F494285
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1482 | 474 | 1482 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300050494|nmdc:mga06z11_131389_c1|nmdc:mga06z11_131389_c1_131_544 |
| Length | 137 |
| Sequence | VGSGWSEEGELMAALAKKPHEAQDGRLDGNDGNTASDLGFYDLRLYVAGQTPKSMTAFANLKRICEEHLAGQYRIEVIDLLKEPQLARGDQILALPTLVRKLPEPIKKIIGDLSNTERTLVGLDLRPRVARDGDGDM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 228 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 282 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 283 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 284 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 285 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 377 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 379 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 404 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 405 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 406 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 407 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 408 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 409 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 410 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 411 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 412 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 413 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 414 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 416 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 417 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 418 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 419 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 420 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 421 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 422 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 425 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 426 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 427 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 429 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 430 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 431 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 432 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 437 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 438 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 439 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 440 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 441 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 445 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 446 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 449 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 463 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 464 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 466 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 468 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 470 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 471 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.82 |
| Nodule | 0.07 |
| Rhizoplane | 2.02 |
| Rhizosphere | 94.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_4028819 | 2162886006 | Unclassified | 921 |
| 2 | SwRhRL2b_contig_859156 | 2162886007 | Bacteria | 1669 |
| 3 | MBSR1b_contig_5926467 | 2162886012 | Bacteria | 1770 |
| 4 | JGI24737J22298_10068766 | 3300001990 | Bacteria | 1059 |
| 5 | JGI25152J39213_1000688 | 3300002773 | Bacteria | 17638 |
| 6 | JGI25150J39212_1000029 | 3300002774 | Bacteria | 103974 |
| 7 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 8 | JGI25153J46596_10000111 | 3300003215 | Bacteria | 92915 |
| 9 | rootL2_10272735 | 3300003322 | Bacteria | 1248 |
| 10 | rootH1_10274450 | 3300003323 | Bacteria | 2588 |
| 11 | Ga0058861_11747774 | 3300004800 | Bacteria | 2318 |
| 12 | Ga0065714_10076656 | 3300005288 | Bacteria | 2769 |
| 13 | Ga0065704_10090549 | 3300005289 | Bacteria | 2774 |
| 14 | Ga0065704_10102668 | 3300005289 | Unclassified | 2193 |
| 15 | Ga0065704_10144240 | 3300005289 | Unclassified | 1488 |
| 16 | Ga0065712_10002629 | 3300005290 | Unclassified | 4414 |
| 17 | Ga0065712_10507318 | 3300005290 | Unclassified | 645 |
| 18 | Ga0065715_10029450 | 3300005293 | Bacteria | 1192 |
| 19 | Ga0065715_10098309 | 3300005293 | Unclassified | 3566 |
| 20 | Ga0065715_10100912 | 3300005293 | Bacteria | 3256 |
| 21 | Ga0065715_10402779 | 3300005293 | Unclassified | 879 |
| 22 | Ga0065715_10520636 | 3300005293 | Unclassified | 764 |
| 23 | Ga0065715_10649427 | 3300005293 | Unclassified | 679 |
| 24 | Ga0065715_10720190 | 3300005293 | Unclassified | 638 |
| 25 | Ga0065707_10003692 | 3300005295 | Unclassified | 3602 |
| 26 | Ga0065707_10006030 | 3300005295 | Bacteria | 4774 |
| 27 | Ga0065707_10018320 | 3300005295 | Bacteria | 2240 |
| 28 | Ga0070658_10438120 | 3300005327 | Bacteria | 1125 |
| 29 | Ga0070658_10817412 | 3300005327 | Bacteria | 810 |
| 30 | Ga0070676_11030037 | 3300005328 | Bacteria | 619 |
| 31 | Ga0070676_11557249 | 3300005328 | Unclassified | 510 |
| 32 | Ga0070683_100173834 | 3300005329 | Bacteria | 2045 |
| 33 | Ga0070683_100516004 | 3300005329 | Unclassified | 1142 |
| 34 | Ga0070683_102347483 | 3300005329 | Bacteria | 511 |
| 35 | Ga0070690_100051342 | 3300005330 | Unclassified | 2632 |
| 36 | Ga0070690_100077793 | 3300005330 | Bacteria | 2166 |
| 37 | Ga0070690_100644009 | 3300005330 | Bacteria | 809 |
| 38 | Ga0070690_100885827 | 3300005330 | Unclassified | 697 |
| 39 | Ga0070670_100138167 | 3300005331 | Bacteria | 2106 |
| 40 | Ga0070670_100253761 | 3300005331 | Bacteria | 1532 |
| 41 | Ga0070670_100339317 | 3300005331 | Bacteria | 1319 |
| 42 | Ga0070670_100522332 | 3300005331 | Unclassified | 1057 |
| 43 | Ga0070670_101254211 | 3300005331 | Unclassified | 678 |
| 44 | Ga0070677_10027751 | 3300005333 | Bacteria | 2134 |
| 45 | Ga0070677_10655552 | 3300005333 | Unclassified | 587 |
| 46 | Ga0068869_100034338 | 3300005334 | Bacteria | 3587 |
| 47 | Ga0068869_100488929 | 3300005334 | Unclassified | 1026 |
| 48 | Ga0068869_100615077 | 3300005334 | Bacteria | 919 |
| 49 | Ga0068869_100618833 | 3300005334 | Bacteria | 916 |
| 50 | Ga0068869_101726184 | 3300005334 | Unclassified | 559 |
| 51 | Ga0068869_101905403 | 3300005334 | Unclassified | 533 |
| 52 | Ga0070666_10046823 | 3300005335 | Bacteria | 2902 |
| 53 | Ga0070666_10160492 | 3300005335 | Unclassified | 1571 |
| 54 | Ga0070666_10340793 | 3300005335 | Bacteria | 1071 |
| 55 | Ga0070666_10533187 | 3300005335 | Bacteria | 853 |
| 56 | Ga0070666_10645146 | 3300005335 | Unclassified | 774 |
| 57 | Ga0070666_11390719 | 3300005335 | Unclassified | 524 |
| 58 | Ga0070680_100107690 | 3300005336 | Bacteria | 2318 |
| 59 | Ga0070682_100003243 | 3300005337 | Bacteria | 9028 |
| 60 | Ga0070682_100004023 | 3300005337 | Bacteria | 8169 |
| 61 | Ga0070682_100007313 | 3300005337 | Bacteria | 6227 |
| 62 | Ga0070682_100519050 | 3300005337 | Unclassified | 926 |
| 63 | Ga0068868_100012556 | 3300005338 | Bacteria | 6194 |
| 64 | Ga0068868_100661322 | 3300005338 | Unclassified | 931 |
| 65 | Ga0068868_100770503 | 3300005338 | Bacteria | 866 |
| 66 | Ga0068868_101650872 | 3300005338 | Unclassified | 603 |
| 67 | Ga0070660_100108132 | 3300005339 | Unclassified | 2210 |
| 68 | Ga0070660_100189137 | 3300005339 | Bacteria | 1667 |
| 69 | Ga0070660_100319579 | 3300005339 | Unclassified | 1275 |
| 70 | Ga0070689_100042806 | 3300005340 | Bacteria | 3478 |
| 71 | Ga0070689_100125393 | 3300005340 | Bacteria | 2054 |
| 72 | Ga0070689_100149304 | 3300005340 | Bacteria | 1884 |
| 73 | Ga0070689_100265605 | 3300005340 | Bacteria | 1419 |
| 74 | Ga0070689_100410462 | 3300005340 | Unclassified | 1146 |
| 75 | Ga0070689_101036632 | 3300005340 | Bacteria | 731 |
| 76 | Ga0070689_101501104 | 3300005340 | Unclassified | 610 |
| 77 | Ga0070691_10194282 | 3300005341 | Bacteria | 1063 |
| 78 | Ga0070691_10370922 | 3300005341 | Bacteria | 800 |
| 79 | Ga0070687_100096543 | 3300005343 | Unclassified | 1646 |
| 80 | Ga0070687_101495390 | 3300005343 | Unclassified | 507 |
| 81 | Ga0070661_100268374 | 3300005344 | Unclassified | 1321 |
| 82 | Ga0070692_10012785 | 3300005345 | Bacteria | 3898 |
| 83 | Ga0070692_10013264 | 3300005345 | Bacteria | 3838 |
| 84 | Ga0070692_10050877 | 3300005345 | Bacteria | 2153 |
| 85 | Ga0070692_10264422 | 3300005345 | Unclassified | 1035 |
| 86 | Ga0070692_10337572 | 3300005345 | Bacteria | 932 |
| 87 | Ga0070692_10433657 | 3300005345 | Bacteria | 837 |
| 88 | Ga0070692_10487586 | 3300005345 | Unclassified | 796 |
| 89 | Ga0070668_100406092 | 3300005347 | Bacteria | 1164 |
| 90 | Ga0070669_100006231 | 3300005353 | Bacteria | 8614 |
| 91 | Ga0070675_100041913 | 3300005354 | Unclassified | 3739 |
| 92 | Ga0070675_100321553 | 3300005354 | Bacteria | 1367 |
| 93 | Ga0070675_101555855 | 3300005354 | Unclassified | 610 |
| 94 | Ga0070675_102142719 | 3300005354 | Bacteria | 515 |
| 95 | Ga0070671_100060167 | 3300005355 | Bacteria | 3162 |
| 96 | Ga0070671_100269878 | 3300005355 | Unclassified | 1446 |
| 97 | Ga0070671_100362852 | 3300005355 | Bacteria | 1237 |
| 98 | Ga0070671_100677124 | 3300005355 | Unclassified | 894 |
| 99 | Ga0070671_101598815 | 3300005355 | Unclassified | 578 |
| 100 | Ga0070674_100185681 | 3300005356 | Bacteria | 1596 |
| 101 | Ga0070674_101530658 | 3300005356 | Unclassified | 600 |
| 102 | Ga0070673_100024795 | 3300005364 | Bacteria | 4403 |
| 103 | Ga0070673_100100149 | 3300005364 | Bacteria | 2385 |
| 104 | Ga0070673_100100271 | 3300005364 | Bacteria | 2384 |
| 105 | Ga0070673_100158066 | 3300005364 | Bacteria | 1925 |
| 106 | Ga0070673_100439294 | 3300005364 | Bacteria | 1172 |
| 107 | Ga0070688_100216997 | 3300005365 | Unclassified | 1346 |
| 108 | Ga0070688_100572203 | 3300005365 | Bacteria | 861 |
| 109 | Ga0070659_100068418 | 3300005366 | Bacteria | 2816 |
| 110 | Ga0070659_100333075 | 3300005366 | Bacteria | 1271 |
| 111 | Ga0070659_100472087 | 3300005366 | Unclassified | 1066 |
| 112 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 113 | Ga0070667_100263315 | 3300005367 | Bacteria | 1544 |
| 114 | Ga0070667_101676777 | 3300005367 | Unclassified | 598 |
| 115 | Ga0070703_10002822 | 3300005406 | Bacteria | 4977 |
| 116 | Ga0070709_10013306 | 3300005434 | Bacteria | 4622 |
| 117 | Ga0070709_10076194 | 3300005434 | Bacteria | 2178 |
| 118 | Ga0070714_100029717 | 3300005435 | Bacteria | 4545 |
| 119 | Ga0070714_101644267 | 3300005435 | Unclassified | 627 |
| 120 | Ga0070713_100008030 | 3300005436 | Bacteria | 7459 |
| 121 | Ga0070713_100020936 | 3300005436 | Bacteria | 5022 |
| 122 | Ga0070713_100043883 | 3300005436 | Unclassified | 3658 |
| 123 | Ga0070713_100353757 | 3300005436 | Unclassified | 1363 |
| 124 | Ga0070713_101256272 | 3300005436 | Bacteria | 717 |
| 125 | Ga0070710_10179285 | 3300005437 | Bacteria | 1325 |
| 126 | Ga0070701_10030762 | 3300005438 | Bacteria | 2658 |
| 127 | Ga0070701_10152057 | 3300005438 | Bacteria | 1334 |
| 128 | Ga0070701_10696198 | 3300005438 | Bacteria | 683 |
| 129 | Ga0070701_10750366 | 3300005438 | Unclassified | 661 |
| 130 | Ga0070711_100054278 | 3300005439 | Bacteria | 2765 |
| 131 | Ga0070711_100143104 | 3300005439 | Bacteria | 1795 |
| 132 | Ga0070711_100249578 | 3300005439 | Unclassified | 1391 |
| 133 | Ga0070711_100295116 | 3300005439 | Bacteria | 1287 |
| 134 | Ga0070711_100357648 | 3300005439 | Bacteria | 1175 |
| 135 | Ga0070711_100473993 | 3300005439 | Unclassified | 1028 |
| 136 | Ga0070711_101637585 | 3300005439 | Bacteria | 563 |
| 137 | Ga0070705_100002412 | 3300005440 | Bacteria | 9405 |
| 138 | Ga0070705_100013552 | 3300005440 | Bacteria | 4173 |
| 139 | Ga0070705_100130731 | 3300005440 | Bacteria | 1637 |
| 140 | Ga0070705_100145152 | 3300005440 | Unclassified | 1567 |
| 141 | Ga0070705_100153628 | 3300005440 | Bacteria | 1530 |
| 142 | Ga0070705_100196042 | 3300005440 | Unclassified | 1381 |
| 143 | Ga0070705_100610419 | 3300005440 | Bacteria | 845 |
| 144 | Ga0070705_100626372 | 3300005440 | Unclassified | 836 |
| 145 | Ga0070705_101916729 | 3300005440 | Unclassified | 504 |
| 146 | Ga0070700_100004564 | 3300005441 | Bacteria | 7245 |
| 147 | Ga0070700_100019588 | 3300005441 | Bacteria | 3908 |
| 148 | Ga0070700_100046598 | 3300005441 | Unclassified | 2679 |
| 149 | Ga0070700_100298797 | 3300005441 | Unclassified | 1174 |
| 150 | Ga0070700_101219317 | 3300005441 | Bacteria | 629 |
| 151 | Ga0070700_101771090 | 3300005441 | Unclassified | 531 |
| 152 | Ga0070694_100004873 | 3300005444 | Bacteria | 8082 |
| 153 | Ga0070694_100013478 | 3300005444 | Bacteria | 5106 |
| 154 | Ga0070694_100019668 | 3300005444 | Bacteria | 4297 |
| 155 | Ga0070694_100164111 | 3300005444 | Unclassified | 1632 |
| 156 | Ga0070694_100221671 | 3300005444 | Unclassified | 1419 |
| 157 | Ga0070694_100229535 | 3300005444 | Bacteria | 1396 |
| 158 | Ga0070694_100491006 | 3300005444 | Bacteria | 976 |
| 159 | Ga0070694_100741551 | 3300005444 | Bacteria | 801 |
| 160 | Ga0070694_100813722 | 3300005444 | Unclassified | 767 |
| 161 | Ga0070694_100937108 | 3300005444 | Bacteria | 716 |
| 162 | Ga0070694_101182447 | 3300005444 | Unclassified | 640 |
| 163 | Ga0070694_101415001 | 3300005444 | Unclassified | 587 |
| 164 | Ga0070708_100092854 | 3300005445 | Bacteria | 2750 |
| 165 | Ga0070708_100137560 | 3300005445 | Bacteria | 2264 |
| 166 | Ga0070708_100284225 | 3300005445 | Unclassified | 1557 |
| 167 | Ga0070708_100368257 | 3300005445 | Unclassified | 1355 |
| 168 | Ga0070663_100000210 | 3300005455 | Bacteria | 29262 |
| 169 | Ga0070663_101037906 | 3300005455 | Unclassified | 714 |
| 170 | Ga0070678_100122300 | 3300005456 | Bacteria | 2054 |
| 171 | Ga0070678_100137934 | 3300005456 | Bacteria | 1948 |
| 172 | Ga0070678_100167517 | 3300005456 | Bacteria | 1786 |
| 173 | Ga0070678_101682184 | 3300005456 | Unclassified | 597 |
| 174 | Ga0070678_102045544 | 3300005456 | Unclassified | 542 |
| 175 | Ga0070662_100044676 | 3300005457 | Bacteria | 3174 |
| 176 | Ga0070662_100593930 | 3300005457 | Bacteria | 931 |
| 177 | Ga0070681_10006697 | 3300005458 | Bacteria | 11209 |
| 178 | Ga0070681_10019243 | 3300005458 | Bacteria | 6831 |
| 179 | Ga0070681_10093059 | 3300005458 | Bacteria | 2963 |
| 180 | Ga0070681_10163416 | 3300005458 | Bacteria | 2150 |
| 181 | Ga0070681_10515435 | 3300005458 | Bacteria | 1109 |
| 182 | Ga0070681_10642445 | 3300005458 | Bacteria | 976 |
| 183 | Ga0068867_100030715 | 3300005459 | Bacteria | 3876 |
| 184 | Ga0068867_100093381 | 3300005459 | Bacteria | 2287 |
| 185 | Ga0068867_100162774 | 3300005459 | Bacteria | 1760 |
| 186 | Ga0068867_100284480 | 3300005459 | Unclassified | 1357 |
| 187 | Ga0068867_100850527 | 3300005459 | Bacteria | 817 |
| 188 | Ga0068867_101067614 | 3300005459 | Bacteria | 736 |
| 189 | Ga0068867_101600892 | 3300005459 | Unclassified | 609 |
| 190 | Ga0068867_101743219 | 3300005459 | Bacteria | 585 |
| 191 | Ga0068867_101761204 | 3300005459 | Unclassified | 582 |
| 192 | Ga0070685_10749380 | 3300005466 | Unclassified | 716 |
| 193 | Ga0070706_100000250 | 3300005467 | Bacteria | 65288 |
| 194 | Ga0070706_100013681 | 3300005467 | Bacteria | 7502 |
| 195 | Ga0070706_100043443 | 3300005467 | Bacteria | 4153 |
| 196 | Ga0070706_100248056 | 3300005467 | Unclassified | 1662 |
| 197 | Ga0070706_100586089 | 3300005467 | Bacteria | 1037 |
| 198 | Ga0070706_101511210 | 3300005467 | Unclassified | 614 |
| 199 | Ga0070707_100002026 | 3300005468 | Bacteria | 19377 |
| 200 | Ga0070707_100065847 | 3300005468 | Bacteria | 3481 |
| 201 | Ga0070707_100166738 | 3300005468 | Bacteria | 2146 |
| 202 | Ga0070707_100352294 | 3300005468 | Bacteria | 1430 |
| 203 | Ga0070698_100002337 | 3300005471 | Bacteria | 20953 |
| 204 | Ga0070698_100020402 | 3300005471 | Bacteria | 6946 |
| 205 | Ga0070698_100371550 | 3300005471 | Bacteria | 1362 |
| 206 | Ga0070698_100418803 | 3300005471 | Unclassified | 1274 |
| 207 | Ga0070698_101719913 | 3300005471 | Bacteria | 580 |
| 208 | Ga0070699_100000012 | 3300005518 | Bacteria | 246521 |
| 209 | Ga0070699_100016852 | 3300005518 | Bacteria | 6273 |
| 210 | Ga0070699_100055893 | 3300005518 | Bacteria | 3417 |
| 211 | Ga0070699_100078449 | 3300005518 | Archaea | 2876 |
| 212 | Ga0070699_100223394 | 3300005518 | Unclassified | 1679 |
| 213 | Ga0070699_100274553 | 3300005518 | Bacteria | 1509 |
| 214 | Ga0070699_100382107 | 3300005518 | Bacteria | 1271 |
| 215 | Ga0070699_100388654 | 3300005518 | Bacteria | 1261 |
| 216 | Ga0070699_100871073 | 3300005518 | Bacteria | 825 |
| 217 | Ga0070684_100319557 | 3300005535 | Unclassified | 1426 |
| 218 | Ga0070684_100471665 | 3300005535 | Bacteria | 1161 |
| 219 | Ga0070697_100001942 | 3300005536 | Bacteria | 15820 |
| 220 | Ga0070697_100085712 | 3300005536 | Bacteria | 2599 |
| 221 | Ga0070697_100092667 | 3300005536 | Bacteria | 2500 |
| 222 | Ga0070697_100152281 | 3300005536 | Bacteria | 1949 |
| 223 | Ga0070697_100158855 | 3300005536 | Bacteria | 1909 |
| 224 | Ga0070697_101066501 | 3300005536 | Unclassified | 719 |
| 225 | Ga0068853_100117977 | 3300005539 | Bacteria | 2364 |
| 226 | Ga0068853_100227672 | 3300005539 | Unclassified | 1704 |
| 227 | Ga0068853_100273079 | 3300005539 | Bacteria | 1557 |
| 228 | Ga0068853_101549870 | 3300005539 | Unclassified | 642 |
| 229 | Ga0068853_101658324 | 3300005539 | Unclassified | 620 |
| 230 | Ga0068853_101683413 | 3300005539 | Unclassified | 615 |
| 231 | Ga0070672_100040436 | 3300005543 | Bacteria | 3577 |
| 232 | Ga0070672_100446856 | 3300005543 | Bacteria | 1113 |
| 233 | Ga0070686_100015451 | 3300005544 | Bacteria | 4423 |
| 234 | Ga0070686_100247208 | 3300005544 | Bacteria | 1301 |
| 235 | Ga0070686_101380743 | 3300005544 | Unclassified | 590 |
| 236 | Ga0070686_101707684 | 3300005544 | Unclassified | 534 |
| 237 | Ga0070695_100029869 | 3300005545 | Bacteria | 3390 |
| 238 | Ga0070695_100092873 | 3300005545 | Bacteria | 2018 |
| 239 | Ga0070695_100096015 | 3300005545 | Bacteria | 1988 |
| 240 | Ga0070695_100108432 | 3300005545 | Bacteria | 1880 |
| 241 | Ga0070695_100184161 | 3300005545 | Bacteria | 1482 |
| 242 | Ga0070695_100220069 | 3300005545 | Bacteria | 1367 |
| 243 | Ga0070695_100514629 | 3300005545 | Unclassified | 928 |
| 244 | Ga0070695_101199579 | 3300005545 | Bacteria | 624 |
| 245 | Ga0070696_100037801 | 3300005546 | Bacteria | 3330 |
| 246 | Ga0070696_100078684 | 3300005546 | Bacteria | 2332 |
| 247 | Ga0070696_100124444 | 3300005546 | Bacteria | 1869 |
| 248 | Ga0070696_100294506 | 3300005546 | Bacteria | 1241 |
| 249 | Ga0070696_101090907 | 3300005546 | Bacteria | 671 |
| 250 | Ga0070696_101400975 | 3300005546 | Bacteria | 596 |
| 251 | Ga0070696_101752780 | 3300005546 | Bacteria | 536 |
| 252 | Ga0070693_100004656 | 3300005547 | Bacteria | 6514 |
| 253 | Ga0070693_100005417 | 3300005547 | Bacteria | 6125 |
| 254 | Ga0070693_100042851 | 3300005547 | Bacteria | 2553 |
| 255 | Ga0070693_100048071 | 3300005547 | Bacteria | 2429 |
| 256 | Ga0070693_100066892 | 3300005547 | Bacteria | 2104 |
| 257 | Ga0070693_100068397 | 3300005547 | Bacteria | 2084 |
| 258 | Ga0070693_100072169 | 3300005547 | Bacteria | 2036 |
| 259 | Ga0070693_100160345 | 3300005547 | Bacteria | 1432 |
| 260 | Ga0070693_100265603 | 3300005547 | Bacteria | 1143 |
| 261 | Ga0070693_100312656 | 3300005547 | Bacteria | 1063 |
| 262 | Ga0070693_100814402 | 3300005547 | Unclassified | 693 |
| 263 | Ga0070693_101333460 | 3300005547 | Bacteria | 556 |
| 264 | Ga0070665_100385874 | 3300005548 | Bacteria | 1408 |
| 265 | Ga0070665_101630959 | 3300005548 | Unclassified | 653 |
| 266 | Ga0070704_100045762 | 3300005549 | Bacteria | 3046 |
| 267 | Ga0070704_100057210 | 3300005549 | Bacteria | 2772 |
| 268 | Ga0070704_100060754 | 3300005549 | Bacteria | 2701 |
| 269 | Ga0070704_100122341 | 3300005549 | Bacteria | 2002 |
| 270 | Ga0070704_100144385 | 3300005549 | Unclassified | 1863 |
| 271 | Ga0070704_100240056 | 3300005549 | Bacteria | 1482 |
| 272 | Ga0070704_100320226 | 3300005549 | Bacteria | 1299 |
| 273 | Ga0070704_100499816 | 3300005549 | Bacteria | 1055 |
| 274 | Ga0070704_100676199 | 3300005549 | Bacteria | 913 |
| 275 | Ga0068855_100079053 | 3300005563 | Bacteria | 3815 |
| 276 | Ga0068855_100235046 | 3300005563 | Unclassified | 2050 |
| 277 | Ga0068855_101557801 | 3300005563 | Unclassified | 677 |
| 278 | Ga0068855_102362097 | 3300005563 | Bacteria | 531 |
| 279 | Ga0068855_102588902 | 3300005563 | Unclassified | 503 |
| 280 | Ga0070664_100050050 | 3300005564 | Bacteria | 3535 |
| 281 | Ga0070664_100147198 | 3300005564 | Bacteria | 2077 |
| 282 | Ga0070664_100194953 | 3300005564 | Bacteria | 1806 |
| 283 | Ga0070664_100330348 | 3300005564 | Unclassified | 1383 |
| 284 | Ga0070664_100411881 | 3300005564 | Bacteria | 1237 |
| 285 | Ga0070664_100511873 | 3300005564 | Bacteria | 1107 |
| 286 | Ga0068857_100008955 | 3300005577 | Bacteria | 8672 |
| 287 | Ga0068857_100015247 | 3300005577 | Bacteria | 6708 |
| 288 | Ga0068857_100073529 | 3300005577 | Bacteria | 3046 |
| 289 | Ga0068857_100084026 | 3300005577 | Bacteria | 2845 |
| 290 | Ga0068857_100175930 | 3300005577 | Bacteria | 1947 |
| 291 | Ga0068857_100415498 | 3300005577 | Unclassified | 1253 |
| 292 | Ga0068857_100503328 | 3300005577 | Bacteria | 1137 |
| 293 | Ga0068857_100655164 | 3300005577 | Unclassified | 995 |
| 294 | Ga0068857_101599633 | 3300005577 | Unclassified | 636 |
| 295 | Ga0068854_100041418 | 3300005578 | Bacteria | 3254 |
| 296 | Ga0068854_100111833 | 3300005578 | Bacteria | 2061 |
| 297 | Ga0068854_100341034 | 3300005578 | Unclassified | 1224 |
| 298 | Ga0068854_100400651 | 3300005578 | Bacteria | 1135 |
| 299 | Ga0068854_100416451 | 3300005578 | Bacteria | 1115 |
| 300 | Ga0068854_100587271 | 3300005578 | Unclassified | 949 |
| 301 | Ga0068854_100640833 | 3300005578 | Viruses | 911 |
| 302 | Ga0068854_101031413 | 3300005578 | Unclassified | 730 |
| 303 | Ga0068854_102022763 | 3300005578 | Unclassified | 531 |
| 304 | Ga0068856_100012621 | 3300005614 | Bacteria | 8179 |
| 305 | Ga0068856_100042701 | 3300005614 | Bacteria | 4461 |
| 306 | Ga0068856_100069494 | 3300005614 | Bacteria | 3483 |
| 307 | Ga0068856_100191809 | 3300005614 | Bacteria | 2057 |
| 308 | Ga0070702_100012823 | 3300005615 | Unclassified | 4217 |
| 309 | Ga0070702_100066498 | 3300005615 | Bacteria | 2114 |
| 310 | Ga0070702_100070012 | 3300005615 | Bacteria | 2069 |
| 311 | Ga0070702_100082972 | 3300005615 | Bacteria | 1924 |
| 312 | Ga0070702_100173220 | 3300005615 | Bacteria | 1406 |
| 313 | Ga0070702_100385897 | 3300005615 | Unclassified | 997 |
| 314 | Ga0070702_100717072 | 3300005615 | Unclassified | 764 |
| 315 | Ga0068852_100020623 | 3300005616 | Bacteria | 5242 |
| 316 | Ga0068852_100512949 | 3300005616 | Unclassified | 1195 |
| 317 | Ga0068852_100576037 | 3300005616 | Bacteria | 1128 |
| 318 | Ga0068852_101075634 | 3300005616 | Bacteria | 824 |
| 319 | Ga0068852_101093714 | 3300005616 | Bacteria | 817 |
| 320 | Ga0068859_100010723 | 3300005617 | Bacteria | 9223 |
| 321 | Ga0068859_100037836 | 3300005617 | Bacteria | 4842 |
| 322 | Ga0068859_100053033 | 3300005617 | Bacteria | 4078 |
| 323 | Ga0068859_100103711 | 3300005617 | Bacteria | 2902 |
| 324 | Ga0068859_100132806 | 3300005617 | Unclassified | 2561 |
| 325 | Ga0068859_100142052 | 3300005617 | Bacteria | 2474 |
| 326 | Ga0068859_100167073 | 3300005617 | Bacteria | 2280 |
| 327 | Ga0068859_100294539 | 3300005617 | Bacteria | 1716 |
| 328 | Ga0068859_100380124 | 3300005617 | Bacteria | 1508 |
| 329 | Ga0068859_100401164 | 3300005617 | Bacteria | 1467 |
| 330 | Ga0068859_100563704 | 3300005617 | Bacteria | 1233 |
| 331 | Ga0068859_100848074 | 3300005617 | Bacteria | 1000 |
| 332 | Ga0068859_100933268 | 3300005617 | Unclassified | 952 |
| 333 | Ga0068859_101004137 | 3300005617 | Bacteria | 916 |
| 334 | Ga0068859_101080701 | 3300005617 | Bacteria | 882 |
| 335 | Ga0068859_101906871 | 3300005617 | Bacteria | 656 |
| 336 | Ga0068859_102143208 | 3300005617 | Unclassified | 617 |
| 337 | Ga0068864_100006038 | 3300005618 | Bacteria | 9946 |
| 338 | Ga0068864_100067551 | 3300005618 | Bacteria | 3104 |
| 339 | Ga0068864_100402774 | 3300005618 | Unclassified | 1300 |
| 340 | Ga0068864_100407953 | 3300005618 | Bacteria | 1292 |
| 341 | Ga0068864_101054402 | 3300005618 | Bacteria | 808 |
| 342 | Ga0068866_10071181 | 3300005718 | Bacteria | 1838 |
| 343 | Ga0068866_10104172 | 3300005718 | Bacteria | 1571 |
| 344 | Ga0068866_10869875 | 3300005718 | Unclassified | 632 |
| 345 | Ga0068861_100130894 | 3300005719 | Bacteria | 2036 |
| 346 | Ga0068861_100312655 | 3300005719 | Unclassified | 1365 |
| 347 | Ga0068861_100639481 | 3300005719 | Bacteria | 981 |
| 348 | Ga0068861_100726362 | 3300005719 | Unclassified | 925 |
| 349 | Ga0068851_10001358 | 3300005834 | Bacteria | 10679 |
| 350 | Ga0068851_10025195 | 3300005834 | Bacteria | 2917 |
| 351 | Ga0068851_10040164 | 3300005834 | Bacteria | 2351 |
| 352 | Ga0068851_10208635 | 3300005834 | Unclassified | 1093 |
| 353 | Ga0068870_10006593 | 3300005840 | Bacteria | 5128 |
| 354 | Ga0068870_10011207 | 3300005840 | Unclassified | 4148 |
| 355 | Ga0068870_10061387 | 3300005840 | Unclassified | 2021 |
| 356 | Ga0068870_10105110 | 3300005840 | Bacteria | 1603 |
| 357 | Ga0068870_10268254 | 3300005840 | Unclassified | 1065 |
| 358 | Ga0068870_11201221 | 3300005840 | Unclassified | 549 |
| 359 | Ga0068863_100005605 | 3300005841 | Bacteria | 12339 |
| 360 | Ga0068863_100012454 | 3300005841 | Bacteria | 8211 |
