0207703_12196833 3300026035 Bacteria 528
888 Ga0207639_10058308 3300026041 Unclassified 2969
889 Ga0207639_10202434 3300026041 Bacteria 1704
890 Ga0207639_11415595 3300026041 Unclassified 652
891 Ga0207639_11421490 3300026041 Unclassified 651
892 Ga0207678_10000063 3300026067 Bacteria 83590
893 Ga0207678_10114430 3300026067 Bacteria 2301
894 Ga0207708_10000031 3300026075 Bacteria 155478
895 Ga0207708_10011459 3300026075 Bacteria 6606
896 Ga0207708_10024121 3300026075 Unclassified 4600
897 Ga0207708_10029346 3300026075 Bacteria 4168
898 Ga0207708_10107471 3300026075 Bacteria 2163
899 Ga0207708_10147408 3300026075 Bacteria 1850
900 Ga0207708_11246581 3300026075 Bacteria 651
901 Ga0207702_10019366 3300026078 Bacteria 5632
902 Ga0207702_10067425 3300026078 Unclassified 3071
903 Ga0207702_10524055 3300026078 Unclassified 1157
904 Ga0207641_10005329 3300026088 Bacteria 10985
905 Ga0207641_10011056 3300026088 Bacteria 7405
906 Ga0207641_10013347 3300026088 Bacteria 6737
907 Ga0207641_10063447 3300026088 Bacteria 3156
908 Ga0207641_10111021 3300026088 Bacteria 2431
909 Ga0207641_10161411 3300026088 Bacteria 2038
910 Ga0207641_10313293 3300026088 Bacteria 1486
911 Ga0207641_10317289 3300026088 Unclassified 1477
912 Ga0207641_10367804 3300026088 Bacteria 1374
913 Ga0207641_11056280 3300026088 Bacteria 810
914 Ga0207648_10020342 3300026089 Bacteria 5979
915 Ga0207648_10248278 3300026089 Bacteria 1586
916 Ga0207648_10293272 3300026089 Bacteria 1457
917 Ga0207648_10488797 3300026089 Bacteria 1125
918 Ga0207648_10729582 3300026089 Unclassified 919
919 Ga0207648_10984519 3300026089 Bacteria 789
920 Ga0207676_10050400 3300026095 Bacteria 3245
921 Ga0207676_10987657 3300026095 Bacteria 829
922 Ga0207676_11080994 3300026095 Unclassified 792
923 Ga0207676_11095251 3300026095 Unclassified 787
924 Ga0207676_11975650 3300026095 Unclassified 582
925 Ga0207674_10024472 3300026116 Bacteria 6453
926 Ga0207674_10051992 3300026116 Bacteria 4179
927 Ga0207674_10093324 3300026116 Bacteria 2998
928 Ga0207674_10117589 3300026116 Bacteria 2629
929 Ga0207674_10158463 3300026116 Unclassified 2218
930 Ga0207674_10256618 3300026116 Bacteria 1695
931 Ga0207674_10328366 3300026116 Unclassified 1479
932 Ga0207674_10739673 3300026116 Bacteria 949
933 Ga0207674_10774523 3300026116 Bacteria 926
934 Ga0207674_11174668 3300026116 Unclassified 737
935 Ga0207674_11728298 3300026116 Unclassified 593
936 Ga0207675_100019551 3300026118 Bacteria 6321
937 Ga0207675_100067780 3300026118 Bacteria 3336
938 Ga0207675_100087644 3300026118 Bacteria 2924
939 Ga0207675_100111996 3300026118 Unclassified 2575
940 Ga0207675_100168486 3300026118 Bacteria 2093
941 Ga0207683_10224729 3300026121 Bacteria 1711
942 Ga0207683_10859766 3300026121 Bacteria 842
943 Ga0207698_10037516 3300026142 Bacteria 3570
944 Ga0207698_10102810 3300026142 Bacteria 2373
945 Ga0207698_10463520 3300026142 Bacteria 1226
946 Ga0207698_10549774 3300026142 Unclassified 1131
947 Ga0207698_10818806 3300026142 Bacteria 934
948 Ga0207698_11734898 3300026142 Unclassified 640
949 Ga0209281_1062835 3300027111 Unclassified 562
950 Ga0209179_1027077 3300027512 Bacteria 1154
951 Ga0209813_10061851 3300027866 Unclassified 1197
952 Ga0207428_10003819 3300027907 Bacteria 14446
953 Ga0265357_1002559 3300028023 Unclassified 1500
954 Ga0268266_10400543 3300028379 Bacteria 1298
955 Ga0268265_10195075 3300028380 Bacteria 1752
956 Ga0268265_10530708 3300028380 Bacteria 1114
957 Ga0268265_11051038 3300028380 Unclassified 806
958 Ga0268265_11436928 3300028380 Unclassified 692
959 Ga0268264_10013446 3300028381 Bacteria 6739
960 Ga0268264_10016633 3300028381 Bacteria 6022
961 Ga0268264_10125603 3300028381 Bacteria 2267
962 Ga0268264_10131359 3300028381 Bacteria 2220
963 Ga0268264_10204843 3300028381 Bacteria 1807
964 Ga0268264_10419794 3300028381 Bacteria 1290
965 Ga0268264_10761805 3300028381 Unclassified 965
966 Ga0265323_10013817 3300028653 Bacteria 3211
967 Ga0265322_10003804 3300028654 Bacteria 4533
968 Ga0265338_10000025 3300028800 Bacteria 296972
969 Ga0265338_10046727 3300028800 Unclassified 3964
970 Ga0265338_10542701 3300028800 Unclassified 815
971 Ga0265324_10099914 3300029957 Unclassified 986
972 Ga0316178_1156890 3300030735 Bacteria 1313
973 Ga0265777_100578 3300030877 Bacteria 1731
974 Ga0265325_10024886 3300031241 Unclassified 3252
975 Ga0265325_10071774 3300031241 Unclassified 1737
976 Ga0265329_10078573 3300031242 Unclassified 1045
977 Ga0265339_10065974 3300031249 Bacteria 1939
978 Ga0265331_10004173 3300031250 Bacteria 9057
979 Ga0265327_10008569 3300031251 Bacteria 7589
980 Ga0265316_10002953 3300031344 Bacteria 17405
981 Ga0265316_10043140 3300031344 Unclassified 3599
982 Ga0265316_10052917 3300031344 Bacteria 3183
983 Ga0265316_10426626 3300031344 Bacteria 953
984 Ga0307408_100021160 3300031548 Bacteria 4399
985 Ga0307408_100069176 3300031548 Unclassified 2602
986 Ga0307408_100535709 3300031548 Unclassified 1031
987 Ga0307408_100698352 3300031548 Unclassified 912
988 Ga0265314_10419421 3300031711 Bacteria 719
989 Ga0307405_10004763 3300031731 Bacteria 6465
990 Ga0307405_10054486 3300031731 Bacteria 2497
991 Ga0307413_11170962 3300031824 Unclassified 667
992 Ga0307413_11765526 3300031824 Unclassified 553
993 Ga0307410_10507227 3300031852 Unclassified 993
994 Ga0307406_10012174 3300031901 Bacteria 4899
995 Ga0307407_10818869 3300031903 Unclassified 709
996 Ga0307412_10006276 3300031911 Bacteria 6711
997 Ga0307412_10488672 3300031911 Unclassified 1022
998 Ga0307412_10664465 3300031911 Unclassified 890
999 Ga0307409_101004930 3300031995 Unclassified 852
1000 Ga0307409_101963354 3300031995 Unclassified 615
1001 Ga0307409_102964226 3300031995 Unclassified 501
1002 Ga0307416_100004668 3300032002 Bacteria 8293
1003 Ga0307416_100083037 3300032002 Bacteria 2716
1004 Ga0307416_100248270 3300032002 Bacteria 1730
1005 Ga0307416_100415148 3300032002 Bacteria 1388
1006 Ga0307416_100775201 3300032002 Unclassified 1053
1007 Ga0307414_10001159 3300032004 Bacteria 13522
1008 Ga0307414_10037715 3300032004 Bacteria 3239
1009 Ga0307414_10191807 3300032004 Bacteria 1654
1010 Ga0307414_10194834 3300032004 Unclassified 1643
1011 Ga0307411_10162139 3300032005 Unclassified 1676
1012 Ga0307411_10384682 3300032005 Unclassified 1155
1013 Ga0307411_11021944 3300032005 Unclassified 741
1014 Ga0307411_11632673 3300032005 Unclassified 595
1015 Ga0307411_12242547 3300032005 Bacteria 512
1016 Ga0307411_12264107 3300032005 Unclassified 510
1017 Ga0307411_12296398 3300032005 Unclassified 507
1018 Ga0307415_100002653 3300032126 Bacteria 8929
1019 Ga0307415_100969160 3300032126 Unclassified 788
1020 Ga0307415_101443991 3300032126 Unclassified 656
1021 Ga0307510_10006599 3300033180 Bacteria 13843
1022 Ga0373948_0164300 3300034817 Unclassified 562
1023 Ga0373940_0005965 3300035088 Bacteria 2675
1024 Ga0373949_0201259 3300035090 Unclassified 598
1025 Ga0373951_0115113 3300035091 Unclassified 727
1026 Ga0373923_0346686 3300035111 Unclassified 709
1027 Ga0373932_0181372 3300035112 Bacteria 739
1028 Ga0373936_0248665 3300035113 Unclassified 794
1029 Ga0373939_0136967 3300035114 Unclassified 879
1030 Ga0373941_0013686 3300035115 Bacteria 2151
1031 Ga0373941_0300527 3300035115 Bacteria 640
1032 Ga0373956_0069096 3300035119 Bacteria 1610
1033 Ga0373943_0325163 3300035170 Unclassified 877
1034 Ga0373946_0032531 3300035171 Bacteria 2095
1035 Ga0373946_0081845 3300035171 Bacteria 1415
1036 Ga0373955_0374390 3300035172 Bacteria 864
1037 Ga0373955_0840094 3300035172 Unclassified 565
1038 Ga0373942_0014442 3300035207 Bacteria 1912
1039 Ga0373961_0191375 3300035241 Unclassified 717
1040 Ga0373924_0196769 3300035410 Unclassified 888
1041 Ga0373924_0245809 3300035410 Unclassified 792
1042 Ga0373924_0518959 3300035410 Unclassified 536
1043 Ga0373931_0079920 3300035691 Bacteria 1802
1044 Ga0373931_0369809 3300035691 Unclassified 901
1045 Ga0373935_0023546 3300035692 Bacteria 3785
1046 Ga0373935_0529664 3300035692 Bacteria 857
1047 Ga0373927_0003719 3300035695 Bacteria 10843
1048 Ga0373927_0062443 3300035695 Bacteria 2409
1049 Ga0373947_0015367 3300035725 Bacteria 4393
1050 Ga0373947_0188439 3300035725 Bacteria 1345
1051 Ga0373937_0007350 3300036401 Bacteria 9538
1052 Ga0373937_0168533 3300036401 Bacteria 2054
1053 Ga0373937_0696450 3300036401 Bacteria 962
1054 Ga0373937_0699348 3300036401 Bacteria 960
1055 Ga0373937_0860986 3300036401 Bacteria 855
1056 Ga0373925_0107049 3300037068 Unclassified 2156
1057 Ga0395899_0064500 3300037312 Unclassified 2693
1058 Ga0395900_0003700 3300037418 Bacteria 16433
1059 Ga0395900_1434654 3300037418 Unclassified 603
1060 Ga0395898_0095698 3300037466 Bacteria 2853
1061 Ga0395898_1023159 3300037466 Unclassified 761
1062 Ga0395905_0000496 3300037471 Bacteria 54071
1063 Ga0395905_0027619 3300037471 Bacteria 5351
1064 Ga0436364_0141118 3300037853 Unclassified 1221
1065 Ga0436364_1211847 3300037853 Bacteria 1063
1066 Ga0395901_0001981 3300038443 Bacteria 21059
1067 Ga0395901_0167038 3300038443 Bacteria 2310
1068 Ga0395901_0577963 3300038443 Bacteria 1136
1069 Ga0436365_1376303 3300039437 Bacteria 20144
1070 Ga0436365_1481395 3300039437 Bacteria 992
1071 Ga0436360_0194576 3300039438 Bacteria 4119
1072 Ga0436360_0687086 3300039438 Unclassified 800
1073 Ga0436360_1185407 3300039438 Unclassified 708
1074 Ga0436361_0186403 3300039447 Unclassified 1680
1075 Ga0436361_0248862 3300039447 Unclassified 1186
1076 Ga0436361_0535007 3300039447 Unclassified 1239
1077 Ga0436361_0809850 3300039447 Bacteria 4801
1078 Ga0436362_0107871 3300039453 Bacteria 1642
1079 Ga0439442_079128 3300042002 Bacteria 703
1080 Ga0439448_0053476 3300042005 Bacteria 1325
1081 Ga0439455_0015377 3300042012 Bacteria 1758
1082 Ga0439458_0003739 3300042157 Unclassified 3526
1083 Ga0439435_0106623 3300042436 Bacteria 866
1084 Ga0451577_0224450 3300042876 Bacteria 1698
1085 Ga0451577_0813414 3300042876 Unclassified 844
1086 Ga0451577_1323502 3300042876 Unclassified 640
1087 Ga0453684_0025701 3300044712 Bacteria 8538
1088 Ga0453684_0367864 3300044712 Bacteria 1617
1089 Ga0453684_0595564 3300044712 Unclassified 1212
1090 Ga0453684_0654753 3300044712 Bacteria 1146
1091 Ga0453684_0757827 3300044712 Unclassified 1050
1092 Ga0453684_1006850 3300044712 Bacteria 886
1093 Ga0453684_1511646 3300044712 Bacteria 692
1094 Ga0453684_1707641 3300044712 Unclassified 643
1095 Ga0453684_2365588 3300044712 Unclassified 527
1096 Ga0451576_0013273 3300045051 Bacteria 9219
1097 Ga0451576_0216108 3300045051 Unclassified 2002
1098 Ga0451576_0372584 3300045051 Unclassified 1496
1099 Ga0451576_1896340 3300045051 Bacteria 615
1100 Ga0451576_2050321 3300045051 Bacteria 589
1101 Ga0466967_0178048 3300045976 Bacteria 2004
1102 Ga0495592_0040268 3300046454 Bacteria 3507
1103 Ga0495603_0295167 3300046455 Unclassified 931
1104 Ga0495603_0690843 3300046455 Bacteria 583
1105 Ga0495591_000055 3300046458 Bacteria 135355
1106 Ga0495629_0000008 3300046459 Bacteria 352138
1107 Ga0495629_0001309 3300046459 Bacteria 19585
1108 Ga0495638_0064453 3300046460 Unclassified 2257
1109 Ga0495641_0101417 3300046461 Bacteria 1284
1110 Ga0495651_0000592 3300046462 Bacteria 28111
1111 Ga0495651_0010129 3300046462 Bacteria 7240
1112 Ga0495651_0063218 3300046462 Bacteria 2830
1113 Ga0495653_0007710 3300046463 Bacteria 8806
1114 Ga0495580_0010339 3300046472 Bacteria 7274
1115 Ga0495580_0125249 3300046472 Bacteria 1783
1116 Ga0495580_0622347 3300046472 Unclassified 712
1117 Ga0495582_0062784 3300046473 Bacteria 2052
1118 Ga0495605_0000688 3300046474 Bacteria 25300
1119 Ga0495605_0002297 3300046474 Bacteria 11924
1120 Ga0495639_0001582 3300046475 Bacteria 10162
1121 Ga0495639_0006686 3300046475 Bacteria 4963
1122 Ga0495639_0224510 3300046475 Unclassified 924
1123 Ga0495639_0618009 3300046475 Unclassified 558
1124 Ga0495662_0031533 3300046476 Bacteria 2561
1125 Ga0495664_0006196 3300046477 Bacteria 6604
1126 Ga0495664_0095442 3300046477 Unclassified 1790
1127 Ga0495594_0028185 3300046499 Bacteria 3029
1128 Ga0495594_0029771 3300046499 Bacteria 2952
1129 Ga0495607_0000601 3300046501 Bacteria 35014
1130 Ga0495607_0003860 3300046501 Bacteria 11292
1131 Ga0495607_0007058 3300046501 Bacteria 7812
1132 Ga0495606_0004167 3300046507 Bacteria 14656
1133 Ga0495606_0293353 3300046507 Bacteria 884
1134 Ga0495608_0011180 3300046511 Bacteria 6248
1135 Ga0495610_0181236 3300046512 Bacteria 876
1136 Ga0495618_0142662 3300046514 Bacteria 1532
1137 Ga0495628_0027484 3300046516 Bacteria 4629
1138 Ga0495628_0268689 3300046516 Unclassified 1269
1139 Ga0495630_0010818 3300046517 Bacteria 6588
1140 Ga0495630_0011497 3300046517 Bacteria 6410
1141 Ga0495630_0021829 3300046517 Bacteria 4727
1142 Ga0495630_0146348 3300046517 Bacteria 1797
1143 Ga0495631_0018542 3300046518 Bacteria 3274
1144 Ga0495632_0000124 3300046519 Bacteria 78023
1145 Ga0495637_0012088 3300046520 Bacteria 4135
1146 Ga0495637_0038790 3300046520 Bacteria 2060
1147 Ga0495666_0000817 3300046526 Bacteria 14415
1148 Ga0495666_0007293 3300046526 Bacteria 5546
1149 Ga0495666_0032771 3300046526 Bacteria 2542
1150 Ga0495652_0009953 3300046529 Bacteria 8618
1151 Ga0495652_0108517 3300046529 Bacteria 2237
1152 Ga0495654_0047494 3300046530 Bacteria 2110
1153 Ga0495665_0004930 3300046531 Bacteria 7196
1154 Ga0495640_0131506 3300046533 Bacteria 1619
1155 Ga0495586_0002774 3300046535 Bacteria 9467
1156 Ga0495586_0105383 3300046535 Bacteria 1567
1157 Ga0495586_0140184 3300046535 Bacteria 1357
1158 Ga0495587_0009875 3300046536 Bacteria 6094
1159 Ga0495621_0116159 3300046539 Unclassified 1030
1160 Ga0495597_0000467 3300046542 Bacteria 34288
1161 Ga0495645_0057384 3300046543 Bacteria 2826
1162 Ga0495645_0087772 3300046543 Bacteria 2225
1163 Ga0495645_0154709 3300046543 Bacteria 1589
1164 Ga0495645_0231328 3300046543 Bacteria 1238
1165 Ga0495622_0038871 3300046557 Bacteria 2215
1166 Ga0495667_0087211 3300046559 Bacteria 2024
1167 Ga0495668_0298746 3300046616 Bacteria 883
1168 Ga0495668_0364189 3300046616 Bacteria 794
1169 Ga0495634_0030948 3300046642 Bacteria 3689
1170 Ga0495635_0012021 3300046663 Bacteria 6068
1171 Ga0495635_0013285 3300046663 Bacteria 5761
1172 Ga0495635_0050813 3300046663 Bacteria 2857
1173 Ga0495661_0002707 3300046665 Bacteria 13503
1174 Ga0495661_0267048 3300046665 Bacteria 867
1175 Ga0495657_0039314 3300046675 Bacteria 3251
1176 Ga0495657_0286792 3300046675 Unclassified 984
1177 Ga0495599_0019005 3300046678 Bacteria 4284
1178 Ga0495599_0337292 3300046678 Bacteria 905
1179 Ga0495599_0380939 3300046678 Unclassified 842
1180 Ga0495623_0005122 3300046679 Bacteria 8602
1181 Ga0495623_0505197 3300046679 Unclassified 638
1182 Ga0495646_0000534 3300046680 Bacteria 20391
1183 Ga0495658_0003686 3300046683 Bacteria 7576
1184 Ga0495669_0068817 3300046684 Bacteria 1611
1185 Ga0495613_0017347 3300046689 Bacteria 5365
1186 Ga0495613_0048524 3300046689 Bacteria 3135
1187 Ga0495613_0543266 3300046689 Bacteria 778
1188 Ga0495624_0001421 3300046690 Bacteria 18642
1189 Ga0495624_0163604 3300046690 Bacteria 1359
1190 Ga0495649_0128479 3300046694 Bacteria 1338
1191 Ga0495649_0318131 3300046694 Bacteria 790
1192 Ga0495600_0024437 3300046809 Bacteria 3889
1193 Ga0495600_0262631 3300046809 Bacteria 1096
1194 Ga0495660_0000741 3300046810 Bacteria 24710
1195 Ga0495581_0010103 3300047315 Bacteria 5462
1196 Ga0495581_0024224 3300047315 Bacteria 3518
1197 Ga0495581_0407215 3300047315 Bacteria 793
1198 Ga0495604_0006230 3300047317 Bacteria 9464
1199 Ga0495674_0019922 3300047319 Bacteria 6219
1200 Ga0495674_0051371 3300047319 Bacteria 3634
1201 Ga0495674_0712820 3300047319 Unclassified 787
1202 Ga0495672_0050803 3300047320 Bacteria 2445
1203 Ga0495672_0112157 3300047320 Bacteria 1462
1204 Ga0495680_0001367 3300047322 Bacteria 26487
1205 Ga0495680_0019988 3300047322 Bacteria 5644
1206 Ga0495680_0040480 3300047322 Bacteria 3712
1207 Ga0495683_0141271 3300047323 Bacteria 1128
1208 Ga0495675_0000750 3300047444 Bacteria 20283
1209 Ga0495675_0058320 3300047444 Unclassified 2448
1210 Ga0495684_0004653 3300047471 Bacteria 10708
1211 Ga0495684_0010156 3300047471 Bacteria 7281
1212 Ga0495684_0078192 3300047471 Bacteria 2511
1213 Ga0495684_0187384 3300047471 Bacteria 1531
1214 Ga0495686_0553233 3300047472 Unclassified 600
1215 Ga0495593_0004341 3300047673 Bacteria 8436
1216 Ga0495602_0063244 3300048088 Bacteria 3207
1217 Ga0495602_0151292 3300048088 Unclassified 1824
1218 Ga0495602_0754565 3300048088 Unclassified 656
1219 Ga0495602_0997434 3300048088 Unclassified 553
1220 Ga0495614_0035729 3300048089 Bacteria 2134
1221 Ga0496100_0029585 3300048903 Bacteria 3390
1222 Ga0496100_0658398 3300048903 Unclassified 816
1223 Ga0496100_0862834 3300048903 Unclassified 710
1224 Ga0496101_0341242 3300048904 Bacteria 1176
1225 Ga0496101_0492174 3300048904 Bacteria 969
1226 Ga0496102_0048066 3300048905 Bacteria 3879
1227 Ga0496102_0373914 3300048905 Unclassified 1341
1228 Ga0496104_0289986 3300048907 Unclassified 1549
1229 Ga0496105_0276048 3300048908 Bacteria 1356
1230 Ga0496106_0013491 3300048909 Bacteria 6034
1231 Ga0496106_0062248 3300048909 Bacteria 2833
1232 Ga0496106_1079298 3300048909 Bacteria 630
1233 Ga0496107_0168505 3300048910 Bacteria 1625
1234 Ga0496107_0214350 3300048910 Bacteria 1432
1235 Ga0496107_0414845 3300048910 Unclassified 1001
1236 Ga0496107_0429050 3300048910 Unclassified 983
1237 Ga0496110_1104918 3300048913 Unclassified 701
1238 Ga0496110_1146457 3300048913 Unclassified 686
1239 Ga0496110_1193124 3300048913 Unclassified 670
1240 Ga0496112_0069436 3300048915 Bacteria 3481
1241 Ga0496112_0085313 3300048915 Unclassified 3124
1242 Ga0496112_0309976 3300048915 Bacteria 1523
1243 Ga0496112_0317644 3300048915 Bacteria 1502
1244 Ga0496113_0342076 3300048916 Bacteria 1200
1245 Ga0496113_0350063 3300048916 Unclassified 1185
1246 Ga0496113_0613695 3300048916 Unclassified 871
1247 Ga0496113_0697352 3300048916 Unclassified 810
1248 Ga0496114_0675591 3300048917 Unclassified 907
1249 Ga0496115_0055079 3300048918 Bacteria 3194
1250 Ga0496115_0971380 3300048918 Unclassified 651
1251 Ga0496117_0007672 3300048920 Bacteria 10451
1252 Ga0496118_0000417 3300048921 Bacteria 70807
1253 Ga0496119_0224810 3300048922 Bacteria 959
1254 Ga0496120_0000015 3300048923 Bacteria 310795
1255 Ga0496120_0094939 3300048923 Bacteria 1586
1256 Ga0496121_0042670 3300048924 Bacteria 3941
1257 Ga0496121_0049014 3300048924 Bacteria 3587
1258 Ga0496122_0000487 3300048925 Bacteria 82253
1259 Ga0496123_0000296 3300048926 Bacteria 97428
1260 Ga0496126_0000134 3300048929 Bacteria 169693
1261 Ga0496126_0040020 3300048929 Bacteria 4347
1262 Ga0501308_066314 3300049128 Bacteria 554
1263 Ga0501292_049371 3300049515 Unclassified 743
1264 Ga0501296_002599 3300049519 Bacteria 1899
1265 Ga0501297_027139 3300049520 Unclassified 745
1266 Ga0501298_009993 3300049521 Unclassified 1623
1267 Ga0501299_001927 3300049522 Bacteria 2802
1268 Ga0501299_002643 3300049522 Bacteria 2499
1269 Ga0501299_007922 3300049522 Bacteria 1712
1270 Ga0501032_0153497 3300049569 Unclassified 1513
1271 Ga0501032_0851233 3300049569 Unclassified 575
1272 Ga0501033_0025817 3300049570 Bacteria 4424
1273 Ga0501033_0186327 3300049570 Unclassified 1486
1274 Ga0501034_0075752 3300049571 Bacteria 3371
1275 Ga0501036_0130620 3300049572 Unclassified 2121
1276 Ga0501036_0272262 3300049572 Unclassified 1417
1277 Ga0501037_0063523 3300049573 Bacteria 2691
1278 Ga0501038_0064210 3300049574 Unclassified 3131
1279 Ga0501038_0102746 3300049574 Bacteria 2378
1280 Ga0501039_0058582 3300049575 Bacteria 2983
1281 Ga0501041_0192904 3300049577 Unclassified 1276
1282 Ga0501042_0133621 3300049578 Unclassified 1788
1283 Ga0501042_0398356 3300049578 Unclassified 997
1284 Ga0501042_0597700 3300049578 Unclassified 802
1285 Ga0501043_0007855 3300049579 Bacteria 8436
1286 Ga0501043_0234521 3300049579 Unclassified 1416
1287 Ga0501046_0003788 3300049580 Bacteria 13844
1288 Ga0501046_0007699 3300049580 Bacteria 9444
1289 Ga0501047_0020232 3300049581 Bacteria 6391
1290 Ga0501047_0134230 3300049581 Unclassified 2355
1291 Ga0501047_0143704 3300049581 Unclassified 2264
1292 Ga0501047_0638772 3300049581 Bacteria 884
1293 Ga0501048_0023535 3300049582 Unclassified 4500
1294 Ga0501048_0161957 3300049582 Unclassified 1583
1295 Ga0501048_0230245 3300049582 Unclassified 1315
1296 Ga0501048_0523047 3300049582 Unclassified 851
1297 Ga0501067_0512880 3300049583 Bacteria 671
1298 Ga0501068_0045922 3300049584 Unclassified 2632
1299 Ga0501068_0375207 3300049584 Unclassified 916
1300 Ga0501070_0229139 3300049586 Unclassified 1522
1301 Ga0501071_0033651 3300049587 Unclassified 3641
1302 Ga0501072_0039878 3300049588 Bacteria 3687
1303 Ga0501072_0882498 3300049588 Unclassified 699
1304 Ga0501073_0027493 3300049589 Bacteria 4067
1305 Ga0501074_0053198 3300049590 Bacteria 2921
1306 Ga0501074_0265699 3300049590 Unclassified 1220
1307 Ga0501075_0293967 3300049591 Bacteria 1237
1308 Ga0501075_0322481 3300049591 Unclassified 1177
1309 Ga0501076_0311010 3300049592 Bacteria 1292
1310 Ga0501077_0041307 3300049593 Unclassified 2936
1311 Ga0501077_0193341 3300049593 Bacteria 1293
1312 Ga0501198_000725 3300049649 Bacteria 4115
1313 Ga0501198_018223 3300049649 Unclassified 1097
1314 Ga0501199_003118 3300049650 Bacteria 1579
1315 Ga0501202_000490 3300049652 Bacteria 5674
1316 Ga0501202_002846 3300049652 Bacteria 2934
1317 Ga0501202_005152 3300049652 Bacteria 2312
1318 Ga0501202_015908 3300049652 Bacteria 1454
1319 Ga0501206_006644 3300049653 Unclassified 1505
1320 Ga0501206_015603 3300049653 Unclassified 1052
1321 Ga0501207_000218 3300049654 Bacteria 5779
1322 Ga0501207_025977 3300049654 Unclassified 963
1323 Ga0501208_000649 3300049655 Bacteria 2874
1324 Ga0501209_005521 3300049656 Unclassified 2289
1325 Ga0501214_064639 3300049659 Unclassified 585
1326 Ga0501216_001646 3300049660 Bacteria 3059
1327 Ga0501216_054183 3300049660 Unclassified 794
1328 Ga0501217_001280 3300049661 Unclassified 4666
1329 Ga0501217_002256 3300049661 Bacteria 3764
1330 Ga0501223_002735 3300049663 Bacteria 3877
1331 Ga0501223_020003 3300049663 Unclassified 1313
1332 Ga0501224_006602 3300049664 Unclassified 1681
1333 Ga0501227_001046 3300049665 Bacteria 6149
1334 Ga0501227_012440 3300049665 Unclassified 1864
1335 Ga0501230_001599 3300049667 Unclassified 2734
1336 Ga0501233_000236 3300049668 Bacteria 8343
1337 Ga0501235_000935 3300049669 Bacteria 6034
1338 Ga0501235_005364 3300049669 Bacteria 2791
1339 Ga0501235_007593 3300049669 Bacteria 2362
1340 Ga0501235_037396 3300049669 Unclassified 1104
1341 Ga0501235_191314 3300049669 Unclassified 550
1342 Ga0501240_000663 3300049673 Unclassified 2966
1343 Ga0501243_016172 3300049675 Unclassified 1203
1344 Ga0501243_026823 3300049675 Unclassified 970
1345 Ga0501243_067980 3300049675 Bacteria 672
1346 Ga0501249_029098 3300049679 Unclassified 1228
1347 Ga0501249_103909 3300049679 Bacteria 682
1348 Ga0501251_003043 3300049681 Unclassified 1654
1349 Ga0501252_075629 3300049682 Unclassified 550
1350 Ga0501253_001873 3300049683 Unclassified 2255
1351 Ga0501253_002458 3300049683 Bacteria 2090
1352 Ga0501255_004194 3300049684 Bacteria 1383
1353 Ga0501257_000868 3300049686 Bacteria 6082
1354 Ga0501257_023587 3300049686 Unclassified 1459
1355 Ga0501257_025056 3300049686 Unclassified 1418
1356 Ga0501260_011517 3300049689 Unclassified 896
1357 Ga0501261_003997 3300049690 Bacteria 1813
1358 Ga0501225_0000779 3300049705 Bacteria 9947
1359 Ga0501225_0025582 3300049705 Unclassified 1623
1360 Ga0501225_0038757 3300049705 Unclassified 1313
1361 Ga0501234_000381 3300049707 Bacteria 6602
1362 Ga0501234_011342 3300049707 Unclassified 1393
1363 Ga0501245_002079 3300049708 Bacteria 2658
1364 Ga0501245_065539 3300049708 Bacteria 673
1365 Ga0501079_0111924 3300049741 Bacteria 2121
1366 Ga0501079_0491449 3300049741 Unclassified 965
1367 Ga0501080_0140518 3300049742 Unclassified 2233
1368 Ga0501080_0258322 3300049742 Unclassified 1587
1369 Ga0501081_0483765 3300049743 Bacteria 921
1370 Ga0501081_0512378 3300049743 Bacteria 895
1371 Ga0501083_0003607 3300049744 Bacteria 10853
1372 Ga0501083_0065233 3300049744 Bacteria 2425
1373 Ga0501083_0663109 3300049744 Bacteria 678
1374 Ga0501266_006165 3300049763 Unclassified 1492
1375 Ga0501268_011857 3300049765 Unclassified 1384
1376 Ga0501268_126746 3300049765 Unclassified 571
1377 Ga0501273_071509 3300049770 Unclassified 563
1378 Ga0501279_107255 3300049775 Unclassified 509
1379 Ga0501283_032281 3300049779 Unclassified 882
1380 Ga0501035_0047901 3300049822 Unclassified 3834
1381 Ga0501035_0222706 3300049822 Bacteria 1610
1382 Ga0501044_0028621 3300049823 Bacteria 5881
1383 Ga0501044_0056539 3300049823 Bacteria 4029
1384 Ga0501044_0103630 3300049823 Bacteria 2859
1385 Ga0501044_0391603 3300049823 Unclassified 1303
1386 Ga0501044_0522925 3300049823 Unclassified 1086
1387 Ga0501045_0065337 3300049824 Bacteria 2671
1388 Ga0501045_0095567 3300049824 Unclassified 2198
1389 Ga0501045_0437251 3300049824 Unclassified 973
1390 Ga0501045_0575657 3300049824 Bacteria 834
1391 Ga0501204_002772 3300049850 Unclassified 1801
1392 Ga0501204_003700 3300049850 Bacteria 1622
1393 Ga0501212_011399 3300049851 Unclassified 1280
1394 nmdc:mga00v17_19908_c1 3300050491 Bacteria 3837
1395 nmdc:mga00v17_461782_c1 3300050491 Bacteria 824
1396 nmdc:mga0yw44_254512_c1 3300050492 Bacteria 1169
1397 nmdc:mga0yw44_305029_c1 3300050492 Archaea 1067
1398 nmdc:mga06z11_131389_c1 3300050494 Unclassified 1406
1399 nmdc:mga04h51_32364_c1 3300050495 Bacteria 1658
1400 nmdc:mga05p37_1104784_c1 3300050507 Unclassified 830
1401 nmdc:mga05p37_133107_c1 3300050507 Bacteria 3050
1402 nmdc:mga05p37_138586_c1 3300050507 Bacteria 2982
1403 nmdc:mga05p37_1473857_c1 3300050507 Unclassified 680
1404 nmdc:mga05p37_249005_c1 3300050507 Bacteria 2132
1405 nmdc:mga05p37_299137_c1 3300050507 Unclassified 1913
1406 nmdc:mga05p37_393021_c1 3300050507 Unclassified 1621
1407 nmdc:mga05p37_569548_c1 3300050507 Bacteria 1285
1408 nmdc:mga05p37_604548_c1 3300050507 Bacteria 1237
1409 nmdc:mga05p37_82279_c1 3300050507 Bacteria 3967
1410 nmdc:mga05p37_837111_c1 3300050507 Bacteria 1001
1411 nmdc:mga09592_1314419_c1 3300050508 Unclassified 594
1412 nmdc:mga09592_1424806_c1 3300050508 Bacteria 566
1413 nmdc:mga09592_147894_c1 3300050508 Unclassified 2026
1414 nmdc:mga09592_150680_c1 3300050508 Bacteria 2006
1415 nmdc:mga09592_158039_c1 3300050508 Bacteria 1957
1416 nmdc:mga09592_297543_c1 3300050508 Unclassified 969
1417 nmdc:mga09592_34375_c1 3300050508 Bacteria 4237
1418 nmdc:mga0qj67_23468_c1 3300050509 Bacteria 4747
1419 nmdc:mga0qj67_78665_c1 3300050509 Bacteria 2640
1420 nmdc:mga0qj67_993385_c1 3300050509 Unclassified 659
1421 nmdc:mga06r32_12645_c1 3300050510 Bacteria 7627
1422 nmdc:mga06r32_142135_c1 3300050510 Unclassified 2377
1423 nmdc:mga06r32_1767719_c1 3300050510 Unclassified 554
1424 nmdc:mga06r32_256434_c1 3300050510 Unclassified 1737
1425 nmdc:mga06r32_67531_c1 3300050510 Bacteria 3452
1426 nmdc:mga06r32_771142_c1 3300050510 Bacteria 924
1427 nmdc:mga06r32_917772_c1 3300050510 Bacteria 831
1428 nmdc:mga08y16_4844_c1 3300050511 Bacteria 14046
1429 nmdc:mga08y16_612708_c1 3300050511 Bacteria 1096
1430 nmdc:mga08y16_625050_c1 3300050511 Bacteria 1083
1431 nmdc:mga0n895_2019706_c1 3300050512 Bacteria 534
1432 nmdc:mga0n895_21383_c2 3300050512 Bacteria 5098
1433 nmdc:mga0n895_418175_c1 3300050512 Bacteria 1355
1434 nmdc:mga0n895_49967_c1 3300050512 Unclassified 4099
1435 nmdc:mga0n895_638112_c1 3300050512 Bacteria 1065
1436 nmdc:mga0n895_655061_c1 3300050512 Unclassified 1049
1437 nmdc:mga0n895_79689_c1 3300050512 Bacteria 3262
1438 nmdc:mga0n895_828524_c1 3300050512 Bacteria 914
1439 nmdc:mga0n895_84854_c1 3300050512 Bacteria 3161
1440 nmdc:mga0rr50_10870_c1 3300050513 Bacteria 5803
1441 nmdc:mga0rr50_159550_c2 3300050513 Bacteria 1628
1442 nmdc:mga0rr50_437062_c1 3300050513 Unclassified 1108
1443 nmdc:mga0rr50_557209_c1 3300050513 Bacteria 976
1444 nmdc:mga0rr50_81725_c1 3300050513 Unclassified 2494
1445 nmdc:mga0rr50_901041_c1 3300050513 Bacteria 754
1446 nmdc:mga08x19_29739_c1 3300050514 Bacteria 3428
1447 nmdc:mga08x19_446960_c1 3300050514 Unclassified 910
1448 nmdc:mga08x19_52113_c1 3300050514 Bacteria 2631
1449 nmdc:mga08x19_8890_c2 3300050514 Bacteria 4143
1450 nmdc:mga0a205_1818_c1 3300050515 Bacteria 18463
1451 nmdc:mga0a205_23201_c1 3300050515 Bacteria 5885
1452 nmdc:mga0a205_258878_c1 3300050515 Bacteria 1618
1453 nmdc:mga0a205_287608_c1 3300050515 Bacteria 1519
1454 nmdc:mga0a205_32605_c1 3300050515 Bacteria 4995
1455 nmdc:mga0a205_485682_c1 3300050515 Bacteria 1093
1456 nmdc:mga0a205_521490_c1 3300050515 Bacteria 1045
1457 nmdc:mga0a205_672085_c1 3300050515 Unclassified 886
1458 nmdc:mga0a205_84565_c1 3300050515 Bacteria 3065
1459 nmdc:mga0a205_98978_c1 3300050515 Unclassified 2815
1460 Ga0495601_0006301 3300053077 Bacteria 6932
1461 Ga0495601_0071464 3300053077 Bacteria 2216
1462 Ga0495612_0004392 3300053078 Bacteria 5847
1463 Ga0495612_0442182 3300053078 Bacteria 593
1464 Ga0495619_0003359 3300053085 Bacteria 10344
1465 Ga0500646_0046586 3300053090 Bacteria 1238
1466 Ga0500641_0010526 3300053096 Bacteria 3344
1467 Ga0500641_0035065 3300053096 Bacteria 2000
1468 Ga0500650_0268609 3300053098 Bacteria 761
1469 Ga0500562_016583 3300053108 Bacteria 1895
1470 Ga0500608_004909 3300053122 Bacteria 5239
1471 Ga0500642_0013299 3300053130 Bacteria 3020
1472 Ga0500658_0144767 3300053134 Archaea 1068
1473 Ga0500568_0006953 3300053139 Bacteria 5609
1474 Ga0500604_0008348 3300053151 Bacteria 2747
1475 Ga0501084_0695291 3300054114 Bacteria 857
1476 Ga0587077_106237 3300059493 Bacteria 681
1477 Ga0501082_0160029 3300060353 Unclassified 1956
1478 Ga0501082_0294096 3300060353 Unclassified 1414
1479 Ga0530510_0098595 3300061734 Unclassified 2136
1480 Ga0530510_0597578 3300061734 Unclassified 839
1481 Ga0530510_1476698 3300061734 Unclassified 522
1482 Ga0530510_1537451 3300061734 Bacteria 511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002773 JGI25152J39213_1000688 JGI25152J39213_10006888 93
2 3300002774 JGI25150J39212_1000029 JGI25150J39212_100002915 93
3 3300003187 JGI25151J46595_10000003 JGI25151J46595_1000000387 93
4 3300003215 JGI25153J46596_10000111 JGI25153J46596_1000011120 93
5 3300005329 Ga0070683_102347483 Ga0070683_1023474831 95
6 3300005614 Ga0068856_100012621 Ga0068856_1000126216 95