| 361 | Ga0068863_100046714 | 3300005841 | Bacteria | 4110 |
| 362 | Ga0068863_100048330 | 3300005841 | Unclassified | 4035 |
| 363 | Ga0068863_100066935 | 3300005841 | Bacteria | 3398 |
| 364 | Ga0068863_100891448 | 3300005841 | Bacteria | 889 |
| 365 | Ga0068863_101786968 | 3300005841 | Bacteria | 624 |
| 366 | Ga0068858_100037811 | 3300005842 | Bacteria | 4476 |
| 367 | Ga0068858_100120385 | 3300005842 | Bacteria | 2454 |
| 368 | Ga0068858_100195143 | 3300005842 | Bacteria | 1913 |
| 369 | Ga0068858_100218134 | 3300005842 | Bacteria | 1806 |
| 370 | Ga0068858_100269751 | 3300005842 | Bacteria | 1619 |
| 371 | Ga0068858_100377375 | 3300005842 | Bacteria | 1360 |
| 372 | Ga0068858_100406120 | 3300005842 | Bacteria | 1309 |
| 373 | Ga0068858_100423528 | 3300005842 | Bacteria | 1280 |
| 374 | Ga0068858_100486278 | 3300005842 | Unclassified | 1192 |
| 375 | Ga0068858_100910523 | 3300005842 | Unclassified | 860 |
| 376 | Ga0068858_102391757 | 3300005842 | Unclassified | 522 |
| 377 | Ga0068860_100004514 | 3300005843 | Bacteria | 14204 |
| 378 | Ga0068860_100061657 | 3300005843 | Bacteria | 3563 |
| 379 | Ga0068860_100074625 | 3300005843 | Unclassified | 3225 |
| 380 | Ga0068860_100133407 | 3300005843 | Bacteria | 2384 |
| 381 | Ga0068860_100184278 | 3300005843 | Bacteria | 2018 |
| 382 | Ga0068860_100312423 | 3300005843 | Bacteria | 1541 |
| 383 | Ga0068860_100498043 | 3300005843 | Bacteria | 1216 |
| 384 | Ga0068860_100542151 | 3300005843 | Unclassified | 1165 |
| 385 | Ga0068860_101337475 | 3300005843 | Bacteria | 737 |
| 386 | Ga0068862_100108122 | 3300005844 | Unclassified | 2439 |
| 387 | Ga0068862_100521314 | 3300005844 | Unclassified | 1131 |
| 388 | Ga0068862_100860043 | 3300005844 | Unclassified | 889 |
| 389 | Ga0068862_101015777 | 3300005844 | Unclassified | 821 |
| 390 | Ga0081455_10021596 | 3300005937 | Bacteria | 6033 |
| 391 | Ga0081539_10016029 | 3300005985 | Bacteria | 5390 |
| 392 | Ga0081539_10027789 | 3300005985 | Unclassified | 3575 |
| 393 | Ga0081539_10047406 | 3300005985 | Bacteria | 2454 |
| 394 | Ga0070717_10265865 | 3300006028 | Bacteria | 1518 |
| 395 | Ga0070717_10350918 | 3300006028 | Bacteria | 1319 |
| 396 | Ga0070717_10977157 | 3300006028 | Unclassified | 771 |
| 397 | Ga0075365_10287425 | 3300006038 | Unclassified | 1157 |
| 398 | Ga0075368_10008168 | 3300006042 | Bacteria | 3719 |
| 399 | Ga0075368_10187031 | 3300006042 | Bacteria | 874 |
| 400 | Ga0075364_10006340 | 3300006051 | Bacteria | 6951 |
| 401 | Ga0075432_10445350 | 3300006058 | Unclassified | 567 |
| 402 | Ga0070715_10295620 | 3300006163 | Bacteria | 864 |
| 403 | Ga0070716_100006865 | 3300006173 | Bacteria | 5582 |
| 404 | Ga0070716_100283473 | 3300006173 | Bacteria | 1144 |
| 405 | Ga0070716_100483907 | 3300006173 | Bacteria | 909 |
| 406 | Ga0070712_100122890 | 3300006175 | Bacteria | 1956 |
| 407 | Ga0070712_100271318 | 3300006175 | Unclassified | 1363 |
| 408 | Ga0070712_100335243 | 3300006175 | Unclassified | 1233 |
| 409 | Ga0070712_100438752 | 3300006175 | Bacteria | 1085 |
| 410 | Ga0070712_100821580 | 3300006175 | Bacteria | 798 |
| 411 | Ga0070712_101135254 | 3300006175 | Bacteria | 679 |
| 412 | Ga0075367_10040931 | 3300006178 | Bacteria | 2707 |
| 413 | Ga0075366_10025466 | 3300006195 | Bacteria | 3456 |
| 414 | Ga0097621_100000225 | 3300006237 | Bacteria | 37800 |
| 415 | Ga0097621_100284772 | 3300006237 | Bacteria | 1456 |
| 416 | Ga0097621_100292296 | 3300006237 | Unclassified | 1437 |
| 417 | Ga0097621_101018727 | 3300006237 | Bacteria | 775 |
| 418 | Ga0068871_100000307 | 3300006358 | Bacteria | 34112 |
| 419 | Ga0068871_100010219 | 3300006358 | Bacteria | 6837 |
| 420 | Ga0068871_100010943 | 3300006358 | Bacteria | 6645 |
| 421 | Ga0068871_100069801 | 3300006358 | Bacteria | 2886 |
| 422 | Ga0068871_100160198 | 3300006358 | Bacteria | 1924 |
| 423 | Ga0068871_100280233 | 3300006358 | Bacteria | 1458 |
| 424 | Ga0075428_100017222 | 3300006844 | Bacteria | 7985 |
| 425 | Ga0075428_100029102 | 3300006844 | Bacteria | 6112 |
| 426 | Ga0075428_100049240 | 3300006844 | Bacteria | 4623 |
| 427 | Ga0075428_100114702 | 3300006844 | Bacteria | 2935 |
| 428 | Ga0075428_100139696 | 3300006844 | Unclassified | 2634 |
| 429 | Ga0075428_100246043 | 3300006844 | Unclassified | 1928 |
| 430 | Ga0075428_100399753 | 3300006844 | Bacteria | 1473 |
| 431 | Ga0075430_100063229 | 3300006846 | Bacteria | 3109 |
| 432 | Ga0075430_100099955 | 3300006846 | Unclassified | 2423 |
| 433 | Ga0075430_100126789 | 3300006846 | Bacteria | 2128 |
| 434 | Ga0075430_100885312 | 3300006846 | Unclassified | 736 |
| 435 | Ga0075431_100001499 | 3300006847 | Bacteria | 21616 |
| 436 | Ga0075431_100023477 | 3300006847 | Bacteria | 6310 |
| 437 | Ga0075431_100035491 | 3300006847 | Bacteria | 5134 |
| 438 | Ga0075431_100036946 | 3300006847 | Bacteria | 5031 |
| 439 | Ga0075431_100962349 | 3300006847 | Unclassified | 822 |
| 440 | Ga0075431_101676873 | 3300006847 | Unclassified | 593 |
| 441 | Ga0075433_10001699 | 3300006852 | Bacteria | 16423 |
| 442 | Ga0075433_10012120 | 3300006852 | Bacteria | 6954 |
| 443 | Ga0075433_10016584 | 3300006852 | Bacteria | 6076 |
| 444 | Ga0075433_10019978 | 3300006852 | Bacteria | 5595 |
| 445 | Ga0075433_10040574 | 3300006852 | Bacteria | 4030 |
| 446 | Ga0075433_10041993 | 3300006852 | Bacteria | 3966 |
| 447 | Ga0075433_10043066 | 3300006852 | Bacteria | 3918 |
| 448 | Ga0075433_10515010 | 3300006852 | Archaea | 1052 |
| 449 | Ga0075433_11329130 | 3300006852 | Bacteria | 622 |
| 450 | Ga0075434_100024652 | 3300006871 | Bacteria | 5882 |
| 451 | Ga0075434_100046671 | 3300006871 | Unclassified | 4298 |
| 452 | Ga0075434_100093946 | 3300006871 | Bacteria | 3003 |
| 453 | Ga0075434_100211827 | 3300006871 | Bacteria | 1958 |
| 454 | Ga0075434_100246544 | 3300006871 | Bacteria | 1806 |
| 455 | Ga0075434_100426526 | 3300006871 | Unclassified | 1347 |
| 456 | Ga0075434_100490932 | 3300006871 | Bacteria | 1249 |
| 457 | Ga0075434_100769296 | 3300006871 | Bacteria | 979 |
| 458 | Ga0075434_100829760 | 3300006871 | Bacteria | 940 |
| 459 | Ga0075434_100920597 | 3300006871 | Unclassified | 889 |
| 460 | Ga0075429_100160274 | 3300006880 | Bacteria | 1970 |
| 461 | Ga0075429_100192505 | 3300006880 | Unclassified | 1786 |
| 462 | Ga0075429_100421960 | 3300006880 | Bacteria | 1168 |
| 463 | Ga0075429_100496837 | 3300006880 | Unclassified | 1069 |
| 464 | Ga0075429_100914767 | 3300006880 | Unclassified | 768 |
| 465 | Ga0068865_100405526 | 3300006881 | Bacteria | 1117 |
| 466 | Ga0068865_100785309 | 3300006881 | Bacteria | 820 |
| 467 | Ga0068865_101826935 | 3300006881 | Bacteria | 549 |
| 468 | Ga0075436_100025078 | 3300006914 | Bacteria | 4100 |
| 469 | Ga0075436_100032565 | 3300006914 | Bacteria | 3593 |
| 470 | Ga0075436_100043993 | 3300006914 | Unclassified | 3079 |
| 471 | Ga0075436_100092593 | 3300006914 | Bacteria | 2101 |
| 472 | Ga0097620_100010723 | 3300006931 | Bacteria | 9223 |
| 473 | Ga0097620_100037831 | 3300006931 | Bacteria | 4842 |
| 474 | Ga0097620_100053034 | 3300006931 | Bacteria | 4078 |
| 475 | Ga0097620_100103701 | 3300006931 | Bacteria | 2902 |
| 476 | Ga0097620_100132805 | 3300006931 | Unclassified | 2561 |
| 477 | Ga0097620_100142049 | 3300006931 | Bacteria | 2474 |
| 478 | Ga0097620_100167073 | 3300006931 | Bacteria | 2280 |
| 479 | Ga0097620_100294552 | 3300006931 | Bacteria | 1716 |
| 480 | Ga0097620_100380135 | 3300006931 | Bacteria | 1508 |
| 481 | Ga0097620_100401202 | 3300006931 | Bacteria | 1467 |
| 482 | Ga0097620_100563653 | 3300006931 | Bacteria | 1233 |
| 483 | Ga0097620_100633948 | 3300006931 | Bacteria | 1161 |
| 484 | Ga0097620_100848130 | 3300006931 | Bacteria | 1000 |
| 485 | Ga0097620_100933284 | 3300006931 | Unclassified | 952 |
| 486 | Ga0097620_101004310 | 3300006931 | Bacteria | 916 |
| 487 | Ga0097620_101080817 | 3300006931 | Bacteria | 882 |
| 488 | Ga0097620_101898590 | 3300006931 | Unclassified | 658 |
| 489 | Ga0097620_101906626 | 3300006931 | Bacteria | 656 |
| 490 | Ga0097620_102143148 | 3300006931 | Unclassified | 617 |
| 491 | Ga0075435_100026093 | 3300007076 | Bacteria | 4554 |
| 492 | Ga0075435_100036054 | 3300007076 | Bacteria | 3928 |
| 493 | Ga0075435_100938015 | 3300007076 | Bacteria | 755 |
| 494 | Ga0075435_101021246 | 3300007076 | Bacteria | 722 |
| 495 | Ga0075435_101190363 | 3300007076 | Unclassified | 667 |
| 496 | Ga0075435_101773620 | 3300007076 | Unclassified | 542 |
| 497 | Ga0099794_10118826 | 3300007265 | Bacteria | 1328 |
| 498 | Ga0099794_10206644 | 3300007265 | Bacteria | 1006 |
| 499 | Ga0099794_10609591 | 3300007265 | Unclassified | 578 |
| 500 | Ga0105251_10218149 | 3300009011 | Bacteria | 859 |
| 501 | Ga0105251_10345093 | 3300009011 | Unclassified | 679 |
| 502 | Ga0105251_10488431 | 3300009011 | Unclassified | 574 |
| 503 | Ga0105240_10000115 | 3300009093 | Bacteria | 165594 |
| 504 | Ga0105240_10034031 | 3300009093 | Bacteria | 6577 |
| 505 | Ga0105240_10069492 | 3300009093 | Bacteria | 4359 |
| 506 | Ga0105240_10117898 | 3300009093 | Bacteria | 3200 |
| 507 | Ga0105240_10385766 | 3300009093 | Bacteria | 1581 |
| 508 | Ga0105240_10487977 | 3300009093 | Unclassified | 1372 |
| 509 | Ga0105240_11824021 | 3300009093 | Unclassified | 634 |
| 510 | Ga0105240_12053947 | 3300009093 | Unclassified | 594 |
| 511 | Ga0111539_10033847 | 3300009094 | Bacteria | 6200 |
| 512 | Ga0111539_10098755 | 3300009094 | Bacteria | 3429 |
| 513 | Ga0111539_10394927 | 3300009094 | Bacteria | 1611 |
| 514 | Ga0111539_10471347 | 3300009094 | Bacteria | 1462 |
| 515 | Ga0111539_13035490 | 3300009094 | Bacteria | 542 |
| 516 | Ga0105245_10005352 | 3300009098 | Bacteria | 11273 |
| 517 | Ga0105245_10060430 | 3300009098 | Bacteria | 3413 |
| 518 | Ga0105245_10138781 | 3300009098 | Bacteria | 2288 |
| 519 | Ga0105245_10144476 | 3300009098 | Bacteria | 2244 |
| 520 | Ga0105245_10207569 | 3300009098 | Bacteria | 1884 |
| 521 | Ga0105245_10984089 | 3300009098 | Bacteria | 887 |
| 522 | Ga0105245_12516065 | 3300009098 | Unclassified | 568 |
| 523 | Ga0105245_12598837 | 3300009098 | Unclassified | 559 |
| 524 | Ga0105247_10022526 | 3300009101 | Bacteria | 3794 |
| 525 | Ga0105247_10087475 | 3300009101 | Unclassified | 1973 |
| 526 | Ga0105247_10104972 | 3300009101 | Bacteria | 1811 |
| 527 | Ga0105247_10128587 | 3300009101 | Bacteria | 1649 |
| 528 | Ga0105247_10462232 | 3300009101 | Unclassified | 917 |
| 529 | Ga0105247_10651063 | 3300009101 | Bacteria | 787 |
| 530 | Ga0105247_10942886 | 3300009101 | Unclassified | 670 |
| 531 | Ga0105247_11445255 | 3300009101 | Bacteria | 558 |
| 532 | Ga0114129_10028076 | 3300009147 | Bacteria | 7972 |
| 533 | Ga0114129_10183182 | 3300009147 | Bacteria | 2848 |
| 534 | Ga0114129_10198896 | 3300009147 | Bacteria | 2716 |
| 535 | Ga0114129_10211130 | 3300009147 | Bacteria | 2624 |
| 536 | Ga0114129_10409043 | 3300009147 | Bacteria | 1787 |
| 537 | Ga0114129_10429875 | 3300009147 | Unclassified | 1735 |
| 538 | Ga0114129_10893029 | 3300009147 | Unclassified | 1127 |
| 539 | Ga0114129_11169266 | 3300009147 | Bacteria | 960 |
| 540 | Ga0114129_12438319 | 3300009147 | Unclassified | 626 |
| 541 | Ga0114129_12611933 | 3300009147 | Unclassified | 603 |
| 542 | Ga0105243_10042170 | 3300009148 | Bacteria | 3571 |
| 543 | Ga0105243_10083569 | 3300009148 | Bacteria | 2612 |
| 544 | Ga0105243_10165738 | 3300009148 | Bacteria | 1909 |
| 545 | Ga0105243_10206265 | 3300009148 | Bacteria | 1727 |
| 546 | Ga0105243_10325217 | 3300009148 | Unclassified | 1403 |
| 547 | Ga0105243_10583534 | 3300009148 | Bacteria | 1073 |
| 548 | Ga0105243_11375570 | 3300009148 | Bacteria | 726 |
| 549 | Ga0105243_11378469 | 3300009148 | Unclassified | 725 |
| 550 | Ga0105243_11900037 | 3300009148 | Unclassified | 628 |
| 551 | Ga0105243_12784933 | 3300009148 | Unclassified | 529 |
| 552 | Ga0105241_10017892 | 3300009174 | Bacteria | 5211 |
| 553 | Ga0105241_10036247 | 3300009174 | Bacteria | 3711 |
| 554 | Ga0105241_10066355 | 3300009174 | Unclassified | 2790 |
| 555 | Ga0105241_10070230 | 3300009174 | Bacteria | 2717 |
| 556 | Ga0105241_10100939 | 3300009174 | Unclassified | 2294 |
| 557 | Ga0105241_10165285 | 3300009174 | Bacteria | 1823 |
| 558 | Ga0105241_10259041 | 3300009174 | Bacteria | 1478 |
| 559 | Ga0105241_10437316 | 3300009174 | Bacteria | 1155 |
| 560 | Ga0105241_10637083 | 3300009174 | Bacteria | 967 |
| 561 | Ga0105241_10783109 | 3300009174 | Unclassified | 877 |
| 562 | Ga0105241_11201872 | 3300009174 | Unclassified | 718 |
| 563 | Ga0105241_11242018 | 3300009174 | Bacteria | 707 |
| 564 | Ga0105241_11278555 | 3300009174 | Bacteria | 698 |
| 565 | Ga0105241_11371373 | 3300009174 | Bacteria | 676 |
| 566 | Ga0105241_11693467 | 3300009174 | Unclassified | 614 |
| 567 | Ga0105241_11888218 | 3300009174 | Unclassified | 585 |
| 568 | Ga0105241_12606950 | 3300009174 | Unclassified | 508 |
| 569 | Ga0105242_10019893 | 3300009176 | Bacteria | 5259 |
| 570 | Ga0105242_10039349 | 3300009176 | Bacteria | 3805 |
| 571 | Ga0105242_10044056 | 3300009176 | Unclassified | 3612 |
| 572 | Ga0105242_10082006 | 3300009176 | Bacteria | 2698 |
| 573 | Ga0105242_10226434 | 3300009176 | Bacteria | 1674 |
| 574 | Ga0105242_10289648 | 3300009176 | Bacteria | 1490 |
| 575 | Ga0105242_11749764 | 3300009176 | Bacteria | 659 |
| 576 | Ga0105248_10000526 | 3300009177 | Bacteria | 43619 |
| 577 | Ga0105248_10001687 | 3300009177 | Bacteria | 24588 |
| 578 | Ga0105248_10007159 | 3300009177 | Bacteria | 12238 |
| 579 | Ga0105248_10012433 | 3300009177 | Bacteria | 9389 |
| 580 | Ga0105248_10132054 | 3300009177 | Bacteria | 2817 |
| 581 | Ga0105248_10162973 | 3300009177 | Bacteria | 2514 |
| 582 | Ga0105248_10165652 | 3300009177 | Bacteria | 2492 |
| 583 | Ga0105248_10273169 | 3300009177 | Bacteria | 1903 |
| 584 | Ga0105248_10541889 | 3300009177 | Bacteria | 1313 |
| 585 | Ga0105248_10747236 | 3300009177 | Bacteria | 1104 |
| 586 | Ga0105248_10833417 | 3300009177 | Bacteria | 1041 |
| 587 | Ga0105248_10928377 | 3300009177 | Bacteria | 983 |
| 588 | Ga0105248_10967744 | 3300009177 | Unclassified | 961 |
| 589 | Ga0105248_11161977 | 3300009177 | Unclassified | 872 |
| 590 | Ga0105248_11863139 | 3300009177 | Bacteria | 682 |
| 591 | Ga0105237_10000199 | 3300009545 | Bacteria | 85277 |
| 592 | Ga0105237_10000267 | 3300009545 | Bacteria | 73368 |
| 593 | Ga0105237_10034465 | 3300009545 | Bacteria | 5125 |
| 594 | Ga0105237_10073724 | 3300009545 | Bacteria | 3405 |
| 595 | Ga0105237_10670830 | 3300009545 | Bacteria | 1043 |
| 596 | Ga0105237_10742590 | 3300009545 | Unclassified | 988 |
| 597 | Ga0105237_11079792 | 3300009545 | Bacteria | 809 |
| 598 | Ga0105238_10134093 | 3300009551 | Bacteria | 2454 |
| 599 | Ga0105238_10371069 | 3300009551 | Unclassified | 1421 |
| 600 | Ga0105238_10876843 | 3300009551 | Unclassified | 915 |
| 601 | Ga0105238_10885960 | 3300009551 | Unclassified | 910 |
| 602 | Ga0105238_11145396 | 3300009551 | Bacteria | 801 |
| 603 | Ga0105238_11217588 | 3300009551 | Unclassified | 778 |
| 604 | Ga0105238_11405881 | 3300009551 | Bacteria | 725 |
| 605 | Ga0105249_10001397 | 3300009553 | Bacteria | 21114 |
| 606 | Ga0105249_10026072 | 3300009553 | Bacteria | 5265 |
| 607 | Ga0105249_10033730 | 3300009553 | Bacteria | 4636 |
| 608 | Ga0105249_10352646 | 3300009553 | Bacteria | 1491 |
| 609 | Ga0105249_11336763 | 3300009553 | Bacteria | 788 |
| 610 | Ga0105239_10009785 | 3300010375 | Bacteria | 10775 |
| 611 | Ga0105239_10043429 | 3300010375 | Bacteria | 4927 |
| 612 | Ga0105239_10266243 | 3300010375 | Bacteria | 1927 |
| 613 | Ga0105239_10346058 | 3300010375 | Bacteria | 1678 |
| 614 | Ga0105239_10429067 | 3300010375 | Bacteria | 1498 |
| 615 | Ga0105239_10606063 | 3300010375 | Bacteria | 1249 |
| 616 | Ga0105239_10757128 | 3300010375 | Unclassified | 1112 |
| 617 | Ga0105239_11045922 | 3300010375 | Bacteria | 939 |
| 618 | Ga0105239_12546674 | 3300010375 | Unclassified | 596 |
| 619 | Ga0105246_10056903 | 3300011119 | Bacteria | 2704 |
| 620 | Ga0105246_10103030 | 3300011119 | Bacteria | 2082 |
| 621 | Ga0105246_10121579 | 3300011119 | Bacteria | 1936 |
| 622 | Ga0105246_10221170 | 3300011119 | Unclassified | 1484 |
| 623 | Ga0105246_10253466 | 3300011119 | Bacteria | 1398 |
| 624 | Ga0105246_10491734 | 3300011119 | Bacteria | 1040 |
| 625 | Ga0105246_12100915 | 3300011119 | Unclassified | 547 |
| 626 | Ga0157373_10005529 | 3300013100 | Bacteria | 9474 |
| 627 | Ga0157373_10688777 | 3300013100 | Unclassified | 748 |
| 628 | Ga0157373_10855604 | 3300013100 | Unclassified | 673 |
| 629 | Ga0157373_10987687 | 3300013100 | Bacteria | 628 |
| 630 | Ga0157373_11064080 | 3300013100 | Bacteria | 606 |
| 631 | Ga0157371_10292213 | 3300013102 | Bacteria | 1179 |
| 632 | Ga0157370_10061502 | 3300013104 | Bacteria | 3564 |
| 633 | Ga0157369_10987187 | 3300013105 | Unclassified | 862 |
| 634 | Ga0157374_10004474 | 3300013296 | Bacteria | 11733 |
| 635 | Ga0157374_10087667 | 3300013296 | Unclassified | 2963 |
| 636 | Ga0157374_10129570 | 3300013296 | Bacteria | 2441 |
| 637 | Ga0157374_10487709 | 3300013296 | Bacteria | 1236 |
| 638 | Ga0157374_10762675 | 3300013296 | Unclassified | 982 |
| 639 | Ga0157374_10775355 | 3300013296 | Bacteria | 974 |
| 640 | Ga0157374_10821593 | 3300013296 | Unclassified | 946 |
| 641 | Ga0157378_10000134 | 3300013297 | Bacteria | 70195 |
| 642 | Ga0157378_10001025 | 3300013297 | Bacteria | 25546 |
| 643 | Ga0157378_10006067 | 3300013297 | Bacteria | 10588 |
| 644 | Ga0157378_10016886 | 3300013297 | Bacteria | 6397 |
| 645 | Ga0157378_10028267 | 3300013297 | Bacteria | 4945 |
| 646 | Ga0157378_10286858 | 3300013297 | Bacteria | 1589 |
| 647 | Ga0157378_10332340 | 3300013297 | Bacteria | 1479 |
| 648 | Ga0157378_11096721 | 3300013297 | Bacteria | 833 |
| 649 | Ga0157378_12475754 | 3300013297 | Bacteria | 571 |
| 650 | Ga0163162_10036150 | 3300013306 | Bacteria | 4921 |
| 651 | Ga0163162_10159868 | 3300013306 | Bacteria | 2374 |
| 652 | Ga0163162_10177363 | 3300013306 | Bacteria | 2256 |
| 653 | Ga0163162_10204692 | 3300013306 | Bacteria | 2103 |
| 654 | Ga0163162_10433584 | 3300013306 | Unclassified | 1446 |
| 655 | Ga0163162_10640359 | 3300013306 | Bacteria | 1187 |
| 656 | Ga0163162_12088802 | 3300013306 | Bacteria | 650 |
| 657 | Ga0163162_12273109 | 3300013306 | Bacteria | 623 |
| 658 | Ga0163162_13443810 | 3300013306 | Bacteria | 504 |
| 659 | Ga0157372_10033757 | 3300013307 | Bacteria | 5622 |
| 660 | Ga0157372_10063742 | 3300013307 | Bacteria | 4134 |
| 661 | Ga0157372_10617125 | 3300013307 | Bacteria | 1264 |
| 662 | Ga0157372_10928710 | 3300013307 | Bacteria | 1009 |
| 663 | Ga0157372_10995488 | 3300013307 | Bacteria | 971 |
| 664 | Ga0157375_10063629 | 3300013308 | Bacteria | 3671 |
| 665 | Ga0157375_10184622 | 3300013308 | Bacteria | 2238 |
| 666 | Ga0157375_10571993 | 3300013308 | Bacteria | 1291 |
| 667 | Ga0157375_11273242 | 3300013308 | Unclassified | 864 |
| 668 | Ga0157375_11547612 | 3300013308 | Bacteria | 783 |
| 669 | Ga0157375_11647074 | 3300013308 | Unclassified | 759 |
| 670 | Ga0163163_10013740 | 3300014325 | Bacteria | 7420 |
| 671 | Ga0163163_10275846 | 3300014325 | Unclassified | 1732 |
| 672 | Ga0163163_10386954 | 3300014325 | Bacteria | 1456 |
| 673 | Ga0163163_10524960 | 3300014325 | Unclassified | 1246 |
| 674 | Ga0163163_10681317 | 3300014325 | Bacteria | 1092 |
| 675 | Ga0157380_11474538 | 3300014326 | Bacteria | 733 |
| 676 | Ga0157380_11604021 | 3300014326 | Unclassified | 706 |
| 677 | Ga0157380_11856561 | 3300014326 | Unclassified | 662 |
| 678 | Ga0157380_12077935 | 3300014326 | Unclassified | 631 |
| 679 | Ga0157377_10110423 | 3300014745 | Bacteria | 1652 |
| 680 | Ga0157377_11200216 | 3300014745 | Unclassified | 587 |
| 681 | Ga0157379_10041034 | 3300014968 | Bacteria | 4131 |
| 682 | Ga0157379_10056516 | 3300014968 | Bacteria | 3506 |
| 683 | Ga0157379_11286772 | 3300014968 | Unclassified | 706 |
| 684 | Ga0157376_10174223 | 3300014969 | Bacteria | 1961 |
| 685 | Ga0157376_10571476 | 3300014969 | Bacteria | 1121 |
| 686 | Ga0182005_1069317 | 3300015265 | Bacteria | 967 |
| 687 | Ga0182005_1226343 | 3300015265 | Unclassified | 571 |
| 688 | Ga0163161_10599060 | 3300017792 | Bacteria | 908 |
| 689 | Ga0213872_10038558 | 3300021361 | Bacteria | 2181 |
| 690 | Ga0213872_10402689 | 3300021361 | Unclassified | 555 |
| 691 | Ga0213876_10033164 | 3300021384 | Unclassified | 2722 |
| 692 | Ga0213876_10235349 | 3300021384 | Bacteria | 973 |
| 693 | Ga0213875_10207652 | 3300021388 | Unclassified | 922 |
| 694 | Ga0207697_10040232 | 3300025315 | Bacteria | 1920 |
| 695 | Ga0207697_10246407 | 3300025315 | Unclassified | 790 |
| 696 | Ga0207697_10339566 | 3300025315 | Bacteria | 667 |
| 697 | Ga0207656_10001285 | 3300025321 | Bacteria | 8249 |
| 698 | Ga0207656_10069665 | 3300025321 | Bacteria | 1560 |
| 699 | Ga0207653_10008038 | 3300025885 | Bacteria | 3287 |
| 700 | Ga0207692_10303072 | 3300025898 | Unclassified | 973 |
| 701 | Ga0207642_10039866 | 3300025899 | Unclassified | 2045 |
| 702 | Ga0207642_10071929 | 3300025899 | Bacteria | 1649 |
| 703 | Ga0207642_10175858 | 3300025899 | Bacteria | 1162 |
| 704 | Ga0207710_10153409 | 3300025900 | Bacteria | 1118 |
| 705 | Ga0207710_10224905 | 3300025900 | Unclassified | 933 |
| 706 | Ga0207688_10451664 | 3300025901 | Bacteria | 801 |
| 707 | Ga0207688_10494503 | 3300025901 | Bacteria | 765 |
| 708 | Ga0207680_10158828 | 3300025903 | Bacteria | 1514 |
| 709 | Ga0207680_10463775 | 3300025903 | Unclassified | 900 |
| 710 | Ga0207647_10039267 | 3300025904 | Unclassified | 2988 |
| 711 | Ga0207647_10100743 | 3300025904 | Bacteria | 1714 |
| 712 | Ga0207647_10435298 | 3300025904 | Bacteria | 736 |
| 713 | Ga0207699_10013633 | 3300025906 | Bacteria | 4167 |
| 714 | Ga0207699_10374128 | 3300025906 | Unclassified | 1010 |
| 715 | Ga0207645_10016652 | 3300025907 | Bacteria | 4863 |
| 716 | Ga0207645_10727293 | 3300025907 | Bacteria | 675 |
| 717 | Ga0207643_10009386 | 3300025908 | Bacteria | 5256 |
| 718 | Ga0207643_10015617 | 3300025908 | Unclassified | 4134 |
| 719 | Ga0207643_10054092 | 3300025908 | Bacteria | 2281 |
| 720 | Ga0207705_10005099 | 3300025909 | Bacteria | 9846 |
| 721 | Ga0207684_10000093 | 3300025910 | Bacteria | 166136 |
| 722 | Ga0207684_10070701 | 3300025910 | Bacteria | 2966 |
| 723 | Ga0207684_10097238 | 3300025910 | Unclassified | 2513 |
| 724 | Ga0207654_10006238 | 3300025911 | Bacteria | 5993 |
| 725 | Ga0207654_10030858 | 3300025911 | Unclassified | 2946 |
| 726 | Ga0207654_10033202 | 3300025911 | Unclassified | 2859 |
| 727 | Ga0207654_10193335 | 3300025911 | Bacteria | 1335 |
| 728 | Ga0207654_10397047 | 3300025911 | Unclassified | 958 |
| 729 | Ga0207654_11182204 | 3300025911 | Unclassified | 557 |
| 730 | Ga0207707_10071835 | 3300025912 | Bacteria | 3016 |
| 731 | Ga0207707_10086108 | 3300025912 | Bacteria | 2746 |
| 732 | Ga0207707_10549170 | 3300025912 | Bacteria | 982 |
| 733 | Ga0207695_10000116 | 3300025913 | Bacteria | 239510 |
| 734 | Ga0207695_10068401 | 3300025913 | Bacteria | 3639 |
| 735 | Ga0207695_10112749 | 3300025913 | Bacteria | 2696 |
| 736 | Ga0207695_10351958 | 3300025913 | Bacteria | 1360 |
| 737 | Ga0207695_10386215 | 3300025913 | Unclassified | 1285 |
| 738 | Ga0207695_10528397 | 3300025913 | Bacteria | 1061 |
| 739 | Ga0207695_11342815 | 3300025913 | Unclassified | 595 |
| 740 | Ga0207671_10000687 | 3300025914 | Bacteria | 43812 |
| 741 | Ga0207671_10009579 | 3300025914 | Bacteria | 8077 |
| 742 | Ga0207671_10308134 | 3300025914 | Unclassified | 1251 |
| 743 | Ga0207671_10392020 | 3300025914 | Unclassified | 1104 |
| 744 | Ga0207671_11049111 | 3300025914 | Bacteria | 641 |
| 745 | Ga0207693_10137841 | 3300025915 | Unclassified | 1919 |
| 746 | Ga0207693_10147312 | 3300025915 | Bacteria | 1851 |
| 747 | Ga0207693_10173714 | 3300025915 | Unclassified | 1696 |
| 748 | Ga0207693_10521423 | 3300025915 | Bacteria | 927 |
| 749 | Ga0207663_10116336 | 3300025916 | Bacteria | 1823 |
| 750 | Ga0207663_10271478 | 3300025916 | Bacteria | 1256 |
| 751 | Ga0207663_10437271 | 3300025916 | Bacteria | 1007 |
| 752 | Ga0207663_11164161 | 3300025916 | Unclassified | 620 |
| 753 | Ga0207660_10062012 | 3300025917 | Bacteria | 2693 |
| 754 | Ga0207660_10670720 | 3300025917 | Bacteria | 845 |
| 755 | Ga0207660_11299572 | 3300025917 | Bacteria | 591 |
| 756 | Ga0207662_10015810 | 3300025918 | Bacteria | 4251 |
| 757 | Ga0207662_10180372 | 3300025918 | Bacteria | 1358 |
| 758 | Ga0207662_10871880 | 3300025918 | Unclassified | 636 |
| 759 | Ga0207657_10131020 | 3300025919 | Unclassified | 2055 |
| 760 | Ga0207657_10302159 | 3300025919 | Bacteria | 1267 |
| 761 | Ga0207649_10054868 | 3300025920 | Unclassified | 2482 |
| 762 | Ga0207649_10501640 | 3300025920 | Bacteria | 923 |
| 763 | Ga0207652_10016862 | 3300025921 | Bacteria | 5971 |
| 764 | Ga0207646_10014742 | 3300025922 | Bacteria | 7405 |
| 765 | Ga0207646_10119154 | 3300025922 | Unclassified | 2371 |
| 766 | Ga0207646_10164839 | 3300025922 | Bacteria | 2000 |
| 767 | Ga0207646_10301513 | 3300025922 | Bacteria | 1447 |
| 768 | Ga0207681_10008337 | 3300025923 | Bacteria | 6338 |
| 769 | Ga0207681_10256526 | 3300025923 | Bacteria | 1367 |
| 770 | Ga0207681_10276707 | 3300025923 | Bacteria | 1320 |
| 771 | Ga0207694_10078555 | 3300025924 | Bacteria | 2587 |
| 772 | Ga0207694_10883458 | 3300025924 | Bacteria | 756 |
| 773 | Ga0207694_11051298 | 3300025924 | Unclassified | 689 |
| 774 | Ga0207694_11103630 | 3300025924 | Bacteria | 671 |
| 775 | Ga0207650_10076903 | 3300025925 | Bacteria | 2522 |
| 776 | Ga0207650_11217278 | 3300025925 | Unclassified | 641 |
| 777 | Ga0207687_10011493 | 3300025927 | Bacteria | 5786 |
| 778 | Ga0207687_10108394 | 3300025927 | Bacteria | 2056 |
| 779 | Ga0207687_10111742 | 3300025927 | Bacteria | 2029 |
| 780 | Ga0207687_10189967 | 3300025927 | Bacteria | 1598 |
| 781 | Ga0207687_10620108 | 3300025927 | Unclassified | 913 |
| 782 | Ga0207687_11933906 | 3300025927 | Unclassified | 504 |
| 783 | Ga0207700_10021700 | 3300025928 | Bacteria | 4390 |
| 784 | Ga0207700_10031595 | 3300025928 | Unclassified | 3764 |
| 785 | Ga0207700_10273025 | 3300025928 | Unclassified | 1452 |
| 786 | Ga0207700_10958822 | 3300025928 | Bacteria | 766 |
| 787 | Ga0207700_11126299 | 3300025928 | Bacteria | 701 |
| 788 | Ga0207664_10007641 | 3300025929 | Bacteria | 7499 |
| 789 | Ga0207644_10075526 | 3300025931 | Bacteria | 2476 |
| 790 | Ga0207644_10326688 | 3300025931 | Bacteria | 1241 |
| 791 | Ga0207644_11818946 | 3300025931 | Bacteria | 510 |
| 792 | Ga0207690_10107500 | 3300025932 | Bacteria | 2004 |
| 793 | Ga0207690_10295129 | 3300025932 | Bacteria | 1267 |
| 794 | Ga0207706_10081965 | 3300025933 | Bacteria | 2835 |
| 795 | Ga0207706_10231877 | 3300025933 | Bacteria | 1615 |
| 796 | Ga0207706_10643447 | 3300025933 | Bacteria | 908 |
| 797 | Ga0207706_11720772 | 3300025933 | Unclassified | 504 |
| 798 | Ga0207686_10008369 | 3300025934 | Bacteria | 5583 |
| 799 | Ga0207686_10043950 | 3300025934 | Bacteria | 2740 |
| 800 | Ga0207686_10118681 | 3300025934 | Bacteria | 1797 |
| 801 | Ga0207686_10203774 | 3300025934 | Unclassified | 1418 |
| 802 | Ga0207709_10020878 | 3300025935 | Unclassified | 3700 |
| 803 | Ga0207709_10140481 | 3300025935 | Bacteria | 1659 |
| 804 | Ga0207709_10255958 | 3300025935 | Bacteria | 1281 |
| 805 | Ga0207709_10465775 | 3300025935 | Bacteria | 980 |
| 806 | Ga0207709_10556024 | 3300025935 | Unclassified | 903 |
| 807 | Ga0207709_10909052 | 3300025935 | Bacteria | 716 |
| 808 | Ga0207709_11292147 | 3300025935 | Unclassified | 603 |
| 809 | Ga0207670_10002947 | 3300025936 | Bacteria | 8989 |
| 810 | Ga0207670_10026837 | 3300025936 | Bacteria | 3634 |
| 811 | Ga0207670_10309090 | 3300025936 | Unclassified | 1240 |
| 812 | Ga0207670_10309892 | 3300025936 | Unclassified | 1239 |
| 813 | Ga0207670_10379222 | 3300025936 | Unclassified | 1126 |
| 814 | Ga0207670_10636984 | 3300025936 | Unclassified | 878 |
| 815 | Ga0207670_10751891 | 3300025936 | Unclassified | 810 |
| 816 | Ga0207669_11515946 | 3300025937 | Bacteria | 572 |
| 817 | Ga0207669_11895116 | 3300025937 | Unclassified | 509 |
| 818 | Ga0207704_10047829 | 3300025938 | Bacteria | 2560 |
| 819 | Ga0207704_10912573 | 3300025938 | Unclassified | 739 |
| 820 | Ga0207665_10159013 | 3300025939 | Bacteria | 1624 |
| 821 | Ga0207665_10206078 | 3300025939 | Bacteria | 1435 |
| 822 | Ga0207665_10315360 | 3300025939 | Bacteria | 1172 |
| 823 | Ga0207691_10023578 | 3300025940 | Bacteria | 5794 |
| 824 | Ga0207691_10916000 | 3300025940 | Unclassified | 733 |
| 825 | Ga0207711_10002710 | 3300025941 | Bacteria | 15632 |
| 826 | Ga0207711_10013418 | 3300025941 | Bacteria | 6806 |
| 827 | Ga0207711_10023161 | 3300025941 | Bacteria | 5198 |
| 828 | Ga0207711_10046701 | 3300025941 | Bacteria | 3700 |
| 829 | Ga0207711_10082965 | 3300025941 | Bacteria | 2803 |
| 830 | Ga0207711_10110981 | 3300025941 | Bacteria | 2439 |
| 831 | Ga0207711_10207379 | 3300025941 | Bacteria | 1790 |
| 832 | Ga0207711_10280547 | 3300025941 | Bacteria | 1534 |
| 833 | Ga0207711_10310859 | 3300025941 | Bacteria | 1455 |
| 834 | Ga0207711_11102282 | 3300025941 | Unclassified | 735 |
| 835 | Ga0207711_11132236 | 3300025941 | Unclassified | 724 |
| 836 | Ga0207689_10028761 | 3300025942 | Bacteria | 4648 |
| 837 | Ga0207689_10082032 | 3300025942 | Bacteria | 2651 |
| 838 | Ga0207689_10341305 | 3300025942 | Bacteria | 1244 |
| 839 | Ga0207689_10352077 | 3300025942 | Unclassified | 1224 |
| 840 | Ga0207689_10543049 | 3300025942 | Unclassified | 976 |
| 841 | Ga0207689_11131425 | 3300025942 | Unclassified | 660 |
| 842 | Ga0207689_11232138 | 3300025942 | Bacteria | 629 |
| 843 | Ga0207661_10419604 | 3300025944 | Unclassified | 1215 |
| 844 | Ga0207661_12100559 | 3300025944 | Bacteria | 511 |
| 845 | Ga0207679_10111021 | 3300025945 | Bacteria | 2164 |
| 846 | Ga0207679_10188536 | 3300025945 | Unclassified | 1712 |
| 847 | Ga0207679_10193396 | 3300025945 | Bacteria | 1693 |
| 848 | Ga0207679_10379759 | 3300025945 | Unclassified | 1238 |
| 849 | Ga0207679_10764036 | 3300025945 | Bacteria | 880 |
| 850 | Ga0207679_11898487 | 3300025945 | Unclassified | 543 |
| 851 | Ga0207667_10019013 | 3300025949 | Bacteria | 7681 |
| 852 | Ga0207651_10004480 | 3300025960 | Bacteria | 7047 |
| 853 | Ga0207651_10152772 | 3300025960 | Bacteria | 1800 |
| 854 | Ga0207651_10261897 | 3300025960 | Bacteria | 1420 |
| 855 | Ga0207651_10382519 | 3300025960 | Bacteria | 1193 |
| 856 | Ga0207651_10417887 | 3300025960 | Unclassified | 1144 |
| 857 | Ga0207651_11058865 | 3300025960 | Bacteria | 726 |
| 858 | Ga0207712_10010118 | 3300025961 | Bacteria | 5980 |
| 859 | Ga0207712_10016699 | 3300025961 | Bacteria | 4757 |
| 860 | Ga0207668_10541687 | 3300025972 | Bacteria | 1007 |
| 861 | Ga0207640_10023432 | 3300025981 | Unclassified | 3710 |
| 862 | Ga0207640_10057844 | 3300025981 | Bacteria | 2552 |
| 863 | Ga0207640_10104686 | 3300025981 | Bacteria | 1992 |
| 864 | Ga0207640_10232017 | 3300025981 | Bacteria | 1420 |
| 865 | Ga0207640_10473881 | 3300025981 | Viruses | 1037 |
| 866 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 867 | Ga0207658_10055939 | 3300025986 | Bacteria | 2926 |
| 868 | Ga0207658_10532878 | 3300025986 | Unclassified | 1049 |
| 869 | Ga0207658_10598570 | 3300025986 | Bacteria | 990 |
| 870 | Ga0207658_11054775 | 3300025986 | Unclassified | 742 |
| 871 | Ga0207677_10279485 | 3300026023 | Bacteria | 1370 |
| 872 | Ga0207677_10650231 | 3300026023 | Unclassified | 930 |
| 873 | Ga0207677_10744261 | 3300026023 | Bacteria | 873 |
| 874 | Ga0207677_11085731 | 3300026023 | Unclassified | 729 |
| 875 | Ga0207703_10048207 | 3300026035 | Bacteria | 3438 |
| 876 | Ga0207703_10053925 | 3300026035 | Unclassified | 3269 |
| 877 | Ga0207703_10065351 | 3300026035 | Bacteria | 2989 |
| 878 | Ga0207703_10119227 | 3300026035 | Bacteria | 2263 |
| 879 | Ga0207703_10124130 | 3300026035 | Bacteria | 2220 |
| 880 | Ga0207703_10209739 | 3300026035 | Bacteria | 1736 |
| 881 | Ga0207703_10230529 | 3300026035 | Bacteria | 1660 |
| 882 | Ga0207703_10255608 | 3300026035 | Bacteria | 1581 |
| 883 | Ga0207703_10366934 | 3300026035 | Bacteria | 1329 |
| 884 | Ga0207703_10557492 | 3300026035 | Bacteria | 1081 |
| 885 | Ga0207703_10774688 | 3300026035 | Bacteria | 915 |
| 886 | Ga0207703_11367214 | 3300026035 | Unclassified | 681 |
| 887 | Ga0207703_12196833 | 3300026035 | Bacteria | 528 |
| 888 | Ga0207639_10058308 | 3300026041 | Unclassified | 2969 |
| 889 | Ga0207639_10202434 | 3300026041 | Bacteria | 1704 |
| 890 | Ga0207639_11415595 | 3300026041 | Unclassified | 652 |
| 891 | Ga0207639_11421490 | 3300026041 | Unclassified | 651 |
| 892 | Ga0207678_10000063 | 3300026067 | Bacteria | 83590 |
| 893 | Ga0207678_10114430 | 3300026067 | Bacteria | 2301 |
| 894 | Ga0207708_10000031 | 3300026075 | Bacteria | 155478 |
| 895 | Ga0207708_10011459 | 3300026075 | Bacteria | 6606 |
| 896 | Ga0207708_10024121 | 3300026075 | Unclassified | 4600 |
| 897 | Ga0207708_10029346 | 3300026075 | Bacteria | 4168 |
| 898 | Ga0207708_10107471 | 3300026075 | Bacteria | 2163 |
| 899 | Ga0207708_10147408 | 3300026075 | Bacteria | 1850 |
| 900 | Ga0207708_11246581 | 3300026075 | Bacteria | 651 |
| 901 | Ga0207702_10019366 | 3300026078 | Bacteria | 5632 |
| 902 | Ga0207702_10067425 | 3300026078 | Unclassified | 3071 |
| 903 | Ga0207702_10524055 | 3300026078 | Unclassified | 1157 |
| 904 | Ga0207641_10005329 | 3300026088 | Bacteria | 10985 |
| 905 | Ga0207641_10011056 | 3300026088 | Bacteria | 7405 |
| 906 | Ga0207641_10013347 | 3300026088 | Bacteria | 6737 |
| 907 | Ga0207641_10063447 | 3300026088 | Bacteria | 3156 |
| 908 | Ga0207641_10111021 | 3300026088 | Bacteria | 2431 |
| 909 | Ga0207641_10161411 | 3300026088 | Bacteria | 2038 |
| 910 | Ga0207641_10313293 | 3300026088 | Bacteria | 1486 |
| 911 | Ga0207641_10317289 | 3300026088 | Unclassified | 1477 |
| 912 | Ga0207641_10367804 | 3300026088 | Bacteria | 1374 |
| 913 | Ga0207641_11056280 | 3300026088 | Bacteria | 810 |
| 914 | Ga0207648_10020342 | 3300026089 | Bacteria | 5979 |
| 915 | Ga0207648_10248278 | 3300026089 | Bacteria | 1586 |
| 916 | Ga0207648_10293272 | 3300026089 | Bacteria | 1457 |
| 917 | Ga0207648_10488797 | 3300026089 | Bacteria | 1125 |
| 918 | Ga0207648_10729582 | 3300026089 | Unclassified | 919 |
| 919 | Ga0207648_10984519 | 3300026089 | Bacteria | 789 |
| 920 | Ga0207676_10050400 | 3300026095 | Bacteria | 3245 |
| 921 | Ga0207676_10987657 | 3300026095 | Bacteria | 829 |
| 922 | Ga0207676_11080994 | 3300026095 | Unclassified | 792 |
| 923 | Ga0207676_11095251 | 3300026095 | Unclassified | 787 |
| 924 | Ga0207676_11975650 | 3300026095 | Unclassified | 582 |
| 925 | Ga0207674_10024472 | 3300026116 | Bacteria | 6453 |
| 926 | Ga0207674_10051992 | 3300026116 | Bacteria | 4179 |
| 927 | Ga0207674_10093324 | 3300026116 | Bacteria | 2998 |
| 928 | Ga0207674_10117589 | 3300026116 | Bacteria | 2629 |
| 929 | Ga0207674_10158463 | 3300026116 | Unclassified | 2218 |
| 930 | Ga0207674_10256618 | 3300026116 | Bacteria | 1695 |
| 931 | Ga0207674_10328366 | 3300026116 | Unclassified | 1479 |
| 932 | Ga0207674_10739673 | 3300026116 | Bacteria | 949 |
| 933 | Ga0207674_10774523 | 3300026116 | Bacteria | 926 |
| 934 | Ga0207674_11174668 | 3300026116 | Unclassified | 737 |
| 935 | Ga0207674_11728298 | 3300026116 | Unclassified | 593 |
| 936 | Ga0207675_100019551 | 3300026118 | Bacteria | 6321 |
| 937 | Ga0207675_100067780 | 3300026118 | Bacteria | 3336 |
| 938 | Ga0207675_100087644 | 3300026118 | Bacteria | 2924 |
| 939 | Ga0207675_100111996 | 3300026118 | Unclassified | 2575 |
| 940 | Ga0207675_100168486 | 3300026118 | Bacteria | 2093 |
| 941 | Ga0207683_10224729 | 3300026121 | Bacteria | 1711 |
| 942 | Ga0207683_10859766 | 3300026121 | Bacteria | 842 |
| 943 | Ga0207698_10037516 | 3300026142 | Bacteria | 3570 |
| 944 | Ga0207698_10102810 | 3300026142 | Bacteria | 2373 |
| 945 | Ga0207698_10463520 | 3300026142 | Bacteria | 1226 |
| 946 | Ga0207698_10549774 | 3300026142 | Unclassified | 1131 |
| 947 | Ga0207698_10818806 | 3300026142 | Bacteria | 934 |
| 948 | Ga0207698_11734898 | 3300026142 | Unclassified | 640 |
| 949 | Ga0209281_1062835 | 3300027111 | Unclassified | 562 |
| 950 | Ga0209179_1027077 | 3300027512 | Bacteria | 1154 |
| 951 | Ga0209813_10061851 | 3300027866 | Unclassified | 1197 |
| 952 | Ga0207428_10003819 | 3300027907 | Bacteria | 14446 |
| 953 | Ga0265357_1002559 | 3300028023 | Unclassified | 1500 |
| 954 | Ga0268266_10400543 | 3300028379 | Bacteria | 1298 |
| 955 | Ga0268265_10195075 | 3300028380 | Bacteria | 1752 |
| 956 | Ga0268265_10530708 | 3300028380 | Bacteria | 1114 |
| 957 | Ga0268265_11051038 | 3300028380 | Unclassified | 806 |
| 958 | Ga0268265_11436928 | 3300028380 | Unclassified | 692 |
| 959 | Ga0268264_10013446 | 3300028381 | Bacteria | 6739 |
| 960 | Ga0268264_10016633 | 3300028381 | Bacteria | 6022 |
| 961 | Ga0268264_10125603 | 3300028381 | Bacteria | 2267 |
| 962 | Ga0268264_10131359 | 3300028381 | Bacteria | 2220 |
| 963 | Ga0268264_10204843 | 3300028381 | Bacteria | 1807 |
| 964 | Ga0268264_10419794 | 3300028381 | Bacteria | 1290 |
| 965 | Ga0268264_10761805 | 3300028381 | Unclassified | 965 |
| 966 | Ga0265323_10013817 | 3300028653 | Bacteria | 3211 |
| 967 | Ga0265322_10003804 | 3300028654 | Bacteria | 4533 |
| 968 | Ga0265338_10000025 | 3300028800 | Bacteria | 296972 |
| 969 | Ga0265338_10046727 | 3300028800 | Unclassified | 3964 |
| 970 | Ga0265338_10542701 | 3300028800 | Unclassified | 815 |
| 971 | Ga0265324_10099914 | 3300029957 | Unclassified | 986 |
| 972 | Ga0316178_1156890 | 3300030735 | Bacteria | 1313 |
| 973 | Ga0265777_100578 | 3300030877 | Bacteria | 1731 |
| 974 | Ga0265325_10024886 | 3300031241 | Unclassified | 3252 |
| 975 | Ga0265325_10071774 | 3300031241 | Unclassified | 1737 |
| 976 | Ga0265329_10078573 | 3300031242 | Unclassified | 1045 |
| 977 | Ga0265339_10065974 | 3300031249 | Bacteria | 1939 |
| 978 | Ga0265331_10004173 | 3300031250 | Bacteria | 9057 |
| 979 | Ga0265327_10008569 | 3300031251 | Bacteria | 7589 |
| 980 | Ga0265316_10002953 | 3300031344 | Bacteria | 17405 |
| 981 | Ga0265316_10043140 | 3300031344 | Unclassified | 3599 |
| 982 | Ga0265316_10052917 | 3300031344 | Bacteria | 3183 |
| 983 | Ga0265316_10426626 | 3300031344 | Bacteria | 953 |
| 984 | Ga0307408_100021160 | 3300031548 | Bacteria | 4399 |
| 985 | Ga0307408_100069176 | 3300031548 | Unclassified | 2602 |
| 986 | Ga0307408_100535709 | 3300031548 | Unclassified | 1031 |
| 987 | Ga0307408_100698352 | 3300031548 | Unclassified | 912 |
| 988 | Ga0265314_10419421 | 3300031711 | Bacteria | 719 |
| 989 | Ga0307405_10004763 | 3300031731 | Bacteria | 6465 |
| 990 | Ga0307405_10054486 | 3300031731 | Bacteria | 2497 |
| 991 | Ga0307413_11170962 | 3300031824 | Unclassified | 667 |
| 992 | Ga0307413_11765526 | 3300031824 | Unclassified | 553 |
| 993 | Ga0307410_10507227 | 3300031852 | Unclassified | 993 |
| 994 | Ga0307406_10012174 | 3300031901 | Bacteria | 4899 |
| 995 | Ga0307407_10818869 | 3300031903 | Unclassified | 709 |
| 996 | Ga0307412_10006276 | 3300031911 | Bacteria | 6711 |
| 997 | Ga0307412_10488672 | 3300031911 | Unclassified | 1022 |
| 998 | Ga0307412_10664465 | 3300031911 | Unclassified | 890 |
| 999 | Ga0307409_101004930 | 3300031995 | Unclassified | 852 |
| 1000 | Ga0307409_101963354 | 3300031995 | Unclassified | 615 |
| 1001 | Ga0307409_102964226 | 3300031995 | Unclassified | 501 |
| 1002 | Ga0307416_100004668 | 3300032002 | Bacteria | 8293 |
| 1003 | Ga0307416_100083037 | 3300032002 | Bacteria | 2716 |
| 1004 | Ga0307416_100248270 | 3300032002 | Bacteria | 1730 |
| 1005 | Ga0307416_100415148 | 3300032002 | Bacteria | 1388 |
| 1006 | Ga0307416_100775201 | 3300032002 | Unclassified | 1053 |
| 1007 | Ga0307414_10001159 | 3300032004 | Bacteria | 13522 |
| 1008 | Ga0307414_10037715 | 3300032004 | Bacteria | 3239 |
| 1009 | Ga0307414_10191807 | 3300032004 | Bacteria | 1654 |
| 1010 | Ga0307414_10194834 | 3300032004 | Unclassified | 1643 |
| 1011 | Ga0307411_10162139 | 3300032005 | Unclassified | 1676 |
| 1012 | Ga0307411_10384682 | 3300032005 | Unclassified | 1155 |
| 1013 | Ga0307411_11021944 | 3300032005 | Unclassified | 741 |
| 1014 | Ga0307411_11632673 | 3300032005 | Unclassified | 595 |
| 1015 | Ga0307411_12242547 | 3300032005 | Bacteria | 512 |
| 1016 | Ga0307411_12264107 | 3300032005 | Unclassified | 510 |
| 1017 | Ga0307411_12296398 | 3300032005 | Unclassified | 507 |
| 1018 | Ga0307415_100002653 | 3300032126 | Bacteria | 8929 |
| 1019 | Ga0307415_100969160 | 3300032126 | Unclassified | 788 |
| 1020 | Ga0307415_101443991 | 3300032126 | Unclassified | 656 |
| 1021 | Ga0307510_10006599 | 3300033180 | Bacteria | 13843 |
| 1022 | Ga0373948_0164300 | 3300034817 | Unclassified | 562 |
| 1023 | Ga0373940_0005965 | 3300035088 | Bacteria | 2675 |
| 1024 | Ga0373949_0201259 | 3300035090 | Unclassified | 598 |
| 1025 | Ga0373951_0115113 | 3300035091 | Unclassified | 727 |
| 1026 | Ga0373923_0346686 | 3300035111 | Unclassified | 709 |
| 1027 | Ga0373932_0181372 | 3300035112 | Bacteria | 739 |
| 1028 | Ga0373936_0248665 | 3300035113 | Unclassified | 794 |
| 1029 | Ga0373939_0136967 | 3300035114 | Unclassified | 879 |
| 1030 | Ga0373941_0013686 | 3300035115 | Bacteria | 2151 |
| 1031 | Ga0373941_0300527 | 3300035115 | Bacteria | 640 |
| 1032 | Ga0373956_0069096 | 3300035119 | Bacteria | 1610 |
| 1033 | Ga0373943_0325163 | 3300035170 | Unclassified | 877 |
| 1034 | Ga0373946_0032531 | 3300035171 | Bacteria | 2095 |
| 1035 | Ga0373946_0081845 | 3300035171 | Bacteria | 1415 |
| 1036 | Ga0373955_0374390 | 3300035172 | Bacteria | 864 |
| 1037 | Ga0373955_0840094 | 3300035172 | Unclassified | 565 |
| 1038 | Ga0373942_0014442 | 3300035207 | Bacteria | 1912 |
| 1039 | Ga0373961_0191375 | 3300035241 | Unclassified | 717 |
| 1040 | Ga0373924_0196769 | 3300035410 | Unclassified | 888 |
| 1041 | Ga0373924_0245809 | 3300035410 | Unclassified | 792 |
| 1042 | Ga0373924_0518959 | 3300035410 | Unclassified | 536 |
| 1043 | Ga0373931_0079920 | 3300035691 | Bacteria | 1802 |
| 1044 | Ga0373931_0369809 | 3300035691 | Unclassified | 901 |
| 1045 | Ga0373935_0023546 | 3300035692 | Bacteria | 3785 |
| 1046 | Ga0373935_0529664 | 3300035692 | Bacteria | 857 |
| 1047 | Ga0373927_0003719 | 3300035695 | Bacteria | 10843 |
| 1048 | Ga0373927_0062443 | 3300035695 | Bacteria | 2409 |
| 1049 | Ga0373947_0015367 | 3300035725 | Bacteria | 4393 |
| 1050 | Ga0373947_0188439 | 3300035725 | Bacteria | 1345 |
| 1051 | Ga0373937_0007350 | 3300036401 | Bacteria | 9538 |
| 1052 | Ga0373937_0168533 | 3300036401 | Bacteria | 2054 |
| 1053 | Ga0373937_0696450 | 3300036401 | Bacteria | 962 |
| 1054 | Ga0373937_0699348 | 3300036401 | Bacteria | 960 |
| 1055 | Ga0373937_0860986 | 3300036401 | Bacteria | 855 |
| 1056 | Ga0373925_0107049 | 3300037068 | Unclassified | 2156 |
| 1057 | Ga0395899_0064500 | 3300037312 | Unclassified | 2693 |
| 1058 | Ga0395900_0003700 | 3300037418 | Bacteria | 16433 |
| 1059 | Ga0395900_1434654 | 3300037418 | Unclassified | 603 |
| 1060 | Ga0395898_0095698 | 3300037466 | Bacteria | 2853 |
| 1061 | Ga0395898_1023159 | 3300037466 | Unclassified | 761 |
| 1062 | Ga0395905_0000496 | 3300037471 | Bacteria | 54071 |
| 1063 | Ga0395905_0027619 | 3300037471 | Bacteria | 5351 |
| 1064 | Ga0436364_0141118 | 3300037853 | Unclassified | 1221 |
| 1065 | Ga0436364_1211847 | 3300037853 | Bacteria | 1063 |
| 1066 | Ga0395901_0001981 | 3300038443 | Bacteria | 21059 |
| 1067 | Ga0395901_0167038 | 3300038443 | Bacteria | 2310 |
| 1068 | Ga0395901_0577963 | 3300038443 | Bacteria | 1136 |
| 1069 | Ga0436365_1376303 | 3300039437 | Bacteria | 20144 |
| 1070 | Ga0436365_1481395 | 3300039437 | Bacteria | 992 |
| 1071 | Ga0436360_0194576 | 3300039438 | Bacteria | 4119 |
| 1072 | Ga0436360_0687086 | 3300039438 | Unclassified | 800 |
| 1073 | Ga0436360_1185407 | 3300039438 | Unclassified | 708 |
| 1074 | Ga0436361_0186403 | 3300039447 | Unclassified | 1680 |
| 1075 | Ga0436361_0248862 | 3300039447 | Unclassified | 1186 |
| 1076 | Ga0436361_0535007 | 3300039447 | Unclassified | 1239 |
| 1077 | Ga0436361_0809850 | 3300039447 | Bacteria | 4801 |
| 1078 | Ga0436362_0107871 | 3300039453 | Bacteria | 1642 |
| 1079 | Ga0439442_079128 | 3300042002 | Bacteria | 703 |
| 1080 | Ga0439448_0053476 | 3300042005 | Bacteria | 1325 |
| 1081 | Ga0439455_0015377 | 3300042012 | Bacteria | 1758 |
| 1082 | Ga0439458_0003739 | 3300042157 | Unclassified | 3526 |
| 1083 | Ga0439435_0106623 | 3300042436 | Bacteria | 866 |
| 1084 | Ga0451577_0224450 | 3300042876 | Bacteria | 1698 |
| 1085 | Ga0451577_0813414 | 3300042876 | Unclassified | 844 |
| 1086 | Ga0451577_1323502 | 3300042876 | Unclassified | 640 |
| 1087 | Ga0453684_0025701 | 3300044712 | Bacteria | 8538 |
| 1088 | Ga0453684_0367864 | 3300044712 | Bacteria | 1617 |
| 1089 | Ga0453684_0595564 | 3300044712 | Unclassified | 1212 |
| 1090 | Ga0453684_0654753 | 3300044712 | Bacteria | 1146 |
| 1091 | Ga0453684_0757827 | 3300044712 | Unclassified | 1050 |
| 1092 | Ga0453684_1006850 | 3300044712 | Bacteria | 886 |
| 1093 | Ga0453684_1511646 | 3300044712 | Bacteria | 692 |
| 1094 | Ga0453684_1707641 | 3300044712 | Unclassified | 643 |
| 1095 | Ga0453684_2365588 | 3300044712 | Unclassified | 527 |
| 1096 | Ga0451576_0013273 | 3300045051 | Bacteria | 9219 |
| 1097 | Ga0451576_0216108 | 3300045051 | Unclassified | 2002 |
| 1098 | Ga0451576_0372584 | 3300045051 | Unclassified | 1496 |
| 1099 | Ga0451576_1896340 | 3300045051 | Bacteria | 615 |
| 1100 | Ga0451576_2050321 | 3300045051 | Bacteria | 589 |
| 1101 | Ga0466967_0178048 | 3300045976 | Bacteria | 2004 |
| 1102 | Ga0495592_0040268 | 3300046454 | Bacteria | 3507 |
| 1103 | Ga0495603_0295167 | 3300046455 | Unclassified | 931 |
| 1104 | Ga0495603_0690843 | 3300046455 | Bacteria | 583 |
| 1105 | Ga0495591_000055 | 3300046458 | Bacteria | 135355 |
| 1106 | Ga0495629_0000008 | 3300046459 | Bacteria | 352138 |
| 1107 | Ga0495629_0001309 | 3300046459 | Bacteria | 19585 |
| 1108 | Ga0495638_0064453 | 3300046460 | Unclassified | 2257 |
| 1109 | Ga0495641_0101417 | 3300046461 | Bacteria | 1284 |
| 1110 | Ga0495651_0000592 | 3300046462 | Bacteria | 28111 |
| 1111 | Ga0495651_0010129 | 3300046462 | Bacteria | 7240 |
| 1112 | Ga0495651_0063218 | 3300046462 | Bacteria | 2830 |
| 1113 | Ga0495653_0007710 | 3300046463 | Bacteria | 8806 |
| 1114 | Ga0495580_0010339 | 3300046472 | Bacteria | 7274 |
| 1115 | Ga0495580_0125249 | 3300046472 | Bacteria | 1783 |
| 1116 | Ga0495580_0622347 | 3300046472 | Unclassified | 712 |
| 1117 | Ga0495582_0062784 | 3300046473 | Bacteria | 2052 |
| 1118 | Ga0495605_0000688 | 3300046474 | Bacteria | 25300 |
| 1119 | Ga0495605_0002297 | 3300046474 | Bacteria | 11924 |
| 1120 | Ga0495639_0001582 | 3300046475 | Bacteria | 10162 |
| 1121 | Ga0495639_0006686 | 3300046475 | Bacteria | 4963 |
| 1122 | Ga0495639_0224510 | 3300046475 | Unclassified | 924 |
| 1123 | Ga0495639_0618009 | 3300046475 | Unclassified | 558 |
| 1124 | Ga0495662_0031533 | 3300046476 | Bacteria | 2561 |
| 1125 | Ga0495664_0006196 | 3300046477 | Bacteria | 6604 |
| 1126 | Ga0495664_0095442 | 3300046477 | Unclassified | 1790 |
| 1127 | Ga0495594_0028185 | 3300046499 | Bacteria | 3029 |
| 1128 | Ga0495594_0029771 | 3300046499 | Bacteria | 2952 |
| 1129 | Ga0495607_0000601 | 3300046501 | Bacteria | 35014 |
| 1130 | Ga0495607_0003860 | 3300046501 | Bacteria | 11292 |
| 1131 | Ga0495607_0007058 | 3300046501 | Bacteria | 7812 |
| 1132 | Ga0495606_0004167 | 3300046507 | Bacteria | 14656 |
| 1133 | Ga0495606_0293353 | 3300046507 | Bacteria | 884 |
| 1134 | Ga0495608_0011180 | 3300046511 | Bacteria | 6248 |
| 1135 | Ga0495610_0181236 | 3300046512 | Bacteria | 876 |
| 1136 | Ga0495618_0142662 | 3300046514 | Bacteria | 1532 |
| 1137 | Ga0495628_0027484 | 3300046516 | Bacteria | 4629 |
| 1138 | Ga0495628_0268689 | 3300046516 | Unclassified | 1269 |
| 1139 | Ga0495630_0010818 | 3300046517 | Bacteria | 6588 |
| 1140 | Ga0495630_0011497 | 3300046517 | Bacteria | 6410 |
| 1141 | Ga0495630_0021829 | 3300046517 | Bacteria | 4727 |
| 1142 | Ga0495630_0146348 | 3300046517 | Bacteria | 1797 |
| 1143 | Ga0495631_0018542 | 3300046518 | Bacteria | 3274 |
| 1144 | Ga0495632_0000124 | 3300046519 | Bacteria | 78023 |
| 1145 | Ga0495637_0012088 | 3300046520 | Bacteria | 4135 |
| 1146 | Ga0495637_0038790 | 3300046520 | Bacteria | 2060 |
| 1147 | Ga0495666_0000817 | 3300046526 | Bacteria | 14415 |
| 1148 | Ga0495666_0007293 | 3300046526 | Bacteria | 5546 |
| 1149 | Ga0495666_0032771 | 3300046526 | Bacteria | 2542 |
| 1150 | Ga0495652_0009953 | 3300046529 | Bacteria | 8618 |
| 1151 | Ga0495652_0108517 | 3300046529 | Bacteria | 2237 |
| 1152 | Ga0495654_0047494 | 3300046530 | Bacteria | 2110 |
| 1153 | Ga0495665_0004930 | 3300046531 | Bacteria | 7196 |
| 1154 | Ga0495640_0131506 | 3300046533 | Bacteria | 1619 |
| 1155 | Ga0495586_0002774 | 3300046535 | Bacteria | 9467 |
| 1156 | Ga0495586_0105383 | 3300046535 | Bacteria | 1567 |
| 1157 | Ga0495586_0140184 | 3300046535 | Bacteria | 1357 |
| 1158 | Ga0495587_0009875 | 3300046536 | Bacteria | 6094 |
| 1159 | Ga0495621_0116159 | 3300046539 | Unclassified | 1030 |
| 1160 | Ga0495597_0000467 | 3300046542 | Bacteria | 34288 |
| 1161 | Ga0495645_0057384 | 3300046543 | Bacteria | 2826 |
| 1162 | Ga0495645_0087772 | 3300046543 | Bacteria | 2225 |
| 1163 | Ga0495645_0154709 | 3300046543 | Bacteria | 1589 |
| 1164 | Ga0495645_0231328 | 3300046543 | Bacteria | 1238 |
| 1165 | Ga0495622_0038871 | 3300046557 | Bacteria | 2215 |
| 1166 | Ga0495667_0087211 | 3300046559 | Bacteria | 2024 |
| 1167 | Ga0495668_0298746 | 3300046616 | Bacteria | 883 |
| 1168 | Ga0495668_0364189 | 3300046616 | Bacteria | 794 |
| 1169 | Ga0495634_0030948 | 3300046642 | Bacteria | 3689 |
| 1170 | Ga0495635_0012021 | 3300046663 | Bacteria | 6068 |
| 1171 | Ga0495635_0013285 | 3300046663 | Bacteria | 5761 |
| 1172 | Ga0495635_0050813 | 3300046663 | Bacteria | 2857 |
| 1173 | Ga0495661_0002707 | 3300046665 | Bacteria | 13503 |
| 1174 | Ga0495661_0267048 | 3300046665 | Bacteria | 867 |
| 1175 | Ga0495657_0039314 | 3300046675 | Bacteria | 3251 |
| 1176 | Ga0495657_0286792 | 3300046675 | Unclassified | 984 |
| 1177 | Ga0495599_0019005 | 3300046678 | Bacteria | 4284 |
| 1178 | Ga0495599_0337292 | 3300046678 | Bacteria | 905 |
| 1179 | Ga0495599_0380939 | 3300046678 | Unclassified | 842 |
| 1180 | Ga0495623_0005122 | 3300046679 | Bacteria | 8602 |
| 1181 | Ga0495623_0505197 | 3300046679 | Unclassified | 638 |
| 1182 | Ga0495646_0000534 | 3300046680 | Bacteria | 20391 |
| 1183 | Ga0495658_0003686 | 3300046683 | Bacteria | 7576 |
| 1184 | Ga0495669_0068817 | 3300046684 | Bacteria | 1611 |
| 1185 | Ga0495613_0017347 | 3300046689 | Bacteria | 5365 |
| 1186 | Ga0495613_0048524 | 3300046689 | Bacteria | 3135 |
| 1187 | Ga0495613_0543266 | 3300046689 | Bacteria | 778 |
| 1188 | Ga0495624_0001421 | 3300046690 | Bacteria | 18642 |
| 1189 | Ga0495624_0163604 | 3300046690 | Bacteria | 1359 |