7 3300013296 Ga0157374_10762675 Ga0157374_107626753 95
8 3300025944 Ga0207661_12100559 Ga0207661_121005592 95
9 3300026078 Ga0207702_10019366 Ga0207702_100193663 95
10 3300033180 Ga0307510_10006599 Ga0307510_100065998 95
11 3300037312 Ga0395899_0064500 Ga0395899_0064500_675_974 95
12 3300037418 Ga0395900_0003700 Ga0395900_0003700_175_474 95
13 3300037466 Ga0395898_0095698 Ga0395898_0095698_2339_2638 95
14 3300037471 Ga0395905_0000496 Ga0395905_0000496_31974_32273 95
15 3300038443 Ga0395901_0001981 Ga0395901_0001981_19520_19819 95
16 3300046507 Ga0495606_0293353 Ga0495606_0293353_251_541 95
17 3300046518 Ga0495631_0018542 Ga0495631_0018542_593_883 95
18 3300046665 Ga0495661_0002707 Ga0495661_0002707_1779_2069 95
19 3300046694 Ga0495649_0128479 Ga0495649_0128479_853_1143 95
20 3300047323 Ga0495683_0141271 Ga0495683_0141271_241_531 95
21 3300053098 Ga0500650_0268609 Ga0500650_0268609_229_519 95
22 3300053122 Ga0500608_004909 Ga0500608_004909_1079_1369 95
23 3300053130 Ga0500642_0013299 Ga0500642_0013299_2295_2585 95
24 3300006871 Ga0075434_100920597 Ga0075434_1009205972 96
25 3300032004 Ga0307414_10191807 Ga0307414_101918073 96
26 3300005327 Ga0070658_10438120 Ga0070658_104381203 99
27 3300005339 Ga0070660_100319579 Ga0070660_1003195792 99
28 3300005467 Ga0070706_100013681 Ga0070706_1000136814 99
29 3300005468 Ga0070707_100002026 Ga0070707_1000020265 99
30 3300005471 Ga0070698_100002337 Ga0070698_1000023375 99
31 3300005518 Ga0070699_100016852 Ga0070699_1000168525 99
32 3300005536 Ga0070697_100001942 Ga0070697_10000194213 99
33 3300005536 Ga0070697_101066501 Ga0070697_1010665012 99
34 3300006881 Ga0068865_101826935 Ga0068865_1018269351 99
35 3300007265 Ga0099794_10118826 Ga0099794_101188262 99
36 3300007265 Ga0099794_10609591 Ga0099794_106095911 99
37 3300017792 Ga0163161_10599060 Ga0163161_105990602 99
38 3300025922 Ga0207646_10014742 Ga0207646_100147422 99
39 3300027111 Ga0209281_1062835 Ga0209281_10628351 99
40 3300005327 Ga0070658_10817412 Ga0070658_108174122 100
41 3300005333 Ga0070677_10027751 Ga0070677_100277512 100
42 3300005335 Ga0070666_10533187 Ga0070666_105331872 100
43 3300005345 Ga0070692_10337572 Ga0070692_103375722 100
44 3300005355 Ga0070671_100362852 Ga0070671_1003628522 100
45 3300005364 Ga0070673_100158066 Ga0070673_1001580663 100
46 3300005434 Ga0070709_10013306 Ga0070709_100133063 100
47 3300005435 Ga0070714_100029717 Ga0070714_1000297172 100
48 3300005436 Ga0070713_100008030 Ga0070713_1000080305 100
49 3300005438 Ga0070701_10696198 Ga0070701_106961982 100
50 3300005439 Ga0070711_100054278 Ga0070711_1000542782 100
51 3300005439 Ga0070711_100249578 Ga0070711_1002495782 100
52 3300005456 Ga0070678_100122300 Ga0070678_1001223003 100
53 3300005456 Ga0070678_100137934 Ga0070678_1001379343 100
54 3300005457 Ga0070662_100044676 Ga0070662_1000446763 100
55 3300005466 Ga0070685_10749380 Ga0070685_107493801 100
56 3300005535 Ga0070684_100471665 Ga0070684_1004716653 100
57 3300005564 Ga0070664_100147198 Ga0070664_1001471982 100
58 3300005615 Ga0070702_100717072 Ga0070702_1007170722 100
59 3300005616 Ga0068852_100576037 Ga0068852_1005760372 100
60 3300006028 Ga0070717_10350918 Ga0070717_103509182 100
61 3300006175 Ga0070712_100271318 Ga0070712_1002713182 100
62 3300006175 Ga0070712_101135254 Ga0070712_1011352542 100
63 3300006871 Ga0075434_100426526 Ga0075434_1004265262 100
64 3300006914 Ga0075436_100032565 Ga0075436_1000325653 100
65 3300007076 Ga0075435_100026093 Ga0075435_1000260935 100
66 3300009098 Ga0105245_10207569 Ga0105245_102075692 100
67 3300009148 Ga0105243_11378469 Ga0105243_113784692 100
68 3300009177 Ga0105248_11863139 Ga0105248_118631392 100
69 3300013306 Ga0163162_12088802 Ga0163162_120888021 100
70 3300014326 Ga0157380_11474538 Ga0157380_114745382 100
71 3300014326 Ga0157380_12077935 Ga0157380_120779352 100
72 3300025906 Ga0207699_10013633 Ga0207699_100136332 100
73 3300025915 Ga0207693_10137841 Ga0207693_101378412 100
74 3300025916 Ga0207663_10437271 Ga0207663_104372711 100
75 3300025928 Ga0207700_10021700 Ga0207700_100217005 100
76 3300025929 Ga0207664_10007641 Ga0207664_100076415 100
77 3300031344 Ga0265316_10002953 Ga0265316_1000295313 100
78 3300046460 Ga0495638_0064453 Ga0495638_0064453_840_1175 100
79 3300046616 Ga0495668_0364189 Ga0495668_0364189_439_774 100
80 3300048910 Ga0496107_0429050 Ga0496107_0429050_92_430 100
81 3300048922 Ga0496119_0224810 Ga0496119_0224810_388_723 100
82 3300050492 nmdc:mga0yw44_305029_c1 nmdc:mga0yw44_305029_c1_548_883 100
83 3300050513 nmdc:mga0rr50_81725_c1 nmdc:mga0rr50_81725_c1_1570_1908 100
84 3300050514 nmdc:mga08x19_446960_c1 nmdc:mga08x19_446960_c1_548_886 100
85 3300053090 Ga0500646_0046586 Ga0500646_0046586_871_1206 100
86 3300053096 Ga0500641_0010526 Ga0500641_0010526_2814_3149 100
87 3300053108 Ga0500562_016583 Ga0500562_016583_147_482 100
88 3300053134 Ga0500658_0144767 Ga0500658_0144767_690_1025 100
89 3300053151 Ga0500604_0008348 Ga0500604_0008348_131_466 100
90 3300009093 Ga0105240_10069492 Ga0105240_100694924 101
91 3300009093 Ga0105240_10487977 Ga0105240_104879772 101
92 3300009545 Ga0105237_11079792 Ga0105237_110797922 101
93 3300013296 Ga0157374_10775355 Ga0157374_107753552 101
94 3300013297 Ga0157378_12475754 Ga0157378_124757541 101
95 3300025913 Ga0207695_10386215 Ga0207695_103862152 101
96 3300025913 Ga0207695_10528397 Ga0207695_105283973 101
97 3300025914 Ga0207671_11049111 Ga0207671_110491112 101
98 3300026142 Ga0207698_10818806 Ga0207698_108188062 101
99 3300049583 Ga0501067_0512880 Ga0501067_0512880_19_351 101
100 3300050513 nmdc:mga0rr50_437062_c1 nmdc:mga0rr50_437062_c1_23_358 101
101 3300061734 Ga0530510_1537451 Ga0530510_1537451_40_417 101
102 3300005293 Ga0065715_10029450 Ga0065715_100294502 102
103 3300005331 Ga0070670_100522332 Ga0070670_1005223322 102
104 3300005334 Ga0068869_100615077 Ga0068869_1006150772 102
105 3300005335 Ga0070666_10046823 Ga0070666_100468234 102
106 3300005335 Ga0070666_11390719 Ga0070666_113907191 102
107 3300005338 Ga0068868_100012556 Ga0068868_10001255610 102
108 3300005338 Ga0068868_100770503 Ga0068868_1007705032 102
109 3300005341 Ga0070691_10194282 Ga0070691_101942822 102
110 3300005355 Ga0070671_100677124 Ga0070671_1006771242 102
111 3300005356 Ga0070674_100185681 Ga0070674_1001856812 102
112 3300005356 Ga0070674_101530658 Ga0070674_1015306581 102
113 3300005364 Ga0070673_100100149 Ga0070673_1001001492 102
114 3300005366 Ga0070659_100472087 Ga0070659_1004720872 102
115 3300005440 Ga0070705_100196042 Ga0070705_1001960422 102
116 3300005441 Ga0070700_100298797 Ga0070700_1002987973 102
117 3300005444 Ga0070694_100741551 Ga0070694_1007415511 102
118 3300005455 Ga0070663_101037906 Ga0070663_1010379062 102
119 3300005456 Ga0070678_100167517 Ga0070678_1001675172 102
120 3300005456 Ga0070678_101682184 Ga0070678_1016821842 102
121 3300005456 Ga0070678_102045544 Ga0070678_1020455441 102
122 3300005457 Ga0070662_100593930 Ga0070662_1005939302 102
123 3300005459 Ga0068867_100030715 Ga0068867_1000307154 102
124 3300005544 Ga0070686_101380743 Ga0070686_1013807432 102
125 3300005544 Ga0070686_101707684 Ga0070686_1017076841 102
126 3300005545 Ga0070695_100096015 Ga0070695_1000960153 102
127 3300005546 Ga0070696_101752780 Ga0070696_1017527801 102
128 3300005547 Ga0070693_100068397 Ga0070693_1000683973 102
129 3300005547 Ga0070693_100265603 Ga0070693_1002656032 102
130 3300005548 Ga0070665_100385874 Ga0070665_1003858742 102
131 3300005564 Ga0070664_100411881 Ga0070664_1004118812 102
132 3300005578 Ga0068854_100111833 Ga0068854_1001118333 102
133 3300005578 Ga0068854_100400651 Ga0068854_1004006513 102
134 3300005615 Ga0070702_100082972 Ga0070702_1000829722 102
135 3300005617 Ga0068859_100142052 Ga0068859_1001420523 102
136 3300005718 Ga0068866_10071181 Ga0068866_100711812 102
137 3300005718 Ga0068866_10104172 Ga0068866_101041723 102
138 3300005719 Ga0068861_100130894 Ga0068861_1001308942 102
139 3300005842 Ga0068858_100120385 Ga0068858_1001203853 102
140 3300005842 Ga0068858_100218134 Ga0068858_1002181342 102
141 3300005843 Ga0068860_100184278 Ga0068860_1001842783 102
142 3300005843 Ga0068860_100312423 Ga0068860_1003124232 102
143 3300005844 Ga0068862_100521314 Ga0068862_1005213143 102
144 3300006237 Ga0097621_100000225 Ga0097621_10000022519 102
145 3300006237 Ga0097621_101018727 Ga0097621_1010187271 102
146 3300006358 Ga0068871_100000307 Ga0068871_10000030734 102
147 3300006358 Ga0068871_100280233 Ga0068871_1002802333 102
148 3300006847 Ga0075431_100036946 Ga0075431_1000369462 102
149 3300006881 Ga0068865_100405526 Ga0068865_1004055262 102
150 3300006931 Ga0097620_100142049 Ga0097620_1001420493 102
151 3300007076 Ga0075435_101190363 Ga0075435_1011903632 102
152 3300007265 Ga0099794_10206644 Ga0099794_102066441 102
153 3300009098 Ga0105245_10005352 Ga0105245_100053528 102
154 3300009098 Ga0105245_10060430 Ga0105245_100604302 102
155 3300009148 Ga0105243_10042170 Ga0105243_100421703 102
156 3300009174 Ga0105241_10070230 Ga0105241_100702303 102
157 3300009174 Ga0105241_11693467 Ga0105241_116934672 102
158 3300009176 Ga0105242_10019893 Ga0105242_100198933 102
159 3300009177 Ga0105248_10273169 Ga0105248_102731692 102
160 3300009553 Ga0105249_10352646 Ga0105249_103526462 102
161 3300010375 Ga0105239_10266243 Ga0105239_102662432 102
162 3300010375 Ga0105239_12546674 Ga0105239_125466742 102
163 3300013296 Ga0157374_10087667 Ga0157374_100876672 102
164 3300013297 Ga0157378_10006067 Ga0157378_100060674 102
165 3300013297 Ga0157378_11096721 Ga0157378_110967212 102
166 3300013306 Ga0163162_10159868 Ga0163162_101598682 102
167 3300013306 Ga0163162_10177363 Ga0163162_101773633 102
168 3300013307 Ga0157372_10995488 Ga0157372_109954881 102
169 3300013308 Ga0157375_10571993 Ga0157375_105719932 102
170 3300014969 Ga0157376_10174223 Ga0157376_101742232 102
171 3300025315 Ga0207697_10040232 Ga0207697_100402322 102
172 3300025899 Ga0207642_10071929 Ga0207642_100719292 102
173 3300025899 Ga0207642_10175858 Ga0207642_101758582 102
174 3300025901 Ga0207688_10494503 Ga0207688_104945031 102
175 3300025907 Ga0207645_10016652 Ga0207645_100166525 102
176 3300025917 Ga0207660_10670720 Ga0207660_106707201 102
177 3300025918 Ga0207662_10015810 Ga0207662_100158102 102
178 3300025923 Ga0207681_10256526 Ga0207681_102565262 102
179 3300025927 Ga0207687_10011493 Ga0207687_100114933 102
180 3300025927 Ga0207687_10189967 Ga0207687_101899672 102
181 3300025928 Ga0207700_11126299 Ga0207700_111262992 102
182 3300025932 Ga0207690_10107500 Ga0207690_101075001 102
183 3300025933 Ga0207706_10231877 Ga0207706_102318773 102
184 3300025934 Ga0207686_10008369 Ga0207686_100083693 102
185 3300025937 Ga0207669_11895116 Ga0207669_118951162 102
186 3300025938 Ga0207704_10912573 Ga0207704_109125731 102
187 3300025941 Ga0207711_10207379 Ga0207711_102073792 102
188 3300025942 Ga0207689_10028761 Ga0207689_100287612 102
189 3300025960 Ga0207651_10152772 Ga0207651_101527723 102
190 3300025960 Ga0207651_10261897 Ga0207651_102618973 102
191 3300025981 Ga0207640_10023432 Ga0207640_100234323 102
192 3300025986 Ga0207658_10532878 Ga0207658_105328782 102
193 3300025986 Ga0207658_10598570 Ga0207658_105985702 102
194 3300026023 Ga0207677_10279485 Ga0207677_102794853 102
195 3300026023 Ga0207677_10744261 Ga0207677_107442611 102
196 3300026035 Ga0207703_10124130 Ga0207703_101241301 102
197 3300026035 Ga0207703_10230529 Ga0207703_102305292 102
198 3300026067 Ga0207678_10114430 Ga0207678_101144301 102
199 3300026075 Ga0207708_10011459 Ga0207708_100114596 102
200 3300026118 Ga0207675_100019551 Ga0207675_1000195516 102
201 3300026121 Ga0207683_10224729 Ga0207683_102247293 102
202 3300026121 Ga0207683_10859766 Ga0207683_108597662 102
203 3300027512 Ga0209179_1027077 Ga0209179_10270772 102
204 3300028381 Ga0268264_10125603 Ga0268264_101256033 102
205 3300030877 Ga0265777_100578 Ga0265777_1005782 102
206 3300035090 Ga0373949_0201259 Ga0373949_0201259_216_551 102
207 3300035111 Ga0373923_0346686 Ga0373923_0346686_290_628 102
208 3300035114 Ga0373939_0136967 Ga0373939_0136967_310_648 102
209 3300035170 Ga0373943_0325163 Ga0373943_0325163_263_601 102
210 3300035207 Ga0373942_0014442 Ga0373942_0014442_352_687 102
211 3300035241 Ga0373961_0191375 Ga0373961_0191375_229_564 102
212 3300035410 Ga0373924_0196769 Ga0373924_0196769_393_725 102
213 3300035691 Ga0373931_0079920 Ga0373931_0079920_292_627 102
214 3300035692 Ga0373935_0023546 Ga0373935_0023546_1684_2022 102
215 3300035695 Ga0373927_0062443 Ga0373927_0062443_1485_1823 102
216 3300035725 Ga0373947_0188439 Ga0373947_0188439_273_611 102
217 3300036401 Ga0373937_0007350 Ga0373937_0007350_8789_9124 102
218 3300037068 Ga0373925_0107049 Ga0373925_0107049_1561_1899 102
219 3300044712 Ga0453684_0595564 Ga0453684_0595564_726_1061 102
220 3300046458 Ga0495591_000055 Ga0495591_000055_123699_124031 102
221 3300046474 Ga0495605_0000688 Ga0495605_0000688_8460_8792 102
222 3300046474 Ga0495605_0002297 Ga0495605_0002297_9075_9407 102
223 3300046475 Ga0495639_0618009 Ga0495639_0618009_81_419 102
224 3300046501 Ga0495607_0000601 Ga0495607_0000601_20717_21049 102
225 3300046501 Ga0495607_0003860 Ga0495607_0003860_6361_6693 102
226 3300046501 Ga0495607_0007058 Ga0495607_0007058_748_1080 102
227 3300046507 Ga0495606_0004167 Ga0495606_0004167_9095_9427 102
228 3300046512 Ga0495610_0181236 Ga0495610_0181236_51_383 102
229 3300046517 Ga0495630_0146348 Ga0495630_0146348_199_537 102
230 3300046520 Ga0495637_0038790 Ga0495637_0038790_640_972 102
231 3300046526 Ga0495666_0032771 Ga0495666_0032771_1038_1376 102
232 3300046530 Ga0495654_0047494 Ga0495654_0047494_878_1210 102
233 3300046542 Ga0495597_0000467 Ga0495597_0000467_19409_19741 102
234 3300046684 Ga0495669_0068817 Ga0495669_0068817_532_873 102
235 3300046810 Ga0495660_0000741 Ga0495660_0000741_13437_13769 102
236 3300047320 Ga0495672_0112157 Ga0495672_0112157_850_1182 102
237 3300047472 Ga0495686_0553233 Ga0495686_0553233_10_342 102
238 3300048905 Ga0496102_0373914 Ga0496102_0373914_680_1015 102
239 3300048909 Ga0496106_0062248 Ga0496106_0062248_280_615 102
240 3300048910 Ga0496107_0168505 Ga0496107_0168505_61_396 102
241 3300048916 Ga0496113_0613695 Ga0496113_0613695_367_702 102
242 3300053077 Ga0495601_0071464 Ga0495601_0071464_1429_1764 102
243 3300005329 Ga0070683_100516004 Ga0070683_1005160042 103
244 3300005330 Ga0070690_100077793 Ga0070690_1000777932 103
245 3300005337 Ga0070682_100007313 Ga0070682_1000073135 103
246 3300005340 Ga0070689_100265605 Ga0070689_1002656051 103
247 3300005340 Ga0070689_100410462 Ga0070689_1004104622 103
248 3300005343 Ga0070687_101495390 Ga0070687_1014953901 103
249 3300005355 Ga0070671_100060167 Ga0070671_1000601674 103
250 3300005364 Ga0070673_100024795 Ga0070673_1000247952 103
251 3300005367 Ga0070667_101676777 Ga0070667_1016767772 103
252 3300005438 Ga0070701_10030762 Ga0070701_100307622 103
253 3300005439 Ga0070711_101637585 Ga0070711_1016375852 103
254 3300005440 Ga0070705_101916729 Ga0070705_1019167291 103
255 3300005444 Ga0070694_101415001 Ga0070694_1014150012 103
256 3300005445 Ga0070708_100092854 Ga0070708_1000928542 103
257 3300005458 Ga0070681_10163416 Ga0070681_101634162 103