| 1190 | Ga0495649_0128479 | 3300046694 | Bacteria | 1338 |
| 1191 | Ga0495649_0318131 | 3300046694 | Bacteria | 790 |
| 1192 | Ga0495600_0024437 | 3300046809 | Bacteria | 3889 |
| 1193 | Ga0495600_0262631 | 3300046809 | Bacteria | 1096 |
| 1194 | Ga0495660_0000741 | 3300046810 | Bacteria | 24710 |
| 1195 | Ga0495581_0010103 | 3300047315 | Bacteria | 5462 |
| 1196 | Ga0495581_0024224 | 3300047315 | Bacteria | 3518 |
| 1197 | Ga0495581_0407215 | 3300047315 | Bacteria | 793 |
| 1198 | Ga0495604_0006230 | 3300047317 | Bacteria | 9464 |
| 1199 | Ga0495674_0019922 | 3300047319 | Bacteria | 6219 |
| 1200 | Ga0495674_0051371 | 3300047319 | Bacteria | 3634 |
| 1201 | Ga0495674_0712820 | 3300047319 | Unclassified | 787 |
| 1202 | Ga0495672_0050803 | 3300047320 | Bacteria | 2445 |
| 1203 | Ga0495672_0112157 | 3300047320 | Bacteria | 1462 |
| 1204 | Ga0495680_0001367 | 3300047322 | Bacteria | 26487 |
| 1205 | Ga0495680_0019988 | 3300047322 | Bacteria | 5644 |
| 1206 | Ga0495680_0040480 | 3300047322 | Bacteria | 3712 |
| 1207 | Ga0495683_0141271 | 3300047323 | Bacteria | 1128 |
| 1208 | Ga0495675_0000750 | 3300047444 | Bacteria | 20283 |
| 1209 | Ga0495675_0058320 | 3300047444 | Unclassified | 2448 |
| 1210 | Ga0495684_0004653 | 3300047471 | Bacteria | 10708 |
| 1211 | Ga0495684_0010156 | 3300047471 | Bacteria | 7281 |
| 1212 | Ga0495684_0078192 | 3300047471 | Bacteria | 2511 |
| 1213 | Ga0495684_0187384 | 3300047471 | Bacteria | 1531 |
| 1214 | Ga0495686_0553233 | 3300047472 | Unclassified | 600 |
| 1215 | Ga0495593_0004341 | 3300047673 | Bacteria | 8436 |
| 1216 | Ga0495602_0063244 | 3300048088 | Bacteria | 3207 |
| 1217 | Ga0495602_0151292 | 3300048088 | Unclassified | 1824 |
| 1218 | Ga0495602_0754565 | 3300048088 | Unclassified | 656 |
| 1219 | Ga0495602_0997434 | 3300048088 | Unclassified | 553 |
| 1220 | Ga0495614_0035729 | 3300048089 | Bacteria | 2134 |
| 1221 | Ga0496100_0029585 | 3300048903 | Bacteria | 3390 |
| 1222 | Ga0496100_0658398 | 3300048903 | Unclassified | 816 |
| 1223 | Ga0496100_0862834 | 3300048903 | Unclassified | 710 |
| 1224 | Ga0496101_0341242 | 3300048904 | Bacteria | 1176 |
| 1225 | Ga0496101_0492174 | 3300048904 | Bacteria | 969 |
| 1226 | Ga0496102_0048066 | 3300048905 | Bacteria | 3879 |
| 1227 | Ga0496102_0373914 | 3300048905 | Unclassified | 1341 |
| 1228 | Ga0496104_0289986 | 3300048907 | Unclassified | 1549 |
| 1229 | Ga0496105_0276048 | 3300048908 | Bacteria | 1356 |
| 1230 | Ga0496106_0013491 | 3300048909 | Bacteria | 6034 |
| 1231 | Ga0496106_0062248 | 3300048909 | Bacteria | 2833 |
| 1232 | Ga0496106_1079298 | 3300048909 | Bacteria | 630 |
| 1233 | Ga0496107_0168505 | 3300048910 | Bacteria | 1625 |
| 1234 | Ga0496107_0214350 | 3300048910 | Bacteria | 1432 |
| 1235 | Ga0496107_0414845 | 3300048910 | Unclassified | 1001 |
| 1236 | Ga0496107_0429050 | 3300048910 | Unclassified | 983 |
| 1237 | Ga0496110_1104918 | 3300048913 | Unclassified | 701 |
| 1238 | Ga0496110_1146457 | 3300048913 | Unclassified | 686 |
| 1239 | Ga0496110_1193124 | 3300048913 | Unclassified | 670 |
| 1240 | Ga0496112_0069436 | 3300048915 | Bacteria | 3481 |
| 1241 | Ga0496112_0085313 | 3300048915 | Unclassified | 3124 |
| 1242 | Ga0496112_0309976 | 3300048915 | Bacteria | 1523 |
| 1243 | Ga0496112_0317644 | 3300048915 | Bacteria | 1502 |
| 1244 | Ga0496113_0342076 | 3300048916 | Bacteria | 1200 |
| 1245 | Ga0496113_0350063 | 3300048916 | Unclassified | 1185 |
| 1246 | Ga0496113_0613695 | 3300048916 | Unclassified | 871 |
| 1247 | Ga0496113_0697352 | 3300048916 | Unclassified | 810 |
| 1248 | Ga0496114_0675591 | 3300048917 | Unclassified | 907 |
| 1249 | Ga0496115_0055079 | 3300048918 | Bacteria | 3194 |
| 1250 | Ga0496115_0971380 | 3300048918 | Unclassified | 651 |
| 1251 | Ga0496117_0007672 | 3300048920 | Bacteria | 10451 |
| 1252 | Ga0496118_0000417 | 3300048921 | Bacteria | 70807 |
| 1253 | Ga0496119_0224810 | 3300048922 | Bacteria | 959 |
| 1254 | Ga0496120_0000015 | 3300048923 | Bacteria | 310795 |
| 1255 | Ga0496120_0094939 | 3300048923 | Bacteria | 1586 |
| 1256 | Ga0496121_0042670 | 3300048924 | Bacteria | 3941 |
| 1257 | Ga0496121_0049014 | 3300048924 | Bacteria | 3587 |
| 1258 | Ga0496122_0000487 | 3300048925 | Bacteria | 82253 |
| 1259 | Ga0496123_0000296 | 3300048926 | Bacteria | 97428 |
| 1260 | Ga0496126_0000134 | 3300048929 | Bacteria | 169693 |
| 1261 | Ga0496126_0040020 | 3300048929 | Bacteria | 4347 |
| 1262 | Ga0501308_066314 | 3300049128 | Bacteria | 554 |
| 1263 | Ga0501292_049371 | 3300049515 | Unclassified | 743 |
| 1264 | Ga0501296_002599 | 3300049519 | Bacteria | 1899 |
| 1265 | Ga0501297_027139 | 3300049520 | Unclassified | 745 |
| 1266 | Ga0501298_009993 | 3300049521 | Unclassified | 1623 |
| 1267 | Ga0501299_001927 | 3300049522 | Bacteria | 2802 |
| 1268 | Ga0501299_002643 | 3300049522 | Bacteria | 2499 |
| 1269 | Ga0501299_007922 | 3300049522 | Bacteria | 1712 |
| 1270 | Ga0501032_0153497 | 3300049569 | Unclassified | 1513 |
| 1271 | Ga0501032_0851233 | 3300049569 | Unclassified | 575 |
| 1272 | Ga0501033_0025817 | 3300049570 | Bacteria | 4424 |
| 1273 | Ga0501033_0186327 | 3300049570 | Unclassified | 1486 |
| 1274 | Ga0501034_0075752 | 3300049571 | Bacteria | 3371 |
| 1275 | Ga0501036_0130620 | 3300049572 | Unclassified | 2121 |
| 1276 | Ga0501036_0272262 | 3300049572 | Unclassified | 1417 |
| 1277 | Ga0501037_0063523 | 3300049573 | Bacteria | 2691 |
| 1278 | Ga0501038_0064210 | 3300049574 | Unclassified | 3131 |
| 1279 | Ga0501038_0102746 | 3300049574 | Bacteria | 2378 |
| 1280 | Ga0501039_0058582 | 3300049575 | Bacteria | 2983 |
| 1281 | Ga0501041_0192904 | 3300049577 | Unclassified | 1276 |
| 1282 | Ga0501042_0133621 | 3300049578 | Unclassified | 1788 |
| 1283 | Ga0501042_0398356 | 3300049578 | Unclassified | 997 |
| 1284 | Ga0501042_0597700 | 3300049578 | Unclassified | 802 |
| 1285 | Ga0501043_0007855 | 3300049579 | Bacteria | 8436 |
| 1286 | Ga0501043_0234521 | 3300049579 | Unclassified | 1416 |
| 1287 | Ga0501046_0003788 | 3300049580 | Bacteria | 13844 |
| 1288 | Ga0501046_0007699 | 3300049580 | Bacteria | 9444 |
| 1289 | Ga0501047_0020232 | 3300049581 | Bacteria | 6391 |
| 1290 | Ga0501047_0134230 | 3300049581 | Unclassified | 2355 |
| 1291 | Ga0501047_0143704 | 3300049581 | Unclassified | 2264 |
| 1292 | Ga0501047_0638772 | 3300049581 | Bacteria | 884 |
| 1293 | Ga0501048_0023535 | 3300049582 | Unclassified | 4500 |
| 1294 | Ga0501048_0161957 | 3300049582 | Unclassified | 1583 |
| 1295 | Ga0501048_0230245 | 3300049582 | Unclassified | 1315 |
| 1296 | Ga0501048_0523047 | 3300049582 | Unclassified | 851 |
| 1297 | Ga0501067_0512880 | 3300049583 | Bacteria | 671 |
| 1298 | Ga0501068_0045922 | 3300049584 | Unclassified | 2632 |
| 1299 | Ga0501068_0375207 | 3300049584 | Unclassified | 916 |
| 1300 | Ga0501070_0229139 | 3300049586 | Unclassified | 1522 |
| 1301 | Ga0501071_0033651 | 3300049587 | Unclassified | 3641 |
| 1302 | Ga0501072_0039878 | 3300049588 | Bacteria | 3687 |
| 1303 | Ga0501072_0882498 | 3300049588 | Unclassified | 699 |
| 1304 | Ga0501073_0027493 | 3300049589 | Bacteria | 4067 |
| 1305 | Ga0501074_0053198 | 3300049590 | Bacteria | 2921 |
| 1306 | Ga0501074_0265699 | 3300049590 | Unclassified | 1220 |
| 1307 | Ga0501075_0293967 | 3300049591 | Bacteria | 1237 |
| 1308 | Ga0501075_0322481 | 3300049591 | Unclassified | 1177 |
| 1309 | Ga0501076_0311010 | 3300049592 | Bacteria | 1292 |
| 1310 | Ga0501077_0041307 | 3300049593 | Unclassified | 2936 |
| 1311 | Ga0501077_0193341 | 3300049593 | Bacteria | 1293 |
| 1312 | Ga0501198_000725 | 3300049649 | Bacteria | 4115 |
| 1313 | Ga0501198_018223 | 3300049649 | Unclassified | 1097 |
| 1314 | Ga0501199_003118 | 3300049650 | Bacteria | 1579 |
| 1315 | Ga0501202_000490 | 3300049652 | Bacteria | 5674 |
| 1316 | Ga0501202_002846 | 3300049652 | Bacteria | 2934 |
| 1317 | Ga0501202_005152 | 3300049652 | Bacteria | 2312 |
| 1318 | Ga0501202_015908 | 3300049652 | Bacteria | 1454 |
| 1319 | Ga0501206_006644 | 3300049653 | Unclassified | 1505 |
| 1320 | Ga0501206_015603 | 3300049653 | Unclassified | 1052 |
| 1321 | Ga0501207_000218 | 3300049654 | Bacteria | 5779 |
| 1322 | Ga0501207_025977 | 3300049654 | Unclassified | 963 |
| 1323 | Ga0501208_000649 | 3300049655 | Bacteria | 2874 |
| 1324 | Ga0501209_005521 | 3300049656 | Unclassified | 2289 |
| 1325 | Ga0501214_064639 | 3300049659 | Unclassified | 585 |
| 1326 | Ga0501216_001646 | 3300049660 | Bacteria | 3059 |
| 1327 | Ga0501216_054183 | 3300049660 | Unclassified | 794 |
| 1328 | Ga0501217_001280 | 3300049661 | Unclassified | 4666 |
| 1329 | Ga0501217_002256 | 3300049661 | Bacteria | 3764 |
| 1330 | Ga0501223_002735 | 3300049663 | Bacteria | 3877 |
| 1331 | Ga0501223_020003 | 3300049663 | Unclassified | 1313 |
| 1332 | Ga0501224_006602 | 3300049664 | Unclassified | 1681 |
| 1333 | Ga0501227_001046 | 3300049665 | Bacteria | 6149 |
| 1334 | Ga0501227_012440 | 3300049665 | Unclassified | 1864 |
| 1335 | Ga0501230_001599 | 3300049667 | Unclassified | 2734 |
| 1336 | Ga0501233_000236 | 3300049668 | Bacteria | 8343 |
| 1337 | Ga0501235_000935 | 3300049669 | Bacteria | 6034 |
| 1338 | Ga0501235_005364 | 3300049669 | Bacteria | 2791 |
| 1339 | Ga0501235_007593 | 3300049669 | Bacteria | 2362 |
| 1340 | Ga0501235_037396 | 3300049669 | Unclassified | 1104 |
| 1341 | Ga0501235_191314 | 3300049669 | Unclassified | 550 |
| 1342 | Ga0501240_000663 | 3300049673 | Unclassified | 2966 |
| 1343 | Ga0501243_016172 | 3300049675 | Unclassified | 1203 |
| 1344 | Ga0501243_026823 | 3300049675 | Unclassified | 970 |
| 1345 | Ga0501243_067980 | 3300049675 | Bacteria | 672 |
| 1346 | Ga0501249_029098 | 3300049679 | Unclassified | 1228 |
| 1347 | Ga0501249_103909 | 3300049679 | Bacteria | 682 |
| 1348 | Ga0501251_003043 | 3300049681 | Unclassified | 1654 |
| 1349 | Ga0501252_075629 | 3300049682 | Unclassified | 550 |
| 1350 | Ga0501253_001873 | 3300049683 | Unclassified | 2255 |
| 1351 | Ga0501253_002458 | 3300049683 | Bacteria | 2090 |
| 1352 | Ga0501255_004194 | 3300049684 | Bacteria | 1383 |
| 1353 | Ga0501257_000868 | 3300049686 | Bacteria | 6082 |
| 1354 | Ga0501257_023587 | 3300049686 | Unclassified | 1459 |
| 1355 | Ga0501257_025056 | 3300049686 | Unclassified | 1418 |
| 1356 | Ga0501260_011517 | 3300049689 | Unclassified | 896 |
| 1357 | Ga0501261_003997 | 3300049690 | Bacteria | 1813 |
| 1358 | Ga0501225_0000779 | 3300049705 | Bacteria | 9947 |
| 1359 | Ga0501225_0025582 | 3300049705 | Unclassified | 1623 |
| 1360 | Ga0501225_0038757 | 3300049705 | Unclassified | 1313 |
| 1361 | Ga0501234_000381 | 3300049707 | Bacteria | 6602 |
| 1362 | Ga0501234_011342 | 3300049707 | Unclassified | 1393 |
| 1363 | Ga0501245_002079 | 3300049708 | Bacteria | 2658 |
| 1364 | Ga0501245_065539 | 3300049708 | Bacteria | 673 |
| 1365 | Ga0501079_0111924 | 3300049741 | Bacteria | 2121 |
| 1366 | Ga0501079_0491449 | 3300049741 | Unclassified | 965 |
| 1367 | Ga0501080_0140518 | 3300049742 | Unclassified | 2233 |
| 1368 | Ga0501080_0258322 | 3300049742 | Unclassified | 1587 |
| 1369 | Ga0501081_0483765 | 3300049743 | Bacteria | 921 |
| 1370 | Ga0501081_0512378 | 3300049743 | Bacteria | 895 |
| 1371 | Ga0501083_0003607 | 3300049744 | Bacteria | 10853 |
| 1372 | Ga0501083_0065233 | 3300049744 | Bacteria | 2425 |
| 1373 | Ga0501083_0663109 | 3300049744 | Bacteria | 678 |
| 1374 | Ga0501266_006165 | 3300049763 | Unclassified | 1492 |
| 1375 | Ga0501268_011857 | 3300049765 | Unclassified | 1384 |
| 1376 | Ga0501268_126746 | 3300049765 | Unclassified | 571 |
| 1377 | Ga0501273_071509 | 3300049770 | Unclassified | 563 |
| 1378 | Ga0501279_107255 | 3300049775 | Unclassified | 509 |
| 1379 | Ga0501283_032281 | 3300049779 | Unclassified | 882 |
| 1380 | Ga0501035_0047901 | 3300049822 | Unclassified | 3834 |
| 1381 | Ga0501035_0222706 | 3300049822 | Bacteria | 1610 |
| 1382 | Ga0501044_0028621 | 3300049823 | Bacteria | 5881 |
| 1383 | Ga0501044_0056539 | 3300049823 | Bacteria | 4029 |
| 1384 | Ga0501044_0103630 | 3300049823 | Bacteria | 2859 |
| 1385 | Ga0501044_0391603 | 3300049823 | Unclassified | 1303 |
| 1386 | Ga0501044_0522925 | 3300049823 | Unclassified | 1086 |
| 1387 | Ga0501045_0065337 | 3300049824 | Bacteria | 2671 |
| 1388 | Ga0501045_0095567 | 3300049824 | Unclassified | 2198 |
| 1389 | Ga0501045_0437251 | 3300049824 | Unclassified | 973 |
| 1390 | Ga0501045_0575657 | 3300049824 | Bacteria | 834 |
| 1391 | Ga0501204_002772 | 3300049850 | Unclassified | 1801 |
| 1392 | Ga0501204_003700 | 3300049850 | Bacteria | 1622 |
| 1393 | Ga0501212_011399 | 3300049851 | Unclassified | 1280 |
| 1394 | nmdc:mga00v17_19908_c1 | 3300050491 | Bacteria | 3837 |
| 1395 | nmdc:mga00v17_461782_c1 | 3300050491 | Bacteria | 824 |
| 1396 | nmdc:mga0yw44_254512_c1 | 3300050492 | Bacteria | 1169 |
| 1397 | nmdc:mga0yw44_305029_c1 | 3300050492 | Archaea | 1067 |
| 1398 | nmdc:mga06z11_131389_c1 | 3300050494 | Unclassified | 1406 |
| 1399 | nmdc:mga04h51_32364_c1 | 3300050495 | Bacteria | 1658 |
| 1400 | nmdc:mga05p37_1104784_c1 | 3300050507 | Unclassified | 830 |
| 1401 | nmdc:mga05p37_133107_c1 | 3300050507 | Bacteria | 3050 |
| 1402 | nmdc:mga05p37_138586_c1 | 3300050507 | Bacteria | 2982 |
| 1403 | nmdc:mga05p37_1473857_c1 | 3300050507 | Unclassified | 680 |
| 1404 | nmdc:mga05p37_249005_c1 | 3300050507 | Bacteria | 2132 |
| 1405 | nmdc:mga05p37_299137_c1 | 3300050507 | Unclassified | 1913 |
| 1406 | nmdc:mga05p37_393021_c1 | 3300050507 | Unclassified | 1621 |
| 1407 | nmdc:mga05p37_569548_c1 | 3300050507 | Bacteria | 1285 |
| 1408 | nmdc:mga05p37_604548_c1 | 3300050507 | Bacteria | 1237 |
| 1409 | nmdc:mga05p37_82279_c1 | 3300050507 | Bacteria | 3967 |
| 1410 | nmdc:mga05p37_837111_c1 | 3300050507 | Bacteria | 1001 |
| 1411 | nmdc:mga09592_1314419_c1 | 3300050508 | Unclassified | 594 |
| 1412 | nmdc:mga09592_1424806_c1 | 3300050508 | Bacteria | 566 |
| 1413 | nmdc:mga09592_147894_c1 | 3300050508 | Unclassified | 2026 |
| 1414 | nmdc:mga09592_150680_c1 | 3300050508 | Bacteria | 2006 |
| 1415 | nmdc:mga09592_158039_c1 | 3300050508 | Bacteria | 1957 |
| 1416 | nmdc:mga09592_297543_c1 | 3300050508 | Unclassified | 969 |
| 1417 | nmdc:mga09592_34375_c1 | 3300050508 | Bacteria | 4237 |
| 1418 | nmdc:mga0qj67_23468_c1 | 3300050509 | Bacteria | 4747 |
| 1419 | nmdc:mga0qj67_78665_c1 | 3300050509 | Bacteria | 2640 |
| 1420 | nmdc:mga0qj67_993385_c1 | 3300050509 | Unclassified | 659 |
| 1421 | nmdc:mga06r32_12645_c1 | 3300050510 | Bacteria | 7627 |
| 1422 | nmdc:mga06r32_142135_c1 | 3300050510 | Unclassified | 2377 |
| 1423 | nmdc:mga06r32_1767719_c1 | 3300050510 | Unclassified | 554 |
| 1424 | nmdc:mga06r32_256434_c1 | 3300050510 | Unclassified | 1737 |
| 1425 | nmdc:mga06r32_67531_c1 | 3300050510 | Bacteria | 3452 |
| 1426 | nmdc:mga06r32_771142_c1 | 3300050510 | Bacteria | 924 |
| 1427 | nmdc:mga06r32_917772_c1 | 3300050510 | Bacteria | 831 |
| 1428 | nmdc:mga08y16_4844_c1 | 3300050511 | Bacteria | 14046 |
| 1429 | nmdc:mga08y16_612708_c1 | 3300050511 | Bacteria | 1096 |
| 1430 | nmdc:mga08y16_625050_c1 | 3300050511 | Bacteria | 1083 |
| 1431 | nmdc:mga0n895_2019706_c1 | 3300050512 | Bacteria | 534 |
| 1432 | nmdc:mga0n895_21383_c2 | 3300050512 | Bacteria | 5098 |
| 1433 | nmdc:mga0n895_418175_c1 | 3300050512 | Bacteria | 1355 |
| 1434 | nmdc:mga0n895_49967_c1 | 3300050512 | Unclassified | 4099 |
| 1435 | nmdc:mga0n895_638112_c1 | 3300050512 | Bacteria | 1065 |
| 1436 | nmdc:mga0n895_655061_c1 | 3300050512 | Unclassified | 1049 |
| 1437 | nmdc:mga0n895_79689_c1 | 3300050512 | Bacteria | 3262 |
| 1438 | nmdc:mga0n895_828524_c1 | 3300050512 | Bacteria | 914 |
| 1439 | nmdc:mga0n895_84854_c1 | 3300050512 | Bacteria | 3161 |
| 1440 | nmdc:mga0rr50_10870_c1 | 3300050513 | Bacteria | 5803 |
| 1441 | nmdc:mga0rr50_159550_c2 | 3300050513 | Bacteria | 1628 |
| 1442 | nmdc:mga0rr50_437062_c1 | 3300050513 | Unclassified | 1108 |
| 1443 | nmdc:mga0rr50_557209_c1 | 3300050513 | Bacteria | 976 |
| 1444 | nmdc:mga0rr50_81725_c1 | 3300050513 | Unclassified | 2494 |
| 1445 | nmdc:mga0rr50_901041_c1 | 3300050513 | Bacteria | 754 |
| 1446 | nmdc:mga08x19_29739_c1 | 3300050514 | Bacteria | 3428 |
| 1447 | nmdc:mga08x19_446960_c1 | 3300050514 | Unclassified | 910 |
| 1448 | nmdc:mga08x19_52113_c1 | 3300050514 | Bacteria | 2631 |
| 1449 | nmdc:mga08x19_8890_c2 | 3300050514 | Bacteria | 4143 |
| 1450 | nmdc:mga0a205_1818_c1 | 3300050515 | Bacteria | 18463 |
| 1451 | nmdc:mga0a205_23201_c1 | 3300050515 | Bacteria | 5885 |
| 1452 | nmdc:mga0a205_258878_c1 | 3300050515 | Bacteria | 1618 |
| 1453 | nmdc:mga0a205_287608_c1 | 3300050515 | Bacteria | 1519 |
| 1454 | nmdc:mga0a205_32605_c1 | 3300050515 | Bacteria | 4995 |
| 1455 | nmdc:mga0a205_485682_c1 | 3300050515 | Bacteria | 1093 |
| 1456 | nmdc:mga0a205_521490_c1 | 3300050515 | Bacteria | 1045 |
| 1457 | nmdc:mga0a205_672085_c1 | 3300050515 | Unclassified | 886 |
| 1458 | nmdc:mga0a205_84565_c1 | 3300050515 | Bacteria | 3065 |
| 1459 | nmdc:mga0a205_98978_c1 | 3300050515 | Unclassified | 2815 |
| 1460 | Ga0495601_0006301 | 3300053077 | Bacteria | 6932 |
| 1461 | Ga0495601_0071464 | 3300053077 | Bacteria | 2216 |
| 1462 | Ga0495612_0004392 | 3300053078 | Bacteria | 5847 |
| 1463 | Ga0495612_0442182 | 3300053078 | Bacteria | 593 |
| 1464 | Ga0495619_0003359 | 3300053085 | Bacteria | 10344 |
| 1465 | Ga0500646_0046586 | 3300053090 | Bacteria | 1238 |
| 1466 | Ga0500641_0010526 | 3300053096 | Bacteria | 3344 |
| 1467 | Ga0500641_0035065 | 3300053096 | Bacteria | 2000 |
| 1468 | Ga0500650_0268609 | 3300053098 | Bacteria | 761 |
| 1469 | Ga0500562_016583 | 3300053108 | Bacteria | 1895 |
| 1470 | Ga0500608_004909 | 3300053122 | Bacteria | 5239 |
| 1471 | Ga0500642_0013299 | 3300053130 | Bacteria | 3020 |
| 1472 | Ga0500658_0144767 | 3300053134 | Archaea | 1068 |
| 1473 | Ga0500568_0006953 | 3300053139 | Bacteria | 5609 |
| 1474 | Ga0500604_0008348 | 3300053151 | Bacteria | 2747 |
| 1475 | Ga0501084_0695291 | 3300054114 | Bacteria | 857 |
| 1476 | Ga0587077_106237 | 3300059493 | Bacteria | 681 |
| 1477 | Ga0501082_0160029 | 3300060353 | Unclassified | 1956 |
| 1478 | Ga0501082_0294096 | 3300060353 | Unclassified | 1414 |
| 1479 | Ga0530510_0098595 | 3300061734 | Unclassified | 2136 |
| 1480 | Ga0530510_0597578 | 3300061734 | Unclassified | 839 |
| 1481 | Ga0530510_1476698 | 3300061734 | Unclassified | 522 |
| 1482 | Ga0530510_1537451 | 3300061734 | Bacteria | 511 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002773 | JGI25152J39213_1000688 | JGI25152J39213_10006888 | 93 |
| 2 | 3300002774 | JGI25150J39212_1000029 | JGI25150J39212_100002915 | 93 |
| 3 | 3300003187 | JGI25151J46595_10000003 | JGI25151J46595_1000000387 | 93 |
| 4 | 3300003215 | JGI25153J46596_10000111 | JGI25153J46596_1000011120 | 93 |
| 5 | 3300005329 | Ga0070683_102347483 | Ga0070683_1023474831 | 95 |
| 6 | 3300005614 | Ga0068856_100012621 | Ga0068856_1000126216 | 95 |
| 7 | 3300013296 | Ga0157374_10762675 | Ga0157374_107626753 | 95 |
| 8 | 3300025944 | Ga0207661_12100559 | Ga0207661_121005592 | 95 |
| 9 | 3300026078 | Ga0207702_10019366 | Ga0207702_100193663 | 95 |
| 10 | 3300033180 | Ga0307510_10006599 | Ga0307510_100065998 | 95 |
| 11 | 3300037312 | Ga0395899_0064500 | Ga0395899_0064500_675_974 | 95 |
| 12 | 3300037418 | Ga0395900_0003700 | Ga0395900_0003700_175_474 | 95 |
| 13 | 3300037466 | Ga0395898_0095698 | Ga0395898_0095698_2339_2638 | 95 |
| 14 | 3300037471 | Ga0395905_0000496 | Ga0395905_0000496_31974_32273 | 95 |
| 15 | 3300038443 | Ga0395901_0001981 | Ga0395901_0001981_19520_19819 | 95 |
| 16 | 3300046507 | Ga0495606_0293353 | Ga0495606_0293353_251_541 | 95 |
| 17 | 3300046518 | Ga0495631_0018542 | Ga0495631_0018542_593_883 | 95 |
| 18 | 3300046665 | Ga0495661_0002707 | Ga0495661_0002707_1779_2069 | 95 |
| 19 | 3300046694 | Ga0495649_0128479 | Ga0495649_0128479_853_1143 | 95 |
| 20 | 3300047323 | Ga0495683_0141271 | Ga0495683_0141271_241_531 | 95 |
| 21 | 3300053098 | Ga0500650_0268609 | Ga0500650_0268609_229_519 | 95 |
| 22 | 3300053122 | Ga0500608_004909 | Ga0500608_004909_1079_1369 | 95 |
| 23 | 3300053130 | Ga0500642_0013299 | Ga0500642_0013299_2295_2585 | 95 |
| 24 | 3300006871 | Ga0075434_100920597 | Ga0075434_1009205972 | 96 |
| 25 | 3300032004 | Ga0307414_10191807 | Ga0307414_101918073 | 96 |
| 26 | 3300005327 | Ga0070658_10438120 | Ga0070658_104381203 | 99 |
| 27 | 3300005339 | Ga0070660_100319579 | Ga0070660_1003195792 | 99 |
| 28 | 3300005467 | Ga0070706_100013681 | Ga0070706_1000136814 | 99 |
| 29 | 3300005468 | Ga0070707_100002026 | Ga0070707_1000020265 | 99 |
| 30 | 3300005471 | Ga0070698_100002337 | Ga0070698_1000023375 | 99 |
| 31 | 3300005518 | Ga0070699_100016852 | Ga0070699_1000168525 | 99 |
| 32 | 3300005536 | Ga0070697_100001942 | Ga0070697_10000194213 | 99 |
| 33 | 3300005536 | Ga0070697_101066501 | Ga0070697_1010665012 | 99 |
| 34 | 3300006881 | Ga0068865_101826935 | Ga0068865_1018269351 | 99 |
| 35 | 3300007265 | Ga0099794_10118826 | Ga0099794_101188262 | 99 |
| 36 | 3300007265 | Ga0099794_10609591 | Ga0099794_106095911 | 99 |
| 37 | 3300017792 | Ga0163161_10599060 | Ga0163161_105990602 | 99 |
| 38 | 3300025922 | Ga0207646_10014742 | Ga0207646_100147422 | 99 |
| 39 | 3300027111 | Ga0209281_1062835 | Ga0209281_10628351 | 99 |
| 40 | 3300005327 | Ga0070658_10817412 | Ga0070658_108174122 | 100 |
| 41 | 3300005333 | Ga0070677_10027751 | Ga0070677_100277512 | 100 |
| 42 | 3300005335 | Ga0070666_10533187 | Ga0070666_105331872 | 100 |
| 43 | 3300005345 | Ga0070692_10337572 | Ga0070692_103375722 | 100 |
| 44 | 3300005355 | Ga0070671_100362852 | Ga0070671_1003628522 | 100 |
| 45 | 3300005364 | Ga0070673_100158066 | Ga0070673_1001580663 | 100 |
| 46 | 3300005434 | Ga0070709_10013306 | Ga0070709_100133063 | 100 |
| 47 | 3300005435 | Ga0070714_100029717 | Ga0070714_1000297172 | 100 |
| 48 | 3300005436 | Ga0070713_100008030 | Ga0070713_1000080305 | 100 |
| 49 | 3300005438 | Ga0070701_10696198 | Ga0070701_106961982 | 100 |
| 50 | 3300005439 | Ga0070711_100054278 | Ga0070711_1000542782 | 100 |
| 51 | 3300005439 | Ga0070711_100249578 | Ga0070711_1002495782 | 100 |
| 52 | 3300005456 | Ga0070678_100122300 | Ga0070678_1001223003 | 100 |
| 53 | 3300005456 | Ga0070678_100137934 | Ga0070678_1001379343 | 100 |
| 54 | 3300005457 | Ga0070662_100044676 | Ga0070662_1000446763 | 100 |
| 55 | 3300005466 | Ga0070685_10749380 | Ga0070685_107493801 | 100 |
| 56 | 3300005535 | Ga0070684_100471665 | Ga0070684_1004716653 | 100 |
| 57 | 3300005564 | Ga0070664_100147198 | Ga0070664_1001471982 | 100 |
| 58 | 3300005615 | Ga0070702_100717072 | Ga0070702_1007170722 | 100 |
| 59 | 3300005616 | Ga0068852_100576037 | Ga0068852_1005760372 | 100 |
| 60 | 3300006028 | Ga0070717_10350918 | Ga0070717_103509182 | 100 |
| 61 | 3300006175 | Ga0070712_100271318 | Ga0070712_1002713182 | 100 |
| 62 | 3300006175 | Ga0070712_101135254 | Ga0070712_1011352542 | 100 |
| 63 | 3300006871 | Ga0075434_100426526 | Ga0075434_1004265262 | 100 |
| 64 | 3300006914 | Ga0075436_100032565 | Ga0075436_1000325653 | 100 |
| 65 | 3300007076 | Ga0075435_100026093 | Ga0075435_1000260935 | 100 |
| 66 | 3300009098 | Ga0105245_10207569 | Ga0105245_102075692 | 100 |
| 67 | 3300009148 | Ga0105243_11378469 | Ga0105243_113784692 | 100 |
| 68 | 3300009177 | Ga0105248_11863139 | Ga0105248_118631392 | 100 |
| 69 | 3300013306 | Ga0163162_12088802 | Ga0163162_120888021 | 100 |
| 70 | 3300014326 | Ga0157380_11474538 | Ga0157380_114745382 | 100 |
| 71 | 3300014326 | Ga0157380_12077935 | Ga0157380_120779352 | 100 |
| 72 | 3300025906 | Ga0207699_10013633 | Ga0207699_100136332 | 100 |
| 73 | 3300025915 | Ga0207693_10137841 | Ga0207693_101378412 | 100 |
| 74 | 3300025916 | Ga0207663_10437271 | Ga0207663_104372711 | 100 |
| 75 | 3300025928 | Ga0207700_10021700 | Ga0207700_100217005 | 100 |
| 76 | 3300025929 | Ga0207664_10007641 | Ga0207664_100076415 | 100 |
| 77 | 3300031344 | Ga0265316_10002953 | Ga0265316_1000295313 | 100 |
| 78 | 3300046460 | Ga0495638_0064453 | Ga0495638_0064453_840_1175 | 100 |
| 79 | 3300046616 | Ga0495668_0364189 | Ga0495668_0364189_439_774 | 100 |
| 80 | 3300048910 | Ga0496107_0429050 | Ga0496107_0429050_92_430 | 100 |
| 81 | 3300048922 | Ga0496119_0224810 | Ga0496119_0224810_388_723 | 100 |
| 82 | 3300050492 | nmdc:mga0yw44_305029_c1 | nmdc:mga0yw44_305029_c1_548_883 | 100 |
| 83 | 3300050513 | nmdc:mga0rr50_81725_c1 | nmdc:mga0rr50_81725_c1_1570_1908 | 100 |
| 84 | 3300050514 | nmdc:mga08x19_446960_c1 | nmdc:mga08x19_446960_c1_548_886 | 100 |
| 85 | 3300053090 | Ga0500646_0046586 | Ga0500646_0046586_871_1206 | 100 |
| 86 | 3300053096 | Ga0500641_0010526 | Ga0500641_0010526_2814_3149 | 100 |
| 87 | 3300053108 | Ga0500562_016583 | Ga0500562_016583_147_482 | 100 |
| 88 | 3300053134 | Ga0500658_0144767 | Ga0500658_0144767_690_1025 | 100 |
| 89 | 3300053151 | Ga0500604_0008348 | Ga0500604_0008348_131_466 | 100 |
| 90 | 3300009093 | Ga0105240_10069492 | Ga0105240_100694924 | 101 |
| 91 | 3300009093 | Ga0105240_10487977 | Ga0105240_104879772 | 101 |
| 92 | 3300009545 | Ga0105237_11079792 | Ga0105237_110797922 | 101 |
| 93 | 3300013296 | Ga0157374_10775355 | Ga0157374_107753552 | 101 |
| 94 | 3300013297 | Ga0157378_12475754 | Ga0157378_124757541 | 101 |
| 95 | 3300025913 | Ga0207695_10386215 | Ga0207695_103862152 | 101 |
| 96 | 3300025913 | Ga0207695_10528397 | Ga0207695_105283973 | 101 |
| 97 | 3300025914 | Ga0207671_11049111 | Ga0207671_110491112 | 101 |
| 98 | 3300026142 | Ga0207698_10818806 | Ga0207698_108188062 | 101 |
| 99 | 3300049583 | Ga0501067_0512880 | Ga0501067_0512880_19_351 | 101 |
| 100 | 3300050513 | nmdc:mga0rr50_437062_c1 | nmdc:mga0rr50_437062_c1_23_358 | 101 |
| 101 | 3300061734 | Ga0530510_1537451 | Ga0530510_1537451_40_417 | 101 |
| 102 | 3300005293 | Ga0065715_10029450 | Ga0065715_100294502 | 102 |
| 103 | 3300005331 | Ga0070670_100522332 | Ga0070670_1005223322 | 102 |
| 104 | 3300005334 | Ga0068869_100615077 | Ga0068869_1006150772 | 102 |
| 105 | 3300005335 | Ga0070666_10046823 | Ga0070666_100468234 | 102 |
| 106 | 3300005335 | Ga0070666_11390719 | Ga0070666_113907191 | 102 |
| 107 | 3300005338 | Ga0068868_100012556 | Ga0068868_10001255610 | 102 |
| 108 | 3300005338 | Ga0068868_100770503 | Ga0068868_1007705032 | 102 |
| 109 | 3300005341 | Ga0070691_10194282 | Ga0070691_101942822 | 102 |
| 110 | 3300005355 | Ga0070671_100677124 | Ga0070671_1006771242 | 102 |
| 111 | 3300005356 | Ga0070674_100185681 | Ga0070674_1001856812 | 102 |
| 112 | 3300005356 | Ga0070674_101530658 | Ga0070674_1015306581 | 102 |
| 113 | 3300005364 | Ga0070673_100100149 | Ga0070673_1001001492 | 102 |
| 114 | 3300005366 | Ga0070659_100472087 | Ga0070659_1004720872 | 102 |
| 115 | 3300005440 | Ga0070705_100196042 | Ga0070705_1001960422 | 102 |
| 116 | 3300005441 | Ga0070700_100298797 | Ga0070700_1002987973 | 102 |
| 117 | 3300005444 | Ga0070694_100741551 | Ga0070694_1007415511 | 102 |
| 118 | 3300005455 | Ga0070663_101037906 | Ga0070663_1010379062 | 102 |
| 119 | 3300005456 | Ga0070678_100167517 | Ga0070678_1001675172 | 102 |
| 120 | 3300005456 | Ga0070678_101682184 | Ga0070678_1016821842 | 102 |
| 121 | 3300005456 | Ga0070678_102045544 | Ga0070678_1020455441 | 102 |
| 122 | 3300005457 | Ga0070662_100593930 | Ga0070662_1005939302 | 102 |
| 123 | 3300005459 | Ga0068867_100030715 | Ga0068867_1000307154 | 102 |
| 124 | 3300005544 | Ga0070686_101380743 | Ga0070686_1013807432 | 102 |
| 125 | 3300005544 | Ga0070686_101707684 | Ga0070686_1017076841 | 102 |
| 126 | 3300005545 | Ga0070695_100096015 | Ga0070695_1000960153 | 102 |
| 127 | 3300005546 | Ga0070696_101752780 | Ga0070696_1017527801 | 102 |
| 128 | 3300005547 | Ga0070693_100068397 | Ga0070693_1000683973 | 102 |
| 129 | 3300005547 | Ga0070693_100265603 | Ga0070693_1002656032 | 102 |
| 130 | 3300005548 | Ga0070665_100385874 | Ga0070665_1003858742 | 102 |
| 131 | 3300005564 | Ga0070664_100411881 | Ga0070664_1004118812 | 102 |
| 132 | 3300005578 | Ga0068854_100111833 | Ga0068854_1001118333 | 102 |
| 133 | 3300005578 | Ga0068854_100400651 | Ga0068854_1004006513 | 102 |
| 134 | 3300005615 | Ga0070702_100082972 | Ga0070702_1000829722 | 102 |
| 135 | 3300005617 | Ga0068859_100142052 | Ga0068859_1001420523 | 102 |
| 136 | 3300005718 | Ga0068866_10071181 | Ga0068866_100711812 | 102 |
| 137 | 3300005718 | Ga0068866_10104172 | Ga0068866_101041723 | 102 |
| 138 | 3300005719 | Ga0068861_100130894 | Ga0068861_1001308942 | 102 |
| 139 | 3300005842 | Ga0068858_100120385 | Ga0068858_1001203853 | 102 |
| 140 | 3300005842 | Ga0068858_100218134 | Ga0068858_1002181342 | 102 |
| 141 | 3300005843 | Ga0068860_100184278 | Ga0068860_1001842783 | 102 |
| 142 | 3300005843 | Ga0068860_100312423 | Ga0068860_1003124232 | 102 |
| 143 | 3300005844 | Ga0068862_100521314 | Ga0068862_1005213143 | 102 |
| 144 | 3300006237 | Ga0097621_100000225 | Ga0097621_10000022519 | 102 |
| 145 | 3300006237 | Ga0097621_101018727 | Ga0097621_1010187271 | 102 |
| 146 | 3300006358 | Ga0068871_100000307 | Ga0068871_10000030734 | 102 |
| 147 | 3300006358 | Ga0068871_100280233 | Ga0068871_1002802333 | 102 |
| 148 | 3300006847 | Ga0075431_100036946 | Ga0075431_1000369462 | 102 |
| 149 | 3300006881 | Ga0068865_100405526 | Ga0068865_1004055262 | 102 |
| 150 | 3300006931 | Ga0097620_100142049 | Ga0097620_1001420493 | 102 |
| 151 | 3300007076 | Ga0075435_101190363 | Ga0075435_1011903632 | 102 |
| 152 | 3300007265 | Ga0099794_10206644 | Ga0099794_102066441 | 102 |
| 153 | 3300009098 | Ga0105245_10005352 | Ga0105245_100053528 | 102 |
| 154 | 3300009098 | Ga0105245_10060430 | Ga0105245_100604302 | 102 |
| 155 | 3300009148 | Ga0105243_10042170 | Ga0105243_100421703 | 102 |
| 156 | 3300009174 | Ga0105241_10070230 | Ga0105241_100702303 | 102 |
| 157 | 3300009174 | Ga0105241_11693467 | Ga0105241_116934672 | 102 |
| 158 | 3300009176 | Ga0105242_10019893 | Ga0105242_100198933 | 102 |
| 159 | 3300009177 | Ga0105248_10273169 | Ga0105248_102731692 | 102 |
| 160 | 3300009553 | Ga0105249_10352646 | Ga0105249_103526462 | 102 |
| 161 | 3300010375 | Ga0105239_10266243 | Ga0105239_102662432 | 102 |
| 162 | 3300010375 | Ga0105239_12546674 | Ga0105239_125466742 | 102 |
| 163 | 3300013296 | Ga0157374_10087667 | Ga0157374_100876672 | 102 |
| 164 | 3300013297 | Ga0157378_10006067 | Ga0157378_100060674 | 102 |
| 165 | 3300013297 | Ga0157378_11096721 | Ga0157378_110967212 | 102 |
| 166 | 3300013306 | Ga0163162_10159868 | Ga0163162_101598682 | 102 |
| 167 | 3300013306 | Ga0163162_10177363 | Ga0163162_101773633 | 102 |
| 168 | 3300013307 | Ga0157372_10995488 | Ga0157372_109954881 | 102 |
| 169 | 3300013308 | Ga0157375_10571993 | Ga0157375_105719932 | 102 |
| 170 | 3300014969 | Ga0157376_10174223 | Ga0157376_101742232 | 102 |
| 171 | 3300025315 | Ga0207697_10040232 | Ga0207697_100402322 | 102 |
| 172 | 3300025899 | Ga0207642_10071929 | Ga0207642_100719292 | 102 |
| 173 | 3300025899 | Ga0207642_10175858 | Ga0207642_101758582 | 102 |
| 174 | 3300025901 | Ga0207688_10494503 | Ga0207688_104945031 | 102 |
| 175 | 3300025907 | Ga0207645_10016652 | Ga0207645_100166525 | 102 |
| 176 | 3300025917 | Ga0207660_10670720 | Ga0207660_106707201 | 102 |
| 177 | 3300025918 | Ga0207662_10015810 | Ga0207662_100158102 | 102 |
| 178 | 3300025923 | Ga0207681_10256526 | Ga0207681_102565262 | 102 |
| 179 | 3300025927 | Ga0207687_10011493 | Ga0207687_100114933 | 102 |
| 180 | 3300025927 | Ga0207687_10189967 | Ga0207687_101899672 | 102 |
| 181 | 3300025928 | Ga0207700_11126299 | Ga0207700_111262992 | 102 |
| 182 | 3300025932 | Ga0207690_10107500 | Ga0207690_101075001 | 102 |
| 183 | 3300025933 | Ga0207706_10231877 | Ga0207706_102318773 | 102 |
| 184 | 3300025934 | Ga0207686_10008369 | Ga0207686_100083693 | 102 |
| 185 | 3300025937 | Ga0207669_11895116 | Ga0207669_118951162 | 102 |
| 186 | 3300025938 | Ga0207704_10912573 | Ga0207704_109125731 | 102 |
| 187 | 3300025941 | Ga0207711_10207379 | Ga0207711_102073792 | 102 |
| 188 | 3300025942 | Ga0207689_10028761 | Ga0207689_100287612 | 102 |
| 189 | 3300025960 | Ga0207651_10152772 | Ga0207651_101527723 | 102 |
| 190 | 3300025960 | Ga0207651_10261897 | Ga0207651_102618973 | 102 |
| 191 | 3300025981 | Ga0207640_10023432 | Ga0207640_100234323 | 102 |
| 192 | 3300025986 | Ga0207658_10532878 | Ga0207658_105328782 | 102 |
| 193 | 3300025986 | Ga0207658_10598570 | Ga0207658_105985702 | 102 |
| 194 | 3300026023 | Ga0207677_10279485 | Ga0207677_102794853 | 102 |
| 195 | 3300026023 | Ga0207677_10744261 | Ga0207677_107442611 | 102 |
| 196 | 3300026035 | Ga0207703_10124130 | Ga0207703_101241301 | 102 |
| 197 | 3300026035 | Ga0207703_10230529 | Ga0207703_102305292 | 102 |
| 198 | 3300026067 | Ga0207678_10114430 | Ga0207678_101144301 | 102 |
| 199 | 3300026075 | Ga0207708_10011459 | Ga0207708_100114596 | 102 |
| 200 | 3300026118 | Ga0207675_100019551 | Ga0207675_1000195516 | 102 |
| 201 | 3300026121 | Ga0207683_10224729 | Ga0207683_102247293 | 102 |
| 202 | 3300026121 | Ga0207683_10859766 | Ga0207683_108597662 | 102 |
| 203 | 3300027512 | Ga0209179_1027077 | Ga0209179_10270772 | 102 |
| 204 | 3300028381 | Ga0268264_10125603 | Ga0268264_101256033 | 102 |
| 205 | 3300030877 | Ga0265777_100578 | Ga0265777_1005782 | 102 |
| 206 | 3300035090 | Ga0373949_0201259 | Ga0373949_0201259_216_551 | 102 |
| 207 | 3300035111 | Ga0373923_0346686 | Ga0373923_0346686_290_628 | 102 |
| 208 | 3300035114 | Ga0373939_0136967 | Ga0373939_0136967_310_648 | 102 |
| 209 | 3300035170 | Ga0373943_0325163 | Ga0373943_0325163_263_601 | 102 |
| 210 | 3300035207 | Ga0373942_0014442 | Ga0373942_0014442_352_687 | 102 |
| 211 | 3300035241 | Ga0373961_0191375 | Ga0373961_0191375_229_564 | 102 |
| 212 | 3300035410 | Ga0373924_0196769 | Ga0373924_0196769_393_725 | 102 |
| 213 | 3300035691 | Ga0373931_0079920 | Ga0373931_0079920_292_627 | 102 |
| 214 | 3300035692 | Ga0373935_0023546 | Ga0373935_0023546_1684_2022 | 102 |
| 215 | 3300035695 | Ga0373927_0062443 | Ga0373927_0062443_1485_1823 | 102 |
| 216 | 3300035725 | Ga0373947_0188439 | Ga0373947_0188439_273_611 | 102 |
| 217 | 3300036401 | Ga0373937_0007350 | Ga0373937_0007350_8789_9124 | 102 |
| 218 | 3300037068 | Ga0373925_0107049 | Ga0373925_0107049_1561_1899 | 102 |
| 219 | 3300044712 | Ga0453684_0595564 | Ga0453684_0595564_726_1061 | 102 |
| 220 | 3300046458 | Ga0495591_000055 | Ga0495591_000055_123699_124031 | 102 |
| 221 | 3300046474 | Ga0495605_0000688 | Ga0495605_0000688_8460_8792 | 102 |
| 222 | 3300046474 | Ga0495605_0002297 | Ga0495605_0002297_9075_9407 | 102 |
| 223 | 3300046475 | Ga0495639_0618009 | Ga0495639_0618009_81_419 | 102 |
| 224 | 3300046501 | Ga0495607_0000601 | Ga0495607_0000601_20717_21049 | 102 |
| 225 | 3300046501 | Ga0495607_0003860 | Ga0495607_0003860_6361_6693 | 102 |
| 226 | 3300046501 | Ga0495607_0007058 | Ga0495607_0007058_748_1080 | 102 |
| 227 | 3300046507 | Ga0495606_0004167 | Ga0495606_0004167_9095_9427 | 102 |
| 228 | 3300046512 | Ga0495610_0181236 | Ga0495610_0181236_51_383 | 102 |
| 229 | 3300046517 | Ga0495630_0146348 | Ga0495630_0146348_199_537 | 102 |
| 230 | 3300046520 | Ga0495637_0038790 | Ga0495637_0038790_640_972 | 102 |
| 231 | 3300046526 | Ga0495666_0032771 | Ga0495666_0032771_1038_1376 | 102 |
| 232 | 3300046530 | Ga0495654_0047494 | Ga0495654_0047494_878_1210 | 102 |
| 233 | 3300046542 | Ga0495597_0000467 | Ga0495597_0000467_19409_19741 | 102 |
| 234 | 3300046684 | Ga0495669_0068817 | Ga0495669_0068817_532_873 | 102 |
| 235 | 3300046810 | Ga0495660_0000741 | Ga0495660_0000741_13437_13769 | 102 |
| 236 | 3300047320 | Ga0495672_0112157 | Ga0495672_0112157_850_1182 | 102 |
| 237 | 3300047472 | Ga0495686_0553233 | Ga0495686_0553233_10_342 | 102 |
| 238 | 3300048905 | Ga0496102_0373914 | Ga0496102_0373914_680_1015 | 102 |
| 239 | 3300048909 | Ga0496106_0062248 | Ga0496106_0062248_280_615 | 102 |
| 240 | 3300048910 | Ga0496107_0168505 | Ga0496107_0168505_61_396 | 102 |
| 241 | 3300048916 | Ga0496113_0613695 | Ga0496113_0613695_367_702 | 102 |
| 242 | 3300053077 | Ga0495601_0071464 | Ga0495601_0071464_1429_1764 | 102 |
| 243 | 3300005329 | Ga0070683_100516004 | Ga0070683_1005160042 | 103 |
| 244 | 3300005330 | Ga0070690_100077793 | Ga0070690_1000777932 | 103 |
| 245 | 3300005337 | Ga0070682_100007313 | Ga0070682_1000073135 | 103 |
| 246 | 3300005340 | Ga0070689_100265605 | Ga0070689_1002656051 | 103 |
| 247 | 3300005340 | Ga0070689_100410462 | Ga0070689_1004104622 | 103 |
| 248 | 3300005343 | Ga0070687_101495390 | Ga0070687_1014953901 | 103 |
| 249 | 3300005355 | Ga0070671_100060167 | Ga0070671_1000601674 | 103 |
| 250 | 3300005364 | Ga0070673_100024795 | Ga0070673_1000247952 | 103 |
| 251 | 3300005367 | Ga0070667_101676777 | Ga0070667_1016767772 | 103 |
| 252 | 3300005438 | Ga0070701_10030762 | Ga0070701_100307622 | 103 |
| 253 | 3300005439 | Ga0070711_101637585 | Ga0070711_1016375852 | 103 |
| 254 | 3300005440 | Ga0070705_101916729 | Ga0070705_1019167291 | 103 |
| 255 | 3300005444 | Ga0070694_101415001 | Ga0070694_1014150012 | 103 |
| 256 | 3300005445 | Ga0070708_100092854 | Ga0070708_1000928542 | 103 |
| 257 | 3300005458 | Ga0070681_10163416 | Ga0070681_101634162 | 103 |
| 258 | 3300005467 | Ga0070706_100043443 | Ga0070706_1000434435 | 103 |
| 259 | 3300005468 | Ga0070707_100065847 | Ga0070707_1000658473 | 103 |
| 260 | 3300005536 | Ga0070697_100085712 | Ga0070697_1000857123 | 103 |
| 261 | 3300005539 | Ga0068853_101658324 | Ga0068853_1016583241 | 103 |
| 262 | 3300005543 | Ga0070672_100040436 | Ga0070672_1000404363 | 103 |
| 263 | 3300005544 | Ga0070686_100015451 | Ga0070686_1000154515 | 103 |
| 264 | 3300005545 | Ga0070695_100220069 | Ga0070695_1002200692 | 103 |
| 265 | 3300005549 | Ga0070704_100060754 | Ga0070704_1000607544 | 103 |
| 266 | 3300005615 | Ga0070702_100385897 | Ga0070702_1003858972 | 103 |
| 267 | 3300005616 | Ga0068852_100512949 | Ga0068852_1005129492 | 103 |
| 268 | 3300005834 | Ga0068851_10208635 | Ga0068851_102086351 | 103 |
| 269 | 3300005841 | Ga0068863_100046714 | Ga0068863_1000467144 | 103 |
| 270 | 3300006871 | Ga0075434_100246544 | Ga0075434_1002465442 | 103 |
| 271 | 3300009101 | Ga0105247_10128587 | Ga0105247_101285873 | 103 |
| 272 | 3300013105 | Ga0157369_10987187 | Ga0157369_109871872 | 103 |
| 273 | 3300013296 | Ga0157374_10004474 | Ga0157374_100044745 | 103 |
| 274 | 3300013297 | Ga0157378_10000134 | Ga0157378_1000013435 | 103 |
| 275 | 3300013308 | Ga0157375_11273242 | Ga0157375_112732422 | 103 |
| 276 | 3300014326 | Ga0157380_11604021 | Ga0157380_116040212 | 103 |
| 277 | 3300025931 | Ga0207644_10075526 | Ga0207644_100755262 | 103 |
| 278 | 3300025936 | Ga0207670_10309090 | Ga0207670_103090903 | 103 |
| 279 | 3300025936 | Ga0207670_10751891 | Ga0207670_107518912 | 103 |
| 280 | 3300025940 | Ga0207691_10023578 | Ga0207691_100235784 | 103 |
| 281 | 3300025941 | Ga0207711_10046701 | Ga0207711_100467012 | 103 |
| 282 | 3300025960 | Ga0207651_10004480 | Ga0207651_100044805 | 103 |
| 283 | 3300026078 | Ga0207702_10067425 | Ga0207702_100674252 | 103 |
| 284 | 3300026088 | Ga0207641_10063447 | Ga0207641_100634472 | 103 |
| 285 | 3300026142 | Ga0207698_10037516 | Ga0207698_100375164 | 103 |
| 286 | 3300028023 | Ga0265357_1002559 | Ga0265357_10025593 | 103 |
| 287 | 3300028381 | Ga0268264_10204843 | Ga0268264_102048433 | 103 |
| 288 | 3300028800 | Ga0265338_10046727 | Ga0265338_100467273 | 103 |
| 289 | 3300029957 | Ga0265324_10099914 | Ga0265324_100999142 | 103 |
| 290 | 3300031241 | Ga0265325_10024886 | Ga0265325_100248863 | 103 |
| 291 | 3300031241 | Ga0265325_10071774 | Ga0265325_100717742 | 103 |
| 292 | 3300031250 | Ga0265331_10004173 | Ga0265331_100041731 | 103 |
| 293 | 3300031251 | Ga0265327_10008569 | Ga0265327_100085696 | 103 |
| 294 | 3300031344 | Ga0265316_10043140 | Ga0265316_100431402 | 103 |
| 295 | 3300031344 | Ga0265316_10426626 | Ga0265316_104266262 | 103 |
| 296 | 3300035112 | Ga0373932_0181372 | Ga0373932_0181372_194_535 | 103 |
| 297 | 3300035113 | Ga0373936_0248665 | Ga0373936_0248665_177_554 | 103 |
| 298 | 3300035171 | Ga0373946_0081845 | Ga0373946_0081845_233_610 | 103 |
| 299 | 3300035410 | Ga0373924_0245809 | Ga0373924_0245809_147_524 | 103 |
| 300 | 3300035695 | Ga0373927_0003719 | Ga0373927_0003719_5818_6195 | 103 |
| 301 | 3300035725 | Ga0373947_0015367 | Ga0373947_0015367_2489_2866 | 103 |
| 302 | 3300036401 | Ga0373937_0168533 | Ga0373937_0168533_1524_1901 | 103 |
| 303 | 3300046455 | Ga0495603_0295167 | Ga0495603_0295167_123_461 | 103 |
| 304 | 3300046462 | Ga0495651_0000592 | Ga0495651_0000592_15374_15751 | 103 |
| 305 | 3300046462 | Ga0495651_0010129 | Ga0495651_0010129_5193_5570 | 103 |
| 306 | 3300046463 | Ga0495653_0007710 | Ga0495653_0007710_7282_7659 | 103 |
| 307 | 3300046472 | Ga0495580_0010339 | Ga0495580_0010339_3140_3517 | 103 |
| 308 | 3300046477 | Ga0495664_0006196 | Ga0495664_0006196_1263_1640 | 103 |
| 309 | 3300046499 | Ga0495594_0029771 | Ga0495594_0029771_1129_1467 | 103 |
| 310 | 3300046511 | Ga0495608_0011180 | Ga0495608_0011180_3284_3661 | 103 |
| 311 | 3300046514 | Ga0495618_0142662 | Ga0495618_0142662_867_1244 | 103 |
| 312 | 3300046516 | Ga0495628_0027484 | Ga0495628_0027484_1062_1439 | 103 |
| 313 | 3300046517 | Ga0495630_0010818 | Ga0495630_0010818_4187_4564 | 103 |
| 314 | 3300046526 | Ga0495666_0007293 | Ga0495666_0007293_1272_1649 | 103 |
| 315 | 3300046529 | Ga0495652_0009953 | Ga0495652_0009953_7426_7803 | 103 |
| 316 | 3300046531 | Ga0495665_0004930 | Ga0495665_0004930_5695_6072 | 103 |
| 317 | 3300046535 | Ga0495586_0105383 | Ga0495586_0105383_154_531 | 103 |
| 318 | 3300046535 | Ga0495586_0140184 | Ga0495586_0140184_98_475 | 103 |
| 319 | 3300046536 | Ga0495587_0009875 | Ga0495587_0009875_1822_2199 | 103 |
| 320 | 3300046539 | Ga0495621_0116159 | Ga0495621_0116159_168_530 | 103 |
| 321 | 3300046543 | Ga0495645_0154709 | Ga0495645_0154709_761_1138 | 103 |
| 322 | 3300046543 | Ga0495645_0231328 | Ga0495645_0231328_597_974 | 103 |
| 323 | 3300046559 | Ga0495667_0087211 | Ga0495667_0087211_496_873 | 103 |
| 324 | 3300046663 | Ga0495635_0013285 | Ga0495635_0013285_3237_3614 | 103 |
| 325 | 3300046675 | Ga0495657_0039314 | Ga0495657_0039314_936_1313 | 103 |
| 326 | 3300046678 | Ga0495599_0019005 | Ga0495599_0019005_3367_3744 | 103 |
| 327 | 3300046679 | Ga0495623_0005122 | Ga0495623_0005122_3284_3661 | 103 |
| 328 | 3300046680 | Ga0495646_0000534 | Ga0495646_0000534_3114_3491 | 103 |
| 329 | 3300046689 | Ga0495613_0048524 | Ga0495613_0048524_1627_2004 | 103 |
| 330 | 3300046690 | Ga0495624_0001421 | Ga0495624_0001421_8187_8564 | 103 |
| 331 | 3300046694 | Ga0495649_0318131 | Ga0495649_0318131_11_361 | 103 |
| 332 | 3300046809 | Ga0495600_0262631 | Ga0495600_0262631_300_677 | 103 |
| 333 | 3300047315 | Ga0495581_0407215 | Ga0495581_0407215_263_640 | 103 |
| 334 | 3300047317 | Ga0495604_0006230 | Ga0495604_0006230_2920_3297 | 103 |
| 335 | 3300047319 | Ga0495674_0051371 | Ga0495674_0051371_1629_2006 | 103 |
| 336 | 3300047322 | Ga0495680_0019988 | Ga0495680_0019988_2870_3247 | 103 |
| 337 | 3300047444 | Ga0495675_0000750 | Ga0495675_0000750_16870_17247 | 103 |
| 338 | 3300047444 | Ga0495675_0058320 | Ga0495675_0058320_300_677 | 103 |
| 339 | 3300047471 | Ga0495684_0004653 | Ga0495684_0004653_7188_7565 | 103 |
| 340 | 3300047471 | Ga0495684_0010156 | Ga0495684_0010156_978_1358 | 103 |
| 341 | 3300047673 | Ga0495593_0004341 | Ga0495593_0004341_4687_5064 | 103 |
| 342 | 3300048088 | Ga0495602_0063244 | Ga0495602_0063244_1813_2190 | 103 |
| 343 | 3300048089 | Ga0495614_0035729 | Ga0495614_0035729_187_564 | 103 |
| 344 | 3300048915 | Ga0496112_0085313 | Ga0496112_0085313_1601_1978 | 103 |
| 345 | 3300050512 | nmdc:mga0n895_418175_c1 | nmdc:mga0n895_418175_c1_193_531 | 103 |
| 346 | 3300053078 | Ga0495612_0004392 | Ga0495612_0004392_1235_1612 | 103 |
| 347 | 3300005329 | Ga0070683_100173834 | Ga0070683_1001738342 | 104 |
| 348 | 3300005330 | Ga0070690_100051342 | Ga0070690_1000513423 | 104 |
| 349 | 3300005334 | Ga0068869_100618833 | Ga0068869_1006188331 | 104 |
| 350 | 3300005335 | Ga0070666_10160492 | Ga0070666_101604923 | 104 |
| 351 | 3300005335 | Ga0070666_10340793 | Ga0070666_103407932 | 104 |
| 352 | 3300005337 | Ga0070682_100519050 | Ga0070682_1005190502 | 104 |
| 353 | 3300005340 | Ga0070689_100042806 | Ga0070689_1000428064 | 104 |
| 354 | 3300005340 | Ga0070689_101036632 | Ga0070689_1010366321 | 104 |
| 355 | 3300005340 | Ga0070689_101501104 | Ga0070689_1015011041 | 104 |
| 356 | 3300005345 | Ga0070692_10487586 | Ga0070692_104875861 | 104 |
| 357 | 3300005355 | Ga0070671_100269878 | Ga0070671_1002698783 | 104 |
| 358 | 3300005366 | Ga0070659_100068418 | Ga0070659_1000684182 | 104 |
| 359 | 3300005367 | Ga0070667_100263315 | Ga0070667_1002633153 | 104 |
| 360 | 3300005437 | Ga0070710_10179285 | Ga0070710_101792851 | 104 |
| 361 | 3300005439 | Ga0070711_100295116 | Ga0070711_1002951162 | 104 |
| 362 | 3300005440 | Ga0070705_100130731 | Ga0070705_1001307311 | 104 |
| 363 | 3300005444 | Ga0070694_101182447 | Ga0070694_1011824471 | 104 |
| 364 | 3300005459 | Ga0068867_100093381 | Ga0068867_1000933813 | 104 |
| 365 | 3300005535 | Ga0070684_100319557 | Ga0070684_1003195572 | 104 |
| 366 | 3300005539 | Ga0068853_100117977 | Ga0068853_1001179772 | 104 |
| 367 | 3300005546 | Ga0070696_100294506 | Ga0070696_1002945062 | 104 |
| 368 | 3300005547 | Ga0070693_100005417 | Ga0070693_1000054174 | 104 |
| 369 | 3300005547 | Ga0070693_100814402 | Ga0070693_1008144022 | 104 |
| 370 | 3300005548 | Ga0070665_101630959 | Ga0070665_1016309592 | 104 |
| 371 | 3300005563 | Ga0068855_100079053 | Ga0068855_1000790533 | 104 |
| 372 | 3300005563 | Ga0068855_101557801 | Ga0068855_1015578011 | 104 |
| 373 | 3300005564 | Ga0070664_100194953 | Ga0070664_1001949532 | 104 |
| 374 | 3300005577 | Ga0068857_100073529 | Ga0068857_1000735292 | 104 |
| 375 | 3300005578 | Ga0068854_100041418 | Ga0068854_1000414182 | 104 |
| 376 | 3300005614 | Ga0068856_100069494 | Ga0068856_1000694943 | 104 |
| 377 | 3300005616 | Ga0068852_100020623 | Ga0068852_1000206232 | 104 |
| 378 | 3300005617 | Ga0068859_100933268 | Ga0068859_1009332683 | 104 |
| 379 | 3300005618 | Ga0068864_100407953 | Ga0068864_1004079532 | 104 |
| 380 | 3300005718 | Ga0068866_10869875 | Ga0068866_108698752 | 104 |
| 381 | 3300005834 | Ga0068851_10025195 | Ga0068851_100251953 | 104 |
| 382 | 3300005840 | Ga0068870_11201221 | Ga0068870_112012212 | 104 |
| 383 | 3300005842 | Ga0068858_100269751 | Ga0068858_1002697512 | 104 |
| 384 | 3300005842 | Ga0068858_100406120 | Ga0068858_1004061203 | 104 |
| 385 | 3300005843 | Ga0068860_100004514 | Ga0068860_1000045147 | 104 |
| 386 | 3300006163 | Ga0070715_10295620 | Ga0070715_102956203 | 104 |
| 387 | 3300006173 | Ga0070716_100483907 | Ga0070716_1004839072 | 104 |
| 388 | 3300006175 | Ga0070712_100821580 | Ga0070712_1008215801 | 104 |
| 389 | 3300006237 | Ga0097621_100292296 | Ga0097621_1002922962 | 104 |
| 390 | 3300006358 | Ga0068871_100010943 | Ga0068871_1000109432 | 104 |
| 391 | 3300006844 | Ga0075428_100017222 | Ga0075428_1000172224 | 104 |
| 392 | 3300006880 | Ga0075429_100160274 | Ga0075429_1001602742 | 104 |
| 393 | 3300006881 | Ga0068865_100785309 | Ga0068865_1007853091 | 104 |
| 394 | 3300006931 | Ga0097620_100933284 | Ga0097620_1009332842 | 104 |
| 395 | 3300009098 | Ga0105245_10138781 | Ga0105245_101387813 | 104 |
| 396 | 3300009098 | Ga0105245_12598837 | Ga0105245_125988372 | 104 |
| 397 | 3300009101 | Ga0105247_10942886 | Ga0105247_109428862 | 104 |
| 398 | 3300009148 | Ga0105243_12784933 | Ga0105243_127849332 | 104 |
| 399 | 3300009174 | Ga0105241_10017892 | Ga0105241_100178923 | 104 |
| 400 | 3300009174 | Ga0105241_12606950 | Ga0105241_126069501 | 104 |
| 401 | 3300009176 | Ga0105242_10044056 | Ga0105242_100440563 | 104 |
| 402 | 3300009176 | Ga0105242_10082006 | Ga0105242_100820062 | 104 |
| 403 | 3300009177 | Ga0105248_10012433 | Ga0105248_100124333 | 104 |
| 404 | 3300009177 | Ga0105248_10132054 | Ga0105248_101320542 | 104 |
| 405 | 3300009545 | Ga0105237_10073724 | Ga0105237_100737243 | 104 |
| 406 | 3300009545 | Ga0105237_10670830 | Ga0105237_106708301 | 104 |
| 407 | 3300009551 | Ga0105238_10134093 | Ga0105238_101340932 | 104 |
| 408 | 3300009551 | Ga0105238_11145396 | Ga0105238_111453962 | 104 |
| 409 | 3300010375 | Ga0105239_10009785 | Ga0105239_100097859 | 104 |
| 410 | 3300010375 | Ga0105239_10606063 | Ga0105239_106060632 | 104 |
| 411 | 3300013100 | Ga0157373_11064080 | Ga0157373_110640802 | 104 |
| 412 | 3300013296 | Ga0157374_10129570 | Ga0157374_101295703 | 104 |
| 413 | 3300013296 | Ga0157374_10487709 | Ga0157374_104877092 | 104 |
| 414 | 3300013297 | Ga0157378_10001025 | Ga0157378_1000102512 | 104 |
| 415 | 3300013306 | Ga0163162_10036150 | Ga0163162_100361503 | 104 |
| 416 | 3300013306 | Ga0163162_10433584 | Ga0163162_104335842 | 104 |
| 417 | 3300013307 | Ga0157372_10063742 | Ga0157372_100637423 | 104 |
| 418 | 3300013307 | Ga0157372_10617125 | Ga0157372_106171253 | 104 |
| 419 | 3300025321 | Ga0207656_10069665 | Ga0207656_100696652 | 104 |
| 420 | 3300025903 | Ga0207680_10463775 | Ga0207680_104637752 | 104 |
| 421 | 3300025911 | Ga0207654_10006238 | Ga0207654_100062382 | 104 |
| 422 | 3300025914 | Ga0207671_10392020 | Ga0207671_103920202 | 104 |
| 423 | 3300025915 | Ga0207693_10521423 | Ga0207693_105214232 | 104 |
| 424 | 3300025916 | Ga0207663_10271478 | Ga0207663_102714783 | 104 |
| 425 | 3300025920 | Ga0207649_10054868 | Ga0207649_100548683 | 104 |
| 426 | 3300025924 | Ga0207694_10078555 | Ga0207694_100785552 | 104 |
| 427 | 3300025927 | Ga0207687_10108394 | Ga0207687_101083942 | 104 |
| 428 | 3300025927 | Ga0207687_10620108 | Ga0207687_106201082 | 104 |
| 429 | 3300025931 | Ga0207644_10326688 | Ga0207644_103266882 | 104 |
| 430 | 3300025933 | Ga0207706_10081965 | Ga0207706_100819653 | 104 |
| 431 | 3300025934 | Ga0207686_10203774 | Ga0207686_102037742 | 104 |
| 432 | 3300025935 | Ga0207709_11292147 | Ga0207709_112921472 | 104 |
| 433 | 3300025936 | Ga0207670_10026837 | Ga0207670_100268371 | 104 |
| 434 | 3300025939 | Ga0207665_10206078 | Ga0207665_102060783 | 104 |
| 435 | 3300025939 | Ga0207665_10315360 | Ga0207665_103153603 | 104 |
| 436 | 3300025941 | Ga0207711_10082965 | Ga0207711_100829654 | 104 |
| 437 | 3300025941 | Ga0207711_10110981 | Ga0207711_101109813 | 104 |
| 438 | 3300025942 | Ga0207689_10352077 | Ga0207689_103520772 | 104 |
| 439 | 3300025944 | Ga0207661_10419604 | Ga0207661_104196042 | 104 |
| 440 | 3300025945 | Ga0207679_10111021 | Ga0207679_101110212 | 104 |
| 441 | 3300025949 | Ga0207667_10019013 | Ga0207667_100190137 | 104 |
| 442 | 3300025981 | Ga0207640_10057844 | Ga0207640_100578442 | 104 |
| 443 | 3300025986 | Ga0207658_11054775 | Ga0207658_110547752 | 104 |
| 444 | 3300026035 | Ga0207703_10065351 | Ga0207703_100653512 | 104 |
| 445 | 3300026035 | Ga0207703_10557492 | Ga0207703_105574923 | 104 |
| 446 | 3300026041 | Ga0207639_10202434 | Ga0207639_102024342 | 104 |
| 447 | 3300026078 | Ga0207702_10524055 | Ga0207702_105240552 | 104 |
| 448 | 3300026089 | Ga0207648_10020342 | Ga0207648_100203423 | 104 |