258 3300005467 Ga0070706_100043443 Ga0070706_1000434435 103
259 3300005468 Ga0070707_100065847 Ga0070707_1000658473 103
260 3300005536 Ga0070697_100085712 Ga0070697_1000857123 103
261 3300005539 Ga0068853_101658324 Ga0068853_1016583241 103
262 3300005543 Ga0070672_100040436 Ga0070672_1000404363 103
263 3300005544 Ga0070686_100015451 Ga0070686_1000154515 103
264 3300005545 Ga0070695_100220069 Ga0070695_1002200692 103
265 3300005549 Ga0070704_100060754 Ga0070704_1000607544 103
266 3300005615 Ga0070702_100385897 Ga0070702_1003858972 103
267 3300005616 Ga0068852_100512949 Ga0068852_1005129492 103
268 3300005834 Ga0068851_10208635 Ga0068851_102086351 103
269 3300005841 Ga0068863_100046714 Ga0068863_1000467144 103
270 3300006871 Ga0075434_100246544 Ga0075434_1002465442 103
271 3300009101 Ga0105247_10128587 Ga0105247_101285873 103
272 3300013105 Ga0157369_10987187 Ga0157369_109871872 103
273 3300013296 Ga0157374_10004474 Ga0157374_100044745 103
274 3300013297 Ga0157378_10000134 Ga0157378_1000013435 103
275 3300013308 Ga0157375_11273242 Ga0157375_112732422 103
276 3300014326 Ga0157380_11604021 Ga0157380_116040212 103
277 3300025931 Ga0207644_10075526 Ga0207644_100755262 103
278 3300025936 Ga0207670_10309090 Ga0207670_103090903 103
279 3300025936 Ga0207670_10751891 Ga0207670_107518912 103
280 3300025940 Ga0207691_10023578 Ga0207691_100235784 103
281 3300025941 Ga0207711_10046701 Ga0207711_100467012 103
282 3300025960 Ga0207651_10004480 Ga0207651_100044805 103
283 3300026078 Ga0207702_10067425 Ga0207702_100674252 103
284 3300026088 Ga0207641_10063447 Ga0207641_100634472 103
285 3300026142 Ga0207698_10037516 Ga0207698_100375164 103
286 3300028023 Ga0265357_1002559 Ga0265357_10025593 103
287 3300028381 Ga0268264_10204843 Ga0268264_102048433 103
288 3300028800 Ga0265338_10046727 Ga0265338_100467273 103
289 3300029957 Ga0265324_10099914 Ga0265324_100999142 103
290 3300031241 Ga0265325_10024886 Ga0265325_100248863 103
291 3300031241 Ga0265325_10071774 Ga0265325_100717742 103
292 3300031250 Ga0265331_10004173 Ga0265331_100041731 103
293 3300031251 Ga0265327_10008569 Ga0265327_100085696 103
294 3300031344 Ga0265316_10043140 Ga0265316_100431402 103
295 3300031344 Ga0265316_10426626 Ga0265316_104266262 103
296 3300035112 Ga0373932_0181372 Ga0373932_0181372_194_535 103
297 3300035113 Ga0373936_0248665 Ga0373936_0248665_177_554 103
298 3300035171 Ga0373946_0081845 Ga0373946_0081845_233_610 103
299 3300035410 Ga0373924_0245809 Ga0373924_0245809_147_524 103
300 3300035695 Ga0373927_0003719 Ga0373927_0003719_5818_6195 103
301 3300035725 Ga0373947_0015367 Ga0373947_0015367_2489_2866 103
302 3300036401 Ga0373937_0168533 Ga0373937_0168533_1524_1901 103
303 3300046455 Ga0495603_0295167 Ga0495603_0295167_123_461 103
304 3300046462 Ga0495651_0000592 Ga0495651_0000592_15374_15751 103
305 3300046462 Ga0495651_0010129 Ga0495651_0010129_5193_5570 103
306 3300046463 Ga0495653_0007710 Ga0495653_0007710_7282_7659 103
307 3300046472 Ga0495580_0010339 Ga0495580_0010339_3140_3517 103
308 3300046477 Ga0495664_0006196 Ga0495664_0006196_1263_1640 103
309 3300046499 Ga0495594_0029771 Ga0495594_0029771_1129_1467 103
310 3300046511 Ga0495608_0011180 Ga0495608_0011180_3284_3661 103
311 3300046514 Ga0495618_0142662 Ga0495618_0142662_867_1244 103
312 3300046516 Ga0495628_0027484 Ga0495628_0027484_1062_1439 103
313 3300046517 Ga0495630_0010818 Ga0495630_0010818_4187_4564 103
314 3300046526 Ga0495666_0007293 Ga0495666_0007293_1272_1649 103
315 3300046529 Ga0495652_0009953 Ga0495652_0009953_7426_7803 103
316 3300046531 Ga0495665_0004930 Ga0495665_0004930_5695_6072 103
317 3300046535 Ga0495586_0105383 Ga0495586_0105383_154_531 103
318 3300046535 Ga0495586_0140184 Ga0495586_0140184_98_475 103
319 3300046536 Ga0495587_0009875 Ga0495587_0009875_1822_2199 103
320 3300046539 Ga0495621_0116159 Ga0495621_0116159_168_530 103
321 3300046543 Ga0495645_0154709 Ga0495645_0154709_761_1138 103
322 3300046543 Ga0495645_0231328 Ga0495645_0231328_597_974 103
323 3300046559 Ga0495667_0087211 Ga0495667_0087211_496_873 103
324 3300046663 Ga0495635_0013285 Ga0495635_0013285_3237_3614 103
325 3300046675 Ga0495657_0039314 Ga0495657_0039314_936_1313 103
326 3300046678 Ga0495599_0019005 Ga0495599_0019005_3367_3744 103
327 3300046679 Ga0495623_0005122 Ga0495623_0005122_3284_3661 103
328 3300046680 Ga0495646_0000534 Ga0495646_0000534_3114_3491 103
329 3300046689 Ga0495613_0048524 Ga0495613_0048524_1627_2004 103
330 3300046690 Ga0495624_0001421 Ga0495624_0001421_8187_8564 103
331 3300046694 Ga0495649_0318131 Ga0495649_0318131_11_361 103
332 3300046809 Ga0495600_0262631 Ga0495600_0262631_300_677 103
333 3300047315 Ga0495581_0407215 Ga0495581_0407215_263_640 103
334 3300047317 Ga0495604_0006230 Ga0495604_0006230_2920_3297 103
335 3300047319 Ga0495674_0051371 Ga0495674_0051371_1629_2006 103
336 3300047322 Ga0495680_0019988 Ga0495680_0019988_2870_3247 103
337 3300047444 Ga0495675_0000750 Ga0495675_0000750_16870_17247 103
338 3300047444 Ga0495675_0058320 Ga0495675_0058320_300_677 103
339 3300047471 Ga0495684_0004653 Ga0495684_0004653_7188_7565 103
340 3300047471 Ga0495684_0010156 Ga0495684_0010156_978_1358 103
341 3300047673 Ga0495593_0004341 Ga0495593_0004341_4687_5064 103
342 3300048088 Ga0495602_0063244 Ga0495602_0063244_1813_2190 103
343 3300048089 Ga0495614_0035729 Ga0495614_0035729_187_564 103
344 3300048915 Ga0496112_0085313 Ga0496112_0085313_1601_1978 103
345 3300050512 nmdc:mga0n895_418175_c1 nmdc:mga0n895_418175_c1_193_531 103
346 3300053078 Ga0495612_0004392 Ga0495612_0004392_1235_1612 103
347 3300005329 Ga0070683_100173834 Ga0070683_1001738342 104
348 3300005330 Ga0070690_100051342 Ga0070690_1000513423 104
349 3300005334 Ga0068869_100618833 Ga0068869_1006188331 104
350 3300005335 Ga0070666_10160492 Ga0070666_101604923 104
351 3300005335 Ga0070666_10340793 Ga0070666_103407932 104
352 3300005337 Ga0070682_100519050 Ga0070682_1005190502 104
353 3300005340 Ga0070689_100042806 Ga0070689_1000428064 104
354 3300005340 Ga0070689_101036632 Ga0070689_1010366321 104
355 3300005340 Ga0070689_101501104 Ga0070689_1015011041 104
356 3300005345 Ga0070692_10487586 Ga0070692_104875861 104
357 3300005355 Ga0070671_100269878 Ga0070671_1002698783 104
358 3300005366 Ga0070659_100068418 Ga0070659_1000684182 104
359 3300005367 Ga0070667_100263315 Ga0070667_1002633153 104
360 3300005437 Ga0070710_10179285 Ga0070710_101792851 104
361 3300005439 Ga0070711_100295116 Ga0070711_1002951162 104
362 3300005440 Ga0070705_100130731 Ga0070705_1001307311 104
363 3300005444 Ga0070694_101182447 Ga0070694_1011824471 104
364 3300005459 Ga0068867_100093381 Ga0068867_1000933813 104
365 3300005535 Ga0070684_100319557 Ga0070684_1003195572 104
366 3300005539 Ga0068853_100117977 Ga0068853_1001179772 104
367 3300005546 Ga0070696_100294506 Ga0070696_1002945062 104
368 3300005547 Ga0070693_100005417 Ga0070693_1000054174 104
369 3300005547 Ga0070693_100814402 Ga0070693_1008144022 104
370 3300005548 Ga0070665_101630959 Ga0070665_1016309592 104
371 3300005563 Ga0068855_100079053 Ga0068855_1000790533 104
372 3300005563 Ga0068855_101557801 Ga0068855_1015578011 104
373 3300005564 Ga0070664_100194953 Ga0070664_1001949532 104
374 3300005577 Ga0068857_100073529 Ga0068857_1000735292 104
375 3300005578 Ga0068854_100041418 Ga0068854_1000414182 104
376 3300005614 Ga0068856_100069494 Ga0068856_1000694943 104
377 3300005616 Ga0068852_100020623 Ga0068852_1000206232 104
378 3300005617 Ga0068859_100933268 Ga0068859_1009332683 104
379 3300005618 Ga0068864_100407953 Ga0068864_1004079532 104
380 3300005718 Ga0068866_10869875 Ga0068866_108698752 104
381 3300005834 Ga0068851_10025195 Ga0068851_100251953 104
382 3300005840 Ga0068870_11201221 Ga0068870_112012212 104
383 3300005842 Ga0068858_100269751 Ga0068858_1002697512 104
384 3300005842 Ga0068858_100406120 Ga0068858_1004061203 104
385 3300005843 Ga0068860_100004514 Ga0068860_1000045147 104
386 3300006163 Ga0070715_10295620 Ga0070715_102956203 104
387 3300006173 Ga0070716_100483907 Ga0070716_1004839072 104
388 3300006175 Ga0070712_100821580 Ga0070712_1008215801 104
389 3300006237 Ga0097621_100292296 Ga0097621_1002922962 104
390 3300006358 Ga0068871_100010943 Ga0068871_1000109432 104
391 3300006844 Ga0075428_100017222 Ga0075428_1000172224 104
392 3300006880 Ga0075429_100160274 Ga0075429_1001602742 104
393 3300006881 Ga0068865_100785309 Ga0068865_1007853091 104
394 3300006931 Ga0097620_100933284 Ga0097620_1009332842 104
395 3300009098 Ga0105245_10138781 Ga0105245_101387813 104
396 3300009098 Ga0105245_12598837 Ga0105245_125988372 104
397 3300009101 Ga0105247_10942886 Ga0105247_109428862 104
398 3300009148 Ga0105243_12784933 Ga0105243_127849332 104
399 3300009174 Ga0105241_10017892 Ga0105241_100178923 104
400 3300009174 Ga0105241_12606950 Ga0105241_126069501 104
401 3300009176 Ga0105242_10044056 Ga0105242_100440563 104
402 3300009176 Ga0105242_10082006 Ga0105242_100820062 104
403 3300009177 Ga0105248_10012433 Ga0105248_100124333 104
404 3300009177 Ga0105248_10132054 Ga0105248_101320542 104
405 3300009545 Ga0105237_10073724 Ga0105237_100737243 104
406 3300009545 Ga0105237_10670830 Ga0105237_106708301 104
407 3300009551 Ga0105238_10134093 Ga0105238_101340932 104
408 3300009551 Ga0105238_11145396 Ga0105238_111453962 104
409 3300010375 Ga0105239_10009785 Ga0105239_100097859 104
410 3300010375 Ga0105239_10606063 Ga0105239_106060632 104
411 3300013100 Ga0157373_11064080 Ga0157373_110640802 104
412 3300013296 Ga0157374_10129570 Ga0157374_101295703 104
413 3300013296 Ga0157374_10487709 Ga0157374_104877092 104
414 3300013297 Ga0157378_10001025 Ga0157378_1000102512 104
415 3300013306 Ga0163162_10036150 Ga0163162_100361503 104
416 3300013306 Ga0163162_10433584 Ga0163162_104335842 104
417 3300013307 Ga0157372_10063742 Ga0157372_100637423 104
418 3300013307 Ga0157372_10617125 Ga0157372_106171253 104
419 3300025321 Ga0207656_10069665 Ga0207656_100696652 104
420 3300025903 Ga0207680_10463775 Ga0207680_104637752 104
421 3300025911 Ga0207654_10006238 Ga0207654_100062382 104
422 3300025914 Ga0207671_10392020 Ga0207671_103920202 104
423 3300025915 Ga0207693_10521423 Ga0207693_105214232 104
424 3300025916 Ga0207663_10271478 Ga0207663_102714783 104
425 3300025920 Ga0207649_10054868 Ga0207649_100548683 104
426 3300025924 Ga0207694_10078555 Ga0207694_100785552 104
427 3300025927 Ga0207687_10108394 Ga0207687_101083942 104
428 3300025927 Ga0207687_10620108 Ga0207687_106201082 104
429 3300025931 Ga0207644_10326688 Ga0207644_103266882 104
430 3300025933 Ga0207706_10081965 Ga0207706_100819653 104
431 3300025934 Ga0207686_10203774 Ga0207686_102037742 104
432 3300025935 Ga0207709_11292147 Ga0207709_112921472 104
433 3300025936 Ga0207670_10026837 Ga0207670_100268371 104
434 3300025939 Ga0207665_10206078 Ga0207665_102060783 104
435 3300025939 Ga0207665_10315360 Ga0207665_103153603 104
436 3300025941 Ga0207711_10082965 Ga0207711_100829654 104
437 3300025941 Ga0207711_10110981 Ga0207711_101109813 104
438 3300025942 Ga0207689_10352077 Ga0207689_103520772 104
439 3300025944 Ga0207661_10419604 Ga0207661_104196042 104
440 3300025945 Ga0207679_10111021 Ga0207679_101110212 104
441 3300025949 Ga0207667_10019013 Ga0207667_100190137 104
442 3300025981 Ga0207640_10057844 Ga0207640_100578442 104
443 3300025986 Ga0207658_11054775 Ga0207658_110547752 104
444 3300026035 Ga0207703_10065351 Ga0207703_100653512 104
445 3300026035 Ga0207703_10557492 Ga0207703_105574923 104
446 3300026041 Ga0207639_10202434 Ga0207639_102024342 104
447 3300026078 Ga0207702_10524055 Ga0207702_105240552 104
448 3300026089 Ga0207648_10020342 Ga0207648_100203423 104
449 3300026095 Ga0207676_11095251 Ga0207676_110952512 104
450 3300026116 Ga0207674_10328366 Ga0207674_103283662 104
451 3300026142 Ga0207698_10549774 Ga0207698_105497743 104
452 3300028381 Ga0268264_10013446 Ga0268264_100134464 104
453 3300032005 Ga0307411_12264107 Ga0307411_122641072 104
454 3300045051 Ga0451576_0372584 Ga0451576_0372584_1066_1404 104
455 3300046678 Ga0495599_0337292 Ga0495599_0337292_524_856 104
456 3300047471 Ga0495684_0187384 Ga0495684_0187384_39_383 104
457 3300048903 Ga0496100_0658398 Ga0496100_0658398_222_560 104
458 3300048903 Ga0496100_0862834 Ga0496100_0862834_29_367 104
459 3300048904 Ga0496101_0492174 Ga0496101_0492174_124_462 104
460 3300048905 Ga0496102_0048066 Ga0496102_0048066_483_821 104
461 3300048909 Ga0496106_0013491 Ga0496106_0013491_2374_2712 104
462 3300048910 Ga0496107_0214350 Ga0496107_0214350_893_1231 104
463 3300048913 Ga0496110_1146457 Ga0496110_1146457_247_585 104
464 3300048915 Ga0496112_0069436 Ga0496112_0069436_2979_3311 104
465 3300048918 Ga0496115_0971380 Ga0496115_0971380_185_523 104
466 3300049744 Ga0501083_0663109 Ga0501083_0663109_35_367 104
467 3300050491 nmdc:mga00v17_461782_c1 nmdc:mga00v17_461782_c1_354_692 104
468 3300050507 nmdc:mga05p37_604548_c1 nmdc:mga05p37_604548_c1_696_1034 104
469 3300050508 nmdc:mga09592_1424806_c1 nmdc:mga09592_1424806_c1_86_424 104
470 3300050515 nmdc:mga0a205_485682_c1 nmdc:mga0a205_485682_c1_625_963 104
471 3300005444 Ga0070694_100813722 Ga0070694_1008137222 105
472 3300005544 Ga0070686_100247208 Ga0070686_1002472082 105
473 3300005617 Ga0068859_100037836 Ga0068859_1000378362 105
474 3300005617 Ga0068859_101906871 Ga0068859_1019068712 105
475 3300005719 Ga0068861_100639481 Ga0068861_1006394812 105
476 3300005843 Ga0068860_101337475 Ga0068860_1013374751 105
477 3300006847 Ga0075431_100001499 Ga0075431_10000149916 105
478 3300006880 Ga0075429_100421960 Ga0075429_1004219602 105
479 3300006931 Ga0097620_100037831 Ga0097620_1000378312 105
480 3300006931 Ga0097620_101906626 Ga0097620_1019066262 105
481 3300007076 Ga0075435_101021246 Ga0075435_1010212461 105
482 3300009094 Ga0111539_10033847 Ga0111539_100338472 105
483 3300013306 Ga0163162_13443810 Ga0163162_134438102 105
484 3300025960 Ga0207651_11058865 Ga0207651_110588652 105
485 3300026075 Ga0207708_10107471 Ga0207708_101074712 105
486 3300026118 Ga0207675_100168486 Ga0207675_1001684863 105
487 3300028380 Ga0268265_10195075 Ga0268265_101950751 105
488 3300031995 Ga0307409_101963354 Ga0307409_1019633542 105
489 3300032002 Ga0307416_100775201 Ga0307416_1007752012 105
490 3300032004 Ga0307414_10194834 Ga0307414_101948342 105
491 3300032005 Ga0307411_11021944 Ga0307411_110219442 105
492 3300032005 Ga0307411_12242547 Ga0307411_122425471 105
493 3300032126 Ga0307415_101443991 Ga0307415_1014439912 105
494 3300037471 Ga0395905_0027619 Ga0395905_0027619_4025_4357 105
495 3300042436 Ga0439435_0106623 Ga0439435_0106623_321_680 105
496 3300046517 Ga0495630_0011497 Ga0495630_0011497_2205_2591 105
497 3300047319 Ga0495674_0712820 Ga0495674_0712820_236_622 105
498 3300048088 Ga0495602_0151292 Ga0495602_0151292_732_1118 105
499 3300049128 Ga0501308_066314 Ga0501308_066314_118_450 105
500 3300049569 Ga0501032_0851233 Ga0501032_0851233_134_484 105
501 3300049570 Ga0501033_0025817 Ga0501033_0025817_2218_2568 105
502 3300049571 Ga0501034_0075752 Ga0501034_0075752_487_837 105
503 3300049572 Ga0501036_0130620 Ga0501036_0130620_539_889 105
504 3300049574 Ga0501038_0102746 Ga0501038_0102746_1207_1557 105
505 3300049577 Ga0501041_0192904 Ga0501041_0192904_621_971 105
506 3300049578 Ga0501042_0597700 Ga0501042_0597700_259_609 105
507 3300049580 Ga0501046_0007699 Ga0501046_0007699_5727_6077 105
508 3300049581 Ga0501047_0134230 Ga0501047_0134230_313_663 105
509 3300049582 Ga0501048_0230245 Ga0501048_0230245_307_657 105
510 3300049588 Ga0501072_0039878 Ga0501072_0039878_1867_2217 105
511 3300049589 Ga0501073_0027493 Ga0501073_0027493_1293_1652 105
512 3300049591 Ga0501075_0293967 Ga0501075_0293967_390_740 105
513 3300049592 Ga0501076_0311010 Ga0501076_0311010_508_858 105
514 3300049669 Ga0501235_191314 Ga0501235_191314_141_482 105
515 3300049743 Ga0501081_0512378 Ga0501081_0512378_489_839 105
516 3300049823 Ga0501044_0028621 Ga0501044_0028621_4066_4416 105
517 3300049824 Ga0501045_0095567 Ga0501045_0095567_1581_1931 105
518 3300050508 nmdc:mga09592_150680_c1 nmdc:mga09592_150680_c1_268_609 105
519 3300050509 nmdc:mga0qj67_78665_c1 nmdc:mga0qj67_78665_c1_1724_2065 105
520 3300050510 nmdc:mga06r32_12645_c1 nmdc:mga06r32_12645_c1_4883_5224 105
521 2162886012 MBSR1b_contig_5926467 MBSR1b_0940.00004790 106
522 3300005347 Ga0070668_100406092 Ga0070668_1004060922 106
523 3300005354 Ga0070675_101555855 Ga0070675_1015558552 106
524 3300005364 Ga0070673_100439294 Ga0070673_1004392943 106
525 3300005365 Ga0070688_100572203 Ga0070688_1005722032 106
526 3300005436 Ga0070713_101256272 Ga0070713_1012562722 106
527 3300005444 Ga0070694_100937108 Ga0070694_1009371082 106
528 3300005518 Ga0070699_100274553 Ga0070699_1002745532 106
529 3300005549 Ga0070704_100499816 Ga0070704_1004998162 106
530 3300005549 Ga0070704_100676199 Ga0070704_1006761992 106
531 3300005617 Ga0068859_101004137 Ga0068859_1010041372 106
532 3300005841 Ga0068863_100005605 Ga0068863_1000056059 106
533 3300005842 Ga0068858_100423528 Ga0068858_1004235282 106
534 3300005843 Ga0068860_100133407 Ga0068860_1001334073 106
535 3300006038 Ga0075365_10287425 Ga0075365_102874252 106
536 3300006042 Ga0075368_10008168 Ga0075368_100081682 106
537 3300006051 Ga0075364_10006340 Ga0075364_100063404 106
538 3300006178 Ga0075367_10040931 Ga0075367_100409313 106
539 3300006195 Ga0075366_10025466 Ga0075366_100254663 106
540 3300006931 Ga0097620_101004310 Ga0097620_1010043102 106
541 3300006931 Ga0097620_101898590 Ga0097620_1018985901 106
542 3300009174 Ga0105241_10637083 Ga0105241_106370832 106
543 3300009177 Ga0105248_10833417 Ga0105248_108334172 106
544 3300009177 Ga0105248_11161977 Ga0105248_111619771 106
545 3300009553 Ga0105249_10033730 Ga0105249_100337302 106
546 3300014326 Ga0157380_11856561 Ga0157380_118565612 106
547 3300014745 Ga0157377_11200216 Ga0157377_112002162 106
548 3300025899 Ga0207642_10039866 Ga0207642_100398662 106
549 3300025928 Ga0207700_10958822 Ga0207700_109588222 106
550 3300025934 Ga0207686_10043950 Ga0207686_100439502 106
551 3300025938 Ga0207704_10047829 Ga0207704_100478292 106
552 3300025972 Ga0207668_10541687 Ga0207668_105416872 106
553 3300026088 Ga0207641_10005329 Ga0207641_100053299 106
554 3300026089 Ga0207648_10488797 Ga0207648_104887972 106
555 3300026118 Ga0207675_100067780 Ga0207675_1000677802 106
556 3300027866 Ga0209813_10061851 Ga0209813_100618513 106
557 3300035171 Ga0373946_0032531 Ga0373946_0032531_323_688 106
558 3300035172 Ga0373955_0840094 Ga0373955_0840094_209_547 106
559 3300035410 Ga0373924_0518959 Ga0373924_0518959_37_375 106
560 3300035692 Ga0373935_0529664 Ga0373935_0529664_126_470 106
561 3300036401 Ga0373937_0696450 Ga0373937_0696450_103_447 106
562 3300036401 Ga0373937_0699348 Ga0373937_0699348_494_856 106
563 3300039453 Ga0436362_0107871 Ga0436362_0107871_147_500 106
564 3300044712 Ga0453684_0025701 Ga0453684_0025701_735_1076 106
565 3300045976 Ga0466967_0178048 Ga0466967_0178048_1084_1428 106
566 3300046455 Ga0495603_0690843 Ga0495603_0690843_32_376 106
567 3300046459 Ga0495629_0001309 Ga0495629_0001309_2469_2813 106
568 3300046461 Ga0495641_0101417 Ga0495641_0101417_363_707 106
569 3300046472 Ga0495580_0125249 Ga0495580_0125249_1430_1765 106
570 3300046473 Ga0495582_0062784 Ga0495582_0062784_1171_1515 106
571 3300046475 Ga0495639_0001582 Ga0495639_0001582_635_979 106
572 3300046475 Ga0495639_0006686 Ga0495639_0006686_2675_3049 106
573 3300046475 Ga0495639_0224510 Ga0495639_0224510_437_799 106
574 3300046499 Ga0495594_0028185 Ga0495594_0028185_1764_2108 106
575 3300046526 Ga0495666_0000817 Ga0495666_0000817_6672_7037 106
576 3300046533 Ga0495640_0131506 Ga0495640_0131506_818_1162 106
577 3300046535 Ga0495586_0002774 Ga0495586_0002774_7252_7617 106
578 3300046642 Ga0495634_0030948 Ga0495634_0030948_1952_2296 106
579 3300046663 Ga0495635_0012021 Ga0495635_0012021_5061_5405 106
580 3300046675 Ga0495657_0286792 Ga0495657_0286792_90_428 106
581 3300046679 Ga0495623_0505197 Ga0495623_0505197_135_473 106
582 3300046683 Ga0495658_0003686 Ga0495658_0003686_5702_6046 106
583 3300046689 Ga0495613_0017347 Ga0495613_0017347_3373_3717 106
584 3300047315 Ga0495581_0010103 Ga0495581_0010103_3305_3670 106
585 3300047315 Ga0495581_0024224 Ga0495581_0024224_2880_3224 106
586 3300047322 Ga0495680_0001367 Ga0495680_0001367_6252_6596 106
587 3300047471 Ga0495684_0078192 Ga0495684_0078192_1592_1936 106
588 3300048088 Ga0495602_0754565 Ga0495602_0754565_284_622 106
589 3300048088 Ga0495602_0997434 Ga0495602_0997434_72_434 106
590 3300049743 Ga0501081_0483765 Ga0501081_0483765_292_627 106
591 3300050491 nmdc:mga00v17_19908_c1 nmdc:mga00v17_19908_c1_859_1200 106
592 3300050492 nmdc:mga0yw44_254512_c1 nmdc:mga0yw44_254512_c1_298_639 106
593 3300050495 nmdc:mga04h51_32364_c1 nmdc:mga04h51_32364_c1_867_1208 106
594 3300050508 nmdc:mga09592_1314419_c1 nmdc:mga09592_1314419_c1_166_501 106
595 3300053085 Ga0495619_0003359 Ga0495619_0003359_459_803 106
596 3300005340 Ga0070689_100149304 Ga0070689_1001493042 107
597 3300005354 Ga0070675_100041913 Ga0070675_1000419132 107
598 3300005354 Ga0070675_102142719 Ga0070675_1021427191 107
599 3300005436 Ga0070713_100353757 Ga0070713_1003537572 107
600 3300005439 Ga0070711_100357648 Ga0070711_1003576482 107
601 3300005445 Ga0070708_100137560 Ga0070708_1001375602 107
602 3300005518 Ga0070699_100000012 Ga0070699_10000001299 107
603 3300005549 Ga0070704_100320226 Ga0070704_1003202263 107
604 3300005614 Ga0068856_100042701 Ga0068856_1000427012 107
605 3300005617 Ga0068859_100848074 Ga0068859_1008480742 107
606 3300005842 Ga0068858_100037811 Ga0068858_1000378112 107
607 3300006028 Ga0070717_10977157 Ga0070717_109771571 107
608 3300006852 Ga0075433_10040574 Ga0075433_100405743 107
609 3300006871 Ga0075434_100211827 Ga0075434_1002118272 107
610 3300006931 Ga0097620_100848130 Ga0097620_1008481302 107
611 3300009094 Ga0111539_10394927 Ga0111539_103949272 107
612 3300009094 Ga0111539_10471347 Ga0111539_104713472 107
613 3300009147 Ga0114129_10183182 Ga0114129_101831823 107
614 3300009177 Ga0105248_10928377 Ga0105248_109283772 107
615 3300009545 Ga0105237_10742590 Ga0105237_107425902 107
616 3300009551 Ga0105238_10876843 Ga0105238_108768432 107
617 3300010375 Ga0105239_10346058 Ga0105239_103460583 107
618 3300011119 Ga0105246_12100915 Ga0105246_121009152 107
619 3300013297 Ga0157378_10016886 Ga0157378_100168863 107
620 3300013297 Ga0157378_10028267 Ga0157378_100282673 107
621 3300021361 Ga0213872_10038558 Ga0213872_100385582 107
622 3300021361 Ga0213872_10402689 Ga0213872_104026891 107
623 3300021384 Ga0213876_10033164 Ga0213876_100331642 107
624 3300021388 Ga0213875_10207652 Ga0213875_102076522 107
625 3300025907 Ga0207645_10727293 Ga0207645_107272931 107
626 3300025921 Ga0207652_10016862 Ga0207652_100168623 107
627 3300025927 Ga0207687_10111742 Ga0207687_101117423 107
628 3300025928 Ga0207700_10273025 Ga0207700_102730252 107
629 3300025941 Ga0207711_11102282 Ga0207711_111022822 107
630 3300026035 Ga0207703_10255608 Ga0207703_102556083 107
631 3300026088 Ga0207641_11056280 Ga0207641_110562802 107
632 3300028379 Ga0268266_10400543 Ga0268266_104005432 107
633 3300028653 Ga0265323_10013817 Ga0265323_100138173 107
634 3300028654 Ga0265322_10003804 Ga0265322_100038043 107
635 3300028800 Ga0265338_10542701 Ga0265338_105427012 107
636 3300031242 Ga0265329_10078573 Ga0265329_100785731 107
637 3300031344 Ga0265316_10052917 Ga0265316_100529172 107
638 3300031995 Ga0307409_102964226 Ga0307409_1029642262 107
639 3300036401 Ga0373937_0860986 Ga0373937_0860986_231_587 107
640 3300037853 Ga0436364_0141118 Ga0436364_0141118_377_730 107
641 3300039437 Ga0436365_1376303 Ga0436365_1376303_4149_4502 107
642 3300039438 Ga0436360_0194576 Ga0436360_0194576_3687_4037 107
643 3300039438 Ga0436360_0687086 Ga0436360_0687086_258_608 107
644 3300039438 Ga0436360_1185407 Ga0436360_1185407_257_607 107
645 3300039447 Ga0436361_0186403 Ga0436361_0186403_109_462 107
646 3300039447 Ga0436361_0248862 Ga0436361_0248862_345_695 107
647 3300039447 Ga0436361_0535007 Ga0436361_0535007_834_1184 107
648 3300039447 Ga0436361_0809850 Ga0436361_0809850_2397_2747 107
649 3300042876 Ga0451577_0813414 Ga0451577_0813414_139_492 107
650 3300042876 Ga0451577_1323502 Ga0451577_1323502_152_523 107
651 3300044712 Ga0453684_0367864 Ga0453684_0367864_704_1078 107
652 3300044712 Ga0453684_0757827 Ga0453684_0757827_321_692 107
653 3300044712 Ga0453684_1707641 Ga0453684_1707641_112_444 107
654 3300045051 Ga0451576_0013273 Ga0451576_0013273_2100_2432 107
655 3300046519 Ga0495632_0000124 Ga0495632_0000124_45393_45755 107
656 3300046520 Ga0495637_0012088 Ga0495637_0012088_3473_3835 107
657 3300046665 Ga0495661_0267048 Ga0495661_0267048_314_676 107
658 3300046690 Ga0495624_0163604 Ga0495624_0163604_607_939 107
659 3300047320 Ga0495672_0050803 Ga0495672_0050803_1120_1464 107
660 3300049569 Ga0501032_0153497 Ga0501032_0153497_459_797 107
661 3300049570 Ga0501033_0186327 Ga0501033_0186327_368_706 107
662 3300049572 Ga0501036_0272262 Ga0501036_0272262_363_701 107
663 3300049573 Ga0501037_0063523 Ga0501037_0063523_654_992 107
664 3300049574 Ga0501038_0064210 Ga0501038_0064210_844_1182 107
665 3300049575 Ga0501039_0058582 Ga0501039_0058582_672_1010 107
666 3300049578 Ga0501042_0133621 Ga0501042_0133621_672_1010 107
667 3300049579 Ga0501043_0234521 Ga0501043_0234521_370_708 107
668 3300049581 Ga0501047_0143704 Ga0501047_0143704_1223_1561 107
669 3300049582 Ga0501048_0161957 Ga0501048_0161957_403_741 107
670 3300049584 Ga0501068_0045922 Ga0501068_0045922_1439_1777 107
671 3300049586 Ga0501070_0229139 Ga0501070_0229139_638_976 107
672 3300049587 Ga0501071_0033651 Ga0501071_0033651_780_1118 107
673 3300049590 Ga0501074_0053198 Ga0501074_0053198_884_1222 107
674 3300049593 Ga0501077_0041307 Ga0501077_0041307_437_775 107
675 3300049741 Ga0501079_0111924 Ga0501079_0111924_346_684 107
676 3300049742 Ga0501080_0258322 Ga0501080_0258322_786_1124 107
677 3300049822 Ga0501035_0047901 Ga0501035_0047901_2570_2908 107
678 3300049823 Ga0501044_0056539 Ga0501044_0056539_1538_1921 107
679 3300049823 Ga0501044_0522925 Ga0501044_0522925_216_554 107
680 3300049824 Ga0501045_0575657 Ga0501045_0575657_176_514 107
681 3300050507 nmdc:mga05p37_133107_c1 nmdc:mga05p37_133107_c1_502_840 107
682 3300050510 nmdc:mga06r32_917772_c1 nmdc:mga06r32_917772_c1_198_557 107
683 3300050511 nmdc:mga08y16_625050_c1 nmdc:mga08y16_625050_c1_238_573 107
684 3300050512 nmdc:mga0n895_638112_c1 nmdc:mga0n895_638112_c1_67_426 107
685 3300050513 nmdc:mga0rr50_557209_c1 nmdc:mga0rr50_557209_c1_533_892 107
686 3300050515 nmdc:mga0a205_84565_c1 nmdc:mga0a205_84565_c1_1388_1747 107
687 3300053139 Ga0500568_0006953 Ga0500568_0006953_1070_1414 107
688 3300054114 Ga0501084_0695291 Ga0501084_0695291_284_622 107
689 3300060353 Ga0501082_0160029 Ga0501082_0160029_667_1005 107
690 3300061734 Ga0530510_0098595 Ga0530510_0098595_478_816 107
691 3300005289 Ga0065704_10144240 Ga0065704_101442402 108
692 3300005340 Ga0070689_100125393 Ga0070689_1001253932 108
693 3300005367 Ga0070667_100000005 Ga0070667_100000005130 108
694 3300005445 Ga0070708_100368257 Ga0070708_1003682572 108
695 3300005455 Ga0070663_100000210 Ga0070663_10000021021 108
696 3300005467 Ga0070706_100248056 Ga0070706_1002480563 108
697 3300005471 Ga0070698_100418803 Ga0070698_1004188032 108
698 3300005471 Ga0070698_101719913 Ga0070698_1017199131 108
699 3300005563 Ga0068855_102362097 Ga0068855_1023620971 108
700 3300005577 Ga0068857_100008955 Ga0068857_1000089555 108
701 3300005842 Ga0068858_100195143 Ga0068858_1001951432 108
702 3300005842 Ga0068858_100377375 Ga0068858_1003773752 108
703 3300005937 Ga0081455_10021596 Ga0081455_100215965 108
704 3300005985 Ga0081539_10016029 Ga0081539_100160296 108
705 3300006844 Ga0075428_100029102 Ga0075428_1000291022 108
706 3300006844 Ga0075428_100114702 Ga0075428_1001147022 108
707 3300006844 Ga0075428_100246043 Ga0075428_1002460433 108
708 3300006846 Ga0075430_100099955 Ga0075430_1000999553 108
709 3300006846 Ga0075430_100126789 Ga0075430_1001267892 108
710 3300006846 Ga0075430_100885312 Ga0075430_1008853122 108
711 3300006847 Ga0075431_100023477 Ga0075431_1000234775 108
712 3300006847 Ga0075431_101676873 Ga0075431_1016768732 108
713 3300006852 Ga0075433_10001699 Ga0075433_100016993 108
714 3300006852 Ga0075433_11329130 Ga0075433_113291301 108
715 3300006871 Ga0075434_100829760 Ga0075434_1008297602 108
716 3300006880 Ga0075429_100192505 Ga0075429_1001925052 108
717 3300006880 Ga0075429_100914767 Ga0075429_1009147672 108
718 3300009093 Ga0105240_10000115 Ga0105240_10000115119 108
719 3300009093 Ga0105240_10117898 Ga0105240_101178983 108
720 3300009094 Ga0111539_13035490 Ga0111539_130354902 108
721 3300009101 Ga0105247_10104972 Ga0105247_101049722 108
722 3300009147 Ga0114129_10211130 Ga0114129_102111302 108
723 3300009147 Ga0114129_10429875 Ga0114129_104298751 108
724 3300009147 Ga0114129_11169266 Ga0114129_111692662 108
725 3300009174 Ga0105241_11278555 Ga0105241_112785551 108
726 3300009177 Ga0105248_10000526 Ga0105248_1000052632 108
727 3300009545 Ga0105237_10000267 Ga0105237_1000026738 108
728 3300009553 Ga0105249_10001397 Ga0105249_100013975 108
729 3300010375 Ga0105239_10043429 Ga0105239_100434293 108
730 3300011119 Ga0105246_10221170 Ga0105246_102211702 108
731 3300013306 Ga0163162_12273109 Ga0163162_122731092 108
732 3300014325 Ga0163163_10275846 Ga0163163_102758462 108
733 3300014968 Ga0157379_11286772 Ga0157379_112867722 108
734 3300014969 Ga0157376_10571476 Ga0157376_105714761 108
735 3300025900 Ga0207710_10153409 Ga0207710_101534092 108
736 3300025901 Ga0207688_10451664 Ga0207688_104516642 108
737 3300025910 Ga0207684_10097238 Ga0207684_100972383 108
738 3300025913 Ga0207695_10000116 Ga0207695_10000116113 108
739 3300025913 Ga0207695_10068401 Ga0207695_100684014 108
740 3300025914 Ga0207671_10000687 Ga0207671_100006878 108
741 3300025914 Ga0207671_10308134 Ga0207671_103081342 108
742 3300025920 Ga0207649_10501640 Ga0207649_105016402 108
743 3300025922 Ga0207646_10119154 Ga0207646_101191542 108
744 3300025924 Ga0207694_11103630 Ga0207694_111036302 108
745 3300025937 Ga0207669_11515946 Ga0207669_115159462 108
746 3300025941 Ga0207711_10002710 Ga0207711_100027105 108
747 3300025961 Ga0207712_10010118 Ga0207712_100101187 108
748 3300025986 Ga0207658_10000006 Ga0207658_10000006244 108
749 3300026035 Ga0207703_10119227 Ga0207703_101192272 108
750 3300026035 Ga0207703_10366934 Ga0207703_103669343 108
751 3300026067 Ga0207678_10000063 Ga0207678_1000006364 108
752 3300026116 Ga0207674_10051992 Ga0207674_100519924 108
753 3300026116 Ga0207674_11174668 Ga0207674_111746681 108
754 3300026142 Ga0207698_10102810 Ga0207698_101028103 108
755 3300028800 Ga0265338_10000025 Ga0265338_10000025204 108
756 3300031249 Ga0265339_10065974 Ga0265339_100659742 108
757 3300031711 Ga0265314_10419421 Ga0265314_104194212 108
758 3300037853 Ga0436364_1211847 Ga0436364_1211847_224_580 108
759 3300044712 Ga0453684_0654753 Ga0453684_0654753_474_806 108
760 3300045051 Ga0451576_2050321 Ga0451576_2050321_67_411 108
761 3300046663 Ga0495635_0050813 Ga0495635_0050813_1947_2288 108
762 3300046809 Ga0495600_0024437 Ga0495600_0024437_3481_3822 108
763 3300047322 Ga0495680_0040480 Ga0495680_0040480_1397_1738 108
764 3300048903 Ga0496100_0029585 Ga0496100_0029585_909_1271 108
765 3300048904 Ga0496101_0341242 Ga0496101_0341242_29_391 108
766 3300048916 Ga0496113_0342076 Ga0496113_0342076_368_724 108
767 3300048917 Ga0496114_0675591 Ga0496114_0675591_302_643 108
768 3300048918 Ga0496115_0055079 Ga0496115_0055079_1015_1377 108
769 3300048920 Ga0496117_0007672 Ga0496117_0007672_5263_5625 108
770 3300048921 Ga0496118_0000417 Ga0496118_0000417_15533_15895 108
771 3300048923 Ga0496120_0000015 Ga0496120_0000015_80211_80573 108
772 3300048923 Ga0496120_0094939 Ga0496120_0094939_239_595 108
773 3300048924 Ga0496121_0042670 Ga0496121_0042670_713_1075 108
774 3300048924 Ga0496121_0049014 Ga0496121_0049014_2046_2408 108
775 3300048925 Ga0496122_0000487 Ga0496122_0000487_33476_33832 108
776 3300048926 Ga0496123_0000296 Ga0496123_0000296_92724_93080 108
777 3300048929 Ga0496126_0000134 Ga0496126_0000134_33166_33528 108
778 3300048929 Ga0496126_0040020 Ga0496126_0040020_830_1192 108
779 3300049578 Ga0501042_0398356 Ga0501042_0398356_21_353 108
780 3300049582 Ga0501048_0523047 Ga0501048_0523047_445_777 108
781 3300049584 Ga0501068_0375207 Ga0501068_0375207_212_544 108
782 3300049588 Ga0501072_0882498 Ga0501072_0882498_80_412 108
783 3300049590 Ga0501074_0265699 Ga0501074_0265699_538_870 108
784 3300049591 Ga0501075_0322481 Ga0501075_0322481_675_1007 108
785 3300049593 Ga0501077_0193341 Ga0501077_0193341_580_912 108
786 3300049741 Ga0501079_0491449 Ga0501079_0491449_372_704 108
787 3300049824 Ga0501045_0437251 Ga0501045_0437251_381_713 108
788 3300050507 nmdc:mga05p37_138586_c1 nmdc:mga05p37_138586_c1_2438_2779 108
789 3300050507 nmdc:mga05p37_299137_c1 nmdc:mga05p37_299137_c1_1276_1608 108
790 3300050507 nmdc:mga05p37_837111_c1 nmdc:mga05p37_837111_c1_583_927 108
791 3300050508 nmdc:mga09592_158039_c1 nmdc:mga09592_158039_c1_473_817 108
792 3300050508 nmdc:mga09592_34375_c1 nmdc:mga09592_34375_c1_3709_4041 108
793 3300050509 nmdc:mga0qj67_993385_c1 nmdc:mga0qj67_993385_c1_235_576 108
794 3300050510 nmdc:mga06r32_1767719_c1 nmdc:mga06r32_1767719_c1_139_471 108
795 3300050510 nmdc:mga06r32_256434_c1 nmdc:mga06r32_256434_c1_225_557 108
796 3300050512 nmdc:mga0n895_2019706_c1 nmdc:mga0n895_2019706_c1_142_513 108
797 3300050512 nmdc:mga0n895_79689_c1 nmdc:mga0n895_79689_c1_2713_3051 108
798 3300050512 nmdc:mga0n895_828524_c1 nmdc:mga0n895_828524_c1_407_748 108
799 3300050515 nmdc:mga0a205_1818_c1 nmdc:mga0a205_1818_c1_4375_4716 108
800 3300050515 nmdc:mga0a205_521490_c1 nmdc:mga0a205_521490_c1_575_913 108
801 3300061734 Ga0530510_0597578 Ga0530510_0597578_419_751 108
802 3300003323 rootH1_10274450 rootH1_102744503 109
803 3300004800 Ga0058861_11747774 Ga0058861_117477742 109
804 3300005435 Ga0070714_101644267 Ga0070714_1016442672 109
805 3300005436 Ga0070713_100020936 Ga0070713_1000209364 109
806 3300005436 Ga0070713_100043883 Ga0070713_1000438832 109
807 3300005439 Ga0070711_100143104 Ga0070711_1001431043 109
808 3300005440 Ga0070705_100013552 Ga0070705_1000135524 109
809 3300005444 Ga0070694_100164111 Ga0070694_1001641112 109
810 3300005458 Ga0070681_10093059 Ga0070681_100930592 109
811 3300005467 Ga0070706_100586089 Ga0070706_1005860892 109
812 3300005467 Ga0070706_101511210 Ga0070706_1015112102 109
813 3300005468 Ga0070707_100166738 Ga0070707_1001667382 109
814 3300005468 Ga0070707_100352294 Ga0070707_1003522942 109
815 3300005471 Ga0070698_100020402 Ga0070698_1000204022 109
816 3300005518 Ga0070699_100055893 Ga0070699_1000558933 109
817 3300005518 Ga0070699_100382107 Ga0070699_1003821072 109
818 3300005518 Ga0070699_100871073 Ga0070699_1008710732 109
819 3300005536 Ga0070697_100092667 Ga0070697_1000926672 109
820 3300005536 Ga0070697_100152281 Ga0070697_1001522812 109
821 3300005536 Ga0070697_100158855 Ga0070697_1001588552 109
822 3300005545 Ga0070695_100092873 Ga0070695_1000928732 109
823 3300005545 Ga0070695_100108432 Ga0070695_1001084322 109
824 3300005546 Ga0070696_100037801 Ga0070696_1000378012 109
825 3300005546 Ga0070696_100124444 Ga0070696_1001244442 109
826 3300005549 Ga0070704_100045762 Ga0070704_1000457622 109
827 3300005549 Ga0070704_100240056 Ga0070704_1002400562 109
828 3300005843 Ga0068860_100061657 Ga0068860_1000616572 109
829 3300005985 Ga0081539_10027789 Ga0081539_100277892 109
830 3300006028 Ga0070717_10265865 Ga0070717_102658652 109
831 3300006175 Ga0070712_100122890 Ga0070712_1001228902 109
832 3300006358 Ga0068871_100160198 Ga0068871_1001601982 109
833 3300006844 Ga0075428_100049240 Ga0075428_1000492402 109
834 3300006852 Ga0075433_10515010 Ga0075433_105150102 109
835 3300006871 Ga0075434_100093946 Ga0075434_1000939462 109
836 3300006871 Ga0075434_100769296 Ga0075434_1007692962 109
837 3300006914 Ga0075436_100043993 Ga0075436_1000439932 109
838 3300006914 Ga0075436_100092593 Ga0075436_1000925932 109
839 3300007076 Ga0075435_100036054 Ga0075435_1000360542 109
840 3300007076 Ga0075435_101773620 Ga0075435_1017736202 109
841 3300009098 Ga0105245_10144476 Ga0105245_101444762 109
842 3300009101 Ga0105247_11445255 Ga0105247_114452551 109
843 3300009147 Ga0114129_10198896 Ga0114129_101988962 109
844 3300009147 Ga0114129_12611933 Ga0114129_126119331 109
845 3300009177 Ga0105248_10747236 Ga0105248_107472362 109
846 3300014968 Ga0157379_10056516 Ga0157379_100565162 109
847 3300021384 Ga0213876_10235349 Ga0213876_102353492 109
848 3300025906 Ga0207699_10374128 Ga0207699_103741282 109
849 3300025910 Ga0207684_10070701 Ga0207684_100707012 109
850 3300025912 Ga0207707_10086108 Ga0207707_100861082 109
851 3300025915 Ga0207693_10147312 Ga0207693_101473122 109
852 3300025916 Ga0207663_10116336 Ga0207663_101163363 109
853 3300025922 Ga0207646_10164839 Ga0207646_101648392 109
854 3300025922 Ga0207646_10301513 Ga0207646_103015132 109
855 3300025928 Ga0207700_10031595 Ga0207700_100315953 109
856 3300025942 Ga0207689_10543049 Ga0207689_105430492 109
857 3300025986 Ga0207658_10055939 Ga0207658_100559393 109
858 3300028381 Ga0268264_10131359 Ga0268264_101313592 109
859 3300035115 Ga0373941_0300527 Ga0373941_0300527_81_443 109
860 3300039437 Ga0436365_1481395 Ga0436365_1481395_222_560 109
861 3300046477 Ga0495664_0095442 Ga0495664_0095442_438_818 109
862 3300046516 Ga0495628_0268689 Ga0495628_0268689_609_989 109
863 3300046543 Ga0495645_0057384 Ga0495645_0057384_554_934 109
864 3300046678 Ga0495599_0380939 Ga0495599_0380939_97_477 109
865 3300048907 Ga0496104_0289986 Ga0496104_0289986_972_1352 109
866 3300048908 Ga0496105_0276048 Ga0496105_0276048_572_952 109
867 3300048913 Ga0496110_1193124 Ga0496110_1193124_321_656 109
868 3300050507 nmdc:mga05p37_249005_c1 nmdc:mga05p37_249005_c1_654_995 109
869 3300050511 nmdc:mga08y16_612708_c1 nmdc:mga08y16_612708_c1_226_570 109
870 3300050512 nmdc:mga0n895_21383_c2 nmdc:mga0n895_21383_c2_1189_1533 109
871 3300050513 nmdc:mga0rr50_159550_c2 nmdc:mga0rr50_159550_c2_1189_1533 109
872 3300050514 nmdc:mga08x19_29739_c1 nmdc:mga08x19_29739_c1_1180_1524 109
873 3300050514 nmdc:mga08x19_52113_c1 nmdc:mga08x19_52113_c1_36_380 109
874 3300050515 nmdc:mga0a205_258878_c1 nmdc:mga0a205_258878_c1_1085_1429 109
875 3300050515 nmdc:mga0a205_98978_c1 nmdc:mga0a205_98978_c1_275_619 109
876 3300053077 Ga0495601_0006301 Ga0495601_0006301_3243_3623 109
877 3300053078 Ga0495612_0442182 Ga0495612_0442182_101_445 109
878 3300005434 Ga0070709_10076194 Ga0070709_100761942 110
879 3300005439 Ga0070711_100473993 Ga0070711_1004739932 110
880 3300005616 Ga0068852_101093714 Ga0068852_1010937141 110
881 3300006175 Ga0070712_100335243 Ga0070712_1003352432 110
882 3300013297 Ga0157378_10286858 Ga0157378_102868582 110
883 3300025898 Ga0207692_10303072 Ga0207692_103030721 110
884 3300025915 Ga0207693_10173714 Ga0207693_101737142 110
885 3300025916 Ga0207663_11164161 Ga0207663_111641612 110
886 3300025936 Ga0207670_10636984 Ga0207670_106369842 110
887 3300026023 Ga0207677_10650231 Ga0207677_106502312 110
888 3300026142 Ga0207698_10463520 Ga0207698_104635202 110
889 3300032005 Ga0307411_11632673 Ga0307411_116326731 110
890 3300042876 Ga0451577_0224450 Ga0451577_0224450_605_952 110
891 3300044712 Ga0453684_1511646 Ga0453684_1511646_325_672 110
892 3300044712 Ga0453684_2365588 Ga0453684_2365588_70_438 110
893 3300046459 Ga0495629_0000008 Ga0495629_0000008_50410_50757 110
894 3300046557 Ga0495622_0038871 Ga0495622_0038871_1759_2106 110
895 3300049581 Ga0501047_0638772 Ga0501047_0638772_16_384 110
896 3300049744 Ga0501083_0065233 Ga0501083_0065233_720_1088 110
897 3300049823 Ga0501044_0103630 Ga0501044_0103630_960_1328 110
898 3300053096 Ga0500641_0035065 Ga0500641_0035065_965_1387 110
899 3300061734 Ga0530510_1476698 Ga0530510_1476698_136_498 110
900 3300005339 Ga0070660_100108132 Ga0070660_1001081323 111
901 3300005339 Ga0070660_100189137 Ga0070660_1001891372 111
902 3300005577 Ga0068857_100655164 Ga0068857_1006551642 111
903 3300005834 Ga0068851_10040164 Ga0068851_100401642 111
904 3300006042 Ga0075368_10187031 Ga0075368_101870312 111
905 3300013104 Ga0157370_10061502 Ga0157370_100615023 111
906 3300025909 Ga0207705_10005099 Ga0207705_100050992 111
907 3300025919 Ga0207657_10131020 Ga0207657_101310202 111
908 3300025919 Ga0207657_10302159 Ga0207657_103021592 111
909 3300025924 Ga0207694_11051298 Ga0207694_110512981 111
910 3300026116 Ga0207674_10158463 Ga0207674_101584632 111
911 3300031824 Ga0307413_11765526 Ga0307413_117655262 111
912 3300049579 Ga0501043_0007855 Ga0501043_0007855_5728_6114 111
913 3300049580 Ga0501046_0003788 Ga0501046_0003788_4770_5156 111
914 3300049581 Ga0501047_0020232 Ga0501047_0020232_3300_3686 111
915 3300049582 Ga0501048_0023535 Ga0501048_0023535_691_1077 111
916 3300049742 Ga0501080_0140518 Ga0501080_0140518_1071_1457 111
917 3300049744 Ga0501083_0003607 Ga0501083_0003607_5690_6076 111
918 3300049822 Ga0501035_0222706 Ga0501035_0222706_964_1350 111
919 3300049823 Ga0501044_0391603 Ga0501044_0391603_376_762 111
920 3300049824 Ga0501045_0065337 Ga0501045_0065337_1209_1595 111
921 3300050494 nmdc:mga06z11_131389_c1 nmdc:mga06z11_131389_c1_131_544 111
922 3300060353 Ga0501082_0294096 Ga0501082_0294096_519_905 111
923 3300005331 Ga0070670_101254211 Ga0070670_1012542112 112
924 3300005345 Ga0070692_10013264 Ga0070692_100132642 112
925 3300005444 Ga0070694_100013478 Ga0070694_1000134783 112
926 3300005563 Ga0068855_100235046 Ga0068855_1002350463 112
927 3300005564 Ga0070664_100330348 Ga0070664_1003303482 112
928 3300005578 Ga0068854_100640833 Ga0068854_1006408332 112
929 3300006844 Ga0075428_100399753 Ga0075428_1003997533 112
930 3300006846 Ga0075430_100063229 Ga0075430_1000632291 112
931 3300006847 Ga0075431_100962349 Ga0075431_1009623492 112
932 3300009093 Ga0105240_12053947 Ga0105240_120539472 112
933 3300014325 Ga0163163_10524960 Ga0163163_105249602 112
934 3300025315 Ga0207697_10339566 Ga0207697_103395662 112
935 3300025903 Ga0207680_10158828 Ga0207680_101588282 112
936 3300025913 Ga0207695_11342815 Ga0207695_113428152 112
937 3300025945 Ga0207679_10379759 Ga0207679_103797591 112
938 3300025981 Ga0207640_10473881 Ga0207640_104738812 112
939 3300026035 Ga0207703_10774688 Ga0207703_107746882 112
940 3300035119 Ga0373956_0069096 Ga0373956_0069096_790_1185 112
941 3300035172 Ga0373955_0374390 Ga0373955_0374390_176_571 112
942 3300044712 Ga0453684_1006850 Ga0453684_1006850_51_428 112
943 3300046454 Ga0495592_0040268 Ga0495592_0040268_1802_2197 112
944 3300046462 Ga0495651_0063218 Ga0495651_0063218_764_1159 112
945 3300046472 Ga0495580_0622347 Ga0495580_0622347_125_520 112
946 3300046476 Ga0495662_0031533 Ga0495662_0031533_1820_2215 112
947 3300046517 Ga0495630_0021829 Ga0495630_0021829_272_667 112
948 3300046529 Ga0495652_0108517 Ga0495652_0108517_1805_2200 112
949 3300046543 Ga0495645_0087772 Ga0495645_0087772_295_690 112
950 3300046689 Ga0495613_0543266 Ga0495613_0543266_39_434 112
951 3300047319 Ga0495674_0019922 Ga0495674_0019922_3995_4390 112
952 3300050508 nmdc:mga09592_147894_c1 nmdc:mga09592_147894_c1_154_495 112
953 3300050509 nmdc:mga0qj67_23468_c1 nmdc:mga0qj67_23468_c1_2909_3250 112
954 3300050510 nmdc:mga06r32_142135_c1 nmdc:mga06r32_142135_c1_1145_1486 112
955 3300050510 nmdc:mga06r32_67531_c1 nmdc:mga06r32_67531_c1_2120_2461 112
956 2162886007 SwRhRL2b_contig_859156 SwRhRL2b_0300.00003550 113
957 3300005289 Ga0065704_10090549 Ga0065704_100905493 113
958 3300005293 Ga0065715_10520636 Ga0065715_105206362 113
959 3300005295 Ga0065707_10006030 Ga0065707_100060303 113
960 3300005328 Ga0070676_11030037 Ga0070676_110300372 113
961 3300005331 Ga0070670_100253761 Ga0070670_1002537612 113
962 3300005334 Ga0068869_100034338 Ga0068869_1000343382 113
963 3300005334 Ga0068869_100488929 Ga0068869_1004889291 113
964 3300005336 Ga0070680_100107690 Ga0070680_1001076903 113
965 3300005338 Ga0068868_100661322 Ga0068868_1006613223 113
966 3300005345 Ga0070692_10050877 Ga0070692_100508772 113
967 3300005365 Ga0070688_100216997 Ga0070688_1002169972 113
968 3300005440 Ga0070705_100145152 Ga0070705_1001451522 113
969 3300005440 Ga0070705_100610419 Ga0070705_1006104192 113
970 3300005441 Ga0070700_101219317 Ga0070700_1012193172 113
971 3300005518 Ga0070699_100078449 Ga0070699_1000784493 113
972 3300005547 Ga0070693_100066892 Ga0070693_1000668922 113
973 3300005547 Ga0070693_100160345 Ga0070693_1001603451 113
974 3300005577 Ga0068857_100175930 Ga0068857_1001759303 113
975 3300005577 Ga0068857_100415498 Ga0068857_1004154982 113
976 3300005577 Ga0068857_100503328 Ga0068857_1005033282 113
977 3300005578 Ga0068854_100341034 Ga0068854_1003410342 113
978 3300005578 Ga0068854_100416451 Ga0068854_1004164512 113
979 3300005617 Ga0068859_100167073 Ga0068859_1001670732 113
980 3300005719 Ga0068861_100726362 Ga0068861_1007263622 113
981 3300005840 Ga0068870_10006593 Ga0068870_100065934 113
982 3300005841 Ga0068863_100066935 Ga0068863_1000669352 113
983 3300005844 Ga0068862_100108122 Ga0068862_1001081222 113
984 3300005844 Ga0068862_100860043 Ga0068862_1008600432 113
985 3300005844 Ga0068862_101015777 Ga0068862_1010157772 113
986 3300005985 Ga0081539_10047406 Ga0081539_100474062 113
987 3300006852 Ga0075433_10012120 Ga0075433_100121204 113
988 3300006852 Ga0075433_10016584 Ga0075433_100165845 113
989 3300006871 Ga0075434_100490932 Ga0075434_1004909322 113
990 3300006914 Ga0075436_100025078 Ga0075436_1000250782 113
991 3300006931 Ga0097620_100167073 Ga0097620_1001670732 113
992 3300006931 Ga0097620_100633948 Ga0097620_1006339482 113
993 3300009101 Ga0105247_10462232 Ga0105247_104622322 113
994 3300009147 Ga0114129_10409043 Ga0114129_104090433 113
995 3300009147 Ga0114129_10893029 Ga0114129_108930292 113
996 3300009148 Ga0105243_10325217 Ga0105243_103252172 113
997 3300009148 Ga0105243_10583534 Ga0105243_105835342 113
998 3300009174 Ga0105241_10036247 Ga0105241_100362474 113
999 3300009174 Ga0105241_11201872 Ga0105241_112018722 113
1000 3300010375 Ga0105239_10429067 Ga0105239_104290672 113
1001 3300011119 Ga0105246_10121579 Ga0105246_101215792 113
1002 3300011119 Ga0105246_10491734 Ga0105246_104917343 113
1003 3300013100 Ga0157373_10005529 Ga0157373_100055294 113
1004 3300013102 Ga0157371_10292213 Ga0157371_102922132 113
1005 3300013306 Ga0163162_10204692 Ga0163162_102046922 113
1006 3300013308 Ga0157375_10184622 Ga0157375_101846223 113
1007 3300013308 Ga0157375_11647074 Ga0157375_116470742 113
1008 3300015265 Ga0182005_1069317 Ga0182005_10693172 113
1009 3300025908 Ga0207643_10015617 Ga0207643_100156173 113
1010 3300025911 Ga0207654_10397047 Ga0207654_103970472 113
1011 3300025917 Ga0207660_10062012 Ga0207660_100620123 113
1012 3300025918 Ga0207662_10871880 Ga0207662_108718802 113
1013 3300025923 Ga0207681_10276707 Ga0207681_102767073 113
1014 3300025935 Ga0207709_10140481 Ga0207709_101404812 113
1015 3300025935 Ga0207709_10909052 Ga0207709_109090522 113
1016 3300025936 Ga0207670_10379222 Ga0207670_103792222 113
1017 3300025942 Ga0207689_11131425 Ga0207689_111314252 113
1018 3300025981 Ga0207640_10232017 Ga0207640_102320172 113
1019 3300026035 Ga0207703_11367214 Ga0207703_113672142 113
1020 3300026075 Ga0207708_11246581 Ga0207708_112465811 113
1021 3300026088 Ga0207641_10011056 Ga0207641_100110565 113
1022 3300026095 Ga0207676_11975650 Ga0207676_119756501 113
1023 3300026116 Ga0207674_10117589 Ga0207674_101175893 113
1024 3300026116 Ga0207674_10739673 Ga0207674_107396732 113
1025 3300026118 Ga0207675_100087644 Ga0207675_1000876443 113
1026 3300026142 Ga0207698_11734898 Ga0207698_117348982 113
1027 3300027907 Ga0207428_10003819 Ga0207428_100038199 113
1028 3300028380 Ga0268265_11051038 Ga0268265_110510382 113
1029 3300028380 Ga0268265_11436928 Ga0268265_114369282 113
1030 3300030735 Ga0316178_1156890 Ga0316178_11568902 113
1031 3300031548 Ga0307408_100535709 Ga0307408_1005357092 113
1032 3300031731 Ga0307405_10054486 Ga0307405_100544861 113
1033 3300031911 Ga0307412_10488672 Ga0307412_104886722 113
1034 3300031911 Ga0307412_10664465 Ga0307412_106644651 113
1035 3300031995 Ga0307409_101004930 Ga0307409_1010049302 113
1036 3300032002 Ga0307416_100083037 Ga0307416_1000830372 113
1037 3300032002 Ga0307416_100415148 Ga0307416_1004151482 113
1038 3300032126 Ga0307415_100969160 Ga0307415_1009691602 113
1039 3300048910 Ga0496107_0414845 Ga0496107_0414845_345_689 113
1040 3300048913 Ga0496110_1104918 Ga0496110_1104918_160_510 113
1041 3300050507 nmdc:mga05p37_1473857_c1 nmdc:mga05p37_1473857_c1_187_531 113
1042 3300050507 nmdc:mga05p37_393021_c1 nmdc:mga05p37_393021_c1_947_1288 113
1043 3300050511 nmdc:mga08y16_4844_c1 nmdc:mga08y16_4844_c1_5233_5583 113
1044 3300050512 nmdc:mga0n895_49967_c1 nmdc:mga0n895_49967_c1_2800_3144 113
1045 3300050513 nmdc:mga0rr50_10870_c1 nmdc:mga0rr50_10870_c1_2915_3256 113
1046 3300050514 nmdc:mga08x19_8890_c2 nmdc:mga08x19_8890_c2_3433_3780 113
1047 3300050515 nmdc:mga0a205_23201_c1 nmdc:mga0a205_23201_c1_1455_1799 113
1048 3300050515 nmdc:mga0a205_287608_c1 nmdc:mga0a205_287608_c1_1006_1350 113
1049 3300059493 Ga0587077_106237 Ga0587077_106237_213_560 113
1050 3300001990 JGI24737J22298_10068766 JGI24737J22298_100687662 114
1051 3300003322 rootL2_10272735 rootL2_102727353 114
1052 3300005288 Ga0065714_10076656 Ga0065714_100766563 114
1053 3300005290 Ga0065712_10002629 Ga0065712_100026296 114
1054 3300005290 Ga0065712_10507318 Ga0065712_105073181 114
1055 3300005293 Ga0065715_10098309 Ga0065715_100983092 114
1056 3300005293 Ga0065715_10100912 Ga0065715_101009122 114
1057 3300005293 Ga0065715_10720190 Ga0065715_107201902 114
1058 3300005295 Ga0065707_10018320 Ga0065707_100183203 114
1059 3300005328 Ga0070676_11557249 Ga0070676_115572491 114
1060 3300005330 Ga0070690_100644009 Ga0070690_1006440092 114
1061 3300005330 Ga0070690_100885827 Ga0070690_1008858272 114
1062 3300005331 Ga0070670_100138167 Ga0070670_1001381672 114
1063 3300005333 Ga0070677_10655552 Ga0070677_106555522 114
1064 3300005334 Ga0068869_101726184 Ga0068869_1017261842 114
1065 3300005334 Ga0068869_101905403 Ga0068869_1019054031 114
1066 3300005335 Ga0070666_10645146 Ga0070666_106451462 114
1067 3300005337 Ga0070682_100003243 Ga0070682_1000032437 114
1068 3300005337 Ga0070682_100004023 Ga0070682_1000040235 114
1069 3300005338 Ga0068868_101650872 Ga0068868_1016508721 114
1070 3300005341 Ga0070691_10370922 Ga0070691_103709222 114
1071 3300005343 Ga0070687_100096543 Ga0070687_1000965433 114
1072 3300005344 Ga0070661_100268374 Ga0070661_1002683743 114
1073 3300005345 Ga0070692_10012785 Ga0070692_100127853 114
1074 3300005345 Ga0070692_10264422 Ga0070692_102644222 114
1075 3300005345 Ga0070692_10433657 Ga0070692_104336572 114
1076 3300005353 Ga0070669_100006231 Ga0070669_1000062315 114
1077 3300005354 Ga0070675_100321553 Ga0070675_1003215532 114
1078 3300005355 Ga0070671_101598815 Ga0070671_1015988152 114
1079 3300005364 Ga0070673_100100271 Ga0070673_1001002713 114
1080 3300005366 Ga0070659_100333075 Ga0070659_1003330752 114
1081 3300005406 Ga0070703_10002822 Ga0070703_100028226 114
1082 3300005438 Ga0070701_10152057 Ga0070701_101520572 114
1083 3300005438 Ga0070701_10750366 Ga0070701_107503662 114
1084 3300005440 Ga0070705_100002412 Ga0070705_1000024123 114
1085 3300005440 Ga0070705_100626372 Ga0070705_1006263722 114
1086 3300005441 Ga0070700_100019588 Ga0070700_1000195883 114
1087 3300005441 Ga0070700_100046598 Ga0070700_1000465982 114
1088 3300005444 Ga0070694_100004873 Ga0070694_1000048733 114
1089 3300005444 Ga0070694_100019668 Ga0070694_1000196683 114
1090 3300005444 Ga0070694_100221671 Ga0070694_1002216712 114
1091 3300005445 Ga0070708_100284225 Ga0070708_1002842252 114
1092 3300005458 Ga0070681_10019243 Ga0070681_100192436 114
1093 3300005458 Ga0070681_10515435 Ga0070681_105154352 114
1094 3300005458 Ga0070681_10642445 Ga0070681_106424452 114
1095 3300005459 Ga0068867_100162774 Ga0068867_1001627742 114
1096 3300005459 Ga0068867_100284480 Ga0068867_1002844803 114
1097 3300005459 Ga0068867_100850527 Ga0068867_1008505272 114
1098 3300005459 Ga0068867_101067614 Ga0068867_1010676141 114
1099 3300005459 Ga0068867_101600892 Ga0068867_1016008921 114
1100 3300005459 Ga0068867_101743219 Ga0068867_1017432191 114
1101 3300005459 Ga0068867_101761204 Ga0068867_1017612041 114
1102 3300005467 Ga0070706_100000250 Ga0070706_10000025023 114
1103 3300005471 Ga0070698_100371550 Ga0070698_1003715503 114
1104 3300005518 Ga0070699_100223394 Ga0070699_1002233941 114
1105 3300005518 Ga0070699_100388654 Ga0070699_1003886542 114
1106 3300005539 Ga0068853_100227672 Ga0068853_1002276722 114
1107 3300005539 Ga0068853_100273079 Ga0068853_1002730791 114
1108 3300005539 Ga0068853_101683413 Ga0068853_1016834131 114
1109 3300005543 Ga0070672_100446856 Ga0070672_1004468562 114
1110 3300005545 Ga0070695_100029869 Ga0070695_1000298693 114
1111 3300005545 Ga0070695_100184161 Ga0070695_1001841612 114
1112 3300005545 Ga0070695_100514629 Ga0070695_1005146292 114
1113 3300005545 Ga0070695_101199579 Ga0070695_1011995791 114
1114 3300005546 Ga0070696_101090907 Ga0070696_1010909072 114
1115 3300005546 Ga0070696_101400975 Ga0070696_1014009752 114
1116 3300005547 Ga0070693_100004656 Ga0070693_1000046564 114
1117 3300005547 Ga0070693_100042851 Ga0070693_1000428513 114
1118 3300005547 Ga0070693_100048071 Ga0070693_1000480712 114
1119 3300005547 Ga0070693_100072169 Ga0070693_1000721694 114
1120 3300005547 Ga0070693_100312656 Ga0070693_1003126563 114
1121 3300005549 Ga0070704_100057210 Ga0070704_1000572101 114
1122 3300005549 Ga0070704_100144385 Ga0070704_1001443851 114
1123 3300005563 Ga0068855_102588902 Ga0068855_1025889021 114
1124 3300005564 Ga0070664_100050050 Ga0070664_1000500503 114
1125 3300005564 Ga0070664_100511873 Ga0070664_1005118731 114
1126 3300005577 Ga0068857_100015247 Ga0068857_1000152473 114
1127 3300005577 Ga0068857_100084026 Ga0068857_1000840262 114
1128 3300005577 Ga0068857_101599633 Ga0068857_1015996331 114
1129 3300005578 Ga0068854_100587271 Ga0068854_1005872712 114
1130 3300005578 Ga0068854_102022763 Ga0068854_1020227631 114
1131 3300005615 Ga0070702_100012823 Ga0070702_1000128232 114
1132 3300005615 Ga0070702_100066498 Ga0070702_1000664982 114
1133 3300005615 Ga0070702_100070012 Ga0070702_1000700122 114
1134 3300005615 Ga0070702_100173220 Ga0070702_1001732203 114
1135 3300005616 Ga0068852_101075634 Ga0068852_1010756341 114
1136 3300005617 Ga0068859_100053033 Ga0068859_1000530333 114
1137 3300005617 Ga0068859_100103711 Ga0068859_1001037112 114
1138 3300005617 Ga0068859_100132806 Ga0068859_1001328062 114
1139 3300005617 Ga0068859_100294539 Ga0068859_1002945392 114
1140 3300005617 Ga0068859_100380124 Ga0068859_1003801242 114
1141 3300005617 Ga0068859_100401164 Ga0068859_1004011643 114
1142 3300005617 Ga0068859_100563704 Ga0068859_1005637042 114
1143 3300005617 Ga0068859_101080701 Ga0068859_1010807012 114
1144 3300005617 Ga0068859_102143208 Ga0068859_1021432082 114
1145 3300005618 Ga0068864_100067551 Ga0068864_1000675514 114
1146 3300005618 Ga0068864_101054402 Ga0068864_1010544022 114
1147 3300005719 Ga0068861_100312655 Ga0068861_1003126551 114
1148 3300005834 Ga0068851_10001358 Ga0068851_100013588 114
1149 3300005840 Ga0068870_10011207 Ga0068870_100112072 114
1150 3300005840 Ga0068870_10105110 Ga0068870_101051102 114
1151 3300005840 Ga0068870_10268254 Ga0068870_102682541 114
1152 3300005841 Ga0068863_100012454 Ga0068863_1000124543 114
1153 3300005841 Ga0068863_100048330 Ga0068863_1000483303 114
1154 3300005841 Ga0068863_100891448 Ga0068863_1008914482 114
1155 3300005841 Ga0068863_101786968 Ga0068863_1017869682 114
1156 3300005842 Ga0068858_100486278 Ga0068858_1004862782 114
1157 3300005842 Ga0068858_100910523 Ga0068858_1009105232 114
1158 3300005842 Ga0068858_102391757 Ga0068858_1023917572 114
1159 3300005843 Ga0068860_100074625 Ga0068860_1000746253 114
1160 3300005843 Ga0068860_100498043 Ga0068860_1004980432 114
1161 3300005843 Ga0068860_100542151 Ga0068860_1005421512 114
1162 3300006058 Ga0075432_10445350 Ga0075432_104453502 114
1163 3300006173 Ga0070716_100006865 Ga0070716_1000068657 114
1164 3300006173 Ga0070716_100283473 Ga0070716_1002834733 114
1165 3300006175 Ga0070712_100438752 Ga0070712_1004387523 114
1166 3300006237 Ga0097621_100284772 Ga0097621_1002847723 114
1167 3300006358 Ga0068871_100010219 Ga0068871_1000102197 114
1168 3300006358 Ga0068871_100069801 Ga0068871_1000698013 114
1169 3300006844 Ga0075428_100139696 Ga0075428_1001396963 114
1170 3300006847 Ga0075431_100035491 Ga0075431_1000354913 114
1171 3300006852 Ga0075433_10019978 Ga0075433_100199785 114
1172 3300006852 Ga0075433_10043066 Ga0075433_100430663 114
1173 3300006871 Ga0075434_100024652 Ga0075434_1000246525 114
1174 3300006880 Ga0075429_100496837 Ga0075429_1004968372 114
1175 3300006931 Ga0097620_100053034 Ga0097620_1000530343 114
1176 3300006931 Ga0097620_100103701 Ga0097620_1001037013 114
1177 3300006931 Ga0097620_100132805 Ga0097620_1001328052 114
1178 3300006931 Ga0097620_100294552 Ga0097620_1002945522 114
1179 3300006931 Ga0097620_100380135 Ga0097620_1003801352 114
1180 3300006931 Ga0097620_100401202 Ga0097620_1004012023 114
1181 3300006931 Ga0097620_100563653 Ga0097620_1005636532 114
1182 3300006931 Ga0097620_101080817 Ga0097620_1010808172 114
1183 3300006931 Ga0097620_102143148 Ga0097620_1021431482 114
1184 3300009011 Ga0105251_10218149 Ga0105251_102181492 114
1185 3300009011 Ga0105251_10345093 Ga0105251_103450932 114
1186 3300009011 Ga0105251_10488431 Ga0105251_104884311 114
1187 3300009093 Ga0105240_10034031 Ga0105240_100340314 114
1188 3300009093 Ga0105240_11824021 Ga0105240_118240211 114
1189 3300009094 Ga0111539_10098755 Ga0111539_100987551 114
1190 3300009098 Ga0105245_10984089 Ga0105245_109840892 114
1191 3300009098 Ga0105245_12516065 Ga0105245_125160651 114
1192 3300009101 Ga0105247_10022526 Ga0105247_100225262 114
1193 3300009101 Ga0105247_10087475 Ga0105247_100874752 114
1194 3300009101 Ga0105247_10651063 Ga0105247_106510632 114
1195 3300009147 Ga0114129_10028076 Ga0114129_100280763 114
1196 3300009147 Ga0114129_12438319 Ga0114129_124383192 114
1197 3300009148 Ga0105243_10083569 Ga0105243_100835692 114
1198 3300009148 Ga0105243_10165738 Ga0105243_101657382 114
1199 3300009148 Ga0105243_10206265 Ga0105243_102062652 114
1200 3300009148 Ga0105243_11900037 Ga0105243_119000372 114
1201 3300009174 Ga0105241_10066355 Ga0105241_100663553 114
1202 3300009174 Ga0105241_10100939 Ga0105241_101009392 114
1203 3300009174 Ga0105241_10259041 Ga0105241_102590412 114
1204 3300009174 Ga0105241_10437316 Ga0105241_104373162 114
1205 3300009174 Ga0105241_10783109 Ga0105241_107831092 114
1206 3300009174 Ga0105241_11242018 Ga0105241_112420182 114
1207 3300009174 Ga0105241_11371373 Ga0105241_113713731 114
1208 3300009176 Ga0105242_10039349 Ga0105242_100393493 114
1209 3300009176 Ga0105242_10226434 Ga0105242_102264342 114
1210 3300009176 Ga0105242_10289648 Ga0105242_102896483 114
1211 3300009176 Ga0105242_11749764 Ga0105242_117497642 114
1212 3300009177 Ga0105248_10007159 Ga0105248_100071595 114
1213 3300009177 Ga0105248_10162973 Ga0105248_101629733 114
1214 3300009177 Ga0105248_10165652 Ga0105248_101656522 114
1215 3300009177 Ga0105248_10541889 Ga0105248_105418892 114
1216 3300009177 Ga0105248_10967744 Ga0105248_109677442 114
1217 3300009545 Ga0105237_10000199 Ga0105237_100001997 114
1218 3300009551 Ga0105238_10371069 Ga0105238_103710692 114
1219 3300009551 Ga0105238_10885960 Ga0105238_108859602 114
1220 3300009551 Ga0105238_11217588 Ga0105238_112175882 114
1221 3300009551 Ga0105238_11405881 Ga0105238_114058811 114
1222 3300009553 Ga0105249_10026072 Ga0105249_100260721 114
1223 3300009553 Ga0105249_11336763 Ga0105249_113367632 114
1224 3300010375 Ga0105239_10757128 Ga0105239_107571282 114
1225 3300010375 Ga0105239_11045922 Ga0105239_110459221 114
1226 3300011119 Ga0105246_10056903 Ga0105246_100569032 114
1227 3300011119 Ga0105246_10103030 Ga0105246_101030303 114
1228 3300013100 Ga0157373_10688777 Ga0157373_106887771 114
1229 3300013100 Ga0157373_10855604 Ga0157373_108556042 114
1230 3300013100 Ga0157373_10987687 Ga0157373_109876872 114
1231 3300013296 Ga0157374_10821593 Ga0157374_108215932 114
1232 3300013297 Ga0157378_10332340 Ga0157378_103323402 114
1233 3300013306 Ga0163162_10640359 Ga0163162_106403592 114
1234 3300013307 Ga0157372_10033757 Ga0157372_100337574 114
1235 3300013307 Ga0157372_10928710 Ga0157372_109287102 114
1236 3300013308 Ga0157375_10063629 Ga0157375_100636292 114
1237 3300013308 Ga0157375_11547612 Ga0157375_115476122 114
1238 3300014325 Ga0163163_10386954 Ga0163163_103869542 114
1239 3300014325 Ga0163163_10681317 Ga0163163_106813172 114
1240 3300014745 Ga0157377_10110423 Ga0157377_101104232 114
1241 3300014968 Ga0157379_10041034 Ga0157379_100410342 114
1242 3300015265 Ga0182005_1226343 Ga0182005_12263432 114
1243 3300025315 Ga0207697_10246407 Ga0207697_102464072 114
1244 3300025321 Ga0207656_10001285 Ga0207656_100012855 114
1245 3300025885 Ga0207653_10008038 Ga0207653_100080383 114
1246 3300025900 Ga0207710_10224905 Ga0207710_102249052 114
1247 3300025904 Ga0207647_10039267 Ga0207647_100392672 114
1248 3300025904 Ga0207647_10100743 Ga0207647_101007432 114
1249 3300025904 Ga0207647_10435298 Ga0207647_104352982 114
1250 3300025908 Ga0207643_10009386 Ga0207643_100093862 114
1251 3300025910 Ga0207684_10000093 Ga0207684_1000009323 114
1252 3300025911 Ga0207654_10030858 Ga0207654_100308583 114
1253 3300025911 Ga0207654_10033202 Ga0207654_100332022 114
1254 3300025911 Ga0207654_10193335 Ga0207654_101933352 114
1255 3300025912 Ga0207707_10549170 Ga0207707_105491701 114
1256 3300025913 Ga0207695_10351958 Ga0207695_103519582 114
1257 3300025914 Ga0207671_10009579 Ga0207671_100095793 114
1258 3300025917 Ga0207660_11299572 Ga0207660_112995721 114
1259 3300025918 Ga0207662_10180372 Ga0207662_101803722 114
1260 3300025923 Ga0207681_10008337 Ga0207681_100083374 114
1261 3300025924 Ga0207694_10883458 Ga0207694_108834582 114
1262 3300025925 Ga0207650_10076903 Ga0207650_100769033 114
1263 3300025925 Ga0207650_11217278 Ga0207650_112172782 114
1264 3300025927 Ga0207687_11933906 Ga0207687_119339061 114
1265 3300025931 Ga0207644_11818946 Ga0207644_118189462 114
1266 3300025932 Ga0207690_10295129 Ga0207690_102951292 114
1267 3300025933 Ga0207706_10643447 Ga0207706_106434472 114
1268 3300025933 Ga0207706_11720772 Ga0207706_117207721 114
1269 3300025934 Ga0207686_10118681 Ga0207686_101186812 114
1270 3300025935 Ga0207709_10020878 Ga0207709_100208782 114
1271 3300025935 Ga0207709_10465775 Ga0207709_104657752 114
1272 3300025935 Ga0207709_10556024 Ga0207709_105560242 114
1273 3300025936 Ga0207670_10002947 Ga0207670_100029475 114
1274 3300025936 Ga0207670_10309892 Ga0207670_103098922 114
1275 3300025939 Ga0207665_10159013 Ga0207665_101590132 114
1276 3300025940 Ga0207691_10916000 Ga0207691_109160002 114
1277 3300025941 Ga0207711_10023161 Ga0207711_100231612 114
1278 3300025941 Ga0207711_10280547 Ga0207711_102805472 114
1279 3300025941 Ga0207711_10310859 Ga0207711_103108592 114
1280 3300025941 Ga0207711_11132236 Ga0207711_111322361 114
1281 3300025942 Ga0207689_10082032 Ga0207689_100820323 114
1282 3300025942 Ga0207689_10341305 Ga0207689_103413052 114
1283 3300025942 Ga0207689_11232138 Ga0207689_112321382 114
1284 3300025945 Ga0207679_10188536 Ga0207679_101885363 114
1285 3300025945 Ga0207679_10193396 Ga0207679_101933963 114
1286 3300025945 Ga0207679_10764036 Ga0207679_107640363 114
1287 3300025945 Ga0207679_11898487 Ga0207679_118984872 114
1288 3300025960 Ga0207651_10382519 Ga0207651_103825191 114
1289 3300025960 Ga0207651_10417887 Ga0207651_104178872 114
1290 3300025961 Ga0207712_10016699 Ga0207712_100166994 114
1291 3300025981 Ga0207640_10104686 Ga0207640_101046863 114
1292 3300026023 Ga0207677_11085731 Ga0207677_110857312 114
1293 3300026035 Ga0207703_10048207 Ga0207703_100482072 114
1294 3300026035 Ga0207703_10053925 Ga0207703_100539252 114
1295 3300026035 Ga0207703_10209739 Ga0207703_102097392 114
1296 3300026035 Ga0207703_12196833 Ga0207703_121968331 114
1297 3300026041 Ga0207639_10058308 Ga0207639_100583083 114
1298 3300026041 Ga0207639_11421490 Ga0207639_114214902 114
1299 3300026075 Ga0207708_10024121 Ga0207708_100241212 114
1300 3300026075 Ga0207708_10029346 Ga0207708_100293464 114
1301 3300026075 Ga0207708_10147408 Ga0207708_101474083 114
1302 3300026088 Ga0207641_10013347 Ga0207641_100133473 114
1303 3300026088 Ga0207641_10111021 Ga0207641_101110213 114
1304 3300026088 Ga0207641_10161411 Ga0207641_101614113 114
1305 3300026088 Ga0207641_10367804 Ga0207641_103678042 114
1306 3300026089 Ga0207648_10248278 Ga0207648_102482782 114
1307 3300026089 Ga0207648_10293272 Ga0207648_102932722 114
1308 3300026089 Ga0207648_10729582 Ga0207648_107295822 114
1309 3300026089 Ga0207648_10984519 Ga0207648_109845192 114
1310 3300026095 Ga0207676_10050400 Ga0207676_100504004 114
1311 3300026095 Ga0207676_10987657 Ga0207676_109876572 114
1312 3300026116 Ga0207674_10024472 Ga0207674_100244727 114
1313 3300026116 Ga0207674_10093324 Ga0207674_100933243 114
1314 3300026116 Ga0207674_10774523 Ga0207674_107745232 114
1315 3300026116 Ga0207674_11728298 Ga0207674_117282982 114
1316 3300026118 Ga0207675_100111996 Ga0207675_1001119962 114
1317 3300028380 Ga0268265_10530708 Ga0268265_105307082 114
1318 3300028381 Ga0268264_10016633 Ga0268264_100166333 114
1319 3300028381 Ga0268264_10419794 Ga0268264_104197942 114
1320 3300028381 Ga0268264_10761805 Ga0268264_107618052 114
1321 3300031548 Ga0307408_100021160 Ga0307408_1000211602 114
1322 3300031548 Ga0307408_100069176 Ga0307408_1000691763 114
1323 3300031548 Ga0307408_100698352 Ga0307408_1006983521 114
1324 3300031731 Ga0307405_10004763 Ga0307405_100047633 114
1325 3300031824 Ga0307413_11170962 Ga0307413_111709621 114
1326 3300031852 Ga0307410_10507227 Ga0307410_105072273 114
1327 3300031901 Ga0307406_10012174 Ga0307406_100121744 114
1328 3300031903 Ga0307407_10818869 Ga0307407_108188692 114
1329 3300031911 Ga0307412_10006276 Ga0307412_100062763 114
1330 3300032002 Ga0307416_100004668 Ga0307416_1000046682 114
1331 3300032002 Ga0307416_100248270 Ga0307416_1002482703 114
1332 3300032004 Ga0307414_10001159 Ga0307414_100011595 114
1333 3300032004 Ga0307414_10037715 Ga0307414_100377152 114
1334 3300032005 Ga0307411_10162139 Ga0307411_101621392 114
1335 3300032005 Ga0307411_10384682 Ga0307411_103846822 114
1336 3300032005 Ga0307411_12296398 Ga0307411_122963982 114
1337 3300032126 Ga0307415_100002653 Ga0307415_1000026533 114
1338 3300034817 Ga0373948_0164300 Ga0373948_0164300_114_461 114
1339 3300035088 Ga0373940_0005965 Ga0373940_0005965_419_766 114
1340 3300035091 Ga0373951_0115113 Ga0373951_0115113_183_530 114
1341 3300035115 Ga0373941_0013686 Ga0373941_0013686_226_573 114
1342 3300035691 Ga0373931_0369809 Ga0373931_0369809_451_804 114
1343 3300038443 Ga0395901_0577963 Ga0395901_0577963_482_826 114
1344 3300042002 Ga0439442_079128 Ga0439442_079128_336_686 114
1345 3300042005 Ga0439448_0053476 Ga0439448_0053476_715_1062 114
1346 3300042012 Ga0439455_0015377 Ga0439455_0015377_673_1020 114
1347 3300042157 Ga0439458_0003739 Ga0439458_0003739_1724_2071 114
1348 3300045051 Ga0451576_1896340 Ga0451576_1896340_173_520 114
1349 3300046616 Ga0495668_0298746 Ga0495668_0298746_347_694 114
1350 3300048909 Ga0496106_1079298 Ga0496106_1079298_246_599 114
1351 3300048915 Ga0496112_0309976 Ga0496112_0309976_647_1000 114
1352 3300048915 Ga0496112_0317644 Ga0496112_0317644_397_744 114
1353 3300048916 Ga0496113_0350063 Ga0496113_0350063_323_673 114
1354 3300048916 Ga0496113_0697352 Ga0496113_0697352_82_429 114
1355 3300049515 Ga0501292_049371 Ga0501292_049371_210_557 114
1356 3300049519 Ga0501296_002599 Ga0501296_002599_970_1317 114
1357 3300049520 Ga0501297_027139 Ga0501297_027139_270_617 114
1358 3300049521 Ga0501298_009993 Ga0501298_009993_697_1044 114
1359 3300049522 Ga0501299_001927 Ga0501299_001927_1855_2199 114
1360 3300049522 Ga0501299_002643 Ga0501299_002643_249_596 114
1361 3300049522 Ga0501299_007922 Ga0501299_007922_1158_1505 114
1362 3300049649 Ga0501198_000725 Ga0501198_000725_1208_1555 114
1363 3300049649 Ga0501198_018223 Ga0501198_018223_205_552 114
1364 3300049650 Ga0501199_003118 Ga0501199_003118_13_360 114
1365 3300049652 Ga0501202_000490 Ga0501202_000490_2121_2468 114
1366 3300049652 Ga0501202_002846 Ga0501202_002846_197_544 114
1367 3300049652 Ga0501202_005152 Ga0501202_005152_1749_2093 114
1368 3300049652 Ga0501202_015908 Ga0501202_015908_159_506 114
1369 3300049653 Ga0501206_006644 Ga0501206_006644_91_435 114
1370 3300049653 Ga0501206_015603 Ga0501206_015603_89_436 114
1371 3300049654 Ga0501207_000218 Ga0501207_000218_2597_2944 114
1372 3300049654 Ga0501207_025977 Ga0501207_025977_340_684 114
1373 3300049655 Ga0501208_000649 Ga0501208_000649_1597_1944 114
1374 3300049656 Ga0501209_005521 Ga0501209_005521_1740_2087 114
1375 3300049659 Ga0501214_064639 Ga0501214_064639_21_368 114
1376 3300049660 Ga0501216_001646 Ga0501216_001646_1644_1988 114
1377 3300049660 Ga0501216_054183 Ga0501216_054183_190_537 114
1378 3300049661 Ga0501217_001280 Ga0501217_001280_502_849 114
1379 3300049661 Ga0501217_002256 Ga0501217_002256_1445_1792 114
1380 3300049663 Ga0501223_002735 Ga0501223_002735_266_613 114
1381 3300049663 Ga0501223_020003 Ga0501223_020003_190_537 114
1382 3300049664 Ga0501224_006602 Ga0501224_006602_55_402 114
1383 3300049665 Ga0501227_001046 Ga0501227_001046_5784_6131 114
1384 3300049665 Ga0501227_012440 Ga0501227_012440_235_579 114
1385 3300049667 Ga0501230_001599 Ga0501230_001599_1763_2110 114
1386 3300049668 Ga0501233_000236 Ga0501233_000236_2311_2658 114
1387 3300049669 Ga0501235_000935 Ga0501235_000935_3257_3604 114
1388 3300049669 Ga0501235_005364 Ga0501235_005364_1595_1942 114
1389 3300049669 Ga0501235_007593 Ga0501235_007593_1314_1661 114
1390 3300049669 Ga0501235_037396 Ga0501235_037396_512_856 114
1391 3300049673 Ga0501240_000663 Ga0501240_000663_42_389 114
1392 3300049675 Ga0501243_016172 Ga0501243_016172_324_671 114
1393 3300049675 Ga0501243_026823 Ga0501243_026823_154_498 114
1394 3300049675 Ga0501243_067980 Ga0501243_067980_129_476 114
1395 3300049679 Ga0501249_029098 Ga0501249_029098_420_767 114
1396 3300049681 Ga0501251_003043 Ga0501251_003043_183_527 114
1397 3300049682 Ga0501252_075629 Ga0501252_075629_38_382 114
1398 3300049683 Ga0501253_001873 Ga0501253_001873_275_622 114
1399 3300049683 Ga0501253_002458 Ga0501253_002458_602_946 114
1400 3300049684 Ga0501255_004194 Ga0501255_004194_919_1266 114
1401 3300049686 Ga0501257_000868 Ga0501257_000868_4163_4507 114
1402 3300049686 Ga0501257_023587 Ga0501257_023587_316_663 114
1403 3300049686 Ga0501257_025056 Ga0501257_025056_814_1161 114
1404 3300049689 Ga0501260_011517 Ga0501260_011517_158_505 114
1405 3300049690 Ga0501261_003997 Ga0501261_003997_787_1134 114
1406 3300049705 Ga0501225_0000779 Ga0501225_0000779_5713_6060 114
1407 3300049705 Ga0501225_0025582 Ga0501225_0025582_70_417 114
1408 3300049705 Ga0501225_0038757 Ga0501225_0038757_552_899 114
1409 3300049707 Ga0501234_000381 Ga0501234_000381_3776_4123 114
1410 3300049707 Ga0501234_011342 Ga0501234_011342_814_1161 114
1411 3300049708 Ga0501245_002079 Ga0501245_002079_406_750 114
1412 3300049763 Ga0501266_006165 Ga0501266_006165_787_1134 114
1413 3300049765 Ga0501268_011857 Ga0501268_011857_688_1032 114
1414 3300049765 Ga0501268_126746 Ga0501268_126746_202_549 114
1415 3300049775 Ga0501279_107255 Ga0501279_107255_144_488 114
1416 3300049779 Ga0501283_032281 Ga0501283_032281_38_382 114
1417 3300049850 Ga0501204_002772 Ga0501204_002772_224_568 114
1418 3300049850 Ga0501204_003700 Ga0501204_003700_1146_1493 114
1419 3300049851 Ga0501212_011399 Ga0501212_011399_235_579 114
1420 3300050507 nmdc:mga05p37_1104784_c1 nmdc:mga05p37_1104784_c1_169_516 114
1421 3300050507 nmdc:mga05p37_569548_c1 nmdc:mga05p37_569548_c1_71_415 114
1422 3300050507 nmdc:mga05p37_82279_c1 nmdc:mga05p37_82279_c1_2835_3182 114
1423 3300050508 nmdc:mga09592_297543_c1 nmdc:mga09592_297543_c1_542_889 114
1424 3300050510 nmdc:mga06r32_771142_c1 nmdc:mga06r32_771142_c1_553_900 114
1425 3300050512 nmdc:mga0n895_655061_c1 nmdc:mga0n895_655061_c1_498_845 114
1426 3300050515 nmdc:mga0a205_672085_c1 nmdc:mga0a205_672085_c1_361_708 114
1427 2162886006 SwRhRL3b_contig_4028819 SwRhRL3b_0524.00001480 115
1428 3300005289 Ga0065704_10102668 Ga0065704_101026683 115
1429 3300005293 Ga0065715_10402779 Ga0065715_104027792 115
1430 3300005293 Ga0065715_10649427 Ga0065715_106494272 115
1431 3300005295 Ga0065707_10003692 Ga0065707_100036922 115
1432 3300005331 Ga0070670_100339317 Ga0070670_1003393172 115
1433 3300005440 Ga0070705_100153628 Ga0070705_1001536282 115
1434 3300005441 Ga0070700_100004564 Ga0070700_1000045644 115
1435 3300005441 Ga0070700_101771090 Ga0070700_1017710901 115
1436 3300005444 Ga0070694_100229535 Ga0070694_1002295353 115
1437 3300005444 Ga0070694_100491006 Ga0070694_1004910062 115
1438 3300005458 Ga0070681_10006697 Ga0070681_100066974 115
1439 3300005539 Ga0068853_101549870 Ga0068853_1015498701 115
1440 3300005546 Ga0070696_100078684 Ga0070696_1000786843 115
1441 3300005547 Ga0070693_101333460 Ga0070693_1013334601 115
1442 3300005549 Ga0070704_100122341 Ga0070704_1001223413 115
1443 3300005578 Ga0068854_101031413 Ga0068854_1010314132 115
1444 3300005614 Ga0068856_100191809 Ga0068856_1001918093 115
1445 3300005617 Ga0068859_100010723 Ga0068859_1000107234 115
1446 3300005618 Ga0068864_100006038 Ga0068864_1000060385 115
1447 3300005618 Ga0068864_100402774 Ga0068864_1004027742 115
1448 3300005840 Ga0068870_10061387 Ga0068870_100613872 115
1449 3300006852 Ga0075433_10041993 Ga0075433_100419933 115
1450 3300006871 Ga0075434_100046671 Ga0075434_1000466713 115
1451 3300006931 Ga0097620_100010723 Ga0097620_1000107237 115
1452 3300007076 Ga0075435_100938015 Ga0075435_1009380152 115
1453 3300009093 Ga0105240_10385766 Ga0105240_103857663 115
1454 3300009148 Ga0105243_11375570 Ga0105243_113755702 115
1455 3300009174 Ga0105241_10165285 Ga0105241_101652853 115
1456 3300009174 Ga0105241_11888218 Ga0105241_118882182 115
1457 3300009177 Ga0105248_10001687 Ga0105248_1000168714 115
1458 3300009545 Ga0105237_10034465 Ga0105237_100344653 115
1459 3300011119 Ga0105246_10253466 Ga0105246_102534662 115
1460 3300014325 Ga0163163_10013740 Ga0163163_100137404 115
1461 3300025908 Ga0207643_10054092 Ga0207643_100540925 115
1462 3300025911 Ga0207654_11182204 Ga0207654_111822042 115
1463 3300025912 Ga0207707_10071835 Ga0207707_100718352 115
1464 3300025913 Ga0207695_10112749 Ga0207695_101127492 115
1465 3300025935 Ga0207709_10255958 Ga0207709_102559582 115
1466 3300025941 Ga0207711_10013418 Ga0207711_100134182 115
1467 3300026041 Ga0207639_11415595 Ga0207639_114155952 115
1468 3300026075 Ga0207708_10000031 Ga0207708_1000003185 115
1469 3300026088 Ga0207641_10313293 Ga0207641_103132932 115
1470 3300026088 Ga0207641_10317289 Ga0207641_103172892 115
1471 3300026095 Ga0207676_11080994 Ga0207676_110809941 115
1472 3300026116 Ga0207674_10256618 Ga0207674_102566182 115
1473 3300037418 Ga0395900_1434654 Ga0395900_1434654_235_588 115
1474 3300037466 Ga0395898_1023159 Ga0395898_1023159_370_723 115
1475 3300038443 Ga0395901_0167038 Ga0395901_0167038_579_932 115
1476 3300045051 Ga0451576_0216108 Ga0451576_0216108_1274_1624 115
1477 3300049679 Ga0501249_103909 Ga0501249_103909_73_420 115
1478 3300049708 Ga0501245_065539 Ga0501245_065539_16_363 115
1479 3300049770 Ga0501273_071509 Ga0501273_071509_163_510 115
1480 3300050512 nmdc:mga0n895_84854_c1 nmdc:mga0n895_84854_c1_2056_2406 115
1481 3300050513 nmdc:mga0rr50_901041_c1 nmdc:mga0rr50_901041_c1_254_604 115
1482 3300050515 nmdc:mga0a205_32605_c1 nmdc:mga0a205_32605_c1_681_1031 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

44

125

0.98

Feature Viewer

pLDDT pTM Quality
60.27 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map