| 449 | 3300026095 | Ga0207676_11095251 | Ga0207676_110952512 | 104 |
| 450 | 3300026116 | Ga0207674_10328366 | Ga0207674_103283662 | 104 |
| 451 | 3300026142 | Ga0207698_10549774 | Ga0207698_105497743 | 104 |
| 452 | 3300028381 | Ga0268264_10013446 | Ga0268264_100134464 | 104 |
| 453 | 3300032005 | Ga0307411_12264107 | Ga0307411_122641072 | 104 |
| 454 | 3300045051 | Ga0451576_0372584 | Ga0451576_0372584_1066_1404 | 104 |
| 455 | 3300046678 | Ga0495599_0337292 | Ga0495599_0337292_524_856 | 104 |
| 456 | 3300047471 | Ga0495684_0187384 | Ga0495684_0187384_39_383 | 104 |
| 457 | 3300048903 | Ga0496100_0658398 | Ga0496100_0658398_222_560 | 104 |
| 458 | 3300048903 | Ga0496100_0862834 | Ga0496100_0862834_29_367 | 104 |
| 459 | 3300048904 | Ga0496101_0492174 | Ga0496101_0492174_124_462 | 104 |
| 460 | 3300048905 | Ga0496102_0048066 | Ga0496102_0048066_483_821 | 104 |
| 461 | 3300048909 | Ga0496106_0013491 | Ga0496106_0013491_2374_2712 | 104 |
| 462 | 3300048910 | Ga0496107_0214350 | Ga0496107_0214350_893_1231 | 104 |
| 463 | 3300048913 | Ga0496110_1146457 | Ga0496110_1146457_247_585 | 104 |
| 464 | 3300048915 | Ga0496112_0069436 | Ga0496112_0069436_2979_3311 | 104 |
| 465 | 3300048918 | Ga0496115_0971380 | Ga0496115_0971380_185_523 | 104 |
| 466 | 3300049744 | Ga0501083_0663109 | Ga0501083_0663109_35_367 | 104 |
| 467 | 3300050491 | nmdc:mga00v17_461782_c1 | nmdc:mga00v17_461782_c1_354_692 | 104 |
| 468 | 3300050507 | nmdc:mga05p37_604548_c1 | nmdc:mga05p37_604548_c1_696_1034 | 104 |
| 469 | 3300050508 | nmdc:mga09592_1424806_c1 | nmdc:mga09592_1424806_c1_86_424 | 104 |
| 470 | 3300050515 | nmdc:mga0a205_485682_c1 | nmdc:mga0a205_485682_c1_625_963 | 104 |
| 471 | 3300005444 | Ga0070694_100813722 | Ga0070694_1008137222 | 105 |
| 472 | 3300005544 | Ga0070686_100247208 | Ga0070686_1002472082 | 105 |
| 473 | 3300005617 | Ga0068859_100037836 | Ga0068859_1000378362 | 105 |
| 474 | 3300005617 | Ga0068859_101906871 | Ga0068859_1019068712 | 105 |
| 475 | 3300005719 | Ga0068861_100639481 | Ga0068861_1006394812 | 105 |
| 476 | 3300005843 | Ga0068860_101337475 | Ga0068860_1013374751 | 105 |
| 477 | 3300006847 | Ga0075431_100001499 | Ga0075431_10000149916 | 105 |
| 478 | 3300006880 | Ga0075429_100421960 | Ga0075429_1004219602 | 105 |
| 479 | 3300006931 | Ga0097620_100037831 | Ga0097620_1000378312 | 105 |
| 480 | 3300006931 | Ga0097620_101906626 | Ga0097620_1019066262 | 105 |
| 481 | 3300007076 | Ga0075435_101021246 | Ga0075435_1010212461 | 105 |
| 482 | 3300009094 | Ga0111539_10033847 | Ga0111539_100338472 | 105 |
| 483 | 3300013306 | Ga0163162_13443810 | Ga0163162_134438102 | 105 |
| 484 | 3300025960 | Ga0207651_11058865 | Ga0207651_110588652 | 105 |
| 485 | 3300026075 | Ga0207708_10107471 | Ga0207708_101074712 | 105 |
| 486 | 3300026118 | Ga0207675_100168486 | Ga0207675_1001684863 | 105 |
| 487 | 3300028380 | Ga0268265_10195075 | Ga0268265_101950751 | 105 |
| 488 | 3300031995 | Ga0307409_101963354 | Ga0307409_1019633542 | 105 |
| 489 | 3300032002 | Ga0307416_100775201 | Ga0307416_1007752012 | 105 |
| 490 | 3300032004 | Ga0307414_10194834 | Ga0307414_101948342 | 105 |
| 491 | 3300032005 | Ga0307411_11021944 | Ga0307411_110219442 | 105 |
| 492 | 3300032005 | Ga0307411_12242547 | Ga0307411_122425471 | 105 |
| 493 | 3300032126 | Ga0307415_101443991 | Ga0307415_1014439912 | 105 |
| 494 | 3300037471 | Ga0395905_0027619 | Ga0395905_0027619_4025_4357 | 105 |
| 495 | 3300042436 | Ga0439435_0106623 | Ga0439435_0106623_321_680 | 105 |
| 496 | 3300046517 | Ga0495630_0011497 | Ga0495630_0011497_2205_2591 | 105 |
| 497 | 3300047319 | Ga0495674_0712820 | Ga0495674_0712820_236_622 | 105 |
| 498 | 3300048088 | Ga0495602_0151292 | Ga0495602_0151292_732_1118 | 105 |
| 499 | 3300049128 | Ga0501308_066314 | Ga0501308_066314_118_450 | 105 |
| 500 | 3300049569 | Ga0501032_0851233 | Ga0501032_0851233_134_484 | 105 |
| 501 | 3300049570 | Ga0501033_0025817 | Ga0501033_0025817_2218_2568 | 105 |
| 502 | 3300049571 | Ga0501034_0075752 | Ga0501034_0075752_487_837 | 105 |
| 503 | 3300049572 | Ga0501036_0130620 | Ga0501036_0130620_539_889 | 105 |
| 504 | 3300049574 | Ga0501038_0102746 | Ga0501038_0102746_1207_1557 | 105 |
| 505 | 3300049577 | Ga0501041_0192904 | Ga0501041_0192904_621_971 | 105 |
| 506 | 3300049578 | Ga0501042_0597700 | Ga0501042_0597700_259_609 | 105 |
| 507 | 3300049580 | Ga0501046_0007699 | Ga0501046_0007699_5727_6077 | 105 |
| 508 | 3300049581 | Ga0501047_0134230 | Ga0501047_0134230_313_663 | 105 |
| 509 | 3300049582 | Ga0501048_0230245 | Ga0501048_0230245_307_657 | 105 |
| 510 | 3300049588 | Ga0501072_0039878 | Ga0501072_0039878_1867_2217 | 105 |
| 511 | 3300049589 | Ga0501073_0027493 | Ga0501073_0027493_1293_1652 | 105 |
| 512 | 3300049591 | Ga0501075_0293967 | Ga0501075_0293967_390_740 | 105 |
| 513 | 3300049592 | Ga0501076_0311010 | Ga0501076_0311010_508_858 | 105 |
| 514 | 3300049669 | Ga0501235_191314 | Ga0501235_191314_141_482 | 105 |
| 515 | 3300049743 | Ga0501081_0512378 | Ga0501081_0512378_489_839 | 105 |
| 516 | 3300049823 | Ga0501044_0028621 | Ga0501044_0028621_4066_4416 | 105 |
| 517 | 3300049824 | Ga0501045_0095567 | Ga0501045_0095567_1581_1931 | 105 |
| 518 | 3300050508 | nmdc:mga09592_150680_c1 | nmdc:mga09592_150680_c1_268_609 | 105 |
| 519 | 3300050509 | nmdc:mga0qj67_78665_c1 | nmdc:mga0qj67_78665_c1_1724_2065 | 105 |
| 520 | 3300050510 | nmdc:mga06r32_12645_c1 | nmdc:mga06r32_12645_c1_4883_5224 | 105 |
| 521 | 2162886012 | MBSR1b_contig_5926467 | MBSR1b_0940.00004790 | 106 |
| 522 | 3300005347 | Ga0070668_100406092 | Ga0070668_1004060922 | 106 |
| 523 | 3300005354 | Ga0070675_101555855 | Ga0070675_1015558552 | 106 |
| 524 | 3300005364 | Ga0070673_100439294 | Ga0070673_1004392943 | 106 |
| 525 | 3300005365 | Ga0070688_100572203 | Ga0070688_1005722032 | 106 |
| 526 | 3300005436 | Ga0070713_101256272 | Ga0070713_1012562722 | 106 |
| 527 | 3300005444 | Ga0070694_100937108 | Ga0070694_1009371082 | 106 |
| 528 | 3300005518 | Ga0070699_100274553 | Ga0070699_1002745532 | 106 |
| 529 | 3300005549 | Ga0070704_100499816 | Ga0070704_1004998162 | 106 |
| 530 | 3300005549 | Ga0070704_100676199 | Ga0070704_1006761992 | 106 |
| 531 | 3300005617 | Ga0068859_101004137 | Ga0068859_1010041372 | 106 |
| 532 | 3300005841 | Ga0068863_100005605 | Ga0068863_1000056059 | 106 |
| 533 | 3300005842 | Ga0068858_100423528 | Ga0068858_1004235282 | 106 |
| 534 | 3300005843 | Ga0068860_100133407 | Ga0068860_1001334073 | 106 |
| 535 | 3300006038 | Ga0075365_10287425 | Ga0075365_102874252 | 106 |
| 536 | 3300006042 | Ga0075368_10008168 | Ga0075368_100081682 | 106 |
| 537 | 3300006051 | Ga0075364_10006340 | Ga0075364_100063404 | 106 |
| 538 | 3300006178 | Ga0075367_10040931 | Ga0075367_100409313 | 106 |
| 539 | 3300006195 | Ga0075366_10025466 | Ga0075366_100254663 | 106 |
| 540 | 3300006931 | Ga0097620_101004310 | Ga0097620_1010043102 | 106 |
| 541 | 3300006931 | Ga0097620_101898590 | Ga0097620_1018985901 | 106 |
| 542 | 3300009174 | Ga0105241_10637083 | Ga0105241_106370832 | 106 |
| 543 | 3300009177 | Ga0105248_10833417 | Ga0105248_108334172 | 106 |
| 544 | 3300009177 | Ga0105248_11161977 | Ga0105248_111619771 | 106 |
| 545 | 3300009553 | Ga0105249_10033730 | Ga0105249_100337302 | 106 |
| 546 | 3300014326 | Ga0157380_11856561 | Ga0157380_118565612 | 106 |
| 547 | 3300014745 | Ga0157377_11200216 | Ga0157377_112002162 | 106 |
| 548 | 3300025899 | Ga0207642_10039866 | Ga0207642_100398662 | 106 |
| 549 | 3300025928 | Ga0207700_10958822 | Ga0207700_109588222 | 106 |
| 550 | 3300025934 | Ga0207686_10043950 | Ga0207686_100439502 | 106 |
| 551 | 3300025938 | Ga0207704_10047829 | Ga0207704_100478292 | 106 |
| 552 | 3300025972 | Ga0207668_10541687 | Ga0207668_105416872 | 106 |
| 553 | 3300026088 | Ga0207641_10005329 | Ga0207641_100053299 | 106 |
| 554 | 3300026089 | Ga0207648_10488797 | Ga0207648_104887972 | 106 |
| 555 | 3300026118 | Ga0207675_100067780 | Ga0207675_1000677802 | 106 |
| 556 | 3300027866 | Ga0209813_10061851 | Ga0209813_100618513 | 106 |
| 557 | 3300035171 | Ga0373946_0032531 | Ga0373946_0032531_323_688 | 106 |
| 558 | 3300035172 | Ga0373955_0840094 | Ga0373955_0840094_209_547 | 106 |
| 559 | 3300035410 | Ga0373924_0518959 | Ga0373924_0518959_37_375 | 106 |
| 560 | 3300035692 | Ga0373935_0529664 | Ga0373935_0529664_126_470 | 106 |
| 561 | 3300036401 | Ga0373937_0696450 | Ga0373937_0696450_103_447 | 106 |
| 562 | 3300036401 | Ga0373937_0699348 | Ga0373937_0699348_494_856 | 106 |
| 563 | 3300039453 | Ga0436362_0107871 | Ga0436362_0107871_147_500 | 106 |
| 564 | 3300044712 | Ga0453684_0025701 | Ga0453684_0025701_735_1076 | 106 |
| 565 | 3300045976 | Ga0466967_0178048 | Ga0466967_0178048_1084_1428 | 106 |
| 566 | 3300046455 | Ga0495603_0690843 | Ga0495603_0690843_32_376 | 106 |
| 567 | 3300046459 | Ga0495629_0001309 | Ga0495629_0001309_2469_2813 | 106 |
| 568 | 3300046461 | Ga0495641_0101417 | Ga0495641_0101417_363_707 | 106 |
| 569 | 3300046472 | Ga0495580_0125249 | Ga0495580_0125249_1430_1765 | 106 |
| 570 | 3300046473 | Ga0495582_0062784 | Ga0495582_0062784_1171_1515 | 106 |
| 571 | 3300046475 | Ga0495639_0001582 | Ga0495639_0001582_635_979 | 106 |
| 572 | 3300046475 | Ga0495639_0006686 | Ga0495639_0006686_2675_3049 | 106 |
| 573 | 3300046475 | Ga0495639_0224510 | Ga0495639_0224510_437_799 | 106 |
| 574 | 3300046499 | Ga0495594_0028185 | Ga0495594_0028185_1764_2108 | 106 |
| 575 | 3300046526 | Ga0495666_0000817 | Ga0495666_0000817_6672_7037 | 106 |
| 576 | 3300046533 | Ga0495640_0131506 | Ga0495640_0131506_818_1162 | 106 |
| 577 | 3300046535 | Ga0495586_0002774 | Ga0495586_0002774_7252_7617 | 106 |
| 578 | 3300046642 | Ga0495634_0030948 | Ga0495634_0030948_1952_2296 | 106 |
| 579 | 3300046663 | Ga0495635_0012021 | Ga0495635_0012021_5061_5405 | 106 |
| 580 | 3300046675 | Ga0495657_0286792 | Ga0495657_0286792_90_428 | 106 |
| 581 | 3300046679 | Ga0495623_0505197 | Ga0495623_0505197_135_473 | 106 |
| 582 | 3300046683 | Ga0495658_0003686 | Ga0495658_0003686_5702_6046 | 106 |
| 583 | 3300046689 | Ga0495613_0017347 | Ga0495613_0017347_3373_3717 | 106 |
| 584 | 3300047315 | Ga0495581_0010103 | Ga0495581_0010103_3305_3670 | 106 |
| 585 | 3300047315 | Ga0495581_0024224 | Ga0495581_0024224_2880_3224 | 106 |
| 586 | 3300047322 | Ga0495680_0001367 | Ga0495680_0001367_6252_6596 | 106 |
| 587 | 3300047471 | Ga0495684_0078192 | Ga0495684_0078192_1592_1936 | 106 |
| 588 | 3300048088 | Ga0495602_0754565 | Ga0495602_0754565_284_622 | 106 |
| 589 | 3300048088 | Ga0495602_0997434 | Ga0495602_0997434_72_434 | 106 |
| 590 | 3300049743 | Ga0501081_0483765 | Ga0501081_0483765_292_627 | 106 |
| 591 | 3300050491 | nmdc:mga00v17_19908_c1 | nmdc:mga00v17_19908_c1_859_1200 | 106 |
| 592 | 3300050492 | nmdc:mga0yw44_254512_c1 | nmdc:mga0yw44_254512_c1_298_639 | 106 |
| 593 | 3300050495 | nmdc:mga04h51_32364_c1 | nmdc:mga04h51_32364_c1_867_1208 | 106 |
| 594 | 3300050508 | nmdc:mga09592_1314419_c1 | nmdc:mga09592_1314419_c1_166_501 | 106 |
| 595 | 3300053085 | Ga0495619_0003359 | Ga0495619_0003359_459_803 | 106 |
| 596 | 3300005340 | Ga0070689_100149304 | Ga0070689_1001493042 | 107 |
| 597 | 3300005354 | Ga0070675_100041913 | Ga0070675_1000419132 | 107 |
| 598 | 3300005354 | Ga0070675_102142719 | Ga0070675_1021427191 | 107 |
| 599 | 3300005436 | Ga0070713_100353757 | Ga0070713_1003537572 | 107 |
| 600 | 3300005439 | Ga0070711_100357648 | Ga0070711_1003576482 | 107 |
| 601 | 3300005445 | Ga0070708_100137560 | Ga0070708_1001375602 | 107 |
| 602 | 3300005518 | Ga0070699_100000012 | Ga0070699_10000001299 | 107 |
| 603 | 3300005549 | Ga0070704_100320226 | Ga0070704_1003202263 | 107 |
| 604 | 3300005614 | Ga0068856_100042701 | Ga0068856_1000427012 | 107 |
| 605 | 3300005617 | Ga0068859_100848074 | Ga0068859_1008480742 | 107 |
| 606 | 3300005842 | Ga0068858_100037811 | Ga0068858_1000378112 | 107 |
| 607 | 3300006028 | Ga0070717_10977157 | Ga0070717_109771571 | 107 |
| 608 | 3300006852 | Ga0075433_10040574 | Ga0075433_100405743 | 107 |
| 609 | 3300006871 | Ga0075434_100211827 | Ga0075434_1002118272 | 107 |
| 610 | 3300006931 | Ga0097620_100848130 | Ga0097620_1008481302 | 107 |
| 611 | 3300009094 | Ga0111539_10394927 | Ga0111539_103949272 | 107 |
| 612 | 3300009094 | Ga0111539_10471347 | Ga0111539_104713472 | 107 |
| 613 | 3300009147 | Ga0114129_10183182 | Ga0114129_101831823 | 107 |
| 614 | 3300009177 | Ga0105248_10928377 | Ga0105248_109283772 | 107 |
| 615 | 3300009545 | Ga0105237_10742590 | Ga0105237_107425902 | 107 |
| 616 | 3300009551 | Ga0105238_10876843 | Ga0105238_108768432 | 107 |
| 617 | 3300010375 | Ga0105239_10346058 | Ga0105239_103460583 | 107 |
| 618 | 3300011119 | Ga0105246_12100915 | Ga0105246_121009152 | 107 |
| 619 | 3300013297 | Ga0157378_10016886 | Ga0157378_100168863 | 107 |
| 620 | 3300013297 | Ga0157378_10028267 | Ga0157378_100282673 | 107 |
| 621 | 3300021361 | Ga0213872_10038558 | Ga0213872_100385582 | 107 |
| 622 | 3300021361 | Ga0213872_10402689 | Ga0213872_104026891 | 107 |
| 623 | 3300021384 | Ga0213876_10033164 | Ga0213876_100331642 | 107 |
| 624 | 3300021388 | Ga0213875_10207652 | Ga0213875_102076522 | 107 |
| 625 | 3300025907 | Ga0207645_10727293 | Ga0207645_107272931 | 107 |
| 626 | 3300025921 | Ga0207652_10016862 | Ga0207652_100168623 | 107 |
| 627 | 3300025927 | Ga0207687_10111742 | Ga0207687_101117423 | 107 |
| 628 | 3300025928 | Ga0207700_10273025 | Ga0207700_102730252 | 107 |
| 629 | 3300025941 | Ga0207711_11102282 | Ga0207711_111022822 | 107 |
| 630 | 3300026035 | Ga0207703_10255608 | Ga0207703_102556083 | 107 |
| 631 | 3300026088 | Ga0207641_11056280 | Ga0207641_110562802 | 107 |
| 632 | 3300028379 | Ga0268266_10400543 | Ga0268266_104005432 | 107 |
| 633 | 3300028653 | Ga0265323_10013817 | Ga0265323_100138173 | 107 |
| 634 | 3300028654 | Ga0265322_10003804 | Ga0265322_100038043 | 107 |
| 635 | 3300028800 | Ga0265338_10542701 | Ga0265338_105427012 | 107 |
| 636 | 3300031242 | Ga0265329_10078573 | Ga0265329_100785731 | 107 |
| 637 | 3300031344 | Ga0265316_10052917 | Ga0265316_100529172 | 107 |
| 638 | 3300031995 | Ga0307409_102964226 | Ga0307409_1029642262 | 107 |
| 639 | 3300036401 | Ga0373937_0860986 | Ga0373937_0860986_231_587 | 107 |
| 640 | 3300037853 | Ga0436364_0141118 | Ga0436364_0141118_377_730 | 107 |
| 641 | 3300039437 | Ga0436365_1376303 | Ga0436365_1376303_4149_4502 | 107 |
| 642 | 3300039438 | Ga0436360_0194576 | Ga0436360_0194576_3687_4037 | 107 |
| 643 | 3300039438 | Ga0436360_0687086 | Ga0436360_0687086_258_608 | 107 |
| 644 | 3300039438 | Ga0436360_1185407 | Ga0436360_1185407_257_607 | 107 |
| 645 | 3300039447 | Ga0436361_0186403 | Ga0436361_0186403_109_462 | 107 |
| 646 | 3300039447 | Ga0436361_0248862 | Ga0436361_0248862_345_695 | 107 |
| 647 | 3300039447 | Ga0436361_0535007 | Ga0436361_0535007_834_1184 | 107 |
| 648 | 3300039447 | Ga0436361_0809850 | Ga0436361_0809850_2397_2747 | 107 |
| 649 | 3300042876 | Ga0451577_0813414 | Ga0451577_0813414_139_492 | 107 |
| 650 | 3300042876 | Ga0451577_1323502 | Ga0451577_1323502_152_523 | 107 |
| 651 | 3300044712 | Ga0453684_0367864 | Ga0453684_0367864_704_1078 | 107 |
| 652 | 3300044712 | Ga0453684_0757827 | Ga0453684_0757827_321_692 | 107 |
| 653 | 3300044712 | Ga0453684_1707641 | Ga0453684_1707641_112_444 | 107 |
| 654 | 3300045051 | Ga0451576_0013273 | Ga0451576_0013273_2100_2432 | 107 |
| 655 | 3300046519 | Ga0495632_0000124 | Ga0495632_0000124_45393_45755 | 107 |
| 656 | 3300046520 | Ga0495637_0012088 | Ga0495637_0012088_3473_3835 | 107 |
| 657 | 3300046665 | Ga0495661_0267048 | Ga0495661_0267048_314_676 | 107 |
| 658 | 3300046690 | Ga0495624_0163604 | Ga0495624_0163604_607_939 | 107 |
| 659 | 3300047320 | Ga0495672_0050803 | Ga0495672_0050803_1120_1464 | 107 |
| 660 | 3300049569 | Ga0501032_0153497 | Ga0501032_0153497_459_797 | 107 |
| 661 | 3300049570 | Ga0501033_0186327 | Ga0501033_0186327_368_706 | 107 |
| 662 | 3300049572 | Ga0501036_0272262 | Ga0501036_0272262_363_701 | 107 |
| 663 | 3300049573 | Ga0501037_0063523 | Ga0501037_0063523_654_992 | 107 |
| 664 | 3300049574 | Ga0501038_0064210 | Ga0501038_0064210_844_1182 | 107 |
| 665 | 3300049575 | Ga0501039_0058582 | Ga0501039_0058582_672_1010 | 107 |
| 666 | 3300049578 | Ga0501042_0133621 | Ga0501042_0133621_672_1010 | 107 |
| 667 | 3300049579 | Ga0501043_0234521 | Ga0501043_0234521_370_708 | 107 |
| 668 | 3300049581 | Ga0501047_0143704 | Ga0501047_0143704_1223_1561 | 107 |
| 669 | 3300049582 | Ga0501048_0161957 | Ga0501048_0161957_403_741 | 107 |
| 670 | 3300049584 | Ga0501068_0045922 | Ga0501068_0045922_1439_1777 | 107 |
| 671 | 3300049586 | Ga0501070_0229139 | Ga0501070_0229139_638_976 | 107 |
| 672 | 3300049587 | Ga0501071_0033651 | Ga0501071_0033651_780_1118 | 107 |
| 673 | 3300049590 | Ga0501074_0053198 | Ga0501074_0053198_884_1222 | 107 |
| 674 | 3300049593 | Ga0501077_0041307 | Ga0501077_0041307_437_775 | 107 |
| 675 | 3300049741 | Ga0501079_0111924 | Ga0501079_0111924_346_684 | 107 |
| 676 | 3300049742 | Ga0501080_0258322 | Ga0501080_0258322_786_1124 | 107 |
| 677 | 3300049822 | Ga0501035_0047901 | Ga0501035_0047901_2570_2908 | 107 |
| 678 | 3300049823 | Ga0501044_0056539 | Ga0501044_0056539_1538_1921 | 107 |
| 679 | 3300049823 | Ga0501044_0522925 | Ga0501044_0522925_216_554 | 107 |
| 680 | 3300049824 | Ga0501045_0575657 | Ga0501045_0575657_176_514 | 107 |
| 681 | 3300050507 | nmdc:mga05p37_133107_c1 | nmdc:mga05p37_133107_c1_502_840 | 107 |
| 682 | 3300050510 | nmdc:mga06r32_917772_c1 | nmdc:mga06r32_917772_c1_198_557 | 107 |
| 683 | 3300050511 | nmdc:mga08y16_625050_c1 | nmdc:mga08y16_625050_c1_238_573 | 107 |
| 684 | 3300050512 | nmdc:mga0n895_638112_c1 | nmdc:mga0n895_638112_c1_67_426 | 107 |
| 685 | 3300050513 | nmdc:mga0rr50_557209_c1 | nmdc:mga0rr50_557209_c1_533_892 | 107 |
| 686 | 3300050515 | nmdc:mga0a205_84565_c1 | nmdc:mga0a205_84565_c1_1388_1747 | 107 |
| 687 | 3300053139 | Ga0500568_0006953 | Ga0500568_0006953_1070_1414 | 107 |
| 688 | 3300054114 | Ga0501084_0695291 | Ga0501084_0695291_284_622 | 107 |
| 689 | 3300060353 | Ga0501082_0160029 | Ga0501082_0160029_667_1005 | 107 |
| 690 | 3300061734 | Ga0530510_0098595 | Ga0530510_0098595_478_816 | 107 |
| 691 | 3300005289 | Ga0065704_10144240 | Ga0065704_101442402 | 108 |
| 692 | 3300005340 | Ga0070689_100125393 | Ga0070689_1001253932 | 108 |
| 693 | 3300005367 | Ga0070667_100000005 | Ga0070667_100000005130 | 108 |
| 694 | 3300005445 | Ga0070708_100368257 | Ga0070708_1003682572 | 108 |
| 695 | 3300005455 | Ga0070663_100000210 | Ga0070663_10000021021 | 108 |
| 696 | 3300005467 | Ga0070706_100248056 | Ga0070706_1002480563 | 108 |
| 697 | 3300005471 | Ga0070698_100418803 | Ga0070698_1004188032 | 108 |
| 698 | 3300005471 | Ga0070698_101719913 | Ga0070698_1017199131 | 108 |
| 699 | 3300005563 | Ga0068855_102362097 | Ga0068855_1023620971 | 108 |
| 700 | 3300005577 | Ga0068857_100008955 | Ga0068857_1000089555 | 108 |
| 701 | 3300005842 | Ga0068858_100195143 | Ga0068858_1001951432 | 108 |
| 702 | 3300005842 | Ga0068858_100377375 | Ga0068858_1003773752 | 108 |
| 703 | 3300005937 | Ga0081455_10021596 | Ga0081455_100215965 | 108 |
| 704 | 3300005985 | Ga0081539_10016029 | Ga0081539_100160296 | 108 |
| 705 | 3300006844 | Ga0075428_100029102 | Ga0075428_1000291022 | 108 |
| 706 | 3300006844 | Ga0075428_100114702 | Ga0075428_1001147022 | 108 |
| 707 | 3300006844 | Ga0075428_100246043 | Ga0075428_1002460433 | 108 |
| 708 | 3300006846 | Ga0075430_100099955 | Ga0075430_1000999553 | 108 |
| 709 | 3300006846 | Ga0075430_100126789 | Ga0075430_1001267892 | 108 |
| 710 | 3300006846 | Ga0075430_100885312 | Ga0075430_1008853122 | 108 |
| 711 | 3300006847 | Ga0075431_100023477 | Ga0075431_1000234775 | 108 |
| 712 | 3300006847 | Ga0075431_101676873 | Ga0075431_1016768732 | 108 |
| 713 | 3300006852 | Ga0075433_10001699 | Ga0075433_100016993 | 108 |
| 714 | 3300006852 | Ga0075433_11329130 | Ga0075433_113291301 | 108 |
| 715 | 3300006871 | Ga0075434_100829760 | Ga0075434_1008297602 | 108 |
| 716 | 3300006880 | Ga0075429_100192505 | Ga0075429_1001925052 | 108 |
| 717 | 3300006880 | Ga0075429_100914767 | Ga0075429_1009147672 | 108 |
| 718 | 3300009093 | Ga0105240_10000115 | Ga0105240_10000115119 | 108 |
| 719 | 3300009093 | Ga0105240_10117898 | Ga0105240_101178983 | 108 |
| 720 | 3300009094 | Ga0111539_13035490 | Ga0111539_130354902 | 108 |
| 721 | 3300009101 | Ga0105247_10104972 | Ga0105247_101049722 | 108 |
| 722 | 3300009147 | Ga0114129_10211130 | Ga0114129_102111302 | 108 |
| 723 | 3300009147 | Ga0114129_10429875 | Ga0114129_104298751 | 108 |
| 724 | 3300009147 | Ga0114129_11169266 | Ga0114129_111692662 | 108 |
| 725 | 3300009174 | Ga0105241_11278555 | Ga0105241_112785551 | 108 |
| 726 | 3300009177 | Ga0105248_10000526 | Ga0105248_1000052632 | 108 |
| 727 | 3300009545 | Ga0105237_10000267 | Ga0105237_1000026738 | 108 |
| 728 | 3300009553 | Ga0105249_10001397 | Ga0105249_100013975 | 108 |
| 729 | 3300010375 | Ga0105239_10043429 | Ga0105239_100434293 | 108 |
| 730 | 3300011119 | Ga0105246_10221170 | Ga0105246_102211702 | 108 |
| 731 | 3300013306 | Ga0163162_12273109 | Ga0163162_122731092 | 108 |
| 732 | 3300014325 | Ga0163163_10275846 | Ga0163163_102758462 | 108 |
| 733 | 3300014968 | Ga0157379_11286772 | Ga0157379_112867722 | 108 |
| 734 | 3300014969 | Ga0157376_10571476 | Ga0157376_105714761 | 108 |
| 735 | 3300025900 | Ga0207710_10153409 | Ga0207710_101534092 | 108 |
| 736 | 3300025901 | Ga0207688_10451664 | Ga0207688_104516642 | 108 |
| 737 | 3300025910 | Ga0207684_10097238 | Ga0207684_100972383 | 108 |
| 738 | 3300025913 | Ga0207695_10000116 | Ga0207695_10000116113 | 108 |
| 739 | 3300025913 | Ga0207695_10068401 | Ga0207695_100684014 | 108 |
| 740 | 3300025914 | Ga0207671_10000687 | Ga0207671_100006878 | 108 |
| 741 | 3300025914 | Ga0207671_10308134 | Ga0207671_103081342 | 108 |
| 742 | 3300025920 | Ga0207649_10501640 | Ga0207649_105016402 | 108 |
| 743 | 3300025922 | Ga0207646_10119154 | Ga0207646_101191542 | 108 |
| 744 | 3300025924 | Ga0207694_11103630 | Ga0207694_111036302 | 108 |
| 745 | 3300025937 | Ga0207669_11515946 | Ga0207669_115159462 | 108 |
| 746 | 3300025941 | Ga0207711_10002710 | Ga0207711_100027105 | 108 |
| 747 | 3300025961 | Ga0207712_10010118 | Ga0207712_100101187 | 108 |
| 748 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006244 | 108 |
| 749 | 3300026035 | Ga0207703_10119227 | Ga0207703_101192272 | 108 |
| 750 | 3300026035 | Ga0207703_10366934 | Ga0207703_103669343 | 108 |
| 751 | 3300026067 | Ga0207678_10000063 | Ga0207678_1000006364 | 108 |
| 752 | 3300026116 | Ga0207674_10051992 | Ga0207674_100519924 | 108 |
| 753 | 3300026116 | Ga0207674_11174668 | Ga0207674_111746681 | 108 |
| 754 | 3300026142 | Ga0207698_10102810 | Ga0207698_101028103 | 108 |
| 755 | 3300028800 | Ga0265338_10000025 | Ga0265338_10000025204 | 108 |
| 756 | 3300031249 | Ga0265339_10065974 | Ga0265339_100659742 | 108 |
| 757 | 3300031711 | Ga0265314_10419421 | Ga0265314_104194212 | 108 |
| 758 | 3300037853 | Ga0436364_1211847 | Ga0436364_1211847_224_580 | 108 |
| 759 | 3300044712 | Ga0453684_0654753 | Ga0453684_0654753_474_806 | 108 |
| 760 | 3300045051 | Ga0451576_2050321 | Ga0451576_2050321_67_411 | 108 |
| 761 | 3300046663 | Ga0495635_0050813 | Ga0495635_0050813_1947_2288 | 108 |
| 762 | 3300046809 | Ga0495600_0024437 | Ga0495600_0024437_3481_3822 | 108 |
| 763 | 3300047322 | Ga0495680_0040480 | Ga0495680_0040480_1397_1738 | 108 |
| 764 | 3300048903 | Ga0496100_0029585 | Ga0496100_0029585_909_1271 | 108 |
| 765 | 3300048904 | Ga0496101_0341242 | Ga0496101_0341242_29_391 | 108 |
| 766 | 3300048916 | Ga0496113_0342076 | Ga0496113_0342076_368_724 | 108 |
| 767 | 3300048917 | Ga0496114_0675591 | Ga0496114_0675591_302_643 | 108 |
| 768 | 3300048918 | Ga0496115_0055079 | Ga0496115_0055079_1015_1377 | 108 |
| 769 | 3300048920 | Ga0496117_0007672 | Ga0496117_0007672_5263_5625 | 108 |
| 770 | 3300048921 | Ga0496118_0000417 | Ga0496118_0000417_15533_15895 | 108 |
| 771 | 3300048923 | Ga0496120_0000015 | Ga0496120_0000015_80211_80573 | 108 |
| 772 | 3300048923 | Ga0496120_0094939 | Ga0496120_0094939_239_595 | 108 |
| 773 | 3300048924 | Ga0496121_0042670 | Ga0496121_0042670_713_1075 | 108 |
| 774 | 3300048924 | Ga0496121_0049014 | Ga0496121_0049014_2046_2408 | 108 |
| 775 | 3300048925 | Ga0496122_0000487 | Ga0496122_0000487_33476_33832 | 108 |
| 776 | 3300048926 | Ga0496123_0000296 | Ga0496123_0000296_92724_93080 | 108 |
| 777 | 3300048929 | Ga0496126_0000134 | Ga0496126_0000134_33166_33528 | 108 |
| 778 | 3300048929 | Ga0496126_0040020 | Ga0496126_0040020_830_1192 | 108 |
| 779 | 3300049578 | Ga0501042_0398356 | Ga0501042_0398356_21_353 | 108 |
| 780 | 3300049582 | Ga0501048_0523047 | Ga0501048_0523047_445_777 | 108 |
| 781 | 3300049584 | Ga0501068_0375207 | Ga0501068_0375207_212_544 | 108 |
| 782 | 3300049588 | Ga0501072_0882498 | Ga0501072_0882498_80_412 | 108 |
| 783 | 3300049590 | Ga0501074_0265699 | Ga0501074_0265699_538_870 | 108 |
| 784 | 3300049591 | Ga0501075_0322481 | Ga0501075_0322481_675_1007 | 108 |
| 785 | 3300049593 | Ga0501077_0193341 | Ga0501077_0193341_580_912 | 108 |
| 786 | 3300049741 | Ga0501079_0491449 | Ga0501079_0491449_372_704 | 108 |
| 787 | 3300049824 | Ga0501045_0437251 | Ga0501045_0437251_381_713 | 108 |
| 788 | 3300050507 | nmdc:mga05p37_138586_c1 | nmdc:mga05p37_138586_c1_2438_2779 | 108 |
| 789 | 3300050507 | nmdc:mga05p37_299137_c1 | nmdc:mga05p37_299137_c1_1276_1608 | 108 |
| 790 | 3300050507 | nmdc:mga05p37_837111_c1 | nmdc:mga05p37_837111_c1_583_927 | 108 |
| 791 | 3300050508 | nmdc:mga09592_158039_c1 | nmdc:mga09592_158039_c1_473_817 | 108 |
| 792 | 3300050508 | nmdc:mga09592_34375_c1 | nmdc:mga09592_34375_c1_3709_4041 | 108 |
| 793 | 3300050509 | nmdc:mga0qj67_993385_c1 | nmdc:mga0qj67_993385_c1_235_576 | 108 |
| 794 | 3300050510 | nmdc:mga06r32_1767719_c1 | nmdc:mga06r32_1767719_c1_139_471 | 108 |
| 795 | 3300050510 | nmdc:mga06r32_256434_c1 | nmdc:mga06r32_256434_c1_225_557 | 108 |
| 796 | 3300050512 | nmdc:mga0n895_2019706_c1 | nmdc:mga0n895_2019706_c1_142_513 | 108 |
| 797 | 3300050512 | nmdc:mga0n895_79689_c1 | nmdc:mga0n895_79689_c1_2713_3051 | 108 |
| 798 | 3300050512 | nmdc:mga0n895_828524_c1 | nmdc:mga0n895_828524_c1_407_748 | 108 |
| 799 | 3300050515 | nmdc:mga0a205_1818_c1 | nmdc:mga0a205_1818_c1_4375_4716 | 108 |
| 800 | 3300050515 | nmdc:mga0a205_521490_c1 | nmdc:mga0a205_521490_c1_575_913 | 108 |
| 801 | 3300061734 | Ga0530510_0597578 | Ga0530510_0597578_419_751 | 108 |
| 802 | 3300003323 | rootH1_10274450 | rootH1_102744503 | 109 |
| 803 | 3300004800 | Ga0058861_11747774 | Ga0058861_117477742 | 109 |
| 804 | 3300005435 | Ga0070714_101644267 | Ga0070714_1016442672 | 109 |
| 805 | 3300005436 | Ga0070713_100020936 | Ga0070713_1000209364 | 109 |
| 806 | 3300005436 | Ga0070713_100043883 | Ga0070713_1000438832 | 109 |
| 807 | 3300005439 | Ga0070711_100143104 | Ga0070711_1001431043 | 109 |
| 808 | 3300005440 | Ga0070705_100013552 | Ga0070705_1000135524 | 109 |
| 809 | 3300005444 | Ga0070694_100164111 | Ga0070694_1001641112 | 109 |
| 810 | 3300005458 | Ga0070681_10093059 | Ga0070681_100930592 | 109 |
| 811 | 3300005467 | Ga0070706_100586089 | Ga0070706_1005860892 | 109 |
| 812 | 3300005467 | Ga0070706_101511210 | Ga0070706_1015112102 | 109 |
| 813 | 3300005468 | Ga0070707_100166738 | Ga0070707_1001667382 | 109 |
| 814 | 3300005468 | Ga0070707_100352294 | Ga0070707_1003522942 | 109 |
| 815 | 3300005471 | Ga0070698_100020402 | Ga0070698_1000204022 | 109 |
| 816 | 3300005518 | Ga0070699_100055893 | Ga0070699_1000558933 | 109 |
| 817 | 3300005518 | Ga0070699_100382107 | Ga0070699_1003821072 | 109 |
| 818 | 3300005518 | Ga0070699_100871073 | Ga0070699_1008710732 | 109 |
| 819 | 3300005536 | Ga0070697_100092667 | Ga0070697_1000926672 | 109 |
| 820 | 3300005536 | Ga0070697_100152281 | Ga0070697_1001522812 | 109 |
| 821 | 3300005536 | Ga0070697_100158855 | Ga0070697_1001588552 | 109 |
| 822 | 3300005545 | Ga0070695_100092873 | Ga0070695_1000928732 | 109 |
| 823 | 3300005545 | Ga0070695_100108432 | Ga0070695_1001084322 | 109 |
| 824 | 3300005546 | Ga0070696_100037801 | Ga0070696_1000378012 | 109 |
| 825 | 3300005546 | Ga0070696_100124444 | Ga0070696_1001244442 | 109 |
| 826 | 3300005549 | Ga0070704_100045762 | Ga0070704_1000457622 | 109 |
| 827 | 3300005549 | Ga0070704_100240056 | Ga0070704_1002400562 | 109 |
| 828 | 3300005843 | Ga0068860_100061657 | Ga0068860_1000616572 | 109 |
| 829 | 3300005985 | Ga0081539_10027789 | Ga0081539_100277892 | 109 |
| 830 | 3300006028 | Ga0070717_10265865 | Ga0070717_102658652 | 109 |
| 831 | 3300006175 | Ga0070712_100122890 | Ga0070712_1001228902 | 109 |
| 832 | 3300006358 | Ga0068871_100160198 | Ga0068871_1001601982 | 109 |
| 833 | 3300006844 | Ga0075428_100049240 | Ga0075428_1000492402 | 109 |
| 834 | 3300006852 | Ga0075433_10515010 | Ga0075433_105150102 | 109 |
| 835 | 3300006871 | Ga0075434_100093946 | Ga0075434_1000939462 | 109 |
| 836 | 3300006871 | Ga0075434_100769296 | Ga0075434_1007692962 | 109 |
| 837 | 3300006914 | Ga0075436_100043993 | Ga0075436_1000439932 | 109 |
| 838 | 3300006914 | Ga0075436_100092593 | Ga0075436_1000925932 | 109 |
| 839 | 3300007076 | Ga0075435_100036054 | Ga0075435_1000360542 | 109 |
| 840 | 3300007076 | Ga0075435_101773620 | Ga0075435_1017736202 | 109 |
| 841 | 3300009098 | Ga0105245_10144476 | Ga0105245_101444762 | 109 |
| 842 | 3300009101 | Ga0105247_11445255 | Ga0105247_114452551 | 109 |
| 843 | 3300009147 | Ga0114129_10198896 | Ga0114129_101988962 | 109 |
| 844 | 3300009147 | Ga0114129_12611933 | Ga0114129_126119331 | 109 |
| 845 | 3300009177 | Ga0105248_10747236 | Ga0105248_107472362 | 109 |
| 846 | 3300014968 | Ga0157379_10056516 | Ga0157379_100565162 | 109 |
| 847 | 3300021384 | Ga0213876_10235349 | Ga0213876_102353492 | 109 |
| 848 | 3300025906 | Ga0207699_10374128 | Ga0207699_103741282 | 109 |
| 849 | 3300025910 | Ga0207684_10070701 | Ga0207684_100707012 | 109 |
| 850 | 3300025912 | Ga0207707_10086108 | Ga0207707_100861082 | 109 |
| 851 | 3300025915 | Ga0207693_10147312 | Ga0207693_101473122 | 109 |
| 852 | 3300025916 | Ga0207663_10116336 | Ga0207663_101163363 | 109 |
| 853 | 3300025922 | Ga0207646_10164839 | Ga0207646_101648392 | 109 |
| 854 | 3300025922 | Ga0207646_10301513 | Ga0207646_103015132 | 109 |
| 855 | 3300025928 | Ga0207700_10031595 | Ga0207700_100315953 | 109 |
| 856 | 3300025942 | Ga0207689_10543049 | Ga0207689_105430492 | 109 |
| 857 | 3300025986 | Ga0207658_10055939 | Ga0207658_100559393 | 109 |
| 858 | 3300028381 | Ga0268264_10131359 | Ga0268264_101313592 | 109 |
| 859 | 3300035115 | Ga0373941_0300527 | Ga0373941_0300527_81_443 | 109 |
| 860 | 3300039437 | Ga0436365_1481395 | Ga0436365_1481395_222_560 | 109 |
| 861 | 3300046477 | Ga0495664_0095442 | Ga0495664_0095442_438_818 | 109 |
| 862 | 3300046516 | Ga0495628_0268689 | Ga0495628_0268689_609_989 | 109 |
| 863 | 3300046543 | Ga0495645_0057384 | Ga0495645_0057384_554_934 | 109 |
| 864 | 3300046678 | Ga0495599_0380939 | Ga0495599_0380939_97_477 | 109 |
| 865 | 3300048907 | Ga0496104_0289986 | Ga0496104_0289986_972_1352 | 109 |
| 866 | 3300048908 | Ga0496105_0276048 | Ga0496105_0276048_572_952 | 109 |
| 867 | 3300048913 | Ga0496110_1193124 | Ga0496110_1193124_321_656 | 109 |
| 868 | 3300050507 | nmdc:mga05p37_249005_c1 | nmdc:mga05p37_249005_c1_654_995 | 109 |
| 869 | 3300050511 | nmdc:mga08y16_612708_c1 | nmdc:mga08y16_612708_c1_226_570 | 109 |
| 870 | 3300050512 | nmdc:mga0n895_21383_c2 | nmdc:mga0n895_21383_c2_1189_1533 | 109 |
| 871 | 3300050513 | nmdc:mga0rr50_159550_c2 | nmdc:mga0rr50_159550_c2_1189_1533 | 109 |
| 872 | 3300050514 | nmdc:mga08x19_29739_c1 | nmdc:mga08x19_29739_c1_1180_1524 | 109 |
| 873 | 3300050514 | nmdc:mga08x19_52113_c1 | nmdc:mga08x19_52113_c1_36_380 | 109 |
| 874 | 3300050515 | nmdc:mga0a205_258878_c1 | nmdc:mga0a205_258878_c1_1085_1429 | 109 |
| 875 | 3300050515 | nmdc:mga0a205_98978_c1 | nmdc:mga0a205_98978_c1_275_619 | 109 |
| 876 | 3300053077 | Ga0495601_0006301 | Ga0495601_0006301_3243_3623 | 109 |
| 877 | 3300053078 | Ga0495612_0442182 | Ga0495612_0442182_101_445 | 109 |
| 878 | 3300005434 | Ga0070709_10076194 | Ga0070709_100761942 | 110 |
| 879 | 3300005439 | Ga0070711_100473993 | Ga0070711_1004739932 | 110 |
| 880 | 3300005616 | Ga0068852_101093714 | Ga0068852_1010937141 | 110 |
| 881 | 3300006175 | Ga0070712_100335243 | Ga0070712_1003352432 | 110 |
| 882 | 3300013297 | Ga0157378_10286858 | Ga0157378_102868582 | 110 |
| 883 | 3300025898 | Ga0207692_10303072 | Ga0207692_103030721 | 110 |
| 884 | 3300025915 | Ga0207693_10173714 | Ga0207693_101737142 | 110 |
| 885 | 3300025916 | Ga0207663_11164161 | Ga0207663_111641612 | 110 |
| 886 | 3300025936 | Ga0207670_10636984 | Ga0207670_106369842 | 110 |
| 887 | 3300026023 | Ga0207677_10650231 | Ga0207677_106502312 | 110 |
| 888 | 3300026142 | Ga0207698_10463520 | Ga0207698_104635202 | 110 |
| 889 | 3300032005 | Ga0307411_11632673 | Ga0307411_116326731 | 110 |
| 890 | 3300042876 | Ga0451577_0224450 | Ga0451577_0224450_605_952 | 110 |
| 891 | 3300044712 | Ga0453684_1511646 | Ga0453684_1511646_325_672 | 110 |
| 892 | 3300044712 | Ga0453684_2365588 | Ga0453684_2365588_70_438 | 110 |
| 893 | 3300046459 | Ga0495629_0000008 | Ga0495629_0000008_50410_50757 | 110 |
| 894 | 3300046557 | Ga0495622_0038871 | Ga0495622_0038871_1759_2106 | 110 |
| 895 | 3300049581 | Ga0501047_0638772 | Ga0501047_0638772_16_384 | 110 |
| 896 | 3300049744 | Ga0501083_0065233 | Ga0501083_0065233_720_1088 | 110 |
| 897 | 3300049823 | Ga0501044_0103630 | Ga0501044_0103630_960_1328 | 110 |
| 898 | 3300053096 | Ga0500641_0035065 | Ga0500641_0035065_965_1387 | 110 |
| 899 | 3300061734 | Ga0530510_1476698 | Ga0530510_1476698_136_498 | 110 |
| 900 | 3300005339 | Ga0070660_100108132 | Ga0070660_1001081323 | 111 |
| 901 | 3300005339 | Ga0070660_100189137 | Ga0070660_1001891372 | 111 |
| 902 | 3300005577 | Ga0068857_100655164 | Ga0068857_1006551642 | 111 |
| 903 | 3300005834 | Ga0068851_10040164 | Ga0068851_100401642 | 111 |
| 904 | 3300006042 | Ga0075368_10187031 | Ga0075368_101870312 | 111 |
| 905 | 3300013104 | Ga0157370_10061502 | Ga0157370_100615023 | 111 |
| 906 | 3300025909 | Ga0207705_10005099 | Ga0207705_100050992 | 111 |
| 907 | 3300025919 | Ga0207657_10131020 | Ga0207657_101310202 | 111 |
| 908 | 3300025919 | Ga0207657_10302159 | Ga0207657_103021592 | 111 |
| 909 | 3300025924 | Ga0207694_11051298 | Ga0207694_110512981 | 111 |
| 910 | 3300026116 | Ga0207674_10158463 | Ga0207674_101584632 | 111 |
| 911 | 3300031824 | Ga0307413_11765526 | Ga0307413_117655262 | 111 |
| 912 | 3300049579 | Ga0501043_0007855 | Ga0501043_0007855_5728_6114 | 111 |
| 913 | 3300049580 | Ga0501046_0003788 | Ga0501046_0003788_4770_5156 | 111 |
| 914 | 3300049581 | Ga0501047_0020232 | Ga0501047_0020232_3300_3686 | 111 |
| 915 | 3300049582 | Ga0501048_0023535 | Ga0501048_0023535_691_1077 | 111 |
| 916 | 3300049742 | Ga0501080_0140518 | Ga0501080_0140518_1071_1457 | 111 |
| 917 | 3300049744 | Ga0501083_0003607 | Ga0501083_0003607_5690_6076 | 111 |
| 918 | 3300049822 | Ga0501035_0222706 | Ga0501035_0222706_964_1350 | 111 |
| 919 | 3300049823 | Ga0501044_0391603 | Ga0501044_0391603_376_762 | 111 |
| 920 | 3300049824 | Ga0501045_0065337 | Ga0501045_0065337_1209_1595 | 111 |
| 921 | 3300050494 | nmdc:mga06z11_131389_c1 | nmdc:mga06z11_131389_c1_131_544 | 111 |
| 922 | 3300060353 | Ga0501082_0294096 | Ga0501082_0294096_519_905 | 111 |
| 923 | 3300005331 | Ga0070670_101254211 | Ga0070670_1012542112 | 112 |
| 924 | 3300005345 | Ga0070692_10013264 | Ga0070692_100132642 | 112 |
| 925 | 3300005444 | Ga0070694_100013478 | Ga0070694_1000134783 | 112 |
| 926 | 3300005563 | Ga0068855_100235046 | Ga0068855_1002350463 | 112 |
| 927 | 3300005564 | Ga0070664_100330348 | Ga0070664_1003303482 | 112 |
| 928 | 3300005578 | Ga0068854_100640833 | Ga0068854_1006408332 | 112 |
| 929 | 3300006844 | Ga0075428_100399753 | Ga0075428_1003997533 | 112 |
| 930 | 3300006846 | Ga0075430_100063229 | Ga0075430_1000632291 | 112 |
| 931 | 3300006847 | Ga0075431_100962349 | Ga0075431_1009623492 | 112 |
| 932 | 3300009093 | Ga0105240_12053947 | Ga0105240_120539472 | 112 |
| 933 | 3300014325 | Ga0163163_10524960 | Ga0163163_105249602 | 112 |
| 934 | 3300025315 | Ga0207697_10339566 | Ga0207697_103395662 | 112 |
| 935 | 3300025903 | Ga0207680_10158828 | Ga0207680_101588282 | 112 |
| 936 | 3300025913 | Ga0207695_11342815 | Ga0207695_113428152 | 112 |
| 937 | 3300025945 | Ga0207679_10379759 | Ga0207679_103797591 | 112 |
| 938 | 3300025981 | Ga0207640_10473881 | Ga0207640_104738812 | 112 |
| 939 | 3300026035 | Ga0207703_10774688 | Ga0207703_107746882 | 112 |
| 940 | 3300035119 | Ga0373956_0069096 | Ga0373956_0069096_790_1185 | 112 |
| 941 | 3300035172 | Ga0373955_0374390 | Ga0373955_0374390_176_571 | 112 |
| 942 | 3300044712 | Ga0453684_1006850 | Ga0453684_1006850_51_428 | 112 |
| 943 | 3300046454 | Ga0495592_0040268 | Ga0495592_0040268_1802_2197 | 112 |
| 944 | 3300046462 | Ga0495651_0063218 | Ga0495651_0063218_764_1159 | 112 |
| 945 | 3300046472 | Ga0495580_0622347 | Ga0495580_0622347_125_520 | 112 |
| 946 | 3300046476 | Ga0495662_0031533 | Ga0495662_0031533_1820_2215 | 112 |
| 947 | 3300046517 | Ga0495630_0021829 | Ga0495630_0021829_272_667 | 112 |
| 948 | 3300046529 | Ga0495652_0108517 | Ga0495652_0108517_1805_2200 | 112 |
| 949 | 3300046543 | Ga0495645_0087772 | Ga0495645_0087772_295_690 | 112 |
| 950 | 3300046689 | Ga0495613_0543266 | Ga0495613_0543266_39_434 | 112 |
| 951 | 3300047319 | Ga0495674_0019922 | Ga0495674_0019922_3995_4390 | 112 |
| 952 | 3300050508 | nmdc:mga09592_147894_c1 | nmdc:mga09592_147894_c1_154_495 | 112 |
| 953 | 3300050509 | nmdc:mga0qj67_23468_c1 | nmdc:mga0qj67_23468_c1_2909_3250 | 112 |
| 954 | 3300050510 | nmdc:mga06r32_142135_c1 | nmdc:mga06r32_142135_c1_1145_1486 | 112 |
| 955 | 3300050510 | nmdc:mga06r32_67531_c1 | nmdc:mga06r32_67531_c1_2120_2461 | 112 |
| 956 | 2162886007 | SwRhRL2b_contig_859156 | SwRhRL2b_0300.00003550 | 113 |
| 957 | 3300005289 | Ga0065704_10090549 | Ga0065704_100905493 | 113 |
| 958 | 3300005293 | Ga0065715_10520636 | Ga0065715_105206362 | 113 |
| 959 | 3300005295 | Ga0065707_10006030 | Ga0065707_100060303 | 113 |
| 960 | 3300005328 | Ga0070676_11030037 | Ga0070676_110300372 | 113 |
| 961 | 3300005331 | Ga0070670_100253761 | Ga0070670_1002537612 | 113 |
| 962 | 3300005334 | Ga0068869_100034338 | Ga0068869_1000343382 | 113 |
| 963 | 3300005334 | Ga0068869_100488929 | Ga0068869_1004889291 | 113 |
| 964 | 3300005336 | Ga0070680_100107690 | Ga0070680_1001076903 | 113 |
| 965 | 3300005338 | Ga0068868_100661322 | Ga0068868_1006613223 | 113 |
| 966 | 3300005345 | Ga0070692_10050877 | Ga0070692_100508772 | 113 |
| 967 | 3300005365 | Ga0070688_100216997 | Ga0070688_1002169972 | 113 |
| 968 | 3300005440 | Ga0070705_100145152 | Ga0070705_1001451522 | 113 |
| 969 | 3300005440 | Ga0070705_100610419 | Ga0070705_1006104192 | 113 |
| 970 | 3300005441 | Ga0070700_101219317 | Ga0070700_1012193172 | 113 |
| 971 | 3300005518 | Ga0070699_100078449 | Ga0070699_1000784493 | 113 |
| 972 | 3300005547 | Ga0070693_100066892 | Ga0070693_1000668922 | 113 |
| 973 | 3300005547 | Ga0070693_100160345 | Ga0070693_1001603451 | 113 |
| 974 | 3300005577 | Ga0068857_100175930 | Ga0068857_1001759303 | 113 |
| 975 | 3300005577 | Ga0068857_100415498 | Ga0068857_1004154982 | 113 |
| 976 | 3300005577 | Ga0068857_100503328 | Ga0068857_1005033282 | 113 |
| 977 | 3300005578 | Ga0068854_100341034 | Ga0068854_1003410342 | 113 |
| 978 | 3300005578 | Ga0068854_100416451 | Ga0068854_1004164512 | 113 |
| 979 | 3300005617 | Ga0068859_100167073 | Ga0068859_1001670732 | 113 |
| 980 | 3300005719 | Ga0068861_100726362 | Ga0068861_1007263622 | 113 |
| 981 | 3300005840 | Ga0068870_10006593 | Ga0068870_100065934 | 113 |
| 982 | 3300005841 | Ga0068863_100066935 | Ga0068863_1000669352 | 113 |
| 983 | 3300005844 | Ga0068862_100108122 | Ga0068862_1001081222 | 113 |
| 984 | 3300005844 | Ga0068862_100860043 | Ga0068862_1008600432 | 113 |
| 985 | 3300005844 | Ga0068862_101015777 | Ga0068862_1010157772 | 113 |
| 986 | 3300005985 | Ga0081539_10047406 | Ga0081539_100474062 | 113 |
| 987 | 3300006852 | Ga0075433_10012120 | Ga0075433_100121204 | 113 |
| 988 | 3300006852 | Ga0075433_10016584 | Ga0075433_100165845 | 113 |
| 989 | 3300006871 | Ga0075434_100490932 | Ga0075434_1004909322 | 113 |
| 990 | 3300006914 | Ga0075436_100025078 | Ga0075436_1000250782 | 113 |
| 991 | 3300006931 | Ga0097620_100167073 | Ga0097620_1001670732 | 113 |
| 992 | 3300006931 | Ga0097620_100633948 | Ga0097620_1006339482 | 113 |
| 993 | 3300009101 | Ga0105247_10462232 | Ga0105247_104622322 | 113 |
| 994 | 3300009147 | Ga0114129_10409043 | Ga0114129_104090433 | 113 |
| 995 | 3300009147 | Ga0114129_10893029 | Ga0114129_108930292 | 113 |
| 996 | 3300009148 | Ga0105243_10325217 | Ga0105243_103252172 | 113 |
| 997 | 3300009148 | Ga0105243_10583534 | Ga0105243_105835342 | 113 |
| 998 | 3300009174 | Ga0105241_10036247 | Ga0105241_100362474 | 113 |
| 999 | 3300009174 | Ga0105241_11201872 | Ga0105241_112018722 | 113 |
| 1000 | 3300010375 | Ga0105239_10429067 | Ga0105239_104290672 | 113 |
| 1001 | 3300011119 | Ga0105246_10121579 | Ga0105246_101215792 | 113 |
| 1002 | 3300011119 | Ga0105246_10491734 | Ga0105246_104917343 | 113 |
| 1003 | 3300013100 | Ga0157373_10005529 | Ga0157373_100055294 | 113 |
| 1004 | 3300013102 | Ga0157371_10292213 | Ga0157371_102922132 | 113 |
| 1005 | 3300013306 | Ga0163162_10204692 | Ga0163162_102046922 | 113 |
| 1006 | 3300013308 | Ga0157375_10184622 | Ga0157375_101846223 | 113 |
| 1007 | 3300013308 | Ga0157375_11647074 | Ga0157375_116470742 | 113 |
| 1008 | 3300015265 | Ga0182005_1069317 | Ga0182005_10693172 | 113 |
| 1009 | 3300025908 | Ga0207643_10015617 | Ga0207643_100156173 | 113 |
| 1010 | 3300025911 | Ga0207654_10397047 | Ga0207654_103970472 | 113 |
| 1011 | 3300025917 | Ga0207660_10062012 | Ga0207660_100620123 | 113 |
| 1012 | 3300025918 | Ga0207662_10871880 | Ga0207662_108718802 | 113 |
| 1013 | 3300025923 | Ga0207681_10276707 | Ga0207681_102767073 | 113 |
| 1014 | 3300025935 | Ga0207709_10140481 | Ga0207709_101404812 | 113 |
| 1015 | 3300025935 | Ga0207709_10909052 | Ga0207709_109090522 | 113 |
| 1016 | 3300025936 | Ga0207670_10379222 | Ga0207670_103792222 | 113 |
| 1017 | 3300025942 | Ga0207689_11131425 | Ga0207689_111314252 | 113 |
| 1018 | 3300025981 | Ga0207640_10232017 | Ga0207640_102320172 | 113 |
| 1019 | 3300026035 | Ga0207703_11367214 | Ga0207703_113672142 | 113 |
| 1020 | 3300026075 | Ga0207708_11246581 | Ga0207708_112465811 | 113 |
| 1021 | 3300026088 | Ga0207641_10011056 | Ga0207641_100110565 | 113 |
| 1022 | 3300026095 | Ga0207676_11975650 | Ga0207676_119756501 | 113 |
| 1023 | 3300026116 | Ga0207674_10117589 | Ga0207674_101175893 | 113 |
| 1024 | 3300026116 | Ga0207674_10739673 | Ga0207674_107396732 | 113 |
| 1025 | 3300026118 | Ga0207675_100087644 | Ga0207675_1000876443 | 113 |
| 1026 | 3300026142 | Ga0207698_11734898 | Ga0207698_117348982 | 113 |
| 1027 | 3300027907 | Ga0207428_10003819 | Ga0207428_100038199 | 113 |
| 1028 | 3300028380 | Ga0268265_11051038 | Ga0268265_110510382 | 113 |
| 1029 | 3300028380 | Ga0268265_11436928 | Ga0268265_114369282 | 113 |
| 1030 | 3300030735 | Ga0316178_1156890 | Ga0316178_11568902 | 113 |
| 1031 | 3300031548 | Ga0307408_100535709 | Ga0307408_1005357092 | 113 |
| 1032 | 3300031731 | Ga0307405_10054486 | Ga0307405_100544861 | 113 |
| 1033 | 3300031911 | Ga0307412_10488672 | Ga0307412_104886722 | 113 |
| 1034 | 3300031911 | Ga0307412_10664465 | Ga0307412_106644651 | 113 |
| 1035 | 3300031995 | Ga0307409_101004930 | Ga0307409_1010049302 | 113 |
| 1036 | 3300032002 | Ga0307416_100083037 | Ga0307416_1000830372 | 113 |
| 1037 | 3300032002 | Ga0307416_100415148 | Ga0307416_1004151482 | 113 |
| 1038 | 3300032126 | Ga0307415_100969160 | Ga0307415_1009691602 | 113 |
| 1039 | 3300048910 | Ga0496107_0414845 | Ga0496107_0414845_345_689 | 113 |
| 1040 | 3300048913 | Ga0496110_1104918 | Ga0496110_1104918_160_510 | 113 |
| 1041 | 3300050507 | nmdc:mga05p37_1473857_c1 | nmdc:mga05p37_1473857_c1_187_531 | 113 |
| 1042 | 3300050507 | nmdc:mga05p37_393021_c1 | nmdc:mga05p37_393021_c1_947_1288 | 113 |
| 1043 | 3300050511 | nmdc:mga08y16_4844_c1 | nmdc:mga08y16_4844_c1_5233_5583 | 113 |
| 1044 | 3300050512 | nmdc:mga0n895_49967_c1 | nmdc:mga0n895_49967_c1_2800_3144 | 113 |
| 1045 | 3300050513 | nmdc:mga0rr50_10870_c1 | nmdc:mga0rr50_10870_c1_2915_3256 | 113 |
| 1046 | 3300050514 | nmdc:mga08x19_8890_c2 | nmdc:mga08x19_8890_c2_3433_3780 | 113 |
| 1047 | 3300050515 | nmdc:mga0a205_23201_c1 | nmdc:mga0a205_23201_c1_1455_1799 | 113 |
| 1048 | 3300050515 | nmdc:mga0a205_287608_c1 | nmdc:mga0a205_287608_c1_1006_1350 | 113 |
| 1049 | 3300059493 | Ga0587077_106237 | Ga0587077_106237_213_560 | 113 |
| 1050 | 3300001990 | JGI24737J22298_10068766 | JGI24737J22298_100687662 | 114 |
| 1051 | 3300003322 | rootL2_10272735 | rootL2_102727353 | 114 |
| 1052 | 3300005288 | Ga0065714_10076656 | Ga0065714_100766563 | 114 |
| 1053 | 3300005290 | Ga0065712_10002629 | Ga0065712_100026296 | 114 |
| 1054 | 3300005290 | Ga0065712_10507318 | Ga0065712_105073181 | 114 |
| 1055 | 3300005293 | Ga0065715_10098309 | Ga0065715_100983092 | 114 |
| 1056 | 3300005293 | Ga0065715_10100912 | Ga0065715_101009122 | 114 |
| 1057 | 3300005293 | Ga0065715_10720190 | Ga0065715_107201902 | 114 |
| 1058 | 3300005295 | Ga0065707_10018320 | Ga0065707_100183203 | 114 |
| 1059 | 3300005328 | Ga0070676_11557249 | Ga0070676_115572491 | 114 |
| 1060 | 3300005330 | Ga0070690_100644009 | Ga0070690_1006440092 | 114 |
| 1061 | 3300005330 | Ga0070690_100885827 | Ga0070690_1008858272 | 114 |
| 1062 | 3300005331 | Ga0070670_100138167 | Ga0070670_1001381672 | 114 |
| 1063 | 3300005333 | Ga0070677_10655552 | Ga0070677_106555522 | 114 |
| 1064 | 3300005334 | Ga0068869_101726184 | Ga0068869_1017261842 | 114 |
| 1065 | 3300005334 | Ga0068869_101905403 | Ga0068869_1019054031 | 114 |
| 1066 | 3300005335 | Ga0070666_10645146 | Ga0070666_106451462 | 114 |
| 1067 | 3300005337 | Ga0070682_100003243 | Ga0070682_1000032437 | 114 |
| 1068 | 3300005337 | Ga0070682_100004023 | Ga0070682_1000040235 | 114 |
| 1069 | 3300005338 | Ga0068868_101650872 | Ga0068868_1016508721 | 114 |
| 1070 | 3300005341 | Ga0070691_10370922 | Ga0070691_103709222 | 114 |
| 1071 | 3300005343 | Ga0070687_100096543 | Ga0070687_1000965433 | 114 |
| 1072 | 3300005344 | Ga0070661_100268374 | Ga0070661_1002683743 | 114 |
| 1073 | 3300005345 | Ga0070692_10012785 | Ga0070692_100127853 | 114 |
| 1074 | 3300005345 | Ga0070692_10264422 | Ga0070692_102644222 | 114 |
| 1075 | 3300005345 | Ga0070692_10433657 | Ga0070692_104336572 | 114 |
| 1076 | 3300005353 | Ga0070669_100006231 | Ga0070669_1000062315 | 114 |
| 1077 | 3300005354 | Ga0070675_100321553 | Ga0070675_1003215532 | 114 |
| 1078 | 3300005355 | Ga0070671_101598815 | Ga0070671_1015988152 | 114 |
| 1079 | 3300005364 | Ga0070673_100100271 | Ga0070673_1001002713 | 114 |
| 1080 | 3300005366 | Ga0070659_100333075 | Ga0070659_1003330752 | 114 |
| 1081 | 3300005406 | Ga0070703_10002822 | Ga0070703_100028226 | 114 |
| 1082 | 3300005438 | Ga0070701_10152057 | Ga0070701_101520572 | 114 |
| 1083 | 3300005438 | Ga0070701_10750366 | Ga0070701_107503662 | 114 |
| 1084 | 3300005440 | Ga0070705_100002412 | Ga0070705_1000024123 | 114 |
| 1085 | 3300005440 | Ga0070705_100626372 | Ga0070705_1006263722 | 114 |
| 1086 | 3300005441 | Ga0070700_100019588 | Ga0070700_1000195883 | 114 |
| 1087 | 3300005441 | Ga0070700_100046598 | Ga0070700_1000465982 | 114 |
| 1088 | 3300005444 | Ga0070694_100004873 | Ga0070694_1000048733 | 114 |
| 1089 | 3300005444 | Ga0070694_100019668 | Ga0070694_1000196683 | 114 |
| 1090 | 3300005444 | Ga0070694_100221671 | Ga0070694_1002216712 | 114 |
| 1091 | 3300005445 | Ga0070708_100284225 | Ga0070708_1002842252 | 114 |
| 1092 | 3300005458 | Ga0070681_10019243 | Ga0070681_100192436 | 114 |
| 1093 | 3300005458 | Ga0070681_10515435 | Ga0070681_105154352 | 114 |
| 1094 | 3300005458 | Ga0070681_10642445 | Ga0070681_106424452 | 114 |
| 1095 | 3300005459 | Ga0068867_100162774 | Ga0068867_1001627742 | 114 |
| 1096 | 3300005459 | Ga0068867_100284480 | Ga0068867_1002844803 | 114 |
| 1097 | 3300005459 | Ga0068867_100850527 | Ga0068867_1008505272 | 114 |
| 1098 | 3300005459 | Ga0068867_101067614 | Ga0068867_1010676141 | 114 |
| 1099 | 3300005459 | Ga0068867_101600892 | Ga0068867_1016008921 | 114 |
| 1100 | 3300005459 | Ga0068867_101743219 | Ga0068867_1017432191 | 114 |
| 1101 | 3300005459 | Ga0068867_101761204 | Ga0068867_1017612041 | 114 |
| 1102 | 3300005467 | Ga0070706_100000250 | Ga0070706_10000025023 | 114 |
| 1103 | 3300005471 | Ga0070698_100371550 | Ga0070698_1003715503 | 114 |
| 1104 | 3300005518 | Ga0070699_100223394 | Ga0070699_1002233941 | 114 |
| 1105 | 3300005518 | Ga0070699_100388654 | Ga0070699_1003886542 | 114 |
| 1106 | 3300005539 | Ga0068853_100227672 | Ga0068853_1002276722 | 114 |
| 1107 | 3300005539 | Ga0068853_100273079 | Ga0068853_1002730791 | 114 |
| 1108 | 3300005539 | Ga0068853_101683413 | Ga0068853_1016834131 | 114 |
| 1109 | 3300005543 | Ga0070672_100446856 | Ga0070672_1004468562 | 114 |
| 1110 | 3300005545 | Ga0070695_100029869 | Ga0070695_1000298693 | 114 |
| 1111 | 3300005545 | Ga0070695_100184161 | Ga0070695_1001841612 | 114 |
| 1112 | 3300005545 | Ga0070695_100514629 | Ga0070695_1005146292 | 114 |
| 1113 | 3300005545 | Ga0070695_101199579 | Ga0070695_1011995791 | 114 |
| 1114 | 3300005546 | Ga0070696_101090907 | Ga0070696_1010909072 | 114 |
| 1115 | 3300005546 | Ga0070696_101400975 | Ga0070696_1014009752 | 114 |
| 1116 | 3300005547 | Ga0070693_100004656 | Ga0070693_1000046564 | 114 |
| 1117 | 3300005547 | Ga0070693_100042851 | Ga0070693_1000428513 | 114 |
| 1118 | 3300005547 | Ga0070693_100048071 | Ga0070693_1000480712 | 114 |
| 1119 | 3300005547 | Ga0070693_100072169 | Ga0070693_1000721694 | 114 |
| 1120 | 3300005547 | Ga0070693_100312656 | Ga0070693_1003126563 | 114 |
| 1121 | 3300005549 | Ga0070704_100057210 | Ga0070704_1000572101 | 114 |
| 1122 | 3300005549 | Ga0070704_100144385 | Ga0070704_1001443851 | 114 |
| 1123 | 3300005563 | Ga0068855_102588902 | Ga0068855_1025889021 | 114 |
| 1124 | 3300005564 | Ga0070664_100050050 | Ga0070664_1000500503 | 114 |
| 1125 | 3300005564 | Ga0070664_100511873 | Ga0070664_1005118731 | 114 |
| 1126 | 3300005577 | Ga0068857_100015247 | Ga0068857_1000152473 | 114 |
| 1127 | 3300005577 | Ga0068857_100084026 | Ga0068857_1000840262 | 114 |
| 1128 | 3300005577 | Ga0068857_101599633 | Ga0068857_1015996331 | 114 |
| 1129 | 3300005578 | Ga0068854_100587271 | Ga0068854_1005872712 | 114 |
| 1130 | 3300005578 | Ga0068854_102022763 | Ga0068854_1020227631 | 114 |
| 1131 | 3300005615 | Ga0070702_100012823 | Ga0070702_1000128232 | 114 |
| 1132 | 3300005615 | Ga0070702_100066498 | Ga0070702_1000664982 | 114 |
| 1133 | 3300005615 | Ga0070702_100070012 | Ga0070702_1000700122 | 114 |
| 1134 | 3300005615 | Ga0070702_100173220 | Ga0070702_1001732203 | 114 |
| 1135 | 3300005616 | Ga0068852_101075634 | Ga0068852_1010756341 | 114 |
| 1136 | 3300005617 | Ga0068859_100053033 | Ga0068859_1000530333 | 114 |
| 1137 | 3300005617 | Ga0068859_100103711 | Ga0068859_1001037112 | 114 |
| 1138 | 3300005617 | Ga0068859_100132806 | Ga0068859_1001328062 | 114 |
| 1139 | 3300005617 | Ga0068859_100294539 | Ga0068859_1002945392 | 114 |
| 1140 | 3300005617 | Ga0068859_100380124 | Ga0068859_1003801242 | 114 |
| 1141 | 3300005617 | Ga0068859_100401164 | Ga0068859_1004011643 | 114 |
| 1142 | 3300005617 | Ga0068859_100563704 | Ga0068859_1005637042 | 114 |
| 1143 | 3300005617 | Ga0068859_101080701 | Ga0068859_1010807012 | 114 |
| 1144 | 3300005617 | Ga0068859_102143208 | Ga0068859_1021432082 | 114 |
| 1145 | 3300005618 | Ga0068864_100067551 | Ga0068864_1000675514 | 114 |
| 1146 | 3300005618 | Ga0068864_101054402 | Ga0068864_1010544022 | 114 |
| 1147 | 3300005719 | Ga0068861_100312655 | Ga0068861_1003126551 | 114 |
| 1148 | 3300005834 | Ga0068851_10001358 | Ga0068851_100013588 | 114 |
| 1149 | 3300005840 | Ga0068870_10011207 | Ga0068870_100112072 | 114 |
| 1150 | 3300005840 | Ga0068870_10105110 | Ga0068870_101051102 | 114 |
| 1151 | 3300005840 | Ga0068870_10268254 | Ga0068870_102682541 | 114 |
| 1152 | 3300005841 | Ga0068863_100012454 | Ga0068863_1000124543 | 114 |
| 1153 | 3300005841 | Ga0068863_100048330 | Ga0068863_1000483303 | 114 |
| 1154 | 3300005841 | Ga0068863_100891448 | Ga0068863_1008914482 | 114 |
| 1155 | 3300005841 | Ga0068863_101786968 | Ga0068863_1017869682 | 114 |
| 1156 | 3300005842 | Ga0068858_100486278 | Ga0068858_1004862782 | 114 |
| 1157 | 3300005842 | Ga0068858_100910523 | Ga0068858_1009105232 | 114 |
| 1158 | 3300005842 | Ga0068858_102391757 | Ga0068858_1023917572 | 114 |
| 1159 | 3300005843 | Ga0068860_100074625 | Ga0068860_1000746253 | 114 |
| 1160 | 3300005843 | Ga0068860_100498043 | Ga0068860_1004980432 | 114 |
| 1161 | 3300005843 | Ga0068860_100542151 | Ga0068860_1005421512 | 114 |
| 1162 | 3300006058 | Ga0075432_10445350 | Ga0075432_104453502 | 114 |
| 1163 | 3300006173 | Ga0070716_100006865 | Ga0070716_1000068657 | 114 |
| 1164 | 3300006173 | Ga0070716_100283473 | Ga0070716_1002834733 | 114 |
| 1165 | 3300006175 | Ga0070712_100438752 | Ga0070712_1004387523 | 114 |
| 1166 | 3300006237 | Ga0097621_100284772 | Ga0097621_1002847723 | 114 |
| 1167 | 3300006358 | Ga0068871_100010219 | Ga0068871_1000102197 | 114 |
| 1168 | 3300006358 | Ga0068871_100069801 | Ga0068871_1000698013 | 114 |
| 1169 | 3300006844 | Ga0075428_100139696 | Ga0075428_1001396963 | 114 |
| 1170 | 3300006847 | Ga0075431_100035491 | Ga0075431_1000354913 | 114 |
| 1171 | 3300006852 | Ga0075433_10019978 | Ga0075433_100199785 | 114 |
| 1172 | 3300006852 | Ga0075433_10043066 | Ga0075433_100430663 | 114 |
| 1173 | 3300006871 | Ga0075434_100024652 | Ga0075434_1000246525 | 114 |
| 1174 | 3300006880 | Ga0075429_100496837 | Ga0075429_1004968372 | 114 |
| 1175 | 3300006931 | Ga0097620_100053034 | Ga0097620_1000530343 | 114 |
| 1176 | 3300006931 | Ga0097620_100103701 | Ga0097620_1001037013 | 114 |
| 1177 | 3300006931 | Ga0097620_100132805 | Ga0097620_1001328052 | 114 |
| 1178 | 3300006931 | Ga0097620_100294552 | Ga0097620_1002945522 | 114 |
| 1179 | 3300006931 | Ga0097620_100380135 | Ga0097620_1003801352 | 114 |
| 1180 | 3300006931 | Ga0097620_100401202 | Ga0097620_1004012023 | 114 |
| 1181 | 3300006931 | Ga0097620_100563653 | Ga0097620_1005636532 | 114 |
| 1182 | 3300006931 | Ga0097620_101080817 | Ga0097620_1010808172 | 114 |
| 1183 | 3300006931 | Ga0097620_102143148 | Ga0097620_1021431482 | 114 |
| 1184 | 3300009011 | Ga0105251_10218149 | Ga0105251_102181492 | 114 |
| 1185 | 3300009011 | Ga0105251_10345093 | Ga0105251_103450932 | 114 |
| 1186 | 3300009011 | Ga0105251_10488431 | Ga0105251_104884311 | 114 |
| 1187 | 3300009093 | Ga0105240_10034031 | Ga0105240_100340314 | 114 |
| 1188 | 3300009093 | Ga0105240_11824021 | Ga0105240_118240211 | 114 |
| 1189 | 3300009094 | Ga0111539_10098755 | Ga0111539_100987551 | 114 |
| 1190 | 3300009098 | Ga0105245_10984089 | Ga0105245_109840892 | 114 |
| 1191 | 3300009098 | Ga0105245_12516065 | Ga0105245_125160651 | 114 |
| 1192 | 3300009101 | Ga0105247_10022526 | Ga0105247_100225262 | 114 |
| 1193 | 3300009101 | Ga0105247_10087475 | Ga0105247_100874752 | 114 |
| 1194 | 3300009101 | Ga0105247_10651063 | Ga0105247_106510632 | 114 |
| 1195 | 3300009147 | Ga0114129_10028076 | Ga0114129_100280763 | 114 |
| 1196 | 3300009147 | Ga0114129_12438319 | Ga0114129_124383192 | 114 |
| 1197 | 3300009148 | Ga0105243_10083569 | Ga0105243_100835692 | 114 |
| 1198 | 3300009148 | Ga0105243_10165738 | Ga0105243_101657382 | 114 |
| 1199 | 3300009148 | Ga0105243_10206265 | Ga0105243_102062652 | 114 |
| 1200 | 3300009148 | Ga0105243_11900037 | Ga0105243_119000372 | 114 |
| 1201 | 3300009174 | Ga0105241_10066355 | Ga0105241_100663553 | 114 |
| 1202 | 3300009174 | Ga0105241_10100939 | Ga0105241_101009392 | 114 |
| 1203 | 3300009174 | Ga0105241_10259041 | Ga0105241_102590412 | 114 |
| 1204 | 3300009174 | Ga0105241_10437316 | Ga0105241_104373162 | 114 |
| 1205 | 3300009174 | Ga0105241_10783109 | Ga0105241_107831092 | 114 |
| 1206 | 3300009174 | Ga0105241_11242018 | Ga0105241_112420182 | 114 |
| 1207 | 3300009174 | Ga0105241_11371373 | Ga0105241_113713731 | 114 |
| 1208 | 3300009176 | Ga0105242_10039349 | Ga0105242_100393493 | 114 |
| 1209 | 3300009176 | Ga0105242_10226434 | Ga0105242_102264342 | 114 |
| 1210 | 3300009176 | Ga0105242_10289648 | Ga0105242_102896483 | 114 |
| 1211 | 3300009176 | Ga0105242_11749764 | Ga0105242_117497642 | 114 |
| 1212 | 3300009177 | Ga0105248_10007159 | Ga0105248_100071595 | 114 |
| 1213 | 3300009177 | Ga0105248_10162973 | Ga0105248_101629733 | 114 |
| 1214 | 3300009177 | Ga0105248_10165652 | Ga0105248_101656522 | 114 |
| 1215 | 3300009177 | Ga0105248_10541889 | Ga0105248_105418892 | 114 |
| 1216 | 3300009177 | Ga0105248_10967744 | Ga0105248_109677442 | 114 |
| 1217 | 3300009545 | Ga0105237_10000199 | Ga0105237_100001997 | 114 |
| 1218 | 3300009551 | Ga0105238_10371069 | Ga0105238_103710692 | 114 |
| 1219 | 3300009551 | Ga0105238_10885960 | Ga0105238_108859602 | 114 |
| 1220 | 3300009551 | Ga0105238_11217588 | Ga0105238_112175882 | 114 |
| 1221 | 3300009551 | Ga0105238_11405881 | Ga0105238_114058811 | 114 |
| 1222 | 3300009553 | Ga0105249_10026072 | Ga0105249_100260721 | 114 |
| 1223 | 3300009553 | Ga0105249_11336763 | Ga0105249_113367632 | 114 |
| 1224 | 3300010375 | Ga0105239_10757128 | Ga0105239_107571282 | 114 |
| 1225 | 3300010375 | Ga0105239_11045922 | Ga0105239_110459221 | 114 |
| 1226 | 3300011119 | Ga0105246_10056903 | Ga0105246_100569032 | 114 |
| 1227 | 3300011119 | Ga0105246_10103030 | Ga0105246_101030303 | 114 |
| 1228 | 3300013100 | Ga0157373_10688777 | Ga0157373_106887771 | 114 |
| 1229 | 3300013100 | Ga0157373_10855604 | Ga0157373_108556042 | 114 |
| 1230 | 3300013100 | Ga0157373_10987687 | Ga0157373_109876872 | 114 |
| 1231 | 3300013296 | Ga0157374_10821593 | Ga0157374_108215932 | 114 |
| 1232 | 3300013297 | Ga0157378_10332340 | Ga0157378_103323402 | 114 |
| 1233 | 3300013306 | Ga0163162_10640359 | Ga0163162_106403592 | 114 |
| 1234 | 3300013307 | Ga0157372_10033757 | Ga0157372_100337574 | 114 |
| 1235 | 3300013307 | Ga0157372_10928710 | Ga0157372_109287102 | 114 |
| 1236 | 3300013308 | Ga0157375_10063629 | Ga0157375_100636292 | 114 |
| 1237 | 3300013308 | Ga0157375_11547612 | Ga0157375_115476122 | 114 |
| 1238 | 3300014325 | Ga0163163_10386954 | Ga0163163_103869542 | 114 |
| 1239 | 3300014325 | Ga0163163_10681317 | Ga0163163_106813172 | 114 |
| 1240 | 3300014745 | Ga0157377_10110423 | Ga0157377_101104232 | 114 |
| 1241 | 3300014968 | Ga0157379_10041034 | Ga0157379_100410342 | 114 |
| 1242 | 3300015265 | Ga0182005_1226343 | Ga0182005_12263432 | 114 |
| 1243 | 3300025315 | Ga0207697_10246407 | Ga0207697_102464072 | 114 |
| 1244 | 3300025321 | Ga0207656_10001285 | Ga0207656_100012855 | 114 |
| 1245 | 3300025885 | Ga0207653_10008038 | Ga0207653_100080383 | 114 |
| 1246 | 3300025900 | Ga0207710_10224905 | Ga0207710_102249052 | 114 |
| 1247 | 3300025904 | Ga0207647_10039267 | Ga0207647_100392672 | 114 |
| 1248 | 3300025904 | Ga0207647_10100743 | Ga0207647_101007432 | 114 |
| 1249 | 3300025904 | Ga0207647_10435298 | Ga0207647_104352982 | 114 |
| 1250 | 3300025908 | Ga0207643_10009386 | Ga0207643_100093862 | 114 |
| 1251 | 3300025910 | Ga0207684_10000093 | Ga0207684_1000009323 | 114 |
| 1252 | 3300025911 | Ga0207654_10030858 | Ga0207654_100308583 | 114 |
| 1253 | 3300025911 | Ga0207654_10033202 | Ga0207654_100332022 | 114 |
| 1254 | 3300025911 | Ga0207654_10193335 | Ga0207654_101933352 | 114 |
| 1255 | 3300025912 | Ga0207707_10549170 | Ga0207707_105491701 | 114 |
| 1256 | 3300025913 | Ga0207695_10351958 | Ga0207695_103519582 | 114 |
| 1257 | 3300025914 | Ga0207671_10009579 | Ga0207671_100095793 | 114 |
| 1258 | 3300025917 | Ga0207660_11299572 | Ga0207660_112995721 | 114 |
| 1259 | 3300025918 | Ga0207662_10180372 | Ga0207662_101803722 | 114 |
| 1260 | 3300025923 | Ga0207681_10008337 | Ga0207681_100083374 | 114 |
| 1261 | 3300025924 | Ga0207694_10883458 | Ga0207694_108834582 | 114 |
| 1262 | 3300025925 | Ga0207650_10076903 | Ga0207650_100769033 | 114 |
| 1263 | 3300025925 | Ga0207650_11217278 | Ga0207650_112172782 | 114 |
| 1264 | 3300025927 | Ga0207687_11933906 | Ga0207687_119339061 | 114 |
| 1265 | 3300025931 | Ga0207644_11818946 | Ga0207644_118189462 | 114 |
| 1266 | 3300025932 | Ga0207690_10295129 | Ga0207690_102951292 | 114 |
| 1267 | 3300025933 | Ga0207706_10643447 | Ga0207706_106434472 | 114 |
| 1268 | 3300025933 | Ga0207706_11720772 | Ga0207706_117207721 | 114 |
| 1269 | 3300025934 | Ga0207686_10118681 | Ga0207686_101186812 | 114 |
| 1270 | 3300025935 | Ga0207709_10020878 | Ga0207709_100208782 | 114 |
| 1271 | 3300025935 | Ga0207709_10465775 | Ga0207709_104657752 | 114 |
| 1272 | 3300025935 | Ga0207709_10556024 | Ga0207709_105560242 | 114 |
| 1273 | 3300025936 | Ga0207670_10002947 | Ga0207670_100029475 | 114 |
| 1274 | 3300025936 | Ga0207670_10309892 | Ga0207670_103098922 | 114 |
| 1275 | 3300025939 | Ga0207665_10159013 | Ga0207665_101590132 | 114 |
| 1276 | 3300025940 | Ga0207691_10916000 | Ga0207691_109160002 | 114 |
| 1277 | 3300025941 | Ga0207711_10023161 | Ga0207711_100231612 | 114 |
| 1278 | 3300025941 | Ga0207711_10280547 | Ga0207711_102805472 | 114 |
| 1279 | 3300025941 | Ga0207711_10310859 | Ga0207711_103108592 | 114 |
| 1280 | 3300025941 | Ga0207711_11132236 | Ga0207711_111322361 | 114 |
| 1281 | 3300025942 | Ga0207689_10082032 | Ga0207689_100820323 | 114 |
| 1282 | 3300025942 | Ga0207689_10341305 | Ga0207689_103413052 | 114 |
| 1283 | 3300025942 | Ga0207689_11232138 | Ga0207689_112321382 | 114 |
| 1284 | 3300025945 | Ga0207679_10188536 | Ga0207679_101885363 | 114 |
| 1285 | 3300025945 | Ga0207679_10193396 | Ga0207679_101933963 | 114 |
| 1286 | 3300025945 | Ga0207679_10764036 | Ga0207679_107640363 | 114 |
| 1287 | 3300025945 | Ga0207679_11898487 | Ga0207679_118984872 | 114 |
| 1288 | 3300025960 | Ga0207651_10382519 | Ga0207651_103825191 | 114 |
| 1289 | 3300025960 | Ga0207651_10417887 | Ga0207651_104178872 | 114 |
| 1290 | 3300025961 | Ga0207712_10016699 | Ga0207712_100166994 | 114 |
| 1291 | 3300025981 | Ga0207640_10104686 | Ga0207640_101046863 | 114 |
| 1292 | 3300026023 | Ga0207677_11085731 | Ga0207677_110857312 | 114 |
| 1293 | 3300026035 | Ga0207703_10048207 | Ga0207703_100482072 | 114 |
| 1294 | 3300026035 | Ga0207703_10053925 | Ga0207703_100539252 | 114 |
| 1295 | 3300026035 | Ga0207703_10209739 | Ga0207703_102097392 | 114 |
| 1296 | 3300026035 | Ga0207703_12196833 | Ga0207703_121968331 | 114 |
| 1297 | 3300026041 | Ga0207639_10058308 | Ga0207639_100583083 | 114 |
| 1298 | 3300026041 | Ga0207639_11421490 | Ga0207639_114214902 | 114 |
| 1299 | 3300026075 | Ga0207708_10024121 | Ga0207708_100241212 | 114 |
| 1300 | 3300026075 | Ga0207708_10029346 | Ga0207708_100293464 | 114 |
| 1301 | 3300026075 | Ga0207708_10147408 | Ga0207708_101474083 | 114 |
| 1302 | 3300026088 | Ga0207641_10013347 | Ga0207641_100133473 | 114 |
| 1303 | 3300026088 | Ga0207641_10111021 | Ga0207641_101110213 | 114 |
| 1304 | 3300026088 | Ga0207641_10161411 | Ga0207641_101614113 | 114 |
| 1305 | 3300026088 | Ga0207641_10367804 | Ga0207641_103678042 | 114 |
| 1306 | 3300026089 | Ga0207648_10248278 | Ga0207648_102482782 | 114 |
| 1307 | 3300026089 | Ga0207648_10293272 | Ga0207648_102932722 | 114 |
| 1308 | 3300026089 | Ga0207648_10729582 | Ga0207648_107295822 | 114 |
| 1309 | 3300026089 | Ga0207648_10984519 | Ga0207648_109845192 | 114 |
| 1310 | 3300026095 | Ga0207676_10050400 | Ga0207676_100504004 | 114 |
| 1311 | 3300026095 | Ga0207676_10987657 | Ga0207676_109876572 | 114 |
| 1312 | 3300026116 | Ga0207674_10024472 | Ga0207674_100244727 | 114 |
| 1313 | 3300026116 | Ga0207674_10093324 | Ga0207674_100933243 | 114 |
| 1314 | 3300026116 | Ga0207674_10774523 | Ga0207674_107745232 | 114 |
| 1315 | 3300026116 | Ga0207674_11728298 | Ga0207674_117282982 | 114 |
| 1316 | 3300026118 | Ga0207675_100111996 | Ga0207675_1001119962 | 114 |
| 1317 | 3300028380 | Ga0268265_10530708 | Ga0268265_105307082 | 114 |
| 1318 | 3300028381 | Ga0268264_10016633 | Ga0268264_100166333 | 114 |
| 1319 | 3300028381 | Ga0268264_10419794 | Ga0268264_104197942 | 114 |
| 1320 | 3300028381 | Ga0268264_10761805 | Ga0268264_107618052 | 114 |
| 1321 | 3300031548 | Ga0307408_100021160 | Ga0307408_1000211602 | 114 |
| 1322 | 3300031548 | Ga0307408_100069176 | Ga0307408_1000691763 | 114 |
| 1323 | 3300031548 | Ga0307408_100698352 | Ga0307408_1006983521 | 114 |
| 1324 | 3300031731 | Ga0307405_10004763 | Ga0307405_100047633 | 114 |
| 1325 | 3300031824 | Ga0307413_11170962 | Ga0307413_111709621 | 114 |
| 1326 | 3300031852 | Ga0307410_10507227 | Ga0307410_105072273 | 114 |
| 1327 | 3300031901 | Ga0307406_10012174 | Ga0307406_100121744 | 114 |
| 1328 | 3300031903 | Ga0307407_10818869 | Ga0307407_108188692 | 114 |
| 1329 | 3300031911 | Ga0307412_10006276 | Ga0307412_100062763 | 114 |
| 1330 | 3300032002 | Ga0307416_100004668 | Ga0307416_1000046682 | 114 |
| 1331 | 3300032002 | Ga0307416_100248270 | Ga0307416_1002482703 | 114 |
| 1332 | 3300032004 | Ga0307414_10001159 | Ga0307414_100011595 | 114 |
| 1333 | 3300032004 | Ga0307414_10037715 | Ga0307414_100377152 | 114 |
| 1334 | 3300032005 | Ga0307411_10162139 | Ga0307411_101621392 | 114 |
| 1335 | 3300032005 | Ga0307411_10384682 | Ga0307411_103846822 | 114 |
| 1336 | 3300032005 | Ga0307411_12296398 | Ga0307411_122963982 | 114 |
| 1337 | 3300032126 | Ga0307415_100002653 | Ga0307415_1000026533 | 114 |
| 1338 | 3300034817 | Ga0373948_0164300 | Ga0373948_0164300_114_461 | 114 |
| 1339 | 3300035088 | Ga0373940_0005965 | Ga0373940_0005965_419_766 | 114 |
| 1340 | 3300035091 | Ga0373951_0115113 | Ga0373951_0115113_183_530 | 114 |
| 1341 | 3300035115 | Ga0373941_0013686 | Ga0373941_0013686_226_573 | 114 |
| 1342 | 3300035691 | Ga0373931_0369809 | Ga0373931_0369809_451_804 | 114 |
| 1343 | 3300038443 | Ga0395901_0577963 | Ga0395901_0577963_482_826 | 114 |
| 1344 | 3300042002 | Ga0439442_079128 | Ga0439442_079128_336_686 | 114 |
| 1345 | 3300042005 | Ga0439448_0053476 | Ga0439448_0053476_715_1062 | 114 |
| 1346 | 3300042012 | Ga0439455_0015377 | Ga0439455_0015377_673_1020 | 114 |
| 1347 | 3300042157 | Ga0439458_0003739 | Ga0439458_0003739_1724_2071 | 114 |
| 1348 | 3300045051 | Ga0451576_1896340 | Ga0451576_1896340_173_520 | 114 |
| 1349 | 3300046616 | Ga0495668_0298746 | Ga0495668_0298746_347_694 | 114 |
| 1350 | 3300048909 | Ga0496106_1079298 | Ga0496106_1079298_246_599 | 114 |
| 1351 | 3300048915 | Ga0496112_0309976 | Ga0496112_0309976_647_1000 | 114 |
| 1352 | 3300048915 | Ga0496112_0317644 | Ga0496112_0317644_397_744 | 114 |
| 1353 | 3300048916 | Ga0496113_0350063 | Ga0496113_0350063_323_673 | 114 |
| 1354 | 3300048916 | Ga0496113_0697352 | Ga0496113_0697352_82_429 | 114 |
| 1355 | 3300049515 | Ga0501292_049371 | Ga0501292_049371_210_557 | 114 |
| 1356 | 3300049519 | Ga0501296_002599 | Ga0501296_002599_970_1317 | 114 |
| 1357 | 3300049520 | Ga0501297_027139 | Ga0501297_027139_270_617 | 114 |
| 1358 | 3300049521 | Ga0501298_009993 | Ga0501298_009993_697_1044 | 114 |
| 1359 | 3300049522 | Ga0501299_001927 | Ga0501299_001927_1855_2199 | 114 |
| 1360 | 3300049522 | Ga0501299_002643 | Ga0501299_002643_249_596 | 114 |
| 1361 | 3300049522 | Ga0501299_007922 | Ga0501299_007922_1158_1505 | 114 |
| 1362 | 3300049649 | Ga0501198_000725 | Ga0501198_000725_1208_1555 | 114 |
| 1363 | 3300049649 | Ga0501198_018223 | Ga0501198_018223_205_552 | 114 |
| 1364 | 3300049650 | Ga0501199_003118 | Ga0501199_003118_13_360 | 114 |
| 1365 | 3300049652 | Ga0501202_000490 | Ga0501202_000490_2121_2468 | 114 |
| 1366 | 3300049652 | Ga0501202_002846 | Ga0501202_002846_197_544 | 114 |
| 1367 | 3300049652 | Ga0501202_005152 | Ga0501202_005152_1749_2093 | 114 |
| 1368 | 3300049652 | Ga0501202_015908 | Ga0501202_015908_159_506 | 114 |
| 1369 | 3300049653 | Ga0501206_006644 | Ga0501206_006644_91_435 | 114 |
| 1370 | 3300049653 | Ga0501206_015603 | Ga0501206_015603_89_436 | 114 |
| 1371 | 3300049654 | Ga0501207_000218 | Ga0501207_000218_2597_2944 | 114 |
| 1372 | 3300049654 | Ga0501207_025977 | Ga0501207_025977_340_684 | 114 |
| 1373 | 3300049655 | Ga0501208_000649 | Ga0501208_000649_1597_1944 | 114 |
| 1374 | 3300049656 | Ga0501209_005521 | Ga0501209_005521_1740_2087 | 114 |
| 1375 | 3300049659 | Ga0501214_064639 | Ga0501214_064639_21_368 | 114 |
| 1376 | 3300049660 | Ga0501216_001646 | Ga0501216_001646_1644_1988 | 114 |
| 1377 | 3300049660 | Ga0501216_054183 | Ga0501216_054183_190_537 | 114 |
| 1378 | 3300049661 | Ga0501217_001280 | Ga0501217_001280_502_849 | 114 |
| 1379 | 3300049661 | Ga0501217_002256 | Ga0501217_002256_1445_1792 | 114 |
| 1380 | 3300049663 | Ga0501223_002735 | Ga0501223_002735_266_613 | 114 |
| 1381 | 3300049663 | Ga0501223_020003 | Ga0501223_020003_190_537 | 114 |
| 1382 | 3300049664 | Ga0501224_006602 | Ga0501224_006602_55_402 | 114 |
| 1383 | 3300049665 | Ga0501227_001046 | Ga0501227_001046_5784_6131 | 114 |
| 1384 | 3300049665 | Ga0501227_012440 | Ga0501227_012440_235_579 | 114 |
| 1385 | 3300049667 | Ga0501230_001599 | Ga0501230_001599_1763_2110 | 114 |
| 1386 | 3300049668 | Ga0501233_000236 | Ga0501233_000236_2311_2658 | 114 |
| 1387 | 3300049669 | Ga0501235_000935 | Ga0501235_000935_3257_3604 | 114 |
| 1388 | 3300049669 | Ga0501235_005364 | Ga0501235_005364_1595_1942 | 114 |
| 1389 | 3300049669 | Ga0501235_007593 | Ga0501235_007593_1314_1661 | 114 |
| 1390 | 3300049669 | Ga0501235_037396 | Ga0501235_037396_512_856 | 114 |
| 1391 | 3300049673 | Ga0501240_000663 | Ga0501240_000663_42_389 | 114 |
| 1392 | 3300049675 | Ga0501243_016172 | Ga0501243_016172_324_671 | 114 |
| 1393 | 3300049675 | Ga0501243_026823 | Ga0501243_026823_154_498 | 114 |
| 1394 | 3300049675 | Ga0501243_067980 | Ga0501243_067980_129_476 | 114 |
| 1395 | 3300049679 | Ga0501249_029098 | Ga0501249_029098_420_767 | 114 |
| 1396 | 3300049681 | Ga0501251_003043 | Ga0501251_003043_183_527 | 114 |
| 1397 | 3300049682 | Ga0501252_075629 | Ga0501252_075629_38_382 | 114 |
| 1398 | 3300049683 | Ga0501253_001873 | Ga0501253_001873_275_622 | 114 |
| 1399 | 3300049683 | Ga0501253_002458 | Ga0501253_002458_602_946 | 114 |
| 1400 | 3300049684 | Ga0501255_004194 | Ga0501255_004194_919_1266 | 114 |
| 1401 | 3300049686 | Ga0501257_000868 | Ga0501257_000868_4163_4507 | 114 |
| 1402 | 3300049686 | Ga0501257_023587 | Ga0501257_023587_316_663 | 114 |
| 1403 | 3300049686 | Ga0501257_025056 | Ga0501257_025056_814_1161 | 114 |
| 1404 | 3300049689 | Ga0501260_011517 | Ga0501260_011517_158_505 | 114 |
| 1405 | 3300049690 | Ga0501261_003997 | Ga0501261_003997_787_1134 | 114 |
| 1406 | 3300049705 | Ga0501225_0000779 | Ga0501225_0000779_5713_6060 | 114 |
| 1407 | 3300049705 | Ga0501225_0025582 | Ga0501225_0025582_70_417 | 114 |
| 1408 | 3300049705 | Ga0501225_0038757 | Ga0501225_0038757_552_899 | 114 |
| 1409 | 3300049707 | Ga0501234_000381 | Ga0501234_000381_3776_4123 | 114 |
| 1410 | 3300049707 | Ga0501234_011342 | Ga0501234_011342_814_1161 | 114 |
| 1411 | 3300049708 | Ga0501245_002079 | Ga0501245_002079_406_750 | 114 |
| 1412 | 3300049763 | Ga0501266_006165 | Ga0501266_006165_787_1134 | 114 |
| 1413 | 3300049765 | Ga0501268_011857 | Ga0501268_011857_688_1032 | 114 |
| 1414 | 3300049765 | Ga0501268_126746 | Ga0501268_126746_202_549 | 114 |
| 1415 | 3300049775 | Ga0501279_107255 | Ga0501279_107255_144_488 | 114 |
| 1416 | 3300049779 | Ga0501283_032281 | Ga0501283_032281_38_382 | 114 |
| 1417 | 3300049850 | Ga0501204_002772 | Ga0501204_002772_224_568 | 114 |
| 1418 | 3300049850 | Ga0501204_003700 | Ga0501204_003700_1146_1493 | 114 |
| 1419 | 3300049851 | Ga0501212_011399 | Ga0501212_011399_235_579 | 114 |
| 1420 | 3300050507 | nmdc:mga05p37_1104784_c1 | nmdc:mga05p37_1104784_c1_169_516 | 114 |
| 1421 | 3300050507 | nmdc:mga05p37_569548_c1 | nmdc:mga05p37_569548_c1_71_415 | 114 |
| 1422 | 3300050507 | nmdc:mga05p37_82279_c1 | nmdc:mga05p37_82279_c1_2835_3182 | 114 |
| 1423 | 3300050508 | nmdc:mga09592_297543_c1 | nmdc:mga09592_297543_c1_542_889 | 114 |
| 1424 | 3300050510 | nmdc:mga06r32_771142_c1 | nmdc:mga06r32_771142_c1_553_900 | 114 |
| 1425 | 3300050512 | nmdc:mga0n895_655061_c1 | nmdc:mga0n895_655061_c1_498_845 | 114 |
| 1426 | 3300050515 | nmdc:mga0a205_672085_c1 | nmdc:mga0a205_672085_c1_361_708 | 114 |
| 1427 | 2162886006 | SwRhRL3b_contig_4028819 | SwRhRL3b_0524.00001480 | 115 |
| 1428 | 3300005289 | Ga0065704_10102668 | Ga0065704_101026683 | 115 |
| 1429 | 3300005293 | Ga0065715_10402779 | Ga0065715_104027792 | 115 |
| 1430 | 3300005293 | Ga0065715_10649427 | Ga0065715_106494272 | 115 |
| 1431 | 3300005295 | Ga0065707_10003692 | Ga0065707_100036922 | 115 |
| 1432 | 3300005331 | Ga0070670_100339317 | Ga0070670_1003393172 | 115 |
| 1433 | 3300005440 | Ga0070705_100153628 | Ga0070705_1001536282 | 115 |
| 1434 | 3300005441 | Ga0070700_100004564 | Ga0070700_1000045644 | 115 |
| 1435 | 3300005441 | Ga0070700_101771090 | Ga0070700_1017710901 | 115 |
| 1436 | 3300005444 | Ga0070694_100229535 | Ga0070694_1002295353 | 115 |
| 1437 | 3300005444 | Ga0070694_100491006 | Ga0070694_1004910062 | 115 |
| 1438 | 3300005458 | Ga0070681_10006697 | Ga0070681_100066974 | 115 |
| 1439 | 3300005539 | Ga0068853_101549870 | Ga0068853_1015498701 | 115 |
| 1440 | 3300005546 | Ga0070696_100078684 | Ga0070696_1000786843 | 115 |
| 1441 | 3300005547 | Ga0070693_101333460 | Ga0070693_1013334601 | 115 |
| 1442 | 3300005549 | Ga0070704_100122341 | Ga0070704_1001223413 | 115 |
| 1443 | 3300005578 | Ga0068854_101031413 | Ga0068854_1010314132 | 115 |
| 1444 | 3300005614 | Ga0068856_100191809 | Ga0068856_1001918093 | 115 |
| 1445 | 3300005617 | Ga0068859_100010723 | Ga0068859_1000107234 | 115 |
| 1446 | 3300005618 | Ga0068864_100006038 | Ga0068864_1000060385 | 115 |
| 1447 | 3300005618 | Ga0068864_100402774 | Ga0068864_1004027742 | 115 |
| 1448 | 3300005840 | Ga0068870_10061387 | Ga0068870_100613872 | 115 |
| 1449 | 3300006852 | Ga0075433_10041993 | Ga0075433_100419933 | 115 |
| 1450 | 3300006871 | Ga0075434_100046671 | Ga0075434_1000466713 | 115 |
| 1451 | 3300006931 | Ga0097620_100010723 | Ga0097620_1000107237 | 115 |
| 1452 | 3300007076 | Ga0075435_100938015 | Ga0075435_1009380152 | 115 |
| 1453 | 3300009093 | Ga0105240_10385766 | Ga0105240_103857663 | 115 |
| 1454 | 3300009148 | Ga0105243_11375570 | Ga0105243_113755702 | 115 |
| 1455 | 3300009174 | Ga0105241_10165285 | Ga0105241_101652853 | 115 |
| 1456 | 3300009174 | Ga0105241_11888218 | Ga0105241_118882182 | 115 |
| 1457 | 3300009177 | Ga0105248_10001687 | Ga0105248_1000168714 | 115 |
| 1458 | 3300009545 | Ga0105237_10034465 | Ga0105237_100344653 | 115 |
| 1459 | 3300011119 | Ga0105246_10253466 | Ga0105246_102534662 | 115 |
| 1460 | 3300014325 | Ga0163163_10013740 | Ga0163163_100137404 | 115 |
| 1461 | 3300025908 | Ga0207643_10054092 | Ga0207643_100540925 | 115 |
| 1462 | 3300025911 | Ga0207654_11182204 | Ga0207654_111822042 | 115 |
| 1463 | 3300025912 | Ga0207707_10071835 | Ga0207707_100718352 | 115 |
| 1464 | 3300025913 | Ga0207695_10112749 | Ga0207695_101127492 | 115 |
| 1465 | 3300025935 | Ga0207709_10255958 | Ga0207709_102559582 | 115 |
| 1466 | 3300025941 | Ga0207711_10013418 | Ga0207711_100134182 | 115 |
| 1467 | 3300026041 | Ga0207639_11415595 | Ga0207639_114155952 | 115 |
| 1468 | 3300026075 | Ga0207708_10000031 | Ga0207708_1000003185 | 115 |
| 1469 | 3300026088 | Ga0207641_10313293 | Ga0207641_103132932 | 115 |
| 1470 | 3300026088 | Ga0207641_10317289 | Ga0207641_103172892 | 115 |
| 1471 | 3300026095 | Ga0207676_11080994 | Ga0207676_110809941 | 115 |
| 1472 | 3300026116 | Ga0207674_10256618 | Ga0207674_102566182 | 115 |
| 1473 | 3300037418 | Ga0395900_1434654 | Ga0395900_1434654_235_588 | 115 |
| 1474 | 3300037466 | Ga0395898_1023159 | Ga0395898_1023159_370_723 | 115 |
| 1475 | 3300038443 | Ga0395901_0167038 | Ga0395901_0167038_579_932 | 115 |
| 1476 | 3300045051 | Ga0451576_0216108 | Ga0451576_0216108_1274_1624 | 115 |
| 1477 | 3300049679 | Ga0501249_103909 | Ga0501249_103909_73_420 | 115 |
| 1478 | 3300049708 | Ga0501245_065539 | Ga0501245_065539_16_363 | 115 |
| 1479 | 3300049770 | Ga0501273_071509 | Ga0501273_071509_163_510 | 115 |
| 1480 | 3300050512 | nmdc:mga0n895_84854_c1 | nmdc:mga0n895_84854_c1_2056_2406 | 115 |
| 1481 | 3300050513 | nmdc:mga0rr50_901041_c1 | nmdc:mga0rr50_901041_c1_254_604 | 115 |
| 1482 | 3300050515 | nmdc:mga0a205_32605_c1 | nmdc:mga0a205_32605_c1_681_1031 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar