F494265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1480 | 427 | 1480 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100094657|Ga0070708_1000946574 |
| Length | 175 |
| Sequence | MPDLRELYQEVILEHSKAPRNYGELATANHRAEGYNPLCGDHFTVYLDLEGDSIRDISFQGSGCAISKASASLMTQSVKGKTRAEAARLFDQFHKLVTGQSPANGNRSELGKLAVFSGVSEFPVRVKCATLAWHTLHALLEGNRALCRRSSLSTQSKEKDSYEGSSIWVRVNRSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 128 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 232 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 239 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 240 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 242 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 279 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 280 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 281 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 282 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 283 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 284 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 357 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.09 |
| Metatranscriptomes | 7.91 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.07 |
| Nodule | 0 |
| Rhizoplane | 3.51 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1074781 | 3300001904 | Unclassified | 530 |
| 2 | JGI24741J21665_1054123 | 3300001915 | Unclassified | 591 |
| 3 | Ga0058863_10127816 | 3300004799 | Bacteria | 7581 |
| 4 | Ga0058863_11021108 | 3300004799 | Bacteria | 1466 |
| 5 | Ga0058863_11730432 | 3300004799 | Bacteria | 685 |
| 6 | Ga0058863_11860926 | 3300004799 | Bacteria | 951 |
| 7 | Ga0058861_11826821 | 3300004800 | Unclassified | 804 |
| 8 | Ga0058861_12031869 | 3300004800 | Unclassified | 1059 |
| 9 | Ga0058862_10023634 | 3300004803 | Bacteria | 1235 |
| 10 | Ga0058862_10034373 | 3300004803 | Bacteria | 7297 |
| 11 | Ga0058862_10724446 | 3300004803 | Bacteria | 1461 |
| 12 | Ga0058862_12268890 | 3300004803 | Bacteria | 1679 |
| 13 | Ga0058862_12345701 | 3300004803 | Bacteria | 970 |
| 14 | Ga0058862_12473751 | 3300004803 | Unclassified | 1123 |
| 15 | Ga0058862_12782718 | 3300004803 | Bacteria | 822 |
| 16 | Ga0065704_10126818 | 3300005289 | Bacteria | 1684 |
| 17 | Ga0065712_10218621 | 3300005290 | Bacteria | 1048 |
| 18 | Ga0065707_10006434 | 3300005295 | Bacteria | 3187 |
| 19 | Ga0065707_10088310 | 3300005295 | Bacteria | 4693 |
| 20 | Ga0070658_10029956 | 3300005327 | Bacteria | 4373 |
| 21 | Ga0070658_10322621 | 3300005327 | Bacteria | 1319 |
| 22 | Ga0070658_10858312 | 3300005327 | Unclassified | 789 |
| 23 | Ga0070658_11469121 | 3300005327 | Bacteria | 591 |
| 24 | Ga0070676_10253514 | 3300005328 | Bacteria | 1175 |
| 25 | Ga0070676_10534570 | 3300005328 | Bacteria | 837 |
| 26 | Ga0070683_100000027 | 3300005329 | Bacteria | 172200 |
| 27 | Ga0070683_100085855 | 3300005329 | Bacteria | 2951 |
| 28 | Ga0070683_100109102 | 3300005329 | Bacteria | 2610 |
| 29 | Ga0070683_100122376 | 3300005329 | Bacteria | 2458 |
| 30 | Ga0070683_100129470 | 3300005329 | Bacteria | 2388 |
| 31 | Ga0070683_100339897 | 3300005329 | Bacteria | 1429 |
| 32 | Ga0070683_100468908 | 3300005329 | Bacteria | 1202 |
| 33 | Ga0070683_100505926 | 3300005329 | Bacteria | 1154 |
| 34 | Ga0070683_100532233 | 3300005329 | Bacteria | 1123 |
| 35 | Ga0070683_101410228 | 3300005329 | Bacteria | 669 |
| 36 | Ga0070670_100000463 | 3300005331 | Bacteria | 32853 |
| 37 | Ga0070670_100001082 | 3300005331 | Bacteria | 21598 |
| 38 | Ga0070670_100011194 | 3300005331 | Bacteria | 7666 |
| 39 | Ga0070670_100056945 | 3300005331 | Bacteria | 3356 |
| 40 | Ga0070670_100111653 | 3300005331 | Bacteria | 2356 |
| 41 | Ga0068869_100005528 | 3300005334 | Bacteria | 7956 |
| 42 | Ga0068869_100012601 | 3300005334 | Bacteria | 5592 |
| 43 | Ga0068869_100429892 | 3300005334 | Bacteria | 1091 |
| 44 | Ga0068869_100730496 | 3300005334 | Bacteria | 846 |
| 45 | Ga0068869_100744136 | 3300005334 | Bacteria | 839 |
| 46 | Ga0068869_101265702 | 3300005334 | Archaea | 650 |
| 47 | Ga0070666_10067040 | 3300005335 | Bacteria | 2437 |
| 48 | Ga0070666_10105851 | 3300005335 | Bacteria | 1943 |
| 49 | Ga0070680_100018863 | 3300005336 | Bacteria | 5457 |
| 50 | Ga0070680_100019548 | 3300005336 | Bacteria | 5369 |
| 51 | Ga0070680_100030425 | 3300005336 | Bacteria | 4337 |
| 52 | Ga0070680_100033808 | 3300005336 | Bacteria | 4123 |
| 53 | Ga0070680_100039352 | 3300005336 | Bacteria | 3827 |
| 54 | Ga0070680_100153383 | 3300005336 | Bacteria | 1935 |
| 55 | Ga0070680_100190183 | 3300005336 | Bacteria | 1729 |
| 56 | Ga0070680_100283317 | 3300005336 | Bacteria | 1404 |
| 57 | Ga0070680_100303536 | 3300005336 | Bacteria | 1354 |
| 58 | Ga0070680_100680242 | 3300005336 | Bacteria | 885 |
| 59 | Ga0070680_100951763 | 3300005336 | Unclassified | 741 |
| 60 | Ga0070682_100000079 | 3300005337 | Bacteria | 87919 |
| 61 | Ga0070682_100389044 | 3300005337 | Bacteria | 1051 |
| 62 | Ga0070682_100483228 | 3300005337 | Bacteria | 956 |
| 63 | Ga0068868_100001785 | 3300005338 | Bacteria | 14749 |
| 64 | Ga0068868_100030424 | 3300005338 | Bacteria | 4140 |
| 65 | Ga0068868_100040900 | 3300005338 | Unclassified | 3610 |
| 66 | Ga0068868_100041428 | 3300005338 | Bacteria | 3588 |
| 67 | Ga0068868_100052957 | 3300005338 | Bacteria | 3196 |
| 68 | Ga0068868_100094920 | 3300005338 | Bacteria | 2407 |
| 69 | Ga0068868_100141354 | 3300005338 | Bacteria | 1976 |
| 70 | Ga0068868_100216735 | 3300005338 | Bacteria | 1601 |
| 71 | Ga0070660_100014351 | 3300005339 | Bacteria | 5704 |
| 72 | Ga0070660_100349004 | 3300005339 | Bacteria | 1218 |
| 73 | Ga0070689_100000539 | 3300005340 | Bacteria | 22556 |
| 74 | Ga0070689_100037297 | 3300005340 | Bacteria | 3717 |
| 75 | Ga0070689_100382322 | 3300005340 | Bacteria | 1187 |
| 76 | Ga0070689_100387431 | 3300005340 | Bacteria | 1179 |
| 77 | Ga0070689_100404387 | 3300005340 | Bacteria | 1155 |
| 78 | Ga0070689_100624043 | 3300005340 | Bacteria | 936 |
| 79 | Ga0070691_10134081 | 3300005341 | Bacteria | 1257 |
| 80 | Ga0070691_10138763 | 3300005341 | Bacteria | 1237 |
| 81 | Ga0070691_10208907 | 3300005341 | Bacteria | 1029 |
| 82 | Ga0070687_100007147 | 3300005343 | Bacteria | 4630 |
| 83 | Ga0070687_100193374 | 3300005343 | Bacteria | 1228 |
| 84 | Ga0070687_100412902 | 3300005343 | Bacteria | 888 |
| 85 | Ga0070661_100192185 | 3300005344 | Bacteria | 1557 |
| 86 | Ga0070661_100278881 | 3300005344 | Bacteria | 1296 |
| 87 | Ga0070661_100304115 | 3300005344 | Bacteria | 1242 |
| 88 | Ga0070661_100330247 | 3300005344 | Bacteria | 1193 |
| 89 | Ga0070661_100577253 | 3300005344 | Bacteria | 907 |
| 90 | Ga0070692_10042923 | 3300005345 | Bacteria | 2324 |
| 91 | Ga0070675_100000003 | 3300005354 | Bacteria | 422595 |
| 92 | Ga0070675_100655528 | 3300005354 | Bacteria | 954 |
| 93 | Ga0070671_100093791 | 3300005355 | Bacteria | 2516 |
| 94 | Ga0070671_101063623 | 3300005355 | Bacteria | 710 |
| 95 | Ga0070674_100284408 | 3300005356 | Bacteria | 1312 |
| 96 | Ga0070673_100122565 | 3300005364 | Bacteria | 2171 |
| 97 | Ga0070673_100412719 | 3300005364 | Bacteria | 1209 |
| 98 | Ga0070673_100593985 | 3300005364 | Bacteria | 1009 |
| 99 | Ga0070673_100806147 | 3300005364 | Bacteria | 867 |
| 100 | Ga0070688_100639171 | 3300005365 | Bacteria | 818 |
| 101 | Ga0070659_100070558 | 3300005366 | Bacteria | 2775 |
| 102 | Ga0070659_100535689 | 3300005366 | Bacteria | 1001 |
| 103 | Ga0070659_101741935 | 3300005366 | Bacteria | 557 |
| 104 | Ga0070667_100934025 | 3300005367 | Bacteria | 808 |
| 105 | Ga0070709_10032322 | 3300005434 | Bacteria | 3154 |
| 106 | Ga0070709_10083607 | 3300005434 | Bacteria | 2088 |
| 107 | Ga0070709_10248002 | 3300005434 | Bacteria | 1281 |
| 108 | Ga0070709_10547093 | 3300005434 | Bacteria | 885 |
| 109 | Ga0070714_100011335 | 3300005435 | Bacteria | 7070 |
| 110 | Ga0070714_100038531 | 3300005435 | Bacteria | 4018 |
| 111 | Ga0070714_100084049 | 3300005435 | Bacteria | 2777 |
| 112 | Ga0070714_100108019 | 3300005435 | Bacteria | 2460 |
| 113 | Ga0070714_100117911 | 3300005435 | Bacteria | 2358 |
| 114 | Ga0070714_100124991 | 3300005435 | Bacteria | 2292 |
| 115 | Ga0070714_100170309 | 3300005435 | Bacteria | 1976 |
| 116 | Ga0070714_100190225 | 3300005435 | Bacteria | 1872 |
| 117 | Ga0070714_100205182 | 3300005435 | Bacteria | 1805 |
| 118 | Ga0070714_100214234 | 3300005435 | Unclassified | 1767 |
| 119 | Ga0070714_100228055 | 3300005435 | Bacteria | 1715 |
| 120 | Ga0070714_100258622 | 3300005435 | Unclassified | 1611 |
| 121 | Ga0070714_100315914 | 3300005435 | Bacteria | 1460 |
| 122 | Ga0070714_100416420 | 3300005435 | Bacteria | 1272 |
| 123 | Ga0070714_100568576 | 3300005435 | Bacteria | 1087 |
| 124 | Ga0070714_102032589 | 3300005435 | Bacteria | 560 |
| 125 | Ga0070713_100008383 | 3300005436 | Bacteria | 7327 |
| 126 | Ga0070713_100021840 | 3300005436 | Bacteria | 4934 |
| 127 | Ga0070713_100075911 | 3300005436 | Unclassified | 2852 |
| 128 | Ga0070713_100086884 | 3300005436 | Bacteria | 2682 |
| 129 | Ga0070713_100104493 | 3300005436 | Bacteria | 2459 |
| 130 | Ga0070713_100105609 | 3300005436 | Bacteria | 2447 |
| 131 | Ga0070713_100127628 | 3300005436 | Bacteria | 2239 |
| 132 | Ga0070713_100158681 | 3300005436 | Unclassified | 2017 |
| 133 | Ga0070713_100216183 | 3300005436 | Unclassified | 1737 |
| 134 | Ga0070713_100230484 | 3300005436 | Bacteria | 1683 |
| 135 | Ga0070713_100255526 | 3300005436 | Bacteria | 1600 |
| 136 | Ga0070713_100265815 | 3300005436 | Bacteria | 1569 |
| 137 | Ga0070713_100375520 | 3300005436 | Bacteria | 1323 |
| 138 | Ga0070713_100420907 | 3300005436 | Bacteria | 1250 |
| 139 | Ga0070713_100669183 | 3300005436 | Bacteria | 990 |
| 140 | Ga0070713_101502376 | 3300005436 | Bacteria | 654 |
| 141 | Ga0070710_10025235 | 3300005437 | Unclassified | 3146 |
| 142 | Ga0070710_10122967 | 3300005437 | Bacteria | 1573 |
| 143 | Ga0070710_10137726 | 3300005437 | Bacteria | 1494 |
| 144 | Ga0070710_10164143 | 3300005437 | Unclassified | 1380 |
| 145 | Ga0070710_10302698 | 3300005437 | Bacteria | 1044 |
| 146 | Ga0070710_10587852 | 3300005437 | Bacteria | 773 |
| 147 | Ga0070701_10000949 | 3300005438 | Bacteria | 10496 |
| 148 | Ga0070711_100006696 | 3300005439 | Bacteria | 6968 |
| 149 | Ga0070711_100213706 | 3300005439 | Bacteria | 1495 |
| 150 | Ga0070711_100634977 | 3300005439 | Bacteria | 894 |
| 151 | Ga0070711_100848302 | 3300005439 | Unclassified | 777 |
| 152 | Ga0070711_100871893 | 3300005439 | Unclassified | 767 |
| 153 | Ga0070705_101777431 | 3300005440 | Bacteria | 522 |
| 154 | Ga0070700_100000009 | 3300005441 | Bacteria | 181474 |
| 155 | Ga0070708_100001651 | 3300005445 | Bacteria | 17109 |
| 156 | Ga0070708_100002626 | 3300005445 | Bacteria | 13911 |
| 157 | Ga0070708_100094657 | 3300005445 | Bacteria | 2725 |
| 158 | Ga0070708_100109118 | 3300005445 | Bacteria | 2542 |
| 159 | Ga0070708_100189331 | 3300005445 | Bacteria | 1924 |
| 160 | Ga0070708_100205949 | 3300005445 | Bacteria | 1843 |
| 161 | Ga0070708_100428983 | 3300005445 | Bacteria | 1247 |
| 162 | Ga0070708_100600083 | 3300005445 | Unclassified | 1038 |
| 163 | Ga0070708_100644079 | 3300005445 | Bacteria | 999 |
| 164 | Ga0070708_100878610 | 3300005445 | Unclassified | 842 |
| 165 | Ga0070663_100273623 | 3300005455 | Bacteria | 1343 |
| 166 | Ga0070678_100153071 | 3300005456 | Bacteria | 1860 |
| 167 | Ga0070662_100131671 | 3300005457 | Bacteria | 1929 |
| 168 | Ga0070662_100541086 | 3300005457 | Unclassified | 975 |
| 169 | Ga0070681_10003881 | 3300005458 | Bacteria | 14072 |
| 170 | Ga0070681_10009757 | 3300005458 | Bacteria | 9448 |
| 171 | Ga0070681_10023368 | 3300005458 | Bacteria | 6217 |
| 172 | Ga0070681_10048821 | 3300005458 | Bacteria | 4227 |
| 173 | Ga0070681_10054237 | 3300005458 | Bacteria | 3994 |
| 174 | Ga0070681_10212491 | 3300005458 | Unclassified | 1850 |
| 175 | Ga0070681_10230167 | 3300005458 | Bacteria | 1768 |
| 176 | Ga0070681_10321561 | 3300005458 | Unclassified | 1457 |
| 177 | Ga0070681_10614193 | 3300005458 | Bacteria | 1002 |
| 178 | Ga0070681_10674743 | 3300005458 | Bacteria | 949 |
| 179 | Ga0070681_11037795 | 3300005458 | Bacteria | 740 |
| 180 | Ga0068867_100217866 | 3300005459 | Bacteria | 1537 |
| 181 | Ga0068867_100442899 | 3300005459 | Bacteria | 1105 |
| 182 | Ga0068867_100847046 | 3300005459 | Bacteria | 819 |
| 183 | Ga0068867_101851097 | 3300005459 | Bacteria | 568 |
| 184 | Ga0068867_101924074 | 3300005459 | Unclassified | 558 |
| 185 | Ga0070685_10019936 | 3300005466 | Bacteria | 3625 |
| 186 | Ga0070706_100005420 | 3300005467 | Bacteria | 12150 |
| 187 | Ga0070706_100006733 | 3300005467 | Bacteria | 10848 |
| 188 | Ga0070706_100032990 | 3300005467 | Bacteria | 4778 |
| 189 | Ga0070706_100054718 | 3300005467 | Bacteria | 3684 |
| 190 | Ga0070706_100116712 | 3300005467 | Bacteria | 2486 |
| 191 | Ga0070706_100196718 | 3300005467 | Bacteria | 1883 |
| 192 | Ga0070706_100354440 | 3300005467 | Bacteria | 1367 |
| 193 | Ga0070706_100511771 | 3300005467 | Bacteria | 1117 |
| 194 | Ga0070706_101603960 | 3300005467 | Bacteria | 594 |
| 195 | Ga0070707_100010978 | 3300005468 | Bacteria | 8437 |
| 196 | Ga0070707_100019381 | 3300005468 | Bacteria | 6409 |
| 197 | Ga0070707_100031374 | 3300005468 | Bacteria | 5062 |
| 198 | Ga0070707_100069096 | 3300005468 | Bacteria | 3400 |
| 199 | Ga0070707_100199627 | 3300005468 | Bacteria | 1949 |
| 200 | Ga0070707_100486210 | 3300005468 | Bacteria | 1196 |
| 201 | Ga0070707_100503942 | 3300005468 | Bacteria | 1172 |
| 202 | Ga0070707_101023145 | 3300005468 | Bacteria | 791 |
| 203 | Ga0070707_101143239 | 3300005468 | Bacteria | 745 |
| 204 | Ga0070707_101788170 | 3300005468 | Unclassified | 582 |
| 205 | Ga0070698_100002386 | 3300005471 | Bacteria | 20723 |
| 206 | Ga0070698_100041416 | 3300005471 | Bacteria | 4728 |
| 207 | Ga0070698_100091868 | 3300005471 | Bacteria | 3017 |
| 208 | Ga0070698_100308818 | 3300005471 | Bacteria | 1512 |
| 209 | Ga0070698_100318883 | 3300005471 | Bacteria | 1485 |
| 210 | Ga0070698_100511677 | 3300005471 | Bacteria | 1139 |
| 211 | Ga0070698_100870836 | 3300005471 | Unclassified | 846 |
| 212 | Ga0070698_101658750 | 3300005471 | Unclassified | 592 |
| 213 | Ga0070699_100011379 | 3300005518 | Bacteria | 7682 |
| 214 | Ga0070699_100018505 | 3300005518 | Bacteria | 5983 |
| 215 | Ga0070699_100043826 | 3300005518 | Bacteria | 3872 |
| 216 | Ga0070699_100056139 | 3300005518 | Bacteria | 3410 |
| 217 | Ga0070699_100080530 | 3300005518 | Bacteria | 2838 |
| 218 | Ga0070699_100170794 | 3300005518 | Bacteria | 1927 |
| 219 | Ga0070699_100371683 | 3300005518 | Bacteria | 1290 |
| 220 | Ga0070699_100387940 | 3300005518 | Bacteria | 1262 |
| 221 | Ga0070699_100438654 | 3300005518 | Unclassified | 1183 |
| 222 | Ga0070699_100507596 | 3300005518 | Bacteria | 1096 |
| 223 | Ga0070699_100562079 | 3300005518 | Bacteria | 1039 |
| 224 | Ga0070699_100853234 | 3300005518 | Bacteria | 834 |
| 225 | Ga0070679_100002130 | 3300005530 | Bacteria | 17837 |
| 226 | Ga0070679_100017081 | 3300005530 | Bacteria | 7014 |
| 227 | Ga0070679_100021300 | 3300005530 | Bacteria | 6327 |
| 228 | Ga0070679_100041085 | 3300005530 | Bacteria | 4604 |
| 229 | Ga0070679_100043914 | 3300005530 | Bacteria | 4451 |
| 230 | Ga0070679_100051807 | 3300005530 | Bacteria | 4089 |
| 231 | Ga0070679_100059965 | 3300005530 | Bacteria | 3792 |
| 232 | Ga0070679_100105697 | 3300005530 | Bacteria | 2801 |
| 233 | Ga0070679_100191563 | 3300005530 | Bacteria | 2013 |
| 234 | Ga0070679_100659981 | 3300005530 | Bacteria | 988 |
| 235 | Ga0070679_100847722 | 3300005530 | Unclassified | 857 |
| 236 | Ga0070679_100968430 | 3300005530 | Unclassified | 794 |
| 237 | Ga0070679_101006130 | 3300005530 | Unclassified | 778 |
| 238 | Ga0070679_101090234 | 3300005530 | Bacteria | 743 |
| 239 | Ga0070684_100075076 | 3300005535 | Bacteria | 2981 |
| 240 | Ga0070684_100225088 | 3300005535 | Bacteria | 1712 |
| 241 | Ga0070684_100447061 | 3300005535 | Bacteria | 1194 |
| 242 | Ga0070684_100882540 | 3300005535 | Viruses | 837 |
| 243 | Ga0070684_101737285 | 3300005535 | Bacteria | 589 |
| 244 | Ga0070697_100015335 | 3300005536 | Bacteria | 6014 |
| 245 | Ga0070697_100045075 | 3300005536 | Bacteria | 3573 |
| 246 | Ga0070697_100066579 | 3300005536 | Bacteria | 2945 |
| 247 | Ga0070697_100152238 | 3300005536 | Bacteria | 1950 |
| 248 | Ga0070697_100197635 | 3300005536 | Bacteria | 1708 |
| 249 | Ga0070697_100235806 | 3300005536 | Unclassified | 1562 |
| 250 | Ga0070697_100286417 | 3300005536 | Bacteria | 1414 |
| 251 | Ga0070697_100289628 | 3300005536 | Unclassified | 1406 |
| 252 | Ga0070697_100304357 | 3300005536 | Bacteria | 1371 |
| 253 | Ga0070697_100717790 | 3300005536 | Bacteria | 882 |
| 254 | Ga0068853_100030002 | 3300005539 | Bacteria | 4590 |
| 255 | Ga0068853_100096267 | 3300005539 | Bacteria | 2611 |
| 256 | Ga0068853_100103900 | 3300005539 | Bacteria | 2515 |
| 257 | Ga0068853_100472817 | 3300005539 | Bacteria | 1181 |
| 258 | Ga0068853_100961508 | 3300005539 | Bacteria | 821 |
| 259 | Ga0068853_101199116 | 3300005539 | Unclassified | 733 |
| 260 | Ga0070686_100356060 | 3300005544 | Bacteria | 1101 |
| 261 | Ga0070695_100843376 | 3300005545 | Bacteria | 737 |
| 262 | Ga0070696_100040678 | 3300005546 | Bacteria | 3210 |
| 263 | Ga0070696_100688771 | 3300005546 | Unclassified | 832 |
| 264 | Ga0070693_100023038 | 3300005547 | Bacteria | 3322 |
| 265 | Ga0070693_100026169 | 3300005547 | Bacteria | 3148 |
| 266 | Ga0070693_100068527 | 3300005547 | Bacteria | 2083 |
| 267 | Ga0070693_100323126 | 3300005547 | Bacteria | 1048 |
| 268 | Ga0070693_100711938 | 3300005547 | Bacteria | 736 |
| 269 | Ga0070665_100056980 | 3300005548 | Bacteria | 3918 |
| 270 | Ga0070665_100298376 | 3300005548 | Bacteria | 1614 |
| 271 | Ga0070704_100733286 | 3300005549 | Bacteria | 879 |
| 272 | Ga0070704_101168591 | 3300005549 | Bacteria | 701 |
| 273 | Ga0068855_100005920 | 3300005563 | Bacteria | 14907 |
| 274 | Ga0068855_100007209 | 3300005563 | Bacteria | 13492 |
| 275 | Ga0068855_100009704 | 3300005563 | Bacteria | 11622 |
| 276 | Ga0068855_100038946 | 3300005563 | Bacteria | 5644 |
| 277 | Ga0068855_100125566 | 3300005563 | Bacteria | 2934 |
| 278 | Ga0068855_100136459 | 3300005563 | Bacteria | 2799 |
| 279 | Ga0068855_100200944 | 3300005563 | Bacteria | 2244 |
| 280 | Ga0068855_100203048 | 3300005563 | Bacteria | 2230 |
| 281 | Ga0068855_100243731 | 3300005563 | Bacteria | 2007 |
| 282 | Ga0068855_100994968 | 3300005563 | Unclassified | 881 |
| 283 | Ga0068855_101000377 | 3300005563 | Bacteria | 878 |
| 284 | Ga0070664_100000866 | 3300005564 | Bacteria | 23426 |
| 285 | Ga0070664_100093002 | 3300005564 | Bacteria | 2612 |
| 286 | Ga0070664_100653764 | 3300005564 | Unclassified | 977 |
| 287 | Ga0068857_100000411 | 3300005577 | Bacteria | 30229 |
| 288 | Ga0068857_100009678 | 3300005577 | Bacteria | 8373 |
| 289 | Ga0068857_100017406 | 3300005577 | Bacteria | 6298 |
| 290 | Ga0068857_100042347 | 3300005577 | Bacteria | 4039 |
| 291 | Ga0068857_100341179 | 3300005577 | Bacteria | 1386 |
| 292 | Ga0068857_102227422 | 3300005577 | Bacteria | 538 |
| 293 | Ga0068854_100020791 | 3300005578 | Bacteria | 4446 |
| 294 | Ga0068854_100023618 | 3300005578 | Bacteria | 4201 |
| 295 | Ga0068854_100060568 | 3300005578 | Bacteria | 2739 |
| 296 | Ga0068854_100066312 | 3300005578 | Bacteria | 2627 |
| 297 | Ga0068854_100088598 | 3300005578 | Bacteria | 2298 |
| 298 | Ga0068854_100102336 | 3300005578 | Bacteria | 2149 |
| 299 | Ga0068856_100008169 | 3300005614 | Bacteria | 10206 |
| 300 | Ga0068856_100012953 | 3300005614 | Bacteria | 8074 |
| 301 | Ga0068856_100032852 | 3300005614 | Bacteria | 5081 |
| 302 | Ga0068856_100037367 | 3300005614 | Bacteria | 4766 |
| 303 | Ga0068856_100057505 | 3300005614 | Bacteria | 3839 |
| 304 | Ga0068856_100103267 | 3300005614 | Bacteria | 2844 |
| 305 | Ga0068856_100121927 | 3300005614 | Bacteria | 2609 |
| 306 | Ga0068856_100403058 | 3300005614 | Bacteria | 1387 |
| 307 | Ga0068856_100716981 | 3300005614 | Bacteria | 1020 |
| 308 | Ga0070702_100011129 | 3300005615 | Bacteria | 4465 |
| 309 | Ga0070702_100047580 | 3300005615 | Bacteria | 2437 |
| 310 | Ga0070702_100192593 | 3300005615 | Bacteria | 1343 |
| 311 | Ga0070702_100587702 | 3300005615 | Bacteria | 832 |
| 312 | Ga0068852_100012058 | 3300005616 | Bacteria | 6542 |
| 313 | Ga0068852_100032637 | 3300005616 | Bacteria | 4313 |
| 314 | Ga0068852_100112836 | 3300005616 | Bacteria | 2474 |
| 315 | Ga0068852_100422951 | 3300005616 | Bacteria | 1314 |
| 316 | Ga0068852_101237040 | 3300005616 | Bacteria | 768 |
| 317 | Ga0068859_100000001 | 3300005617 | Bacteria | 545224 |
| 318 | Ga0068859_100102667 | 3300005617 | Bacteria | 2917 |
| 319 | Ga0068859_100775216 | 3300005617 | Bacteria | 1047 |
| 320 | Ga0068864_100000001 | 3300005618 | Bacteria | 686767 |
| 321 | Ga0068864_100015763 | 3300005618 | Bacteria | 6287 |
| 322 | Ga0068864_100136078 | 3300005618 | Bacteria | 2212 |
| 323 | Ga0068864_101108302 | 3300005618 | Bacteria | 788 |
| 324 | Ga0068866_10057313 | 3300005718 | Bacteria | 2007 |
| 325 | Ga0068866_10785266 | 3300005718 | Unclassified | 661 |
| 326 | Ga0068870_10059842 | 3300005840 | Bacteria | 2043 |
| 327 | Ga0068870_10402039 | 3300005840 | Bacteria | 891 |
| 328 | Ga0068863_100100913 | 3300005841 | Bacteria | 2743 |
| 329 | Ga0068863_100126026 | 3300005841 | Bacteria | 2443 |
| 330 | Ga0068863_100388966 | 3300005841 | Bacteria | 1363 |
| 331 | Ga0068863_100590054 | 3300005841 | Bacteria | 1099 |
| 332 | Ga0068863_100687900 | 3300005841 | Unclassified | 1016 |
| 333 | Ga0068863_101415259 | 3300005841 | Bacteria | 703 |
| 334 | Ga0068858_100000467 | 3300005842 | Bacteria | 42180 |
| 335 | Ga0068858_100009146 | 3300005842 | Bacteria | 9474 |
| 336 | Ga0068858_100037092 | 3300005842 | Bacteria | 4519 |
| 337 | Ga0068858_100729284 | 3300005842 | Bacteria | 965 |
| 338 | Ga0068860_100127649 | 3300005843 | Bacteria | 2438 |
| 339 | Ga0068860_100208777 | 3300005843 | Bacteria | 1894 |
| 340 | Ga0070717_10000089 | 3300006028 | Bacteria | 71898 |
| 341 | Ga0070717_10003192 | 3300006028 | Bacteria | 11711 |
| 342 | Ga0070717_10003519 | 3300006028 | Bacteria | 11221 |
| 343 | Ga0070717_10007708 | 3300006028 | Bacteria | 8008 |
| 344 | Ga0070717_10109003 | 3300006028 | Bacteria | 2360 |
| 345 | Ga0070717_10154244 | 3300006028 | Bacteria | 1989 |
| 346 | Ga0070717_10176333 | 3300006028 | Bacteria | 1861 |
| 347 | Ga0070717_10178463 | 3300006028 | Unclassified | 1850 |
| 348 | Ga0070717_10246108 | 3300006028 | Unclassified | 1578 |
| 349 | Ga0070717_10255770 | 3300006028 | Bacteria | 1548 |
| 350 | Ga0070717_10311075 | 3300006028 | Bacteria | 1402 |
| 351 | Ga0070717_10439465 | 3300006028 | Bacteria | 1175 |
| 352 | Ga0070717_10442247 | 3300006028 | Bacteria | 1171 |
| 353 | Ga0070717_10452265 | 3300006028 | Bacteria | 1157 |
| 354 | Ga0070717_10499744 | 3300006028 | Bacteria | 1099 |
| 355 | Ga0070717_10505250 | 3300006028 | Bacteria | 1093 |
| 356 | Ga0070717_10554327 | 3300006028 | Bacteria | 1041 |
| 357 | Ga0070717_10762548 | 3300006028 | Bacteria | 880 |
| 358 | Ga0070717_10852097 | 3300006028 | Bacteria | 829 |
| 359 | Ga0070717_10989546 | 3300006028 | Unclassified | 766 |
| 360 | Ga0070717_11006649 | 3300006028 | Bacteria | 759 |
| 361 | Ga0070717_11062232 | 3300006028 | Bacteria | 737 |
| 362 | Ga0070717_11171334 | 3300006028 | Bacteria | 699 |
| 363 | Ga0070717_11226929 | 3300006028 | Unclassified | 682 |
| 364 | Ga0070715_10029831 | 3300006163 | Unclassified | 2200 |
| 365 | Ga0070715_10134463 | 3300006163 | Bacteria | 1194 |
| 366 | Ga0070716_100012539 | 3300006173 | Bacteria | 4299 |
| 367 | Ga0070716_100069089 | 3300006173 | Bacteria | 2069 |
| 368 | Ga0070716_100236640 | 3300006173 | Bacteria | 1236 |
| 369 | Ga0070716_100251525 | 3300006173 | Bacteria | 1204 |
| 370 | Ga0070716_100299575 | 3300006173 | Bacteria | 1118 |
| 371 | Ga0070716_100339365 | 3300006173 | Bacteria | 1059 |
| 372 | Ga0070712_100003532 | 3300006175 | Bacteria | 9625 |
| 373 | Ga0070712_100018655 | 3300006175 | Bacteria | 4511 |
| 374 | Ga0070712_100032656 | 3300006175 | Bacteria | 3516 |
| 375 | Ga0070712_100049048 | 3300006175 | Bacteria | 2930 |
| 376 | Ga0070712_100162949 | 3300006175 | Bacteria | 1723 |
| 377 | Ga0070712_100173972 | 3300006175 | Bacteria | 1673 |
| 378 | Ga0070712_100220913 | 3300006175 | Bacteria | 1500 |
| 379 | Ga0070712_100244025 | 3300006175 | Bacteria | 1432 |
| 380 | Ga0070712_100354583 | 3300006175 | Bacteria | 1201 |
| 381 | Ga0070712_100376087 | 3300006175 | Bacteria | 1168 |
| 382 | Ga0070712_100387133 | 3300006175 | Bacteria | 1152 |
| 383 | Ga0070712_100397837 | 3300006175 | Unclassified | 1137 |
| 384 | Ga0070712_101630862 | 3300006175 | Unclassified | 564 |
| 385 | Ga0097621_100000105 | 3300006237 | Bacteria | 47605 |
| 386 | Ga0097621_100000310 | 3300006237 | Bacteria | 32966 |
| 387 | Ga0097621_100000987 | 3300006237 | Bacteria | 19981 |
| 388 | Ga0097621_100029240 | 3300006237 | Bacteria | 4351 |
| 389 | Ga0097621_100125003 | 3300006237 | Bacteria | 2184 |
| 390 | Ga0097621_100378247 | 3300006237 | Bacteria | 1264 |
| 391 | Ga0097621_100973584 | 3300006237 | Unclassified | 793 |
| 392 | Ga0068871_100000837 | 3300006358 | Bacteria | 20609 |
| 393 | Ga0068871_100003783 | 3300006358 | Bacteria | 10419 |
| 394 | Ga0068871_100009686 | 3300006358 | Bacteria | 6994 |
| 395 | Ga0068871_100197519 | 3300006358 | Bacteria | 1735 |
| 396 | Ga0068871_100705305 | 3300006358 | Bacteria | 925 |
| 397 | Ga0068871_101044475 | 3300006358 | Bacteria | 762 |
| 398 | Ga0075428_100002434 | 3300006844 | Bacteria | 20219 |
| 399 | Ga0075428_100044054 | 3300006844 | Bacteria | 4905 |
| 400 | Ga0075428_100087764 | 3300006844 | Bacteria | 3393 |
| 401 | Ga0075428_100565788 | 3300006844 | Bacteria | 1215 |
| 402 | Ga0075428_100950193 | 3300006844 | Bacteria | 911 |
| 403 | Ga0075430_100068934 | 3300006846 | Bacteria | 2968 |
| 404 | Ga0075430_100312390 | 3300006846 | Bacteria | 1300 |
| 405 | Ga0075430_100926302 | 3300006846 | Unclassified | 718 |
| 406 | Ga0075430_101192108 | 3300006846 | Bacteria | 627 |
| 407 | Ga0075431_100017617 | 3300006847 | Bacteria | 7261 |
| 408 | Ga0075431_100047210 | 3300006847 | Bacteria | 4439 |
| 409 | Ga0075433_10008295 | 3300006852 | Bacteria | 8282 |
| 410 | Ga0075433_10304686 | 3300006852 | Bacteria | 1411 |
| 411 | Ga0075433_10786556 | 3300006852 | Bacteria | 832 |
| 412 | Ga0075433_10964406 | 3300006852 | Bacteria | 743 |
| 413 | Ga0075434_100016559 | 3300006871 | Bacteria | 7089 |
| 414 | Ga0075434_100018244 | 3300006871 | Bacteria | 6777 |
| 415 | Ga0075434_100090357 | 3300006871 | Bacteria | 3064 |
| 416 | Ga0075434_100100266 | 3300006871 | Unclassified | 2902 |
| 417 | Ga0075434_100128993 | 3300006871 | Bacteria | 2547 |
| 418 | Ga0075434_100245724 | 3300006871 | Unclassified | 1809 |
| 419 | Ga0075434_100390522 | 3300006871 | Bacteria | 1413 |
| 420 | Ga0075434_100629290 | 3300006871 | Bacteria | 1092 |
| 421 | Ga0075434_100782837 | 3300006871 | Unclassified | 970 |
| 422 | Ga0075429_100336049 | 3300006880 | Bacteria | 1322 |
| 423 | Ga0075429_100685577 | 3300006880 | Bacteria | 898 |
| 424 | Ga0068865_100079200 | 3300006881 | Bacteria | 2353 |
| 425 | Ga0068865_100197831 | 3300006881 | Bacteria | 1559 |
| 426 | Ga0068865_100850751 | 3300006881 | Bacteria | 790 |
| 427 | Ga0075436_100003427 | 3300006914 | Bacteria | 10872 |
| 428 | Ga0075436_100009672 | 3300006914 | Bacteria | 6599 |
| 429 | Ga0075436_100012530 | 3300006914 | Bacteria | 5811 |
| 430 | Ga0075436_100022071 | 3300006914 | Bacteria | 4371 |
| 431 | Ga0075436_100036783 | 3300006914 | Bacteria | 3380 |
| 432 | Ga0075436_100105033 | 3300006914 | Bacteria | 1969 |
| 433 | Ga0075436_100270051 | 3300006914 | Bacteria | 1214 |
| 434 | Ga0075436_100271612 | 3300006914 | Bacteria | 1211 |
| 435 | Ga0075436_100301844 | 3300006914 | Bacteria | 1148 |
| 436 | Ga0097620_100000001 | 3300006931 | Bacteria | 545224 |
| 437 | Ga0097620_100102673 | 3300006931 | Bacteria | 2917 |
| 438 | Ga0097620_100775339 | 3300006931 | Bacteria | 1047 |
| 439 | Ga0075435_100000187 | 3300007076 | Bacteria | 37010 |
| 440 | Ga0075435_100012620 | 3300007076 | Bacteria | 6259 |
| 441 | Ga0075435_100025300 | 3300007076 | Bacteria | 4620 |
| 442 | Ga0075435_100051127 | 3300007076 | Bacteria | 3328 |
| 443 | Ga0075435_100147251 | 3300007076 | Bacteria | 1978 |
| 444 | Ga0075435_100286265 | 3300007076 | Unclassified | 1407 |
| 445 | Ga0075435_100309842 | 3300007076 | Bacteria | 1351 |
| 446 | Ga0075435_100688686 | 3300007076 | Bacteria | 888 |
| 447 | Ga0099795_10069494 | 3300007788 | Bacteria | 1325 |
| 448 | Ga0099795_10086882 | 3300007788 | Bacteria | 1206 |
| 449 | Ga0105240_10013038 | 3300009093 | Bacteria | 11442 |
| 450 | Ga0105240_10024899 | 3300009093 | Bacteria | 7878 |
| 451 | Ga0105240_10044258 | 3300009093 | Bacteria | 5659 |
| 452 | Ga0105240_10047167 | 3300009093 | Bacteria | 5453 |
| 453 | Ga0105240_10053697 | 3300009093 | Bacteria | 5056 |
| 454 | Ga0105240_10060071 | 3300009093 | Bacteria | 4741 |
| 455 | Ga0105240_10061933 | 3300009093 | Bacteria | 4660 |
| 456 | Ga0105240_10070273 | 3300009093 | Bacteria | 4332 |
| 457 | Ga0105240_10096593 | 3300009093 | Bacteria | 3601 |
| 458 | Ga0105240_10265016 | 3300009093 | Bacteria | 1981 |
| 459 | Ga0105240_10385121 | 3300009093 | Bacteria | 1583 |
| 460 | Ga0105240_10413961 | 3300009093 | Bacteria | 1516 |
| 461 | Ga0105240_10521960 | 3300009093 | Bacteria | 1318 |
| 462 | Ga0105240_10564658 | 3300009093 | Bacteria | 1257 |
| 463 | Ga0105240_10789909 | 3300009093 | Bacteria | 1029 |
| 464 | Ga0105240_11934558 | 3300009093 | Unclassified | 613 |
| 465 | Ga0111539_10000003 | 3300009094 | Bacteria | 880006 |
| 466 | Ga0111539_10189545 | 3300009094 | Unclassified | 2400 |
| 467 | Ga0111539_10361181 | 3300009094 | Bacteria | 1690 |
| 468 | Ga0105245_10000010 | 3300009098 | Bacteria | 278233 |
| 469 | Ga0105245_10000376 | 3300009098 | Bacteria | 41489 |
| 470 | Ga0105245_10000598 | 3300009098 | Bacteria | 32661 |
| 471 | Ga0105245_10001899 | 3300009098 | Bacteria | 18994 |
| 472 | Ga0105245_10033851 | 3300009098 | Bacteria | 4528 |
| 473 | Ga0105245_10727007 | 3300009098 | Bacteria | 1027 |
| 474 | Ga0114129_10084367 | 3300009147 | Bacteria | 4411 |
| 475 | Ga0114129_10114023 | 3300009147 | Bacteria | 3727 |
| 476 | Ga0114129_10614802 | 3300009147 | Bacteria | 1406 |
| 477 | Ga0114129_10831647 | 3300009147 | Unclassified | 1175 |
| 478 | Ga0114129_11940937 | 3300009147 | Bacteria | 713 |
| 479 | Ga0105241_10056519 | 3300009174 | Bacteria | 3009 |
| 480 | Ga0105241_10659924 | 3300009174 | Bacteria | 951 |
| 481 | Ga0105241_10899135 | 3300009174 | Bacteria | 822 |
| 482 | Ga0105242_10003591 | 3300009176 | Bacteria | 12063 |
| 483 | Ga0105242_10085585 | 3300009176 | Bacteria | 2644 |
| 484 | Ga0105242_10090010 | 3300009176 | Bacteria | 2581 |
| 485 | Ga0105242_11209705 | 3300009176 | Bacteria | 775 |
| 486 | Ga0105248_10005773 | 3300009177 | Bacteria | 13599 |
| 487 | Ga0105248_10083969 | 3300009177 | Bacteria | 3582 |
| 488 | Ga0105248_10164874 | 3300009177 | Bacteria | 2498 |
| 489 | Ga0105248_10203691 | 3300009177 | Bacteria | 2230 |
| 490 | Ga0105248_10312224 | 3300009177 | Bacteria | 1771 |
| 491 | Ga0105248_11732161 | 3300009177 | Bacteria | 708 |
| 492 | Ga0105237_10020063 | 3300009545 | Bacteria | 6900 |
| 493 | Ga0105237_10054701 | 3300009545 | Bacteria | 3999 |
| 494 | Ga0105237_10253081 | 3300009545 | Bacteria | 1763 |
| 495 | Ga0105237_10327000 | 3300009545 | Bacteria | 1537 |
| 496 | Ga0105237_10682122 | 3300009545 | Bacteria | 1034 |
| 497 | Ga0105237_11001398 | 3300009545 | Bacteria | 842 |
| 498 | Ga0105237_11385806 | 3300009545 | Bacteria | 709 |
| 499 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 500 | Ga0105238_10001073 | 3300009551 | Bacteria | 27609 |
| 501 | Ga0105238_10022389 | 3300009551 | Bacteria | 6440 |
| 502 | Ga0105238_10030613 | 3300009551 | Bacteria | 5479 |
| 503 | Ga0105238_10265593 | 3300009551 | Bacteria | 1696 |
| 504 | Ga0105238_10349329 | 3300009551 | Bacteria | 1468 |
| 505 | Ga0105238_10354724 | 3300009551 | Bacteria | 1456 |
| 506 | Ga0105238_10936092 | 3300009551 | Bacteria | 886 |
| 507 | Ga0105238_11085244 | 3300009551 | Bacteria | 823 |
| 508 | Ga0105238_11318511 | 3300009551 | Bacteria | 748 |
| 509 | Ga0105238_11624685 | 3300009551 | Bacteria | 676 |
| 510 | Ga0105249_10276614 | 3300009553 | Bacteria | 1675 |
| 511 | Ga0105239_10046171 | 3300010375 | Bacteria | 4773 |
| 512 | Ga0105239_10047898 | 3300010375 | Bacteria | 4685 |
| 513 | Ga0105239_10150288 | 3300010375 | Bacteria | 2599 |
| 514 | Ga0105239_10669464 | 3300010375 | Bacteria | 1186 |
| 515 | Ga0105239_10675359 | 3300010375 | Bacteria | 1180 |
| 516 | Ga0105239_11132276 | 3300010375 | Bacteria | 901 |
| 517 | Ga0105246_10125623 | 3300011119 | Bacteria | 1908 |
| 518 | Ga0157373_10035076 | 3300013100 | Bacteria | 3603 |
| 519 | Ga0157373_10041467 | 3300013100 | Bacteria | 3293 |
| 520 | Ga0157373_10095981 | 3300013100 | Bacteria | 2087 |
| 521 | Ga0157373_11252787 | 3300013100 | Unclassified | 560 |
| 522 | Ga0157371_10013642 | 3300013102 | Bacteria | 6167 |
| 523 | Ga0157371_10059203 | 3300013102 | Bacteria | 2715 |
| 524 | Ga0157371_10151287 | 3300013102 | Bacteria | 1655 |
| 525 | Ga0157371_10157590 | 3300013102 | Bacteria | 1621 |
| 526 | Ga0157371_10197060 | 3300013102 | Bacteria | 1443 |
| 527 | Ga0157370_10047428 | 3300013104 | Bacteria | 4118 |
| 528 | Ga0157370_10060753 | 3300013104 | Bacteria | 3587 |
| 529 | Ga0157370_10137920 | 3300013104 | Bacteria | 2273 |
| 530 | Ga0157370_10142918 | 3300013104 | Bacteria | 2229 |
| 531 | Ga0157370_10225299 | 3300013104 | Bacteria | 1736 |
| 532 | Ga0157370_10259732 | 3300013104 | Bacteria | 1605 |
| 533 | Ga0157370_10285221 | 3300013104 | Unclassified | 1525 |
| 534 | Ga0157370_10303636 | 3300013104 | Bacteria | 1473 |
| 535 | Ga0157370_10349405 | 3300013104 | Unclassified | 1363 |
| 536 | Ga0157370_10743664 | 3300013104 | Bacteria | 894 |
| 537 | Ga0157369_10000226 | 3300013105 | Bacteria | 77681 |
| 538 | Ga0157369_10000589 | 3300013105 | Bacteria | 47375 |
| 539 | Ga0157369_10036635 | 3300013105 | Bacteria | 5373 |
| 540 | Ga0157369_10050121 | 3300013105 | Bacteria | 4523 |
| 541 | Ga0157369_10050515 | 3300013105 | Bacteria | 4503 |
| 542 | Ga0157369_10051610 | 3300013105 | Bacteria | 4450 |
| 543 | Ga0157369_10052618 | 3300013105 | Bacteria | 4405 |
| 544 | Ga0157369_10065221 | 3300013105 | Bacteria | 3920 |
| 545 | Ga0157369_10119470 | 3300013105 | Bacteria | 2797 |
| 546 | Ga0157369_10144184 | 3300013105 | Bacteria | 2518 |
| 547 | Ga0157369_10216440 | 3300013105 | Unclassified | 2006 |
| 548 | Ga0157369_10224513 | 3300013105 | Bacteria | 1965 |
| 549 | Ga0157369_10250432 | 3300013105 | Bacteria | 1849 |
| 550 | Ga0157369_10262051 | 3300013105 | Bacteria | 1803 |
| 551 | Ga0157369_10336609 | 3300013105 | Unclassified | 1568 |
| 552 | Ga0157369_10422859 | 3300013105 | Bacteria | 1381 |
| 553 | Ga0157374_10000354 | 3300013296 | Bacteria | 42454 |
| 554 | Ga0157374_10000422 | 3300013296 | Bacteria | 38332 |
| 555 | Ga0157374_10009945 | 3300013296 | Bacteria | 8167 |
| 556 | Ga0157374_10019238 | 3300013296 | Bacteria | 6041 |
| 557 | Ga0157374_10063273 | 3300013296 | Bacteria | 3470 |
| 558 | Ga0157374_10065197 | 3300013296 | Bacteria | 3420 |
| 559 | Ga0157374_10147550 | 3300013296 | Bacteria | 2285 |
| 560 | Ga0157374_11218271 | 3300013296 | Bacteria | 774 |
| 561 | Ga0157378_10000328 | 3300013297 | Bacteria | 46856 |
| 562 | Ga0157378_10000383 | 3300013297 | Bacteria | 43831 |
| 563 | Ga0157378_10000545 | 3300013297 | Bacteria | 35778 |
| 564 | Ga0157378_10000678 | 3300013297 | Bacteria | 31999 |
| 565 | Ga0157378_10001262 | 3300013297 | Bacteria | 22775 |
| 566 | Ga0157378_10012420 | 3300013297 | Bacteria | 7457 |
| 567 | Ga0157378_10065860 | 3300013297 | Bacteria | 3243 |
| 568 | Ga0157378_10943603 | 3300013297 | Bacteria | 895 |
| 569 | Ga0157378_11307456 | 3300013297 | Bacteria | 766 |
| 570 | Ga0157378_11461715 | 3300013297 | Bacteria | 727 |
| 571 | Ga0163162_10028742 | 3300013306 | Bacteria | 5503 |
| 572 | Ga0163162_10107826 | 3300013306 | Bacteria | 2881 |
| 573 | Ga0157372_10000068 | 3300013307 | Bacteria | 111270 |
| 574 | Ga0157372_10000321 | 3300013307 | Bacteria | 52711 |
| 575 | Ga0157372_10000536 | 3300013307 | Bacteria | 41814 |
| 576 | Ga0157372_10014991 | 3300013307 | Bacteria | 8295 |
| 577 | Ga0157372_10016084 | 3300013307 | Bacteria | 8026 |
| 578 | Ga0157372_10022300 | 3300013307 | Bacteria | 6850 |
| 579 | Ga0157372_10025353 | 3300013307 | Bacteria | 6445 |
| 580 | Ga0157372_10053320 | 3300013307 | Unclassified | 4507 |
| 581 | Ga0157372_10057899 | 3300013307 | Bacteria | 4332 |
| 582 | Ga0157372_10105486 | 3300013307 | Bacteria | 3223 |
| 583 | Ga0157372_10151250 | 3300013307 | Bacteria | 2679 |
| 584 | Ga0157372_10268494 | 3300013307 | Bacteria | 1982 |
| 585 | Ga0157372_10441398 | 3300013307 | Bacteria | 1517 |
| 586 | Ga0157372_10617735 | 3300013307 | Bacteria | 1263 |
| 587 | Ga0157372_10650161 | 3300013307 | Bacteria | 1228 |
| 588 | Ga0157372_10860540 | 3300013307 | Bacteria | 1052 |
| 589 | Ga0157372_11076825 | 3300013307 | Bacteria | 930 |
| 590 | Ga0157372_11442667 | 3300013307 | Unclassified | 793 |
| 591 | Ga0157372_11633122 | 3300013307 | Bacteria | 742 |
| 592 | Ga0157372_11818785 | 3300013307 | Bacteria | 700 |
| 593 | Ga0157372_11902674 | 3300013307 | Unclassified | 684 |
| 594 | Ga0157375_10000010 | 3300013308 | Bacteria | 361011 |
| 595 | Ga0157375_10000077 | 3300013308 | Bacteria | 100528 |
| 596 | Ga0157375_10000604 | 3300013308 | Bacteria | 31871 |
| 597 | Ga0157375_10108529 | 3300013308 | Bacteria | 2870 |
| 598 | Ga0157375_10411848 | 3300013308 | Bacteria | 1518 |
| 599 | Ga0157375_10953423 | 3300013308 | Unclassified | 1000 |
| 600 | Ga0157375_11389103 | 3300013308 | Bacteria | 827 |
| 601 | Ga0163163_10198346 | 3300014325 | Bacteria | 2055 |
| 602 | Ga0163163_12041774 | 3300014325 | Bacteria | 633 |
| 603 | Ga0157380_10036241 | 3300014326 | Bacteria | 3815 |
| 604 | Ga0157380_10747290 | 3300014326 | Bacteria | 989 |
| 605 | Ga0157377_10000004 | 3300014745 | Bacteria | 430019 |
| 606 | Ga0157377_10000183 | 3300014745 | Bacteria | 36240 |
| 607 | Ga0157377_10325296 | 3300014745 | Bacteria | 1023 |
| 608 | Ga0157377_11144423 | 3300014745 | Bacteria | 599 |
| 609 | Ga0157379_10067740 | 3300014968 | Bacteria | 3191 |
| 610 | Ga0157379_10586753 | 3300014968 | Bacteria | 1039 |
| 611 | Ga0157379_11115941 | 3300014968 | Unclassified | 756 |
| 612 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 613 | Ga0157376_10008017 | 3300014969 | Bacteria | 7584 |
| 614 | Ga0157376_10081920 | 3300014969 | Bacteria | 2771 |
| 615 | Ga0157376_10953333 | 3300014969 | Bacteria | 879 |
| 616 | Ga0182006_1154264 | 3300015261 | Bacteria | 777 |
| 617 | Ga0163161_10024299 | 3300017792 | Bacteria | 4281 |
| 618 | Ga0184602_129751 | 3300019161 | Unclassified | 774 |
| 619 | Ga0184596_108408 | 3300019176 | Unclassified | 971 |
| 620 | Ga0184601_108260 | 3300019183 | Bacteria | 1593 |
| 621 | Ga0184599_128580 | 3300019188 | Bacteria | 1258 |
| 622 | Ga0184600_107366 | 3300019190 | Bacteria | 1216 |
| 623 | Ga0184600_123562 | 3300019190 | Bacteria | 699 |
| 624 | Ga0197907_10379512 | 3300020069 | Bacteria | 1015 |
| 625 | Ga0197907_10425626 | 3300020069 | Bacteria | 1369 |
| 626 | Ga0197907_10539006 | 3300020069 | Bacteria | 1276 |
| 627 | Ga0197907_10540100 | 3300020069 | Bacteria | 1338 |
| 628 | Ga0197907_10717659 | 3300020069 | Bacteria | 893 |
| 629 | Ga0197907_10796502 | 3300020069 | Bacteria | 1967 |
| 630 | Ga0197907_10869068 | 3300020069 | Bacteria | 1978 |
| 631 | Ga0197907_11005754 | 3300020069 | Bacteria | 1868 |
| 632 | Ga0206356_10374345 | 3300020070 | Bacteria | 965 |
| 633 | Ga0206356_10433137 | 3300020070 | Bacteria | 1226 |
| 634 | Ga0206356_10684346 | 3300020070 | Bacteria | 953 |
| 635 | Ga0206356_11395039 | 3300020070 | Bacteria | 702 |
| 636 | Ga0206356_11397745 | 3300020070 | Bacteria | 2384 |
| 637 | Ga0206349_1634275 | 3300020075 | Bacteria | 1289 |
| 638 | Ga0206349_1888706 | 3300020075 | Unclassified | 1312 |
| 639 | Ga0206355_1217712 | 3300020076 | Unclassified | 650 |
| 640 | Ga0206355_1435135 | 3300020076 | Bacteria | 1679 |
| 641 | Ga0206351_10110990 | 3300020077 | Bacteria | 776 |
| 642 | Ga0206351_10169684 | 3300020077 | Bacteria | 569 |
| 643 | Ga0206351_10303434 | 3300020077 | Bacteria | 2371 |
| 644 | Ga0206351_10402462 | 3300020077 | Bacteria | 1758 |
| 645 | Ga0206351_10782694 | 3300020077 | Bacteria | 952 |
| 646 | Ga0206351_10911997 | 3300020077 | Bacteria | 674 |
| 647 | Ga0206352_10548939 | 3300020078 | Unclassified | 1329 |
| 648 | Ga0206352_10742236 | 3300020078 | Bacteria | 1330 |
| 649 | Ga0206352_10814601 | 3300020078 | Unclassified | 622 |
| 650 | Ga0206352_10853031 | 3300020078 | Bacteria | 657 |
| 651 | Ga0206350_10417453 | 3300020080 | Unclassified | 622 |
| 652 | Ga0206350_10694412 | 3300020080 | Bacteria | 1657 |
| 653 | Ga0206350_10704807 | 3300020080 | Bacteria | 877 |
| 654 | Ga0206350_10783616 | 3300020080 | Bacteria | 1043 |
| 655 | Ga0206350_11500735 | 3300020080 | Unclassified | 859 |
| 656 | Ga0206354_10345737 | 3300020081 | Bacteria | 958 |
| 657 | Ga0206354_11268864 | 3300020081 | Bacteria | 1405 |
| 658 | Ga0206353_10839656 | 3300020082 | Bacteria | 808 |
| 659 | Ga0206353_11764120 | 3300020082 | Bacteria | 507 |
| 660 | Ga0206353_11887567 | 3300020082 | Unclassified | 830 |
| 661 | Ga0206353_11971794 | 3300020082 | Bacteria | 1565 |
| 662 | Ga0154015_1009766 | 3300020610 | Unclassified | 734 |
| 663 | Ga0154015_1182847 | 3300020610 | Bacteria | 1063 |
| 664 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 665 | Ga0213873_10000358 | 3300021358 | Bacteria | 7542 |
| 666 | Ga0213874_10197723 | 3300021377 | Bacteria | 722 |
| 667 | Ga0213876_10000015 | 3300021384 | Bacteria | 304025 |
| 668 | Ga0213876_10000203 | 3300021384 | Bacteria | 60770 |
| 669 | Ga0213876_10008965 | 3300021384 | Bacteria | 5395 |
| 670 | Ga0213876_10015149 | 3300021384 | Bacteria | 4084 |
| 671 | Ga0224712_10010154 | 3300022467 | Bacteria | 2868 |
| 672 | Ga0224712_10025251 | 3300022467 | Bacteria | 2086 |
| 673 | Ga0224712_10069648 | 3300022467 | Bacteria | 1425 |
| 674 | Ga0224712_10081856 | 3300022467 | Unclassified | 1334 |
| 675 | Ga0224712_10097294 | 3300022467 | Bacteria | 1242 |
| 676 | Ga0224712_10166174 | 3300022467 | Unclassified | 987 |
| 677 | Ga0224712_10230023 | 3300022467 | Bacteria | 851 |
| 678 | Ga0224712_10602424 | 3300022467 | Bacteria | 536 |
| 679 | Ga0224712_10621586 | 3300022467 | Unclassified | 528 |
| 680 | Ga0247555_100578 | 3300023539 | Bacteria | 984 |
| 681 | Ga0247553_100294 | 3300023672 | Bacteria | 1728 |
| 682 | Ga0224572_1042095 | 3300024225 | Unclassified | 859 |
| 683 | Ga0228598_1001498 | 3300024227 | Bacteria | 5125 |
| 684 | Ga0228598_1026759 | 3300024227 | Bacteria | 1135 |
| 685 | Ga0207656_10025741 | 3300025321 | Bacteria | 2392 |
| 686 | Ga0207682_10469931 | 3300025893 | Unclassified | 596 |
| 687 | Ga0207692_10031523 | 3300025898 | Bacteria | 2540 |
| 688 | Ga0207692_10143764 | 3300025898 | Bacteria | 1359 |
| 689 | Ga0207692_10794131 | 3300025898 | Bacteria | 619 |
| 690 | Ga0207642_10131415 | 3300025899 | Unclassified | 1307 |
| 691 | Ga0207642_10500581 | 3300025899 | Unclassified | 744 |
| 692 | Ga0207688_10084127 | 3300025901 | Bacteria | 1821 |
| 693 | Ga0207680_10087293 | 3300025903 | Bacteria | 1975 |
| 694 | Ga0207647_10002357 | 3300025904 | Bacteria | 14349 |
| 695 | Ga0207685_10028724 | 3300025905 | Bacteria | 1962 |
| 696 | Ga0207685_10032655 | 3300025905 | Bacteria | 1874 |
| 697 | Ga0207685_10035964 | 3300025905 | Bacteria | 1812 |
| 698 | Ga0207699_10009273 | 3300025906 | Unclassified | 4892 |
| 699 | Ga0207699_10165984 | 3300025906 | Bacteria | 1474 |
| 700 | Ga0207699_10501426 | 3300025906 | Unclassified | 876 |
| 701 | Ga0207699_10589220 | 3300025906 | Bacteria | 809 |
| 702 | Ga0207699_10786717 | 3300025906 | Bacteria | 699 |
| 703 | Ga0207645_10021974 | 3300025907 | Bacteria | 4156 |
| 704 | Ga0207645_10157090 | 3300025907 | Bacteria | 1486 |
| 705 | Ga0207645_10527792 | 3300025907 | Bacteria | 800 |
| 706 | Ga0207643_10042578 | 3300025908 | Bacteria | 2560 |
| 707 | Ga0207643_10220968 | 3300025908 | Bacteria | 1159 |
| 708 | Ga0207705_10000465 | 3300025909 | Bacteria | 34700 |
| 709 | Ga0207705_10013917 | 3300025909 | Bacteria | 5801 |
| 710 | Ga0207705_10079084 | 3300025909 | Bacteria | 2394 |
| 711 | Ga0207705_10191530 | 3300025909 | Bacteria | 1547 |
| 712 | Ga0207684_10002137 | 3300025910 | Bacteria | 20256 |
| 713 | Ga0207684_10019277 | 3300025910 | Bacteria | 5837 |
| 714 | Ga0207684_10027313 | 3300025910 | Bacteria | 4865 |
| 715 | Ga0207684_10039142 | 3300025910 | Bacteria | 4023 |
| 716 | Ga0207684_10177588 | 3300025910 | Bacteria | 1836 |
| 717 | Ga0207684_10350683 | 3300025910 | Bacteria | 1270 |
| 718 | Ga0207684_10353952 | 3300025910 | Bacteria | 1264 |
| 719 | Ga0207654_10252553 | 3300025911 | Bacteria | 1183 |
| 720 | Ga0207654_10384908 | 3300025911 | Bacteria | 972 |
| 721 | Ga0207707_10009163 | 3300025912 | Bacteria | 8598 |
| 722 | Ga0207707_10009842 | 3300025912 | Bacteria | 8289 |
| 723 | Ga0207707_10010547 | 3300025912 | Bacteria | 8022 |
| 724 | Ga0207707_10015240 | 3300025912 | Bacteria | 6693 |
| 725 | Ga0207707_10040973 | 3300025912 | Bacteria | 4044 |
| 726 | Ga0207707_10191234 | 3300025912 | Unclassified | 1786 |
| 727 | Ga0207707_10222196 | 3300025912 | Bacteria | 1644 |
| 728 | Ga0207707_10425647 | 3300025912 | Bacteria | 1138 |
| 729 | Ga0207707_10477695 | 3300025912 | Bacteria | 1065 |
| 730 | Ga0207707_10563947 | 3300025912 | Bacteria | 966 |
| 731 | Ga0207707_11157218 | 3300025912 | Bacteria | 628 |
| 732 | Ga0207695_10001894 | 3300025913 | Bacteria | 32659 |
| 733 | Ga0207695_10004033 | 3300025913 | Bacteria | 20203 |
| 734 | Ga0207695_10054696 | 3300025913 | Bacteria | 4165 |
| 735 | Ga0207695_10056717 | 3300025913 | Bacteria | 4075 |
| 736 | Ga0207695_10082572 | 3300025913 | Bacteria | 3248 |
| 737 | Ga0207695_10202755 | 3300025913 | Bacteria | 1897 |
| 738 | Ga0207695_10263281 | 3300025913 | Bacteria | 1621 |
| 739 | Ga0207695_10487441 | 3300025913 | Unclassified | 1115 |
| 740 | Ga0207695_10513928 | 3300025913 | Bacteria | 1079 |
| 741 | Ga0207695_10528046 | 3300025913 | Bacteria | 1062 |
| 742 | Ga0207695_11012185 | 3300025913 | Bacteria | 711 |
| 743 | Ga0207695_11137974 | 3300025913 | Bacteria | 660 |
| 744 | Ga0207671_10128012 | 3300025914 | Bacteria | 1947 |
| 745 | Ga0207671_10224068 | 3300025914 | Unclassified | 1474 |
| 746 | Ga0207671_10397732 | 3300025914 | Bacteria | 1096 |
| 747 | Ga0207693_10002022 | 3300025915 | Bacteria | 17794 |
| 748 | Ga0207693_10011730 | 3300025915 | Bacteria | 7086 |
| 749 | Ga0207693_10048525 | 3300025915 | Bacteria | 3334 |
| 750 | Ga0207693_10056621 | 3300025915 | Bacteria | 3073 |
| 751 | Ga0207693_10069057 | 3300025915 | Bacteria | 2766 |
| 752 | Ga0207693_10241705 | 3300025915 | Unclassified | 1417 |
| 753 | Ga0207693_10259381 | 3300025915 | Bacteria | 1363 |
| 754 | Ga0207693_10323002 | 3300025915 | Bacteria | 1208 |
| 755 | Ga0207693_10413674 | 3300025915 | Bacteria | 1054 |
| 756 | Ga0207693_10761552 | 3300025915 | Bacteria | 748 |
| 757 | Ga0207663_10001864 | 3300025916 | Bacteria | 9977 |
| 758 | Ga0207663_10028448 | 3300025916 | Bacteria | 3272 |
| 759 | Ga0207663_10075435 | 3300025916 | Bacteria | 2188 |
| 760 | Ga0207663_10090428 | 3300025916 | Unclassified | 2029 |
| 761 | Ga0207663_10102907 | 3300025916 | Bacteria | 1922 |
| 762 | Ga0207663_10127400 | 3300025916 | Unclassified | 1753 |
| 763 | Ga0207663_10235345 | 3300025916 | Bacteria | 1340 |
| 764 | Ga0207663_10246497 | 3300025916 | Bacteria | 1313 |
| 765 | Ga0207663_10695439 | 3300025916 | Unclassified | 805 |
| 766 | Ga0207660_10000046 | 3300025917 | Bacteria | 61187 |
| 767 | Ga0207660_10016552 | 3300025917 | Bacteria | 4882 |
| 768 | Ga0207660_10018783 | 3300025917 | Bacteria | 4614 |
| 769 | Ga0207660_10042097 | 3300025917 | Bacteria | 3204 |
| 770 | Ga0207660_10135597 | 3300025917 | Bacteria | 1878 |
| 771 | Ga0207660_10164831 | 3300025917 | Bacteria | 1712 |
| 772 | Ga0207660_10252536 | 3300025917 | Bacteria | 1392 |
| 773 | Ga0207660_10804381 | 3300025917 | Bacteria | 767 |
| 774 | Ga0207660_10995453 | 3300025917 | Bacteria | 684 |
| 775 | Ga0207660_11101635 | 3300025917 | Bacteria | 647 |
| 776 | Ga0207662_10012231 | 3300025918 | Bacteria | 4777 |
| 777 | Ga0207662_10080969 | 3300025918 | Bacteria | 1982 |
| 778 | Ga0207657_10002434 | 3300025919 | Bacteria | 20096 |
| 779 | Ga0207657_10004942 | 3300025919 | Bacteria | 14024 |
| 780 | Ga0207657_10233686 | 3300025919 | Bacteria | 1470 |
| 781 | Ga0207649_10210518 | 3300025920 | Bacteria | 1379 |
| 782 | Ga0207649_11122139 | 3300025920 | Unclassified | 621 |
| 783 | Ga0207652_10007259 | 3300025921 | Bacteria | 8929 |
| 784 | Ga0207652_10021650 | 3300025921 | Bacteria | 5306 |
| 785 | Ga0207652_10030873 | 3300025921 | Bacteria | 4493 |
| 786 | Ga0207652_10041598 | 3300025921 | Bacteria | 3907 |
| 787 | Ga0207652_10080997 | 3300025921 | Bacteria | 2839 |
| 788 | Ga0207652_10108104 | 3300025921 | Bacteria | 2464 |
| 789 | Ga0207652_10241217 | 3300025921 | Bacteria | 1629 |
| 790 | Ga0207652_10384970 | 3300025921 | Unclassified | 1266 |
| 791 | Ga0207652_10514521 | 3300025921 | Bacteria | 1077 |
| 792 | Ga0207652_10520628 | 3300025921 | Bacteria | 1070 |
| 793 | Ga0207652_11043225 | 3300025921 | Bacteria | 717 |
| 794 | Ga0207646_10004008 | 3300025922 | Bacteria | 16295 |
| 795 | Ga0207646_10004874 | 3300025922 | Bacteria | 14380 |
| 796 | Ga0207646_10102318 | 3300025922 | Bacteria | 2568 |
| 797 | Ga0207646_10156938 | 3300025922 | Bacteria | 2053 |
| 798 | Ga0207646_10235893 | 3300025922 | Bacteria | 1653 |
| 799 | Ga0207646_10276655 | 3300025922 | Bacteria | 1517 |
| 800 | Ga0207646_10289890 | 3300025922 | Bacteria | 1479 |
| 801 | Ga0207646_10302817 | 3300025922 | Bacteria | 1444 |
| 802 | Ga0207646_10312355 | 3300025922 | Bacteria | 1420 |
| 803 | Ga0207646_10324743 | 3300025922 | Unclassified | 1390 |
| 804 | Ga0207646_11336553 | 3300025922 | Unclassified | 625 |
| 805 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 806 | Ga0207694_10010846 | 3300025924 | Bacteria | 6878 |
| 807 | Ga0207694_10025697 | 3300025924 | Bacteria | 4477 |
| 808 | Ga0207694_10042291 | 3300025924 | Bacteria | 3515 |
| 809 | Ga0207694_10218421 | 3300025924 | Bacteria | 1554 |
| 810 | Ga0207694_10506208 | 3300025924 | Bacteria | 1011 |
| 811 | Ga0207694_10527582 | 3300025924 | Bacteria | 990 |
| 812 | Ga0207650_10000453 | 3300025925 | Bacteria | 34778 |
| 813 | Ga0207650_10001518 | 3300025925 | Bacteria | 16598 |
| 814 | Ga0207650_10038864 | 3300025925 | Bacteria | 3478 |
| 815 | Ga0207650_10052864 | 3300025925 | Bacteria | 3010 |
| 816 | Ga0207659_10000006 | 3300025926 | Bacteria | 384976 |
| 817 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 818 | Ga0207687_10000266 | 3300025927 | Bacteria | 35609 |
| 819 | Ga0207687_10000753 | 3300025927 | Bacteria | 21897 |
| 820 | Ga0207687_10001541 | 3300025927 | Bacteria | 15813 |
| 821 | Ga0207687_10050541 | 3300025927 | Bacteria | 2894 |
| 822 | Ga0207687_10232101 | 3300025927 | Bacteria | 1458 |
| 823 | Ga0207700_10006682 | 3300025928 | Bacteria | 6996 |
| 824 | Ga0207700_10021316 | 3300025928 | Unclassified | 4422 |
| 825 | Ga0207700_10027264 | 3300025928 | Bacteria | 3998 |
| 826 | Ga0207700_10027562 | 3300025928 | Bacteria | 3981 |
| 827 | Ga0207700_10079211 | 3300025928 | Bacteria | 2558 |
| 828 | Ga0207700_10079893 | 3300025928 | Bacteria | 2548 |
| 829 | Ga0207700_10179225 | 3300025928 | Bacteria | 1773 |
| 830 | Ga0207700_10189294 | 3300025928 | Bacteria | 1728 |
| 831 | Ga0207700_10295414 | 3300025928 | Bacteria | 1397 |
| 832 | Ga0207700_10377751 | 3300025928 | Bacteria | 1239 |
| 833 | Ga0207700_10718342 | 3300025928 | Bacteria | 892 |
| 834 | Ga0207700_10881985 | 3300025928 | Unclassified | 801 |
| 835 | Ga0207664_10023253 | 3300025929 | Bacteria | 4640 |
| 836 | Ga0207664_10106371 | 3300025929 | Bacteria | 2326 |
| 837 | Ga0207664_10163918 | 3300025929 | Bacteria | 1898 |
| 838 | Ga0207664_10164663 | 3300025929 | Bacteria | 1893 |
| 839 | Ga0207664_10180610 | 3300025929 | Bacteria | 1811 |
| 840 | Ga0207664_10229970 | 3300025929 | Bacteria | 1612 |
| 841 | Ga0207664_10233341 | 3300025929 | Bacteria | 1600 |
| 842 | Ga0207664_10260055 | 3300025929 | Bacteria | 1518 |
| 843 | Ga0207664_10334653 | 3300025929 | Bacteria | 1338 |
| 844 | Ga0207664_10419261 | 3300025929 | Bacteria | 1192 |
| 845 | Ga0207664_10670069 | 3300025929 | Unclassified | 933 |
| 846 | Ga0207644_10285796 | 3300025931 | Bacteria | 1325 |
| 847 | Ga0207644_10896507 | 3300025931 | Bacteria | 743 |
| 848 | Ga0207690_10305492 | 3300025932 | Bacteria | 1246 |
| 849 | Ga0207706_10352804 | 3300025933 | Bacteria | 1279 |
| 850 | Ga0207686_10003600 | 3300025934 | Bacteria | 8298 |
| 851 | Ga0207686_10070463 | 3300025934 | Bacteria | 2246 |
| 852 | Ga0207686_10093474 | 3300025934 | Bacteria | 1991 |
| 853 | Ga0207709_10101715 | 3300025935 | Bacteria | 1901 |
| 854 | Ga0207670_10066653 | 3300025936 | Bacteria | 2474 |
| 855 | Ga0207670_10235209 | 3300025936 | Bacteria | 1409 |
| 856 | Ga0207670_10364784 | 3300025936 | Bacteria | 1147 |
| 857 | Ga0207670_10386608 | 3300025936 | Bacteria | 1116 |
| 858 | Ga0207704_10142310 | 3300025938 | Bacteria | 1680 |
| 859 | Ga0207704_10446628 | 3300025938 | Bacteria | 1031 |
| 860 | Ga0207704_10460936 | 3300025938 | Unclassified | 1016 |
| 861 | Ga0207665_10002075 | 3300025939 | Bacteria | 13523 |
| 862 | Ga0207665_10011933 | 3300025939 | Bacteria | 5707 |
| 863 | Ga0207665_10073967 | 3300025939 | Bacteria | 2332 |
| 864 | Ga0207665_10081528 | 3300025939 | Bacteria | 2228 |
| 865 | Ga0207665_10105979 | 3300025939 | Bacteria | 1969 |
| 866 | Ga0207665_10132174 | 3300025939 | Bacteria | 1773 |
| 867 | Ga0207665_10140563 | 3300025939 | Bacteria | 1721 |
| 868 | Ga0207665_10150408 | 3300025939 | Bacteria | 1667 |
| 869 | Ga0207665_10225328 | 3300025939 | Bacteria | 1376 |
| 870 | Ga0207665_10313127 | 3300025939 | Bacteria | 1176 |
| 871 | Ga0207665_10849123 | 3300025939 | Bacteria | 723 |
| 872 | Ga0207665_10949755 | 3300025939 | Bacteria | 683 |
| 873 | Ga0207691_10000966 | 3300025940 | Bacteria | 28538 |
| 874 | Ga0207691_10982452 | 3300025940 | Bacteria | 705 |
| 875 | Ga0207711_10119056 | 3300025941 | Bacteria | 2356 |
| 876 | Ga0207711_10132375 | 3300025941 | Bacteria | 2237 |
| 877 | Ga0207711_10237181 | 3300025941 | Bacteria | 1672 |
| 878 | Ga0207711_10602066 | 3300025941 | Bacteria | 1025 |
| 879 | Ga0207689_10006874 | 3300025942 | Bacteria | 10004 |
| 880 | Ga0207689_10018488 | 3300025942 | Bacteria | 5881 |
| 881 | Ga0207689_10281643 | 3300025942 | Bacteria | 1377 |
| 882 | Ga0207689_10330797 | 3300025942 | Bacteria | 1265 |
| 883 | Ga0207689_10574034 | 3300025942 | Bacteria | 948 |
| 884 | Ga0207661_10000015 | 3300025944 | Bacteria | 318960 |
| 885 | Ga0207661_10021016 | 3300025944 | Bacteria | 4887 |
| 886 | Ga0207661_10043662 | 3300025944 | Bacteria | 3539 |
| 887 | Ga0207661_10050671 | 3300025944 | Bacteria | 3309 |
| 888 | Ga0207661_10077751 | 3300025944 | Bacteria | 2730 |
| 889 | Ga0207661_10128482 | 3300025944 | Bacteria | 2167 |
| 890 | Ga0207661_10779229 | 3300025944 | Bacteria | 880 |
| 891 | Ga0207661_10957476 | 3300025944 | Bacteria | 788 |
| 892 | Ga0207661_12019695 | 3300025944 | Bacteria | 522 |
| 893 | Ga0207679_10029894 | 3300025945 | Bacteria | 3798 |
| 894 | Ga0207679_10067574 | 3300025945 | Bacteria | 2682 |
| 895 | Ga0207679_10226355 | 3300025945 | Bacteria | 1576 |
| 896 | Ga0207679_10918620 | 3300025945 | Unclassified | 801 |
| 897 | Ga0207667_10000544 | 3300025949 | Bacteria | 49743 |
| 898 | Ga0207667_10004693 | 3300025949 | Bacteria | 16723 |
| 899 | Ga0207667_10004714 | 3300025949 | Bacteria | 16691 |
| 900 | Ga0207667_10019963 | 3300025949 | Bacteria | 7466 |
| 901 | Ga0207667_10023906 | 3300025949 | Bacteria | 6722 |
| 902 | Ga0207667_10035982 | 3300025949 | Bacteria | 5309 |
| 903 | Ga0207667_10134958 | 3300025949 | Bacteria | 2541 |
| 904 | Ga0207667_10367248 | 3300025949 | Bacteria | 1467 |
| 905 | Ga0207667_10411266 | 3300025949 | Unclassified | 1377 |
| 906 | Ga0207667_10816217 | 3300025949 | Unclassified | 929 |
| 907 | Ga0207667_10990293 | 3300025949 | Bacteria | 828 |
| 908 | Ga0207651_10012516 | 3300025960 | Bacteria | 4807 |
| 909 | Ga0207651_11156184 | 3300025960 | Bacteria | 694 |
| 910 | Ga0207640_10067872 | 3300025981 | Bacteria | 2388 |
| 911 | Ga0207640_10083398 | 3300025981 | Bacteria | 2192 |
| 912 | Ga0207640_10116473 | 3300025981 | Bacteria | 1905 |
| 913 | Ga0207640_10122448 | 3300025981 | Bacteria | 1866 |
| 914 | Ga0207640_10166203 | 3300025981 | Bacteria | 1638 |
| 915 | Ga0207677_10000003 | 3300026023 | Bacteria | 450061 |
| 916 | Ga0207677_10000048 | 3300026023 | Bacteria | 101555 |
| 917 | Ga0207677_10022339 | 3300026023 | Bacteria | 3887 |
| 918 | Ga0207677_10096482 | 3300026023 | Bacteria | 2163 |
| 919 | Ga0207677_10362870 | 3300026023 | Bacteria | 1217 |
| 920 | Ga0207703_10000085 | 3300026035 | Bacteria | 107333 |
| 921 | Ga0207703_10079566 | 3300026035 | Bacteria | 2727 |
| 922 | Ga0207703_10704102 | 3300026035 | Bacteria | 961 |
| 923 | Ga0207703_10872020 | 3300026035 | Bacteria | 861 |
| 924 | Ga0207639_10000048 | 3300026041 | Bacteria | 124627 |
| 925 | Ga0207639_10034616 | 3300026041 | Bacteria | 3734 |
| 926 | Ga0207639_10062525 | 3300026041 | Unclassified | 2879 |
| 927 | Ga0207639_10066138 | 3300026041 | Bacteria | 2808 |
| 928 | Ga0207639_10653303 | 3300026041 | Bacteria | 973 |
| 929 | Ga0207639_11051752 | 3300026041 | Bacteria | 763 |
| 930 | Ga0207678_10017836 | 3300026067 | Bacteria | 6233 |
| 931 | Ga0207708_10000003 | 3300026075 | Bacteria | 324662 |
| 932 | Ga0207708_10650088 | 3300026075 | Bacteria | 897 |
| 933 | Ga0207702_10009517 | 3300026078 | Bacteria | 8160 |
| 934 | Ga0207702_10020916 | 3300026078 | Bacteria | 5415 |
| 935 | Ga0207702_10037516 | 3300026078 | Bacteria | 4057 |
| 936 | Ga0207702_10050507 | 3300026078 | Bacteria | 3511 |
| 937 | Ga0207702_10154004 | 3300026078 | Bacteria | 2094 |
| 938 | Ga0207702_10190319 | 3300026078 | Bacteria | 1895 |
| 939 | Ga0207702_10359150 | 3300026078 | Bacteria | 1396 |
| 940 | Ga0207702_10361563 | 3300026078 | Bacteria | 1391 |
| 941 | Ga0207702_11074128 | 3300026078 | Unclassified | 799 |
| 942 | Ga0207641_10086268 | 3300026088 | Bacteria | 2737 |
| 943 | Ga0207641_10250043 | 3300026088 | Bacteria | 1655 |
| 944 | Ga0207641_10532967 | 3300026088 | Unclassified | 1143 |
| 945 | Ga0207641_11336605 | 3300026088 | Bacteria | 717 |
| 946 | Ga0207641_11429058 | 3300026088 | Bacteria | 693 |
| 947 | Ga0207648_10050715 | 3300026089 | Bacteria | 3628 |
| 948 | Ga0207648_10143437 | 3300026089 | Bacteria | 2106 |
| 949 | Ga0207648_10624225 | 3300026089 | Unclassified | 995 |
| 950 | Ga0207648_11650553 | 3300026089 | Bacteria | 602 |
| 951 | Ga0207648_11799043 | 3300026089 | Unclassified | 574 |
| 952 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 953 | Ga0207676_10029988 | 3300026095 | Bacteria | 4077 |
| 954 | Ga0207676_10079087 | 3300026095 | Bacteria | 2665 |
| 955 | Ga0207676_10926724 | 3300026095 | Bacteria | 856 |
| 956 | Ga0207676_11076245 | 3300026095 | Bacteria | 794 |
| 957 | Ga0207676_11657726 | 3300026095 | Bacteria | 638 |
| 958 | Ga0207674_10002393 | 3300026116 | Bacteria | 23705 |
| 959 | Ga0207674_10018430 | 3300026116 | Bacteria | 7587 |
| 960 | Ga0207674_10030121 | 3300026116 | Bacteria | 5709 |
| 961 | Ga0207674_10061585 | 3300026116 | Bacteria | 3792 |
| 962 | Ga0207674_10493518 | 3300026116 | Bacteria | 1183 |
| 963 | Ga0207674_10792649 | 3300026116 | Bacteria | 914 |
| 964 | Ga0207675_100119172 | 3300026118 | Bacteria | 2496 |
| 965 | Ga0207683_10052189 | 3300026121 | Bacteria | 3582 |
| 966 | Ga0207683_10802781 | 3300026121 | Bacteria | 873 |
| 967 | Ga0207698_10012820 | 3300026142 | Bacteria | 5505 |
| 968 | Ga0207698_10121277 | 3300026142 | Bacteria | 2214 |
| 969 | Ga0207698_10490831 | 3300026142 | Bacteria | 1193 |
| 970 | Ga0207698_10997268 | 3300026142 | Unclassified | 848 |
| 971 | Ga0209998_10046853 | 3300027717 | Bacteria | 993 |
| 972 | Ga0207428_10000001 | 3300027907 | Bacteria | 1034622 |
| 973 | Ga0265356_1000382 | 3300028017 | Bacteria | 8040 |
| 974 | Ga0268266_10011258 | 3300028379 | Bacteria | 7786 |
| 975 | Ga0268264_10012706 | 3300028381 | Bacteria | 6929 |
| 976 | Ga0268264_10177468 | 3300028381 | Bacteria | 1932 |
| 977 | Ga0268264_10270964 | 3300028381 | Bacteria | 1586 |
| 978 | Ga0265319_1045307 | 3300028563 | Bacteria | 1470 |
| 979 | Ga0265322_10000052 | 3300028654 | Bacteria | 58413 |
| 980 | Ga0265338_10022692 | 3300028800 | Bacteria | 6482 |
| 981 | Ga0265338_10070036 | 3300028800 | Bacteria | 3010 |
| 982 | Ga0265338_10121979 | 3300028800 | Bacteria | 2075 |
| 983 | Ga0265338_10350355 | 3300028800 | Bacteria | 1062 |
| 984 | Ga0265762_1009357 | 3300030760 | Bacteria | 1747 |
| 985 | Ga0265767_102183 | 3300030836 | Bacteria | 1029 |
| 986 | Ga0265766_1000450 | 3300030863 | Bacteria | 1776 |
| 987 | Ga0265777_102316 | 3300030877 | Unclassified | 1096 |
| 988 | Ga0265770_1041509 | 3300030878 | Unclassified | 806 |
| 989 | Ga0265765_1008197 | 3300030879 | Bacteria | 1135 |
| 990 | Ga0265765_1056890 | 3300030879 | Unclassified | 546 |
| 991 | Ga0265773_1003081 | 3300031018 | Unclassified | 1067 |
| 992 | Ga0265779_106989 | 3300031043 | Unclassified | 641 |
| 993 | Ga0265760_10018687 | 3300031090 | Bacteria | 1996 |
| 994 | Ga0265760_10053779 | 3300031090 | Bacteria | 1215 |
| 995 | Ga0265760_10152571 | 3300031090 | Bacteria | 758 |
| 996 | Ga0265760_10170304 | 3300031090 | Bacteria | 723 |
| 997 | Ga0265330_10000781 | 3300031235 | Bacteria | 20009 |
| 998 | Ga0265330_10433842 | 3300031235 | Bacteria | 557 |
| 999 | Ga0265325_10001352 | 3300031241 | Bacteria | 17364 |
| 1000 | Ga0265325_10006355 | 3300031241 | Bacteria | 7180 |
| 1001 | Ga0265340_10053709 | 3300031247 | Bacteria | 1945 |
| 1002 | Ga0265340_10075885 | 3300031247 | Bacteria | 1588 |
| 1003 | Ga0265340_10142687 | 3300031247 | Bacteria | 1095 |
| 1004 | Ga0265339_10000581 | 3300031249 | Bacteria | 28517 |
| 1005 | Ga0265339_10046055 | 3300031249 | Bacteria | 2399 |
| 1006 | Ga0265339_10154003 | 3300031249 | Bacteria | 1160 |
| 1007 | Ga0265339_10182866 | 3300031249 | Bacteria | 1043 |
| 1008 | Ga0265331_10022616 | 3300031250 | Bacteria | 3206 |
| 1009 | Ga0265316_10031546 | 3300031344 | Bacteria | 4331 |
| 1010 | Ga0265316_10085635 | 3300031344 | Bacteria | 2411 |
| 1011 | Ga0265316_10166914 | 3300031344 | Bacteria | 1644 |
| 1012 | Ga0307408_100119927 | 3300031548 | Bacteria | 2036 |
| 1013 | Ga0307408_100762074 | 3300031548 | Bacteria | 875 |
| 1014 | Ga0265313_10016516 | 3300031595 | Bacteria | 4240 |
| 1015 | Ga0265313_10063426 | 3300031595 | Bacteria | 1723 |
| 1016 | Ga0316575_10010260 | 3300031665 | Bacteria | 3436 |
| 1017 | Ga0316575_10010428 | 3300031665 | Bacteria | 3415 |
| 1018 | Ga0265314_10230674 | 3300031711 | Bacteria | 1074 |
| 1019 | Ga0265342_10019690 | 3300031712 | Bacteria | 4344 |
| 1020 | Ga0265342_10041034 | 3300031712 | Bacteria | 2804 |
| 1021 | Ga0265342_10203217 | 3300031712 | Unclassified | 1075 |
| 1022 | Ga0265342_10410353 | 3300031712 | Bacteria | 699 |
| 1023 | Ga0316576_10000849 | 3300031727 | Bacteria | 15507 |
| 1024 | Ga0316576_10034159 | 3300031727 | Bacteria | 3624 |
| 1025 | Ga0316576_10067827 | 3300031727 | Bacteria | 2627 |
| 1026 | Ga0316576_10142392 | 3300031727 | Bacteria | 1805 |
| 1027 | Ga0316576_10183821 | 3300031727 | Bacteria | 1576 |
| 1028 | Ga0316576_10555620 | 3300031727 | Bacteria | 841 |
| 1029 | Ga0316578_10005100 | 3300031728 | Bacteria | 6322 |
| 1030 | Ga0316578_10022136 | 3300031728 | Bacteria | 3539 |
| 1031 | Ga0316578_10459041 | 3300031728 | Unclassified | 752 |
| 1032 | Ga0316578_10590527 | 3300031728 | Bacteria | 651 |
| 1033 | Ga0316577_10143662 | 3300031733 | Bacteria | 1344 |
| 1034 | Ga0316577_10743115 | 3300031733 | Bacteria | 557 |
| 1035 | Ga0307406_10763701 | 3300031901 | Bacteria | 813 |
| 1036 | Ga0307409_101869289 | 3300031995 | Bacteria | 630 |
| 1037 | Ga0307416_100160167 | 3300032002 | Bacteria | 2079 |
| 1038 | Ga0307416_100734687 | 3300032002 | Bacteria | 1079 |
| 1039 | Ga0307416_100816860 | 3300032002 | Bacteria | 1029 |
| 1040 | Ga0316053_100535 | 3300032120 | Bacteria | 1775 |
| 1041 | Ga0316053_100897 | 3300032120 | Bacteria | 1478 |
| 1042 | Ga0316583_10016100 | 3300032133 | Bacteria | 2692 |
| 1043 | Ga0316583_10126559 | 3300032133 | Bacteria | 891 |
| 1044 | Ga0316585_10008305 | 3300032137 | Bacteria | 3010 |
| 1045 | Ga0316585_10174561 | 3300032137 | Bacteria | 710 |
| 1046 | Ga0316580_10014263 | 3300032139 | Bacteria | 2426 |
| 1047 | Ga0316593_10000495 | 3300032168 | Bacteria | 7321 |
| 1048 | Ga0316214_1042550 | 3300033545 | Bacteria | 653 |
| 1049 | Ga0373926_0008040 | 3300035083 | Bacteria | 3513 |
| 1050 | Ga0373926_0038855 | 3300035083 | Bacteria | 1696 |
| 1051 | Ga0373934_0008649 | 3300035086 | Bacteria | 3797 |
| 1052 | Ga0373944_0078045 | 3300035089 | Bacteria | 1089 |
| 1053 | Ga0373923_0106353 | 3300035111 | Bacteria | 1242 |
| 1054 | Ga0373923_0139461 | 3300035111 | Bacteria | 1095 |
| 1055 | Ga0373923_0352395 | 3300035111 | Bacteria | 703 |
| 1056 | Ga0373932_0015857 | 3300035112 | Bacteria | 1916 |
| 1057 | Ga0373936_0001853 | 3300035113 | Bacteria | 7795 |
| 1058 | Ga0373936_0045310 | 3300035113 | Bacteria | 1771 |
| 1059 | Ga0373936_0127143 | 3300035113 | Bacteria | 1093 |
| 1060 | Ga0373941_0040822 | 3300035115 | Bacteria | 1433 |
| 1061 | Ga0373945_0001941 | 3300035116 | Bacteria | 6419 |
| 1062 | Ga0373954_0113716 | 3300035118 | Bacteria | 1310 |
| 1063 | Ga0373956_0004323 | 3300035119 | Bacteria | 5702 |
| 1064 | Ga0373956_0016550 | 3300035119 | Bacteria | 3098 |
| 1065 | Ga0373956_0108016 | 3300035119 | Bacteria | 1294 |
| 1066 | Ga0373956_0476175 | 3300035119 | Unclassified | 596 |
| 1067 | Ga0373957_0538051 | 3300035120 | Bacteria | 510 |
| 1068 | Ga0373960_0070317 | 3300035121 | Bacteria | 1081 |
| 1069 | Ga0373943_0006453 | 3300035170 | Bacteria | 5269 |
| 1070 | Ga0373943_0007607 | 3300035170 | Bacteria | 4866 |
| 1071 | Ga0373943_0023234 | 3300035170 | Bacteria | 2882 |
| 1072 | Ga0373943_0034837 | 3300035170 | Bacteria | 2403 |
| 1073 | Ga0373943_0058763 | 3300035170 | Bacteria | 1915 |
| 1074 | Ga0373946_0065260 | 3300035171 | Bacteria | 1558 |
| 1075 | Ga0373946_0195655 | 3300035171 | Bacteria | 966 |
| 1076 | Ga0373946_0205609 | 3300035171 | Bacteria | 945 |
| 1077 | Ga0373955_0074221 | 3300035172 | Bacteria | 1908 |
| 1078 | Ga0373955_0212843 | 3300035172 | Unclassified | 1153 |
| 1079 | Ga0373955_0220524 | 3300035172 | Unclassified | 1133 |
| 1080 | Ga0373955_0295973 | 3300035172 | Bacteria | 975 |
| 1081 | Ga0373955_0491704 | 3300035172 | Unclassified | 749 |
| 1082 | Ga0316574_0001193 | 3300035398 | Bacteria | 12063 |
| 1083 | Ga0316574_0004738 | 3300035398 | Bacteria | 7181 |
| 1084 | Ga0316574_0053555 | 3300035398 | Bacteria | 2519 |
| 1085 | Ga0316574_0229932 | 3300035398 | Bacteria | 1187 |
| 1086 | Ga0316574_0278081 | 3300035398 | Bacteria | 1067 |
| 1087 | Ga0316574_0806010 | 3300035398 | Bacteria | 571 |
| 1088 | Ga0373924_0000274 | 3300035410 | Bacteria | 15809 |
| 1089 | Ga0373924_0014296 | 3300035410 | Bacteria | 2998 |
| 1090 | Ga0373924_0207276 | 3300035410 | Bacteria | 865 |
| 1091 | Ga0373924_0307721 | 3300035410 | Unclassified | 704 |
| 1092 | Ga0373931_0278980 | 3300035691 | Unclassified | 1025 |
| 1093 | Ga0373931_0579336 | 3300035691 | Bacteria | 732 |
| 1094 | Ga0373935_0010120 | 3300035692 | Bacteria | 5648 |
| 1095 | Ga0373935_0024337 | 3300035692 | Bacteria | 3727 |
| 1096 | Ga0373935_0170640 | 3300035692 | Bacteria | 1488 |
| 1097 | Ga0373935_0210668 | 3300035692 | Bacteria | 1346 |
| 1098 | Ga0373935_0554407 | 3300035692 | Bacteria | 838 |
| 1099 | Ga0373927_0006641 | 3300035695 | Bacteria | 7874 |
| 1100 | Ga0373927_0274241 | 3300035695 | Bacteria | 1109 |
| 1101 | Ga0373927_0474516 | 3300035695 | Bacteria | 827 |
| 1102 | Ga0373927_0839530 | 3300035695 | Unclassified | 607 |
| 1103 | Ga0373927_1127685 | 3300035695 | Bacteria | 517 |
| 1104 | Ga0373933_0003213 | 3300035724 | Bacteria | 9123 |
| 1105 | Ga0373933_0114686 | 3300035724 | Bacteria | 1683 |
| 1106 | Ga0373933_0457624 | 3300035724 | Bacteria | 835 |
| 1107 | Ga0373933_1034400 | 3300035724 | Unclassified | 541 |
| 1108 | Ga0373947_0009153 | 3300035725 | Bacteria | 5693 |
| 1109 | Ga0373947_0102011 | 3300035725 | Bacteria | 1804 |
| 1110 | Ga0373947_0173877 | 3300035725 | Bacteria | 1399 |
| 1111 | Ga0373947_0308227 | 3300035725 | Bacteria | 1057 |
| 1112 | Ga0373937_0000455 | 3300036401 | Bacteria | 37834 |
| 1113 | Ga0373937_0001803 | 3300036401 | Bacteria | 17999 |
| 1114 | Ga0373937_0030189 | 3300036401 | Bacteria | 4910 |
| 1115 | Ga0373937_0073694 | 3300036401 | Unclassified | 3150 |
| 1116 | Ga0373937_0092209 | 3300036401 | Bacteria | 2808 |
| 1117 | Ga0373937_0291908 | 3300036401 | Bacteria | 1541 |
| 1118 | Ga0373937_0366409 | 3300036401 | Bacteria | 1366 |
| 1119 | Ga0373937_0451882 | 3300036401 | Bacteria | 1220 |
| 1120 | Ga0373937_0499063 | 3300036401 | Bacteria | 1156 |
| 1121 | Ga0373937_0541482 | 3300036401 | Unclassified | 1106 |
| 1122 | Ga0373937_0682105 | 3300036401 | Bacteria | 974 |
| 1123 | Ga0373937_0701993 | 3300036401 | Bacteria | 958 |
| 1124 | Ga0373937_0922960 | 3300036401 | Bacteria | 822 |
| 1125 | Ga0316582_0043565 | 3300036647 | Bacteria | 2816 |
| 1126 | Ga0316582_0137662 | 3300036647 | Bacteria | 1644 |
| 1127 | Ga0316582_0292794 | 3300036647 | Bacteria | 1118 |
| 1128 | Ga0316584_0129011 | 3300036712 | Bacteria | 1888 |
| 1129 | Ga0373925_0008739 | 3300037068 | Bacteria | 7378 |
| 1130 | Ga0373925_0021012 | 3300037068 | Bacteria | 4757 |
| 1131 | Ga0373925_0098621 | 3300037068 | Bacteria | 2243 |
| 1132 | Ga0373925_0216974 | 3300037068 | Bacteria | 1526 |
| 1133 | Ga0373925_0888056 | 3300037068 | Bacteria | 735 |
| 1134 | Ga0373925_1775294 | 3300037068 | Bacteria | 503 |
| 1135 | Ga0395900_0205792 | 3300037418 | Bacteria | 1989 |
| 1136 | Ga0395898_0016476 | 3300037466 | Bacteria | 7561 |
| 1137 | Ga0395898_0662158 | 3300037466 | Bacteria | 986 |
| 1138 | Ga0436364_1340096 | 3300037853 | Bacteria | 4413 |
| 1139 | Ga0395901_0190034 | 3300038443 | Bacteria | 2154 |
| 1140 | Ga0395901_0424127 | 3300038443 | Unclassified | 1364 |
| 1141 | Ga0400490_14648 | 3300038726 | Bacteria | 3599 |
| 1142 | Ga0436365_0151500 | 3300039437 | Bacteria | 70579 |
| 1143 | Ga0436365_0236781 | 3300039437 | Bacteria | 970 |
| 1144 | Ga0436365_0968862 | 3300039437 | Bacteria | 3322 |
| 1145 | Ga0436365_1407004 | 3300039437 | Bacteria | 3392 |
| 1146 | Ga0436365_1524178 | 3300039437 | Bacteria | 77408 |
| 1147 | Ga0436365_1664004 | 3300039437 | Bacteria | 6048 |
| 1148 | Ga0436365_1692853 | 3300039437 | Bacteria | 1529 |
| 1149 | Ga0436363_0387793 | 3300039450 | Bacteria | 745 |
| 1150 | Ga0436362_0273161 | 3300039453 | Bacteria | 561309 |
| 1151 | Ga0436362_0948018 | 3300039453 | Bacteria | 6477 |
| 1152 | Ga0451807_0349962 | 3300041486 | Bacteria | 1956 |
| 1153 | Ga0451853_3382037 | 3300041512 | Bacteria | 992 |
| 1154 | Ga0450920_028141 | 3300042122 | Bacteria | 1101 |
| 1155 | Ga0450923_002993 | 3300042125 | Bacteria | 2497 |
| 1156 | Ga0450923_024509 | 3300042125 | Bacteria | 1197 |
| 1157 | Ga0450894_000599 | 3300042131 | Bacteria | 6070 |
| 1158 | Ga0450896_003252 | 3300042133 | Bacteria | 2150 |
| 1159 | Ga0450898_020528 | 3300042134 | Bacteria | 1159 |
| 1160 | Ga0439435_0088581 | 3300042436 | Bacteria | 937 |
| 1161 | Ga0450918_014259 | 3300042531 | Bacteria | 1381 |
| 1162 | Ga0451577_0000614 | 3300042876 | Bacteria | 57427 |
| 1163 | Ga0451577_0079314 | 3300042876 | Bacteria | 2927 |
| 1164 | Ga0451577_0087542 | 3300042876 | Bacteria | 2779 |
| 1165 | Ga0451577_0320960 | 3300042876 | Bacteria | 1404 |
| 1166 | Ga0453683_0140146 | 3300044673 | Bacteria | 1526 |
| 1167 | Ga0453683_0158874 | 3300044673 | Bacteria | 1430 |
| 1168 | Ga0466966_0421313 | 3300044684 | Unclassified | 802 |
| 1169 | Ga0466961_0457910 | 3300044693 | Bacteria | 772 |
| 1170 | Ga0466963_0073051 | 3300044694 | Bacteria | 2312 |
| 1171 | Ga0466963_0086757 | 3300044694 | Unclassified | 2127 |
| 1172 | Ga0466963_0095891 | 3300044694 | Bacteria | 2026 |
| 1173 | Ga0466964_0275436 | 3300044706 | Unclassified | 839 |
| 1174 | Ga0453684_0001797 | 3300044712 | Bacteria | 56922 |
| 1175 | Ga0453684_0047620 | 3300044712 | Bacteria | 5682 |
| 1176 | Ga0453684_0394087 | 3300044712 | Bacteria | 1552 |
| 1177 | Ga0466971_0589174 | 3300044719 | Bacteria | 554 |
| 1178 | Ga0466968_0107957 | 3300044735 | Bacteria | 1249 |
| 1179 | Ga0466968_0212272 | 3300044735 | Bacteria | 910 |
| 1180 | Ga0466970_0466226 | 3300044765 | Unclassified | 725 |
| 1181 | Ga0466957_0000055 | 3300044842 | Bacteria | 42244 |
| 1182 | Ga0466957_0115774 | 3300044842 | Unclassified | 1705 |
| 1183 | Ga0466957_0960957 | 3300044842 | Unclassified | 612 |
| 1184 | Ga0466959_0046896 | 3300045049 | Bacteria | 3180 |
| 1185 | Ga0466959_0112706 | 3300045049 | Bacteria | 1940 |
| 1186 | Ga0466959_0419766 | 3300045049 | Bacteria | 908 |
| 1187 | Ga0451576_0317271 | 3300045051 | Bacteria | 1631 |
| 1188 | Ga0451576_0873320 | 3300045051 | Bacteria | 944 |
| 1189 | Ga0451576_1204279 | 3300045051 | Unclassified | 791 |
| 1190 | Ga0451576_1392512 | 3300045051 | Bacteria | 730 |
| 1191 | Ga0466958_0034374 | 3300045836 | Bacteria | 3024 |
| 1192 | Ga0466958_0276360 | 3300045836 | Bacteria | 1076 |
| 1193 | Ga0466967_0027554 | 3300045976 | Bacteria | 4728 |
| 1194 | Ga0466967_0033460 | 3300045976 | Bacteria | 4352 |
| 1195 | Ga0466967_0046854 | 3300045976 | Bacteria | 3766 |
| 1196 | Ga0466967_1556224 | 3300045976 | Bacteria | 658 |
| 1197 | Ga0495603_0130161 | 3300046455 | Bacteria | 1466 |
| 1198 | Ga0495629_1048308 | 3300046459 | Bacteria | 529 |
| 1199 | Ga0495651_0002665 | 3300046462 | Bacteria | 13856 |
| 1200 | Ga0495651_0011592 | 3300046462 | Bacteria | 6774 |
| 1201 | Ga0495653_0257489 | 3300046463 | Bacteria | 1155 |
| 1202 | Ga0495580_0000634 | 3300046472 | Bacteria | 29763 |
| 1203 | Ga0495580_0023089 | 3300046472 | Bacteria | 4572 |
| 1204 | Ga0495580_0068416 | 3300046472 | Bacteria | 2483 |
| 1205 | Ga0495580_0071624 | 3300046472 | Bacteria | 2421 |
| 1206 | Ga0495580_0183504 | 3300046472 | Unclassified | 1444 |
| 1207 | Ga0495580_0380215 | 3300046472 | Bacteria | 954 |
| 1208 | Ga0495580_0466016 | 3300046472 | Bacteria | 846 |
| 1209 | Ga0495582_0012769 | 3300046473 | Bacteria | 4627 |
| 1210 | Ga0495582_0023662 | 3300046473 | Bacteria | 3359 |
| 1211 | Ga0495582_0256428 | 3300046473 | Bacteria | 1003 |
| 1212 | Ga0495639_0043201 | 3300046475 | Bacteria | 2035 |
| 1213 | Ga0495639_0053642 | 3300046475 | Bacteria | 1837 |
| 1214 | Ga0495664_0248387 | 3300046477 | Bacteria | 1076 |
| 1215 | Ga0495584_0225488 | 3300046491 | Bacteria | 952 |
| 1216 | Ga0495594_0406313 | 3300046499 | Bacteria | 775 |
| 1217 | Ga0495594_0409091 | 3300046499 | Bacteria | 772 |
| 1218 | Ga0495608_0197387 | 3300046511 | Unclassified | 1269 |
| 1219 | Ga0495608_0281384 | 3300046511 | Bacteria | 1032 |
| 1220 | Ga0495620_0006479 | 3300046515 | Bacteria | 6429 |
| 1221 | Ga0495628_0193333 | 3300046516 | Bacteria | 1536 |
| 1222 | Ga0495628_0356074 | 3300046516 | Bacteria | 1075 |
| 1223 | Ga0495628_0622625 | 3300046516 | Bacteria | 769 |
| 1224 | Ga0495630_0252278 | 3300046517 | Unclassified | 1348 |
| 1225 | Ga0495630_0596485 | 3300046517 | Bacteria | 847 |
| 1226 | Ga0495630_0600783 | 3300046517 | Bacteria | 843 |
| 1227 | Ga0495666_0047763 | 3300046526 | Bacteria | 2062 |
| 1228 | Ga0495652_0035479 | 3300046529 | Bacteria | 4341 |
| 1229 | Ga0495652_0108432 | 3300046529 | Unclassified | 2238 |
| 1230 | Ga0495665_0015678 | 3300046531 | Bacteria | 4079 |
| 1231 | Ga0495665_0449390 | 3300046531 | Bacteria | 651 |
| 1232 | Ga0495586_0083397 | 3300046535 | Bacteria | 1759 |
| 1233 | Ga0495587_0005061 | 3300046536 | Bacteria | 8621 |
| 1234 | Ga0495587_0348400 | 3300046536 | Unclassified | 826 |
| 1235 | Ga0495598_0274727 | 3300046537 | Unclassified | 631 |
| 1236 | Ga0495621_0043692 | 3300046539 | Bacteria | 1581 |
| 1237 | Ga0495621_0144405 | 3300046539 | Bacteria | 933 |
| 1238 | Ga0495645_0524722 | 3300046543 | Bacteria | 737 |
| 1239 | Ga0495633_0414888 | 3300046558 | Bacteria | 609 |
| 1240 | Ga0495667_0144941 | 3300046559 | Bacteria | 1530 |
| 1241 | Ga0495667_0500433 | 3300046559 | Bacteria | 761 |
| 1242 | Ga0495635_0594547 | 3300046663 | Bacteria | 723 |
| 1243 | Ga0495588_0203002 | 3300046674 | Bacteria | 1047 |
| 1244 | Ga0495588_0362818 | 3300046674 | Unclassified | 761 |
| 1245 | Ga0495657_0185235 | 3300046675 | Unclassified | 1275 |
| 1246 | Ga0495657_0223452 | 3300046675 | Bacteria | 1141 |
| 1247 | Ga0495657_0285258 | 3300046675 | Bacteria | 987 |
| 1248 | Ga0495657_0725626 | 3300046675 | Unclassified | 570 |
| 1249 | Ga0495623_0114176 | 3300046679 | Bacteria | 1633 |
| 1250 | Ga0495623_0133257 | 3300046679 | Bacteria | 1485 |
| 1251 | Ga0495623_0325356 | 3300046679 | Bacteria | 843 |
| 1252 | Ga0495647_0130840 | 3300046681 | Bacteria | 1063 |
| 1253 | Ga0495647_0197263 | 3300046681 | Bacteria | 882 |
| 1254 | Ga0495658_0113098 | 3300046683 | Bacteria | 1634 |
| 1255 | Ga0495669_0121672 | 3300046684 | Bacteria | 1223 |
| 1256 | Ga0495600_0261042 | 3300046809 | Bacteria | 1100 |
| 1257 | Ga0495581_0039807 | 3300047315 | Bacteria | 2721 |
| 1258 | Ga0495604_0167692 | 3300047317 | Bacteria | 1547 |
| 1259 | Ga0495674_0164604 | 3300047319 | Bacteria | 1854 |
| 1260 | Ga0495674_0446866 | 3300047319 | Bacteria | 1039 |
| 1261 | Ga0495674_0706141 | 3300047319 | Bacteria | 791 |
| 1262 | Ga0495674_0764077 | 3300047319 | Bacteria | 754 |
| 1263 | Ga0495676_0682745 | 3300047321 | Bacteria | 665 |
| 1264 | Ga0495680_0221712 | 3300047322 | Bacteria | 1350 |
| 1265 | Ga0495680_0318677 | 3300047322 | Unclassified | 1088 |
| 1266 | Ga0495675_0012326 | 3300047444 | Bacteria | 5380 |
| 1267 | Ga0495675_0037102 | 3300047444 | Bacteria | 3105 |
| 1268 | Ga0495675_0056274 | 3300047444 | Bacteria | 2494 |
| 1269 | Ga0495675_0262963 | 3300047444 | Unclassified | 1033 |
| 1270 | Ga0495684_0549167 | 3300047471 | Bacteria | 787 |
| 1271 | Ga0495593_0038862 | 3300047673 | Bacteria | 2569 |
| 1272 | Ga0495602_0000191 | 3300048088 | Bacteria | 58052 |
| 1273 | Ga0495602_0075891 | 3300048088 | Bacteria | 2851 |
| 1274 | Ga0495602_0154200 | 3300048088 | Unclassified | 1801 |
| 1275 | Ga0495602_0308267 | 3300048088 | Bacteria | 1156 |
| 1276 | Ga0495602_0509148 | 3300048088 | Bacteria | 840 |
| 1277 | Ga0495602_0528292 | 3300048088 | Bacteria | 821 |
| 1278 | Ga0496100_0057755 | 3300048903 | Bacteria | 2543 |
| 1279 | Ga0496100_0073346 | 3300048903 | Bacteria | 2290 |
| 1280 | Ga0496100_0101387 | 3300048903 | Bacteria | 1985 |
| 1281 | Ga0496101_0145139 | 3300048904 | Bacteria | 1812 |
| 1282 | Ga0496101_0324190 | 3300048904 | Bacteria | 1209 |
| 1283 | Ga0496102_0402142 | 3300048905 | Bacteria | 1287 |
| 1284 | Ga0496102_0886777 | 3300048905 | Bacteria | 814 |
| 1285 | Ga0496102_0930936 | 3300048905 | Bacteria | 790 |
| 1286 | Ga0496102_1427125 | 3300048905 | Bacteria | 611 |
| 1287 | Ga0496104_0004317 | 3300048907 | Bacteria | 12368 |
| 1288 | Ga0496104_0065499 | 3300048907 | Bacteria | 3448 |
| 1289 | Ga0496104_0074475 | 3300048907 | Bacteria | 3232 |
| 1290 | Ga0496104_0199151 | 3300048907 | Bacteria | 1915 |
| 1291 | Ga0496104_0395530 | 3300048907 | Bacteria | 1294 |
| 1292 | Ga0496104_0520395 | 3300048907 | Bacteria | 1101 |
| 1293 | Ga0496104_0596568 | 3300048907 | Bacteria | 1015 |
| 1294 | Ga0496104_0753595 | 3300048907 | Bacteria | 881 |
| 1295 | Ga0496104_0868662 | 3300048907 | Bacteria | 807 |
| 1296 | Ga0496105_0001295 | 3300048908 | Bacteria | 17503 |
| 1297 | Ga0496105_0153234 | 3300048908 | Bacteria | 1894 |
| 1298 | Ga0496105_0756181 | 3300048908 | Unclassified | 742 |
| 1299 | Ga0496106_0092821 | 3300048909 | Bacteria | 2332 |
| 1300 | Ga0496106_0717609 | 3300048909 | Unclassified | 796 |
| 1301 | Ga0496107_0240967 | 3300048910 | Bacteria | 1346 |
| 1302 | Ga0496107_0313798 | 3300048910 | Bacteria | 1167 |
| 1303 | Ga0496108_0192152 | 3300048911 | Bacteria | 1769 |
| 1304 | Ga0496108_1394384 | 3300048911 | Bacteria | 586 |
| 1305 | Ga0496108_1401939 | 3300048911 | Unclassified | 584 |
| 1306 | Ga0496109_0050587 | 3300048912 | Bacteria | 3784 |
| 1307 | Ga0496110_0033571 | 3300048913 | Bacteria | 4440 |
| 1308 | Ga0496110_0106151 | 3300048913 | Bacteria | 2520 |
| 1309 | Ga0496111_0001171 | 3300048914 | Bacteria | 14598 |
| 1310 | Ga0496111_0132068 | 3300048914 | Bacteria | 1848 |
| 1311 | Ga0496112_0001167 | 3300048915 | Bacteria | 19657 |
| 1312 | Ga0496112_0003245 | 3300048915 | Bacteria | 13406 |
| 1313 | Ga0496112_0015233 | 3300048915 | Bacteria | 7167 |
| 1314 | Ga0496112_0018055 | 3300048915 | Bacteria | 6639 |
| 1315 | Ga0496112_0054419 | 3300048915 | Bacteria | 3932 |
| 1316 | Ga0496112_0151175 | 3300048915 | Bacteria | 2289 |
| 1317 | Ga0496112_0279704 | 3300048915 | Bacteria | 1616 |
| 1318 | Ga0496112_0561788 | 3300048915 | Bacteria | 1075 |
| 1319 | Ga0496112_0596943 | 3300048915 | Unclassified | 1036 |
| 1320 | Ga0496112_0930510 | 3300048915 | Unclassified | 791 |
| 1321 | Ga0496112_1936527 | 3300048915 | Unclassified | 501 |
| 1322 | Ga0496113_0000290 | 3300048916 | Bacteria | 23756 |
| 1323 | Ga0496113_0267572 | 3300048916 | Bacteria | 1366 |
| 1324 | Ga0496113_0576116 | 3300048916 | Bacteria | 902 |
| 1325 | Ga0496114_0001818 | 3300048917 | Bacteria | 16184 |
| 1326 | Ga0496114_0112225 | 3300048917 | Bacteria | 2336 |
| 1327 | Ga0496114_0814271 | 3300048917 | Unclassified | 813 |
| 1328 | Ga0496115_0521612 | 3300048918 | Unclassified | 953 |
| 1329 | Ga0501299_144080 | 3300049522 | Bacteria | 595 |
| 1330 | Ga0501031_0293436 | 3300049568 | Bacteria | 1054 |
| 1331 | Ga0501031_0605746 | 3300049568 | Bacteria | 705 |
| 1332 | Ga0501032_0207149 | 3300049569 | Bacteria | 1279 |
| 1333 | Ga0501032_0674262 | 3300049569 | Bacteria | 656 |
| 1334 | Ga0501033_0384565 | 3300049570 | Bacteria | 980 |
| 1335 | Ga0501036_0037085 | 3300049572 | Bacteria | 4124 |
| 1336 | Ga0501036_0110920 | 3300049572 | Bacteria | 2318 |
| 1337 | Ga0501036_1312625 | 3300049572 | Unclassified | 588 |
| 1338 | Ga0501038_0100946 | 3300049574 | Bacteria | 2403 |
| 1339 | Ga0501038_0193406 | 3300049574 | Bacteria | 1636 |
| 1340 | Ga0501038_0790347 | 3300049574 | Bacteria | 706 |
| 1341 | Ga0501039_0027910 | 3300049575 | Bacteria | 4341 |
| 1342 | Ga0501039_0456679 | 3300049575 | Bacteria | 1003 |
| 1343 | Ga0501039_0615539 | 3300049575 | Bacteria | 851 |
| 1344 | Ga0501040_0014732 | 3300049576 | Bacteria | 5158 |
| 1345 | Ga0501040_0223517 | 3300049576 | Bacteria | 1340 |
| 1346 | Ga0501040_1262847 | 3300049576 | Bacteria | 536 |
| 1347 | Ga0501041_0000881 | 3300049577 | Bacteria | 16230 |
| 1348 | Ga0501041_0124950 | 3300049577 | Bacteria | 1601 |
| 1349 | Ga0501041_1025713 | 3300049577 | Unclassified | 531 |
| 1350 | Ga0501042_0002368 | 3300049578 | Bacteria | 11557 |
| 1351 | Ga0501042_0047477 | 3300049578 | Bacteria | 3062 |
| 1352 | Ga0501043_0764846 | 3300049579 | Unclassified | 701 |
| 1353 | Ga0501046_0219952 | 3300049580 | Bacteria | 1406 |
| 1354 | Ga0501047_0112172 | 3300049581 | Bacteria | 2609 |
| 1355 | Ga0501047_0148420 | 3300049581 | Bacteria | 2221 |
| 1356 | Ga0501048_0047770 | 3300049582 | Bacteria | 3054 |
| 1357 | Ga0501048_0146512 | 3300049582 | Bacteria | 1670 |
| 1358 | Ga0501068_0017200 | 3300049584 | Bacteria | 4178 |
| 1359 | Ga0501069_0465927 | 3300049585 | Bacteria | 752 |
| 1360 | Ga0501070_0083015 | 3300049586 | Bacteria | 2652 |
| 1361 | Ga0501070_0327788 | 3300049586 | Bacteria | 1245 |
| 1362 | Ga0501071_0004621 | 3300049587 | Bacteria | 8737 |
| 1363 | Ga0501071_0011873 | 3300049587 | Bacteria | 5883 |
| 1364 | Ga0501071_1105275 | 3300049587 | Bacteria | 612 |
| 1365 | Ga0501071_1594294 | 3300049587 | Unclassified | 504 |
| 1366 | Ga0501072_0002447 | 3300049588 | Bacteria | 13910 |
| 1367 | Ga0501072_0429990 | 3300049588 | Bacteria | 1046 |
| 1368 | Ga0501073_0009228 | 3300049589 | Bacteria | 7273 |
| 1369 | Ga0501073_0025682 | 3300049589 | Bacteria | 4222 |
| 1370 | Ga0501073_0159639 | 3300049589 | Bacteria | 1562 |
| 1371 | Ga0501073_0400178 | 3300049589 | Bacteria | 949 |
| 1372 | Ga0501074_0044233 | 3300049590 | Bacteria | 3224 |
| 1373 | Ga0501074_0424060 | 3300049590 | Bacteria | 943 |
| 1374 | Ga0501075_0001143 | 3300049591 | Bacteria | 17114 |
| 1375 | Ga0501075_0354285 | 3300049591 | Unclassified | 1118 |
| 1376 | Ga0501075_0565336 | 3300049591 | Bacteria | 868 |
| 1377 | Ga0501075_1348289 | 3300049591 | Bacteria | 540 |
| 1378 | Ga0501076_0007665 | 3300049592 | Bacteria | 7861 |
| 1379 | Ga0501076_0056818 | 3300049592 | Bacteria | 3106 |
| 1380 | Ga0501076_0397190 | 3300049592 | Bacteria | 1134 |
| 1381 | Ga0501076_0435693 | 3300049592 | Bacteria | 1079 |
| 1382 | Ga0501077_0035059 | 3300049593 | Bacteria | 3194 |
| 1383 | Ga0501079_0007802 | 3300049741 | Bacteria | 8104 |
| 1384 | Ga0501079_0098301 | 3300049741 | Bacteria | 2269 |
| 1385 | Ga0501080_0069849 | 3300049742 | Bacteria | 3267 |
| 1386 | Ga0501080_0079413 | 3300049742 | Bacteria | 3051 |
| 1387 | Ga0501080_0388636 | 3300049742 | Bacteria | 1256 |
| 1388 | Ga0501081_0004261 | 3300049743 | Bacteria | 9169 |
| 1389 | Ga0501083_0065970 | 3300049744 | Bacteria | 2411 |
| 1390 | Ga0501035_0157846 | 3300049822 | Bacteria | 1965 |
| 1391 | Ga0501045_0097965 | 3300049824 | Bacteria | 2169 |
| 1392 | Ga0501045_0113152 | 3300049824 | Bacteria | 2013 |
| 1393 | nmdc:mga05p37_189585_c1 | 3300050507 | Bacteria | 2497 |
| 1394 | nmdc:mga05p37_603568_c1 | 3300050507 | Bacteria | 1238 |
| 1395 | nmdc:mga05p37_682605_c1 | 3300050507 | Unclassified | 1144 |
| 1396 | nmdc:mga05p37_8536_c1 | 3300050507 | Bacteria | 4974 |
| 1397 | nmdc:mga09592_343599_c1 | 3300050508 | Bacteria | 1292 |
| 1398 | nmdc:mga09592_705629_c1 | 3300050508 | Unclassified | 858 |
| 1399 | nmdc:mga0qj67_286368_c1 | 3300050509 | Bacteria | 1335 |
| 1400 | nmdc:mga0qj67_406834_c1 | 3300050509 | Bacteria | 1098 |
| 1401 | nmdc:mga0qj67_854832_c1 | 3300050509 | Unclassified | 718 |
| 1402 | nmdc:mga06r32_108250_c1 | 3300050510 | Bacteria | 2732 |
| 1403 | nmdc:mga06r32_2354_c1 | 3300050510 | Bacteria | 16931 |
| 1404 | nmdc:mga08y16_1_c1 | 3300050511 | Bacteria | 1034622 |
| 1405 | nmdc:mga08y16_284736_c1 | 3300050511 | Bacteria | 1704 |
| 1406 | nmdc:mga0n895_1043056_c1 | 3300050512 | Bacteria | 797 |
| 1407 | nmdc:mga0n895_1313065_c1 | 3300050512 | Bacteria | 694 |
| 1408 | nmdc:mga0n895_16332_c1 | 3300050512 | Bacteria | 6808 |
| 1409 | nmdc:mga0n895_170166_c1 | 3300050512 | Bacteria | 2210 |
| 1410 | nmdc:mga0n895_19859_c1 | 3300050512 | Bacteria | 6254 |
| 1411 | nmdc:mga0n895_238734_c1 | 3300050512 | Bacteria | 1844 |
| 1412 | nmdc:mga0n895_360054_c1 | 3300050512 | Bacteria | 1473 |
| 1413 | nmdc:mga0n895_866273_c1 | 3300050512 | Bacteria | 890 |
| 1414 | nmdc:mga0rr50_1265604_c1 | 3300050513 | Unclassified | 626 |
| 1415 | nmdc:mga0rr50_156066_c1 | 3300050513 | Bacteria | 1849 |
| 1416 | nmdc:mga0rr50_1807_c1 | 3300050513 | Bacteria | 11826 |
| 1417 | nmdc:mga0rr50_41509_c1 | 3300050513 | Bacteria | 3353 |
| 1418 | nmdc:mga0rr50_432089_c1 | 3300050513 | Bacteria | 1115 |
| 1419 | nmdc:mga0rr50_7195_c1 | 3300050513 | Bacteria | 6839 |
| 1420 | nmdc:mga08x19_142954_c1 | 3300050514 | Bacteria | 1617 |
| 1421 | nmdc:mga08x19_1679_c1 | 3300050514 | Bacteria | 13617 |
| 1422 | nmdc:mga08x19_2609_c1 | 3300050514 | Bacteria | 10933 |
| 1423 | nmdc:mga08x19_27429_c1 | 3300050514 | Bacteria | 3562 |
| 1424 | nmdc:mga08x19_688297_c1 | 3300050514 | Bacteria | 726 |
| 1425 | nmdc:mga08x19_7721_c1 | 3300050514 | Bacteria | 6389 |
| 1426 | nmdc:mga08x19_93793_c1 | 3300050514 | Bacteria | 1984 |
| 1427 | nmdc:mga08x19_96720_c1 | 3300050514 | Bacteria | 1955 |
| 1428 | nmdc:mga0a205_11707_c1 | 3300050515 | Bacteria | 8090 |
| 1429 | nmdc:mga0a205_901298_c1 | 3300050515 | Bacteria | 731 |
| 1430 | Ga0495601_0001368 | 3300053077 | Bacteria | 13415 |
| 1431 | Ga0495601_0029406 | 3300053077 | Bacteria | 3408 |
| 1432 | Ga0495601_0283714 | 3300053077 | Bacteria | 1080 |
| 1433 | Ga0495612_0286979 | 3300053078 | Bacteria | 736 |
| 1434 | Ga0495612_0617504 | 3300053078 | Unclassified | 501 |
| 1435 | Ga0495655_0000287 | 3300053083 | Bacteria | 9217 |
| 1436 | Ga0495595_0096456 | 3300053084 | Bacteria | 1423 |
| 1437 | Ga0495619_0024573 | 3300053085 | Bacteria | 3865 |
| 1438 | Ga0495619_0524999 | 3300053085 | Bacteria | 813 |
| 1439 | Ga0500590_122855 | 3300053148 | Bacteria | 1214 |
| 1440 | Ga0501084_0013954 | 3300054114 | Bacteria | 6650 |
| 1441 | Ga0587084_015300 | 3300059477 | Unclassified | 1081 |
| 1442 | Ga0587093_000692 | 3300059478 | Bacteria | 2512 |
| 1443 | Ga0587066_014595 | 3300059490 | Bacteria | 1210 |
| 1444 | Ga0587066_138035 | 3300059490 | Unclassified | 592 |
| 1445 | Ga0587070_001449 | 3300059491 | Bacteria | 2453 |
| 1446 | Ga0587070_015526 | 3300059491 | Bacteria | 1207 |
| 1447 | Ga0587073_0016559 | 3300059492 | Bacteria | 1347 |
| 1448 | Ga0587077_001212 | 3300059493 | Unclassified | 2689 |
| 1449 | Ga0587085_014007 | 3300059506 | Bacteria | 1125 |
| 1450 | Ga0587085_017002 | 3300059506 | Unclassified | 1060 |
| 1451 | Ga0587086_008478 | 3300059507 | Unclassified | 1202 |
| 1452 | Ga0587086_028327 | 3300059507 | Unclassified | 809 |
| 1453 | Ga0587091_003320 | 3300059511 | Bacteria | 2013 |
| 1454 | Ga0587091_012597 | 3300059511 | Bacteria | 1342 |
| 1455 | Ga0587092_025904 | 3300059512 | Bacteria | 939 |
| 1456 | Ga0587094_008397 | 3300059513 | Unclassified | 1292 |
| 1457 | Ga0587099_004327 | 3300059622 | Unclassified | 1226 |
| 1458 | Ga0587101_009866 | 3300059623 | Unclassified | 1188 |
| 1459 | Ga0587113_005354 | 3300059625 | Bacteria | 1055 |
| 1460 | Ga0587128_002833 | 3300059630 | Bacteria | 1852 |
| 1461 | Ga0587128_033757 | 3300059630 | Bacteria | 862 |
| 1462 | Ga0587067_036706 | 3300059640 | Unclassified | 933 |
| 1463 | Ga0587069_007244 | 3300059642 | Bacteria | 1364 |
| 1464 | Ga0587075_001635 | 3300059644 | Bacteria | 2215 |
| 1465 | Ga0587076_046883 | 3300059645 | Bacteria | 829 |
| 1466 | Ga0587078_000650 | 3300059646 | Bacteria | 2745 |
| 1467 | Ga0587107_005299 | 3300059652 | Unclassified | 1358 |
| 1468 | Ga0587114_001009 | 3300059655 | Unclassified | 2199 |
| 1469 | Ga0587114_036039 | 3300059655 | Bacteria | 781 |
| 1470 | Ga0587114_065311 | 3300059655 | Bacteria | 648 |
| 1471 | Ga0587071_003502 | 3300060344 | Bacteria | 2258 |
| 1472 | Ga0501082_0001055 | 3300060353 | Bacteria | 24399 |
| 1473 | Ga0501082_0166228 | 3300060353 | Bacteria | 1917 |
| 1474 | Ga0501082_0180877 | 3300060353 | Bacteria | 1834 |
| 1475 | Ga0501082_1318309 | 3300060353 | Bacteria | 631 |
| 1476 | Ga0466962_0240908 | 3300061719 | Bacteria | 888 |
| 1477 | Ga0466962_0282852 | 3300061719 | Bacteria | 819 |
| 1478 | Ga0466962_0447746 | 3300061719 | Bacteria | 650 |
| 1479 | Ga0530510_0089182 | 3300061734 | Bacteria | 2248 |
| 1480 | Ga0530510_0747336 | 3300061734 | Unclassified | 746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0229932 | Ga0316574_0229932_10_384 | 119 |
| 2 | 3300035398 | Ga0316574_0806010 | Ga0316574_0806010_27_404 | 119 |
| 3 | 3300037068 | Ga0373925_1775294 | Ga0373925_1775294_35_409 | 121 |
| 4 | 3300059490 | Ga0587066_138035 | Ga0587066_138035_126_506 | 123 |
| 5 | 3300049568 | Ga0501031_0605746 | Ga0501031_0605746_306_689 | 127 |
| 6 | 3300026075 | Ga0207708_10650088 | Ga0207708_106500882 | 130 |
| 7 | 3300035410 | Ga0373924_0307721 | Ga0373924_0307721_10_423 | 136 |
| 8 | 3300025949 | Ga0207667_10816217 | Ga0207667_108162172 | 139 |
| 9 | 3300041486 | Ga0451807_0349962 | Ga0451807_0349962_106_528 | 139 |
| 10 | 3300041512 | Ga0451853_3382037 | Ga0451853_3382037_256_678 | 139 |
| 11 | 3300005615 | Ga0070702_100587702 | Ga0070702_1005877022 | 140 |
| 12 | 3300013297 | Ga0157378_11307456 | Ga0157378_113074562 | 140 |
| 13 | 3300035695 | Ga0373927_0474516 | Ga0373927_0474516_236_688 | 141 |
| 14 | 3300037068 | Ga0373925_0888056 | Ga0373925_0888056_70_522 | 141 |
| 15 | 3300049574 | Ga0501038_0790347 | Ga0501038_0790347_30_476 | 141 |
| 16 | 3300049577 | Ga0501041_1025713 | Ga0501041_1025713_47_493 | 141 |
| 17 | 3300049591 | Ga0501075_0354285 | Ga0501075_0354285_136_582 | 141 |
| 18 | 3300049592 | Ga0501076_0435693 | Ga0501076_0435693_132_578 | 141 |
| 19 | 3300027717 | Ga0209998_10046853 | Ga0209998_100468532 | 142 |
| 20 | 3300031727 | Ga0316576_10000849 | Ga0316576_100008494 | 142 |
| 21 | 3300031727 | Ga0316576_10142392 | Ga0316576_101423922 | 142 |
| 22 | 3300038726 | Ga0400490_14648 | Ga0400490_14648_764_1213 | 142 |
| 23 | 3300044673 | Ga0453683_0158874 | Ga0453683_0158874_801_1244 | 142 |
| 24 | 3300006844 | Ga0075428_100565788 | Ga0075428_1005657881 | 143 |
| 25 | 3300006846 | Ga0075430_100926302 | Ga0075430_1009263022 | 143 |
| 26 | 3300007076 | Ga0075435_100286265 | Ga0075435_1002862652 | 143 |
| 27 | 3300009094 | Ga0111539_10189545 | Ga0111539_101895452 | 143 |
| 28 | 3300009147 | Ga0114129_10831647 | Ga0114129_108316472 | 143 |
| 29 | 3300031090 | Ga0265760_10018687 | Ga0265760_100186873 | 143 |
| 30 | 3300031665 | Ga0316575_10010260 | Ga0316575_100102603 | 143 |
| 31 | 3300031665 | Ga0316575_10010428 | Ga0316575_100104283 | 143 |
| 32 | 3300031727 | Ga0316576_10034159 | Ga0316576_100341593 | 143 |
| 33 | 3300031727 | Ga0316576_10067827 | Ga0316576_100678273 | 143 |
| 34 | 3300031727 | Ga0316576_10183821 | Ga0316576_101838212 | 143 |
| 35 | 3300031727 | Ga0316576_10555620 | Ga0316576_105556202 | 143 |
| 36 | 3300031728 | Ga0316578_10005100 | Ga0316578_100051002 | 143 |
| 37 | 3300031728 | Ga0316578_10022136 | Ga0316578_100221363 | 143 |
| 38 | 3300031728 | Ga0316578_10459041 | Ga0316578_104590411 | 143 |
| 39 | 3300031733 | Ga0316577_10143662 | Ga0316577_101436622 | 143 |
| 40 | 3300032133 | Ga0316583_10016100 | Ga0316583_100161002 | 143 |
| 41 | 3300032137 | Ga0316585_10008305 | Ga0316585_100083053 | 143 |
| 42 | 3300032137 | Ga0316585_10174561 | Ga0316585_101745611 | 143 |
| 43 | 3300032139 | Ga0316580_10014263 | Ga0316580_100142633 | 143 |
| 44 | 3300032168 | Ga0316593_10000495 | Ga0316593_100004955 | 143 |
| 45 | 3300035398 | Ga0316574_0001193 | Ga0316574_0001193_6614_7060 | 143 |
| 46 | 3300035398 | Ga0316574_0004738 | Ga0316574_0004738_5941_6384 | 143 |
| 47 | 3300035398 | Ga0316574_0053555 | Ga0316574_0053555_819_1265 | 143 |
| 48 | 3300035398 | Ga0316574_0278081 | Ga0316574_0278081_348_797 | 143 |
| 49 | 3300036647 | Ga0316582_0043565 | Ga0316582_0043565_260_706 | 143 |
| 50 | 3300036647 | Ga0316582_0137662 | Ga0316582_0137662_776_1222 | 143 |
| 51 | 3300036647 | Ga0316582_0292794 | Ga0316582_0292794_549_995 | 143 |
| 52 | 3300036712 | Ga0316584_0129011 | Ga0316584_0129011_592_1038 | 143 |
| 53 | 3300050507 | nmdc:mga05p37_682605_c1 | nmdc:mga05p37_682605_c1_197_637 | 143 |
| 54 | 3300050509 | nmdc:mga0qj67_854832_c1 | nmdc:mga0qj67_854832_c1_171_611 | 143 |
| 55 | 3300005440 | Ga0070705_101777431 | Ga0070705_1017774311 | 144 |
| 56 | 3300005539 | Ga0068853_101199116 | Ga0068853_1011991162 | 144 |
| 57 | 3300005563 | Ga0068855_100994968 | Ga0068855_1009949681 | 144 |
| 58 | 3300005618 | Ga0068864_100000001 | Ga0068864_100000001219 | 144 |
| 59 | 3300005841 | Ga0068863_100100913 | Ga0068863_1001009134 | 144 |
| 60 | 3300006871 | Ga0075434_100245724 | Ga0075434_1002457243 | 144 |
| 61 | 3300009551 | Ga0105238_11624685 | Ga0105238_116246852 | 144 |
| 62 | 3300026041 | Ga0207639_11051752 | Ga0207639_110517522 | 144 |
| 63 | 3300026088 | Ga0207641_10086268 | Ga0207641_100862684 | 144 |
| 64 | 3300026095 | Ga0207676_10000002 | Ga0207676_10000002615 | 144 |
| 65 | 3300026095 | Ga0207676_11657726 | Ga0207676_116577261 | 144 |
| 66 | 3300035119 | Ga0373956_0476175 | Ga0373956_0476175_46_489 | 144 |
| 67 | 3300035172 | Ga0373955_0212843 | Ga0373955_0212843_450_893 | 144 |
| 68 | 3300048905 | Ga0496102_0886777 | Ga0496102_0886777_109_552 | 144 |
| 69 | 3300048907 | Ga0496104_0395530 | Ga0496104_0395530_359_802 | 144 |
| 70 | 3300048915 | Ga0496112_0151175 | Ga0496112_0151175_605_1048 | 144 |
| 71 | 3300050512 | nmdc:mga0n895_238734_c1 | nmdc:mga0n895_238734_c1_591_1034 | 144 |
| 72 | 3300004799 | Ga0058863_11860926 | Ga0058863_118609261 | 145 |
| 73 | 3300004803 | Ga0058862_12782718 | Ga0058862_127827182 | 145 |
| 74 | 3300005336 | Ga0070680_100039352 | Ga0070680_1000393522 | 145 |
| 75 | 3300005439 | Ga0070711_100848302 | Ga0070711_1008483022 | 145 |
| 76 | 3300005458 | Ga0070681_10321561 | Ga0070681_103215612 | 145 |
| 77 | 3300005530 | Ga0070679_100059965 | Ga0070679_1000599654 | 145 |
| 78 | 3300005549 | Ga0070704_101168591 | Ga0070704_1011685911 | 145 |
| 79 | 3300005617 | Ga0068859_100000001 | Ga0068859_100000001290 | 145 |
| 80 | 3300005843 | Ga0068860_100127649 | Ga0068860_1001276492 | 145 |
| 81 | 3300006844 | Ga0075428_100044054 | Ga0075428_1000440542 | 145 |
| 82 | 3300006846 | Ga0075430_100068934 | Ga0075430_1000689343 | 145 |
| 83 | 3300006846 | Ga0075430_101192108 | Ga0075430_1011921082 | 145 |
| 84 | 3300006847 | Ga0075431_100047210 | Ga0075431_1000472103 | 145 |
| 85 | 3300006931 | Ga0097620_100000001 | Ga0097620_100000001290 | 145 |
| 86 | 3300009553 | Ga0105249_10276614 | Ga0105249_102766142 | 145 |
| 87 | 3300013100 | Ga0157373_11252787 | Ga0157373_112527871 | 145 |
| 88 | 3300013307 | Ga0157372_11076825 | Ga0157372_110768252 | 145 |
| 89 | 3300013308 | Ga0157375_10000077 | Ga0157375_1000007774 | 145 |
| 90 | 3300014326 | Ga0157380_10036241 | Ga0157380_100362417 | 145 |
| 91 | 3300020069 | Ga0197907_10425626 | Ga0197907_104256262 | 145 |
| 92 | 3300020070 | Ga0206356_10684346 | Ga0206356_106843462 | 145 |
| 93 | 3300020076 | Ga0206355_1217712 | Ga0206355_12177121 | 145 |
| 94 | 3300020077 | Ga0206351_10110990 | Ga0206351_101109901 | 145 |
| 95 | 3300020082 | Ga0206353_11971794 | Ga0206353_119717942 | 145 |
| 96 | 3300020610 | Ga0154015_1182847 | Ga0154015_11828472 | 145 |
| 97 | 3300022467 | Ga0224712_10097294 | Ga0224712_100972942 | 145 |
| 98 | 3300025893 | Ga0207682_10469931 | Ga0207682_104699312 | 145 |
| 99 | 3300025912 | Ga0207707_10425647 | Ga0207707_104256472 | 145 |
| 100 | 3300025921 | Ga0207652_10108104 | Ga0207652_101081042 | 145 |
| 101 | 3300025938 | Ga0207704_10142310 | Ga0207704_101423102 | 145 |
| 102 | 3300025940 | Ga0207691_10000966 | Ga0207691_100009663 | 145 |
| 103 | 3300028381 | Ga0268264_10012706 | Ga0268264_100127068 | 145 |
| 104 | 3300031995 | Ga0307409_101869289 | Ga0307409_1018692892 | 145 |
| 105 | 3300035119 | Ga0373956_0108016 | Ga0373956_0108016_592_1038 | 145 |
| 106 | 3300035695 | Ga0373927_1127685 | Ga0373927_1127685_12_461 | 145 |
| 107 | 3300036401 | Ga0373937_0541482 | Ga0373937_0541482_508_954 | 145 |
| 108 | 3300039437 | Ga0436365_0236781 | Ga0436365_0236781_389_838 | 145 |
| 109 | 3300042876 | Ga0451577_0087542 | Ga0451577_0087542_1182_1628 | 145 |
| 110 | 3300044673 | Ga0453683_0140146 | Ga0453683_0140146_907_1356 | 145 |
| 111 | 3300046499 | Ga0495594_0409091 | Ga0495594_0409091_32_487 | 145 |
| 112 | 3300047319 | Ga0495674_0706141 | Ga0495674_0706141_56_502 | 145 |
| 113 | 3300048915 | Ga0496112_0561788 | Ga0496112_0561788_355_804 | 145 |
| 114 | 3300049581 | Ga0501047_0112172 | Ga0501047_0112172_936_1397 | 145 |
| 115 | 3300049585 | Ga0501069_0465927 | Ga0501069_0465927_65_520 | 145 |
| 116 | 3300049589 | Ga0501073_0400178 | Ga0501073_0400178_310_765 | 145 |
| 117 | 3300050509 | nmdc:mga0qj67_286368_c1 | nmdc:mga0qj67_286368_c1_737_1186 | 145 |
| 118 | 3300050510 | nmdc:mga06r32_108250_c1 | nmdc:mga06r32_108250_c1_1354_1803 | 145 |
| 119 | 3300004799 | Ga0058863_10127816 | Ga0058863_101278166 | 146 |
| 120 | 3300004799 | Ga0058863_11021108 | Ga0058863_110211082 | 146 |
| 121 | 3300004799 | Ga0058863_11730432 | Ga0058863_117304321 | 146 |
| 122 | 3300004803 | Ga0058862_10023634 | Ga0058862_100236342 | 146 |
| 123 | 3300004803 | Ga0058862_10034373 | Ga0058862_100343736 | 146 |
| 124 | 3300004803 | Ga0058862_10724446 | Ga0058862_107244463 | 146 |
| 125 | 3300005329 | Ga0070683_100122376 | Ga0070683_1001223762 | 146 |
| 126 | 3300005336 | Ga0070680_100033808 | Ga0070680_1000338082 | 146 |
| 127 | 3300005336 | Ga0070680_100153383 | Ga0070680_1001533832 | 146 |
| 128 | 3300005336 | Ga0070680_100190183 | Ga0070680_1001901834 | 146 |
| 129 | 3300005336 | Ga0070680_100680242 | Ga0070680_1006802421 | 146 |
| 130 | 3300005336 | Ga0070680_100951763 | Ga0070680_1009517632 | 146 |
| 131 | 3300005337 | Ga0070682_100000079 | Ga0070682_1000000795 | 146 |
| 132 | 3300005340 | Ga0070689_100000539 | Ga0070689_10000053916 | 146 |
| 133 | 3300005344 | Ga0070661_100278881 | Ga0070661_1002788811 | 146 |
| 134 | 3300005364 | Ga0070673_100412719 | Ga0070673_1004127192 | 146 |
| 135 | 3300005434 | Ga0070709_10032322 | Ga0070709_100323224 | 146 |
| 136 | 3300005434 | Ga0070709_10083607 | Ga0070709_100836072 | 146 |
| 137 | 3300005435 | Ga0070714_100084049 | Ga0070714_1000840494 | 146 |
| 138 | 3300005435 | Ga0070714_100124991 | Ga0070714_1001249912 | 146 |
| 139 | 3300005435 | Ga0070714_100258622 | Ga0070714_1002586222 | 146 |
| 140 | 3300005435 | Ga0070714_100315914 | Ga0070714_1003159142 | 146 |
| 141 | 3300005435 | Ga0070714_100416420 | Ga0070714_1004164202 | 146 |
| 142 | 3300005436 | Ga0070713_100021840 | Ga0070713_1000218404 | 146 |
| 143 | 3300005436 | Ga0070713_100105609 | Ga0070713_1001056092 | 146 |
| 144 | 3300005436 | Ga0070713_100216183 | Ga0070713_1002161833 | 146 |
| 145 | 3300005436 | Ga0070713_100255526 | Ga0070713_1002555262 | 146 |
| 146 | 3300005436 | Ga0070713_100420907 | Ga0070713_1004209072 | 146 |
| 147 | 3300005436 | Ga0070713_101502376 | Ga0070713_1015023762 | 146 |
| 148 | 3300005437 | Ga0070710_10137726 | Ga0070710_101377262 | 146 |
| 149 | 3300005437 | Ga0070710_10164143 | Ga0070710_101641432 | 146 |
| 150 | 3300005438 | Ga0070701_10000949 | Ga0070701_1000094911 | 146 |
| 151 | 3300005439 | Ga0070711_100006696 | Ga0070711_1000066965 | 146 |
| 152 | 3300005439 | Ga0070711_100871893 | Ga0070711_1008718932 | 146 |
| 153 | 3300005458 | Ga0070681_10054237 | Ga0070681_100542374 | 146 |
| 154 | 3300005458 | Ga0070681_10230167 | Ga0070681_102301672 | 146 |
| 155 | 3300005458 | Ga0070681_10614193 | Ga0070681_106141932 | 146 |
| 156 | 3300005467 | Ga0070706_100196718 | Ga0070706_1001967182 | 146 |
| 157 | 3300005530 | Ga0070679_100017081 | Ga0070679_1000170812 | 146 |
| 158 | 3300005530 | Ga0070679_100041085 | Ga0070679_1000410854 | 146 |
| 159 | 3300005530 | Ga0070679_100847722 | Ga0070679_1008477222 | 146 |
| 160 | 3300005530 | Ga0070679_100968430 | Ga0070679_1009684302 | 146 |
| 161 | 3300005530 | Ga0070679_101006130 | Ga0070679_1010061302 | 146 |
| 162 | 3300005535 | Ga0070684_100882540 | Ga0070684_1008825401 | 146 |
| 163 | 3300005539 | Ga0068853_100096267 | Ga0068853_1000962677 | 146 |
| 164 | 3300005545 | Ga0070695_100843376 | Ga0070695_1008433762 | 146 |
| 165 | 3300005546 | Ga0070696_100040678 | Ga0070696_1000406781 | 146 |
| 166 | 3300005563 | Ga0068855_100125566 | Ga0068855_1001255664 | 146 |
| 167 | 3300005563 | Ga0068855_100203048 | Ga0068855_1002030482 | 146 |
| 168 | 3300005577 | Ga0068857_100341179 | Ga0068857_1003411792 | 146 |
| 169 | 3300005578 | Ga0068854_100060568 | Ga0068854_1000605683 | 146 |
| 170 | 3300005614 | Ga0068856_100057505 | Ga0068856_1000575052 | 146 |
| 171 | 3300005842 | Ga0068858_100000467 | Ga0068858_10000046729 | 146 |
| 172 | 3300006028 | Ga0070717_10000089 | Ga0070717_1000008945 | 146 |
| 173 | 3300006028 | Ga0070717_10255770 | Ga0070717_102557702 | 146 |
| 174 | 3300006028 | Ga0070717_10505250 | Ga0070717_105052502 | 146 |
| 175 | 3300006028 | Ga0070717_10554327 | Ga0070717_105543272 | 146 |
| 176 | 3300006028 | Ga0070717_10852097 | Ga0070717_108520972 | 146 |
| 177 | 3300006028 | Ga0070717_10989546 | Ga0070717_109895462 | 146 |
| 178 | 3300006028 | Ga0070717_11226929 | Ga0070717_112269291 | 146 |
| 179 | 3300006163 | Ga0070715_10029831 | Ga0070715_100298312 | 146 |
| 180 | 3300006173 | Ga0070716_100299575 | Ga0070716_1002995752 | 146 |
| 181 | 3300006173 | Ga0070716_100339365 | Ga0070716_1003393652 | 146 |
| 182 | 3300006175 | Ga0070712_100018655 | Ga0070712_1000186552 | 146 |
| 183 | 3300006175 | Ga0070712_100032656 | Ga0070712_1000326564 | 146 |
| 184 | 3300006175 | Ga0070712_100173972 | Ga0070712_1001739722 | 146 |
| 185 | 3300006175 | Ga0070712_100244025 | Ga0070712_1002440252 | 146 |
| 186 | 3300006175 | Ga0070712_100376087 | Ga0070712_1003760872 | 146 |
| 187 | 3300006175 | Ga0070712_100387133 | Ga0070712_1003871331 | 146 |
| 188 | 3300006175 | Ga0070712_100397837 | Ga0070712_1003978372 | 146 |
| 189 | 3300006237 | Ga0097621_100378247 | Ga0097621_1003782472 | 146 |
| 190 | 3300006358 | Ga0068871_101044475 | Ga0068871_1010444751 | 146 |
| 191 | 3300006846 | Ga0075430_100312390 | Ga0075430_1003123902 | 146 |
| 192 | 3300006914 | Ga0075436_100003427 | Ga0075436_1000034272 | 146 |
| 193 | 3300006914 | Ga0075436_100022071 | Ga0075436_1000220715 | 146 |
| 194 | 3300006914 | Ga0075436_100036783 | Ga0075436_1000367832 | 146 |
| 195 | 3300006914 | Ga0075436_100105033 | Ga0075436_1001050332 | 146 |
| 196 | 3300006914 | Ga0075436_100270051 | Ga0075436_1002700512 | 146 |
| 197 | 3300007076 | Ga0075435_100309842 | Ga0075435_1003098422 | 146 |
| 198 | 3300007076 | Ga0075435_100688686 | Ga0075435_1006886862 | 146 |
| 199 | 3300009093 | Ga0105240_10047167 | Ga0105240_100471672 | 146 |
| 200 | 3300009093 | Ga0105240_10265016 | Ga0105240_102650162 | 146 |
| 201 | 3300009093 | Ga0105240_10564658 | Ga0105240_105646582 | 146 |
| 202 | 3300009093 | Ga0105240_10789909 | Ga0105240_107899092 | 146 |
| 203 | 3300009093 | Ga0105240_11934558 | Ga0105240_119345581 | 146 |
| 204 | 3300009098 | Ga0105245_10000598 | Ga0105245_1000059810 | 146 |
| 205 | 3300009098 | Ga0105245_10033851 | Ga0105245_100338516 | 146 |
| 206 | 3300009174 | Ga0105241_10056519 | Ga0105241_100565192 | 146 |
| 207 | 3300009545 | Ga0105237_10327000 | Ga0105237_103270002 | 146 |
| 208 | 3300009545 | Ga0105237_10682122 | Ga0105237_106821222 | 146 |
| 209 | 3300009551 | Ga0105238_10354724 | Ga0105238_103547242 | 146 |
| 210 | 3300009551 | Ga0105238_11318511 | Ga0105238_113185112 | 146 |
| 211 | 3300010375 | Ga0105239_10669464 | Ga0105239_106694642 | 146 |
| 212 | 3300013100 | Ga0157373_10041467 | Ga0157373_100414673 | 146 |
| 213 | 3300013100 | Ga0157373_10095981 | Ga0157373_100959812 | 146 |
| 214 | 3300013102 | Ga0157371_10197060 | Ga0157371_101970602 | 146 |
| 215 | 3300013104 | Ga0157370_10060753 | Ga0157370_100607532 | 146 |
| 216 | 3300013104 | Ga0157370_10225299 | Ga0157370_102252992 | 146 |
| 217 | 3300013104 | Ga0157370_10259732 | Ga0157370_102597322 | 146 |
| 218 | 3300013104 | Ga0157370_10303636 | Ga0157370_103036362 | 146 |
| 219 | 3300013105 | Ga0157369_10119470 | Ga0157369_101194702 | 146 |
| 220 | 3300013105 | Ga0157369_10216440 | Ga0157369_102164403 | 146 |
| 221 | 3300013105 | Ga0157369_10224513 | Ga0157369_102245132 | 146 |
| 222 | 3300013105 | Ga0157369_10250432 | Ga0157369_102504323 | 146 |
| 223 | 3300013296 | Ga0157374_10147550 | Ga0157374_101475501 | 146 |
| 224 | 3300013297 | Ga0157378_10012420 | Ga0157378_100124204 | 146 |
| 225 | 3300013307 | Ga0157372_10053320 | Ga0157372_100533202 | 146 |
| 226 | 3300013307 | Ga0157372_10057899 | Ga0157372_100578994 | 146 |
| 227 | 3300013307 | Ga0157372_10441398 | Ga0157372_104413981 | 146 |
| 228 | 3300013307 | Ga0157372_10617735 | Ga0157372_106177352 | 146 |
| 229 | 3300013307 | Ga0157372_10650161 | Ga0157372_106501612 | 146 |
| 230 | 3300013307 | Ga0157372_11442667 | Ga0157372_114426672 | 146 |
| 231 | 3300014326 | Ga0157380_10747290 | Ga0157380_107472902 | 146 |
| 232 | 3300014745 | Ga0157377_10000183 | Ga0157377_1000018332 | 146 |
| 233 | 3300014745 | Ga0157377_11144423 | Ga0157377_111444231 | 146 |
| 234 | 3300015261 | Ga0182006_1154264 | Ga0182006_11542642 | 146 |
| 235 | 3300020069 | Ga0197907_10379512 | Ga0197907_103795122 | 146 |
| 236 | 3300020069 | Ga0197907_11005754 | Ga0197907_110057542 | 146 |
| 237 | 3300020070 | Ga0206356_10374345 | Ga0206356_103743451 | 146 |
| 238 | 3300020070 | Ga0206356_11395039 | Ga0206356_113950391 | 146 |
| 239 | 3300020081 | Ga0206354_10345737 | Ga0206354_103457372 | 146 |
| 240 | 3300020082 | Ga0206353_11887567 | Ga0206353_118875671 | 146 |
| 241 | 3300021384 | Ga0213876_10008965 | Ga0213876_100089653 | 146 |
| 242 | 3300022467 | Ga0224712_10010154 | Ga0224712_100101543 | 146 |
| 243 | 3300022467 | Ga0224712_10230023 | Ga0224712_102300231 | 146 |
| 244 | 3300022467 | Ga0224712_10602424 | Ga0224712_106024241 | 146 |
| 245 | 3300025321 | Ga0207656_10025741 | Ga0207656_100257411 | 146 |
| 246 | 3300025906 | Ga0207699_10165984 | Ga0207699_101659842 | 146 |
| 247 | 3300025906 | Ga0207699_10501426 | Ga0207699_105014261 | 146 |
| 248 | 3300025906 | Ga0207699_10589220 | Ga0207699_105892202 | 146 |
| 249 | 3300025908 | Ga0207643_10042578 | Ga0207643_100425783 | 146 |
| 250 | 3300025910 | Ga0207684_10350683 | Ga0207684_103506832 | 146 |
| 251 | 3300025911 | Ga0207654_10252553 | Ga0207654_102525532 | 146 |
| 252 | 3300025912 | Ga0207707_10009842 | Ga0207707_100098428 | 146 |
| 253 | 3300025912 | Ga0207707_10015240 | Ga0207707_100152407 | 146 |
| 254 | 3300025912 | Ga0207707_10191234 | Ga0207707_101912343 | 146 |
| 255 | 3300025912 | Ga0207707_10477695 | Ga0207707_104776951 | 146 |
| 256 | 3300025913 | Ga0207695_11012185 | Ga0207695_110121851 | 146 |
| 257 | 3300025913 | Ga0207695_11137974 | Ga0207695_111379741 | 146 |
| 258 | 3300025915 | Ga0207693_10002022 | Ga0207693_1000202220 | 146 |
| 259 | 3300025915 | Ga0207693_10069057 | Ga0207693_100690573 | 146 |
| 260 | 3300025915 | Ga0207693_10259381 | Ga0207693_102593812 | 146 |
| 261 | 3300025915 | Ga0207693_10323002 | Ga0207693_103230022 | 146 |
| 262 | 3300025916 | Ga0207663_10001864 | Ga0207663_100018648 | 146 |
| 263 | 3300025916 | Ga0207663_10090428 | Ga0207663_100904282 | 146 |
| 264 | 3300025916 | Ga0207663_10235345 | Ga0207663_102353452 | 146 |
| 265 | 3300025916 | Ga0207663_10695439 | Ga0207663_106954392 | 146 |
| 266 | 3300025917 | Ga0207660_10000046 | Ga0207660_1000004614 | 146 |
| 267 | 3300025917 | Ga0207660_10042097 | Ga0207660_100420972 | 146 |
| 268 | 3300025917 | Ga0207660_10135597 | Ga0207660_101355972 | 146 |
| 269 | 3300025917 | Ga0207660_11101635 | Ga0207660_111016352 | 146 |
| 270 | 3300025920 | Ga0207649_10210518 | Ga0207649_102105183 | 146 |
| 271 | 3300025921 | Ga0207652_10021650 | Ga0207652_100216505 | 146 |
| 272 | 3300025921 | Ga0207652_10080997 | Ga0207652_100809974 | 146 |
| 273 | 3300025921 | Ga0207652_10384970 | Ga0207652_103849702 | 146 |
| 274 | 3300025921 | Ga0207652_10514521 | Ga0207652_105145212 | 146 |
| 275 | 3300025927 | Ga0207687_10000753 | Ga0207687_1000075317 | 146 |
| 276 | 3300025927 | Ga0207687_10001541 | Ga0207687_1000154110 | 146 |
| 277 | 3300025928 | Ga0207700_10006682 | Ga0207700_100066822 | 146 |
| 278 | 3300025928 | Ga0207700_10079211 | Ga0207700_100792113 | 146 |
| 279 | 3300025928 | Ga0207700_10179225 | Ga0207700_101792253 | 146 |
| 280 | 3300025928 | Ga0207700_10189294 | Ga0207700_101892942 | 146 |
| 281 | 3300025928 | Ga0207700_10295414 | Ga0207700_102954142 | 146 |
| 282 | 3300025929 | Ga0207664_10106371 | Ga0207664_101063713 | 146 |
| 283 | 3300025929 | Ga0207664_10163918 | Ga0207664_101639182 | 146 |
| 284 | 3300025929 | Ga0207664_10260055 | Ga0207664_102600552 | 146 |
| 285 | 3300025929 | Ga0207664_10670069 | Ga0207664_106700692 | 146 |
| 286 | 3300025939 | Ga0207665_10011933 | Ga0207665_100119332 | 146 |
| 287 | 3300025939 | Ga0207665_10313127 | Ga0207665_103131272 | 146 |
| 288 | 3300025942 | Ga0207689_10281643 | Ga0207689_102816432 | 146 |
| 289 | 3300025944 | Ga0207661_10128482 | Ga0207661_101284823 | 146 |
| 290 | 3300025949 | Ga0207667_10019963 | Ga0207667_1001996312 | 146 |
| 291 | 3300025949 | Ga0207667_10367248 | Ga0207667_103672482 | 146 |
| 292 | 3300025960 | Ga0207651_10012516 | Ga0207651_100125163 | 146 |
| 293 | 3300025981 | Ga0207640_10122448 | Ga0207640_101224482 | 146 |
| 294 | 3300026035 | Ga0207703_10000085 | Ga0207703_1000008552 | 146 |
| 295 | 3300026041 | Ga0207639_10062525 | Ga0207639_100625252 | 146 |
| 296 | 3300026078 | Ga0207702_10190319 | Ga0207702_101903192 | 146 |
| 297 | 3300026116 | Ga0207674_10493518 | Ga0207674_104935182 | 146 |
| 298 | 3300026142 | Ga0207698_10997268 | Ga0207698_109972682 | 146 |
| 299 | 3300035086 | Ga0373934_0008649 | Ga0373934_0008649_1015_1464 | 146 |
| 300 | 3300035111 | Ga0373923_0139461 | Ga0373923_0139461_420_866 | 146 |
| 301 | 3300035111 | Ga0373923_0352395 | Ga0373923_0352395_148_600 | 146 |
| 302 | 3300035119 | Ga0373956_0004323 | Ga0373956_0004323_2608_3057 | 146 |
| 303 | 3300035119 | Ga0373956_0016550 | Ga0373956_0016550_530_982 | 146 |
| 304 | 3300035121 | Ga0373960_0070317 | Ga0373960_0070317_458_904 | 146 |
| 305 | 3300035172 | Ga0373955_0295973 | Ga0373955_0295973_396_845 | 146 |
| 306 | 3300035410 | Ga0373924_0014296 | Ga0373924_0014296_1310_1762 | 146 |
| 307 | 3300035691 | Ga0373931_0579336 | Ga0373931_0579336_220_666 | 146 |
| 308 | 3300035692 | Ga0373935_0170640 | Ga0373935_0170640_284_730 | 146 |
| 309 | 3300035724 | Ga0373933_0003213 | Ga0373933_0003213_2644_3093 | 146 |
| 310 | 3300035724 | Ga0373933_1034400 | Ga0373933_1034400_79_531 | 146 |
| 311 | 3300035725 | Ga0373947_0173877 | Ga0373947_0173877_852_1298 | 146 |
| 312 | 3300036401 | Ga0373937_0000455 | Ga0373937_0000455_12702_13151 | 146 |
| 313 | 3300036401 | Ga0373937_0001803 | Ga0373937_0001803_12383_12835 | 146 |
| 314 | 3300036401 | Ga0373937_0073694 | Ga0373937_0073694_183_635 | 146 |
| 315 | 3300036401 | Ga0373937_0451882 | Ga0373937_0451882_233_682 | 146 |
| 316 | 3300036401 | Ga0373937_0701993 | Ga0373937_0701993_205_654 | 146 |
| 317 | 3300037068 | Ga0373925_0008739 | Ga0373925_0008739_4414_4860 | 146 |
| 318 | 3300038443 | Ga0395901_0424127 | Ga0395901_0424127_872_1324 | 146 |
| 319 | 3300039437 | Ga0436365_0968862 | Ga0436365_0968862_315_764 | 146 |
| 320 | 3300039437 | Ga0436365_1692853 | Ga0436365_1692853_310_759 | 146 |
| 321 | 3300042876 | Ga0451577_0320960 | Ga0451577_0320960_391_840 | 146 |
| 322 | 3300044684 | Ga0466966_0421313 | Ga0466966_0421313_239_685 | 146 |
| 323 | 3300044693 | Ga0466961_0457910 | Ga0466961_0457910_220_666 | 146 |
| 324 | 3300044712 | Ga0453684_0047620 | Ga0453684_0047620_3234_3683 | 146 |
| 325 | 3300044719 | Ga0466971_0589174 | Ga0466971_0589174_67_513 | 146 |
| 326 | 3300044735 | Ga0466968_0107957 | Ga0466968_0107957_775_1221 | 146 |
| 327 | 3300044842 | Ga0466957_0960957 | Ga0466957_0960957_58_504 | 146 |
| 328 | 3300045976 | Ga0466967_0027554 | Ga0466967_0027554_1937_2389 | 146 |
| 329 | 3300045976 | Ga0466967_0033460 | Ga0466967_0033460_2463_2909 | 146 |
| 330 | 3300045976 | Ga0466967_1556224 | Ga0466967_1556224_79_525 | 146 |
| 331 | 3300046462 | Ga0495651_0002665 | Ga0495651_0002665_10837_11286 | 146 |
| 332 | 3300046463 | Ga0495653_0257489 | Ga0495653_0257489_63_512 | 146 |
| 333 | 3300046472 | Ga0495580_0380215 | Ga0495580_0380215_268_714 | 146 |
| 334 | 3300046516 | Ga0495628_0356074 | Ga0495628_0356074_35_487 | 146 |
| 335 | 3300046529 | Ga0495652_0035479 | Ga0495652_0035479_2812_3261 | 146 |
| 336 | 3300046529 | Ga0495652_0108432 | Ga0495652_0108432_1444_1896 | 146 |
| 337 | 3300046536 | Ga0495587_0005061 | Ga0495587_0005061_5077_5526 | 146 |
| 338 | 3300046536 | Ga0495587_0348400 | Ga0495587_0348400_307_759 | 146 |
| 339 | 3300046539 | Ga0495621_0043692 | Ga0495621_0043692_184_630 | 146 |
| 340 | 3300046543 | Ga0495645_0524722 | Ga0495645_0524722_240_689 | 146 |
| 341 | 3300046674 | Ga0495588_0203002 | Ga0495588_0203002_154_600 | 146 |
| 342 | 3300046675 | Ga0495657_0285258 | Ga0495657_0285258_17_466 | 146 |
| 343 | 3300046679 | Ga0495623_0114176 | Ga0495623_0114176_448_897 | 146 |
| 344 | 3300047317 | Ga0495604_0167692 | Ga0495604_0167692_226_675 | 146 |
| 345 | 3300047444 | Ga0495675_0012326 | Ga0495675_0012326_3410_3859 | 146 |
| 346 | 3300048088 | Ga0495602_0000191 | Ga0495602_0000191_24643_25092 | 146 |
| 347 | 3300048088 | Ga0495602_0528292 | Ga0495602_0528292_89_532 | 146 |
| 348 | 3300048903 | Ga0496100_0073346 | Ga0496100_0073346_492_944 | 146 |
| 349 | 3300048905 | Ga0496102_1427125 | Ga0496102_1427125_52_504 | 146 |
| 350 | 3300048907 | Ga0496104_0199151 | Ga0496104_0199151_169_612 | 146 |
| 351 | 3300048907 | Ga0496104_0520395 | Ga0496104_0520395_249_701 | 146 |
| 352 | 3300048907 | Ga0496104_0596568 | Ga0496104_0596568_430_876 | 146 |
| 353 | 3300048908 | Ga0496105_0001295 | Ga0496105_0001295_950_1402 | 146 |
| 354 | 3300048908 | Ga0496105_0756181 | Ga0496105_0756181_100_543 | 146 |
| 355 | 3300048914 | Ga0496111_0132068 | Ga0496111_0132068_930_1382 | 146 |
| 356 | 3300048915 | Ga0496112_0018055 | Ga0496112_0018055_369_815 | 146 |
| 357 | 3300048915 | Ga0496112_0930510 | Ga0496112_0930510_85_537 | 146 |
| 358 | 3300049576 | Ga0501040_1262847 | Ga0501040_1262847_76_525 | 146 |
| 359 | 3300050509 | nmdc:mga0qj67_406834_c1 | nmdc:mga0qj67_406834_c1_521_973 | 146 |
| 360 | 3300050513 | nmdc:mga0rr50_1265604_c1 | nmdc:mga0rr50_1265604_c1_129_581 | 146 |
| 361 | 3300050513 | nmdc:mga0rr50_432089_c1 | nmdc:mga0rr50_432089_c1_230_679 | 146 |
| 362 | 3300050514 | nmdc:mga08x19_142954_c1 | nmdc:mga08x19_142954_c1_559_1005 | 146 |
| 363 | 3300050514 | nmdc:mga08x19_2609_c1 | nmdc:mga08x19_2609_c1_920_1366 | 146 |
| 364 | 3300050514 | nmdc:mga08x19_688297_c1 | nmdc:mga08x19_688297_c1_210_659 | 146 |
| 365 | 3300050514 | nmdc:mga08x19_7721_c1 | nmdc:mga08x19_7721_c1_5737_6186 | 146 |
| 366 | 3300050514 | nmdc:mga08x19_93793_c1 | nmdc:mga08x19_93793_c1_513_962 | 146 |
| 367 | 3300050514 | nmdc:mga08x19_96720_c1 | nmdc:mga08x19_96720_c1_68_517 | 146 |
| 368 | 3300059492 | Ga0587073_0016559 | Ga0587073_0016559_570_1022 | 146 |
| 369 | 3300059630 | Ga0587128_002833 | Ga0587128_002833_861_1304 | 146 |
| 370 | 3300059655 | Ga0587114_036039 | Ga0587114_036039_228_680 | 146 |
| 371 | 3300061719 | Ga0466962_0240908 | Ga0466962_0240908_206_658 | 146 |
| 372 | 3300061719 | Ga0466962_0282852 | Ga0466962_0282852_48_494 | 146 |
| 373 | 3300004800 | Ga0058861_11826821 | Ga0058861_118268212 | 147 |
| 374 | 3300004800 | Ga0058861_12031869 | Ga0058861_120318692 | 147 |
| 375 | 3300004803 | Ga0058862_12268890 | Ga0058862_122688902 | 147 |
| 376 | 3300004803 | Ga0058862_12345701 | Ga0058862_123457012 | 147 |
| 377 | 3300004803 | Ga0058862_12473751 | Ga0058862_124737512 | 147 |
| 378 | 3300005289 | Ga0065704_10126818 | Ga0065704_101268182 | 147 |
| 379 | 3300005290 | Ga0065712_10218621 | Ga0065712_102186212 | 147 |
| 380 | 3300005295 | Ga0065707_10006434 | Ga0065707_100064342 | 147 |
| 381 | 3300005295 | Ga0065707_10088310 | Ga0065707_100883105 | 147 |
| 382 | 3300005327 | Ga0070658_10029956 | Ga0070658_100299564 | 147 |
| 383 | 3300005327 | Ga0070658_10322621 | Ga0070658_103226212 | 147 |
| 384 | 3300005327 | Ga0070658_10858312 | Ga0070658_108583121 | 147 |
| 385 | 3300005328 | Ga0070676_10253514 | Ga0070676_102535142 | 147 |
| 386 | 3300005328 | Ga0070676_10534570 | Ga0070676_105345701 | 147 |
| 387 | 3300005329 | Ga0070683_100000027 | Ga0070683_100000027133 | 147 |
| 388 | 3300005329 | Ga0070683_100085855 | Ga0070683_1000858554 | 147 |
| 389 | 3300005329 | Ga0070683_100129470 | Ga0070683_1001294703 | 147 |
| 390 | 3300005329 | Ga0070683_100339897 | Ga0070683_1003398973 | 147 |
| 391 | 3300005329 | Ga0070683_100468908 | Ga0070683_1004689082 | 147 |
| 392 | 3300005329 | Ga0070683_100505926 | Ga0070683_1005059261 | 147 |
| 393 | 3300005329 | Ga0070683_100532233 | Ga0070683_1005322332 | 147 |
| 394 | 3300005329 | Ga0070683_101410228 | Ga0070683_1014102282 | 147 |
| 395 | 3300005331 | Ga0070670_100000463 | Ga0070670_10000046321 | 147 |
| 396 | 3300005331 | Ga0070670_100001082 | Ga0070670_10000108215 | 147 |
| 397 | 3300005331 | Ga0070670_100011194 | Ga0070670_1000111946 | 147 |
| 398 | 3300005331 | Ga0070670_100056945 | Ga0070670_1000569453 | 147 |
| 399 | 3300005331 | Ga0070670_100111653 | Ga0070670_1001116533 | 147 |
| 400 | 3300005334 | Ga0068869_100005528 | Ga0068869_1000055287 | 147 |
| 401 | 3300005334 | Ga0068869_100012601 | Ga0068869_1000126013 | 147 |
| 402 | 3300005334 | Ga0068869_100429892 | Ga0068869_1004298922 | 147 |
| 403 | 3300005334 | Ga0068869_100730496 | Ga0068869_1007304961 | 147 |
| 404 | 3300005334 | Ga0068869_100744136 | Ga0068869_1007441362 | 147 |
| 405 | 3300005334 | Ga0068869_101265702 | Ga0068869_1012657021 | 147 |
| 406 | 3300005335 | Ga0070666_10067040 | Ga0070666_100670401 | 147 |
| 407 | 3300005335 | Ga0070666_10105851 | Ga0070666_101058512 | 147 |
| 408 | 3300005336 | Ga0070680_100018863 | Ga0070680_1000188632 | 147 |
| 409 | 3300005336 | Ga0070680_100019548 | Ga0070680_1000195483 | 147 |
| 410 | 3300005336 | Ga0070680_100283317 | Ga0070680_1002833172 | 147 |
| 411 | 3300005336 | Ga0070680_100303536 | Ga0070680_1003035361 | 147 |
| 412 | 3300005337 | Ga0070682_100389044 | Ga0070682_1003890441 | 147 |
| 413 | 3300005337 | Ga0070682_100483228 | Ga0070682_1004832282 | 147 |
| 414 | 3300005338 | Ga0068868_100001785 | Ga0068868_10000178510 | 147 |
| 415 | 3300005338 | Ga0068868_100030424 | Ga0068868_1000304242 | 147 |
| 416 | 3300005338 | Ga0068868_100040900 | Ga0068868_1000409006 | 147 |
| 417 | 3300005338 | Ga0068868_100041428 | Ga0068868_1000414283 | 147 |
| 418 | 3300005338 | Ga0068868_100052957 | Ga0068868_1000529573 | 147 |
| 419 | 3300005338 | Ga0068868_100094920 | Ga0068868_1000949203 | 147 |
| 420 | 3300005338 | Ga0068868_100141354 | Ga0068868_1001413543 | 147 |
| 421 | 3300005338 | Ga0068868_100216735 | Ga0068868_1002167352 | 147 |
| 422 | 3300005339 | Ga0070660_100349004 | Ga0070660_1003490041 | 147 |
| 423 | 3300005340 | Ga0070689_100037297 | Ga0070689_1000372973 | 147 |
| 424 | 3300005340 | Ga0070689_100382322 | Ga0070689_1003823222 | 147 |
| 425 | 3300005340 | Ga0070689_100387431 | Ga0070689_1003874312 | 147 |
| 426 | 3300005340 | Ga0070689_100404387 | Ga0070689_1004043871 | 147 |
| 427 | 3300005340 | Ga0070689_100624043 | Ga0070689_1006240431 | 147 |
| 428 | 3300005341 | Ga0070691_10134081 | Ga0070691_101340813 | 147 |
| 429 | 3300005341 | Ga0070691_10138763 | Ga0070691_101387631 | 147 |
| 430 | 3300005341 | Ga0070691_10208907 | Ga0070691_102089071 | 147 |
| 431 | 3300005343 | Ga0070687_100007147 | Ga0070687_1000071472 | 147 |
| 432 | 3300005343 | Ga0070687_100193374 | Ga0070687_1001933742 | 147 |
| 433 | 3300005343 | Ga0070687_100412902 | Ga0070687_1004129022 | 147 |
| 434 | 3300005344 | Ga0070661_100192185 | Ga0070661_1001921852 | 147 |
| 435 | 3300005344 | Ga0070661_100304115 | Ga0070661_1003041152 | 147 |
| 436 | 3300005344 | Ga0070661_100577253 | Ga0070661_1005772532 | 147 |
| 437 | 3300005345 | Ga0070692_10042923 | Ga0070692_100429232 | 147 |
| 438 | 3300005354 | Ga0070675_100000003 | Ga0070675_100000003109 | 147 |
| 439 | 3300005354 | Ga0070675_100655528 | Ga0070675_1006555282 | 147 |
| 440 | 3300005355 | Ga0070671_100093791 | Ga0070671_1000937914 | 147 |
| 441 | 3300005355 | Ga0070671_101063623 | Ga0070671_1010636232 | 147 |
| 442 | 3300005356 | Ga0070674_100284408 | Ga0070674_1002844083 | 147 |
| 443 | 3300005364 | Ga0070673_100122565 | Ga0070673_1001225651 | 147 |
| 444 | 3300005364 | Ga0070673_100593985 | Ga0070673_1005939852 | 147 |
| 445 | 3300005364 | Ga0070673_100806147 | Ga0070673_1008061472 | 147 |
| 446 | 3300005365 | Ga0070688_100639171 | Ga0070688_1006391712 | 147 |
| 447 | 3300005366 | Ga0070659_100535689 | Ga0070659_1005356892 | 147 |
| 448 | 3300005367 | Ga0070667_100934025 | Ga0070667_1009340252 | 147 |
| 449 | 3300005434 | Ga0070709_10248002 | Ga0070709_102480022 | 147 |
| 450 | 3300005434 | Ga0070709_10547093 | Ga0070709_105470932 | 147 |
| 451 | 3300005435 | Ga0070714_100011335 | Ga0070714_1000113354 | 147 |
| 452 | 3300005435 | Ga0070714_100038531 | Ga0070714_1000385312 | 147 |
| 453 | 3300005435 | Ga0070714_100108019 | Ga0070714_1001080193 | 147 |
| 454 | 3300005435 | Ga0070714_100117911 | Ga0070714_1001179112 | 147 |
| 455 | 3300005435 | Ga0070714_100170309 | Ga0070714_1001703093 | 147 |
| 456 | 3300005435 | Ga0070714_100190225 | Ga0070714_1001902252 | 147 |
| 457 | 3300005435 | Ga0070714_100205182 | Ga0070714_1002051822 | 147 |
| 458 | 3300005435 | Ga0070714_100214234 | Ga0070714_1002142342 | 147 |
| 459 | 3300005435 | Ga0070714_100228055 | Ga0070714_1002280552 | 147 |
| 460 | 3300005435 | Ga0070714_100568576 | Ga0070714_1005685762 | 147 |
| 461 | 3300005435 | Ga0070714_102032589 | Ga0070714_1020325891 | 147 |
| 462 | 3300005436 | Ga0070713_100008383 | Ga0070713_1000083832 | 147 |
| 463 | 3300005436 | Ga0070713_100075911 | Ga0070713_1000759112 | 147 |
| 464 | 3300005436 | Ga0070713_100086884 | Ga0070713_1000868842 | 147 |
| 465 | 3300005436 | Ga0070713_100104493 | Ga0070713_1001044932 | 147 |
| 466 | 3300005436 | Ga0070713_100127628 | Ga0070713_1001276282 | 147 |
| 467 | 3300005436 | Ga0070713_100158681 | Ga0070713_1001586811 | 147 |
| 468 | 3300005436 | Ga0070713_100230484 | Ga0070713_1002304842 | 147 |
| 469 | 3300005436 | Ga0070713_100265815 | Ga0070713_1002658152 | 147 |
| 470 | 3300005436 | Ga0070713_100375520 | Ga0070713_1003755201 | 147 |
| 471 | 3300005436 | Ga0070713_100669183 | Ga0070713_1006691832 | 147 |
| 472 | 3300005437 | Ga0070710_10025235 | Ga0070710_100252352 | 147 |
| 473 | 3300005437 | Ga0070710_10122967 | Ga0070710_101229672 | 147 |
| 474 | 3300005437 | Ga0070710_10302698 | Ga0070710_103026982 | 147 |
| 475 | 3300005437 | Ga0070710_10587852 | Ga0070710_105878522 | 147 |
| 476 | 3300005439 | Ga0070711_100213706 | Ga0070711_1002137062 | 147 |
| 477 | 3300005439 | Ga0070711_100634977 | Ga0070711_1006349771 | 147 |
| 478 | 3300005441 | Ga0070700_100000009 | Ga0070700_10000000974 | 147 |
| 479 | 3300005445 | Ga0070708_100001651 | Ga0070708_1000016512 | 147 |
| 480 | 3300005445 | Ga0070708_100002626 | Ga0070708_10000262611 | 147 |
| 481 | 3300005445 | Ga0070708_100094657 | Ga0070708_1000946574 | 147 |
| 482 | 3300005445 | Ga0070708_100109118 | Ga0070708_1001091183 | 147 |
| 483 | 3300005445 | Ga0070708_100189331 | Ga0070708_1001893313 | 147 |
| 484 | 3300005445 | Ga0070708_100205949 | Ga0070708_1002059492 | 147 |
| 485 | 3300005445 | Ga0070708_100428983 | Ga0070708_1004289832 | 147 |
| 486 | 3300005445 | Ga0070708_100600083 | Ga0070708_1006000832 | 147 |
| 487 | 3300005445 | Ga0070708_100644079 | Ga0070708_1006440792 | 147 |
| 488 | 3300005445 | Ga0070708_100878610 | Ga0070708_1008786102 | 147 |
| 489 | 3300005456 | Ga0070678_100153071 | Ga0070678_1001530713 | 147 |
| 490 | 3300005457 | Ga0070662_100131671 | Ga0070662_1001316712 | 147 |
| 491 | 3300005457 | Ga0070662_100541086 | Ga0070662_1005410861 | 147 |
| 492 | 3300005458 | Ga0070681_10003881 | Ga0070681_100038815 | 147 |
| 493 | 3300005458 | Ga0070681_10009757 | Ga0070681_100097573 | 147 |
| 494 | 3300005458 | Ga0070681_10023368 | Ga0070681_100233685 | 147 |
| 495 | 3300005458 | Ga0070681_10212491 | Ga0070681_102124911 | 147 |
| 496 | 3300005458 | Ga0070681_10674743 | Ga0070681_106747432 | 147 |
| 497 | 3300005458 | Ga0070681_11037795 | Ga0070681_110377952 | 147 |
| 498 | 3300005459 | Ga0068867_100217866 | Ga0068867_1002178661 | 147 |
| 499 | 3300005459 | Ga0068867_100442899 | Ga0068867_1004428992 | 147 |
| 500 | 3300005459 | Ga0068867_100847046 | Ga0068867_1008470462 | 147 |
| 501 | 3300005459 | Ga0068867_101851097 | Ga0068867_1018510971 | 147 |
| 502 | 3300005459 | Ga0068867_101924074 | Ga0068867_1019240741 | 147 |
| 503 | 3300005466 | Ga0070685_10019936 | Ga0070685_100199365 | 147 |
| 504 | 3300005467 | Ga0070706_100005420 | Ga0070706_1000054209 | 147 |
| 505 | 3300005467 | Ga0070706_100006733 | Ga0070706_1000067337 | 147 |
| 506 | 3300005467 | Ga0070706_100032990 | Ga0070706_1000329902 | 147 |
| 507 | 3300005467 | Ga0070706_100054718 | Ga0070706_1000547183 | 147 |
| 508 | 3300005467 | Ga0070706_100116712 | Ga0070706_1001167123 | 147 |
| 509 | 3300005467 | Ga0070706_100354440 | Ga0070706_1003544402 | 147 |
| 510 | 3300005467 | Ga0070706_100511771 | Ga0070706_1005117712 | 147 |
| 511 | 3300005467 | Ga0070706_101603960 | Ga0070706_1016039601 | 147 |
| 512 | 3300005468 | Ga0070707_100010978 | Ga0070707_1000109788 | 147 |
| 513 | 3300005468 | Ga0070707_100019381 | Ga0070707_1000193814 | 147 |
| 514 | 3300005468 | Ga0070707_100031374 | Ga0070707_1000313742 | 147 |
| 515 | 3300005468 | Ga0070707_100069096 | Ga0070707_1000690963 | 147 |
| 516 | 3300005468 | Ga0070707_100199627 | Ga0070707_1001996272 | 147 |
| 517 | 3300005468 | Ga0070707_100486210 | Ga0070707_1004862102 | 147 |
| 518 | 3300005468 | Ga0070707_100503942 | Ga0070707_1005039421 | 147 |
| 519 | 3300005468 | Ga0070707_101023145 | Ga0070707_1010231452 | 147 |
| 520 | 3300005468 | Ga0070707_101143239 | Ga0070707_1011432391 | 147 |
| 521 | 3300005468 | Ga0070707_101788170 | Ga0070707_1017881701 | 147 |
| 522 | 3300005471 | Ga0070698_100002386 | Ga0070698_10000238610 | 147 |
| 523 | 3300005471 | Ga0070698_100041416 | Ga0070698_1000414162 | 147 |
| 524 | 3300005471 | Ga0070698_100091868 | Ga0070698_1000918684 | 147 |
| 525 | 3300005471 | Ga0070698_100308818 | Ga0070698_1003088182 | 147 |
| 526 | 3300005471 | Ga0070698_100318883 | Ga0070698_1003188832 | 147 |
| 527 | 3300005471 | Ga0070698_100511677 | Ga0070698_1005116772 | 147 |
| 528 | 3300005471 | Ga0070698_100870836 | Ga0070698_1008708362 | 147 |
| 529 | 3300005471 | Ga0070698_101658750 | Ga0070698_1016587501 | 147 |
| 530 | 3300005518 | Ga0070699_100011379 | Ga0070699_1000113797 | 147 |
| 531 | 3300005518 | Ga0070699_100018505 | Ga0070699_1000185055 | 147 |
| 532 | 3300005518 | Ga0070699_100043826 | Ga0070699_1000438265 | 147 |
| 533 | 3300005518 | Ga0070699_100056139 | Ga0070699_1000561393 | 147 |
| 534 | 3300005518 | Ga0070699_100080530 | Ga0070699_1000805303 | 147 |
| 535 | 3300005518 | Ga0070699_100170794 | Ga0070699_1001707944 | 147 |
| 536 | 3300005518 | Ga0070699_100371683 | Ga0070699_1003716832 | 147 |
| 537 | 3300005518 | Ga0070699_100387940 | Ga0070699_1003879402 | 147 |
| 538 | 3300005518 | Ga0070699_100438654 | Ga0070699_1004386542 | 147 |
| 539 | 3300005518 | Ga0070699_100507596 | Ga0070699_1005075962 | 147 |
| 540 | 3300005518 | Ga0070699_100562079 | Ga0070699_1005620792 | 147 |
| 541 | 3300005518 | Ga0070699_100853234 | Ga0070699_1008532341 | 147 |
| 542 | 3300005530 | Ga0070679_100002130 | Ga0070679_10000213013 | 147 |
| 543 | 3300005530 | Ga0070679_100043914 | Ga0070679_1000439144 | 147 |
| 544 | 3300005530 | Ga0070679_100051807 | Ga0070679_1000518074 | 147 |
| 545 | 3300005530 | Ga0070679_100105697 | Ga0070679_1001056974 | 147 |
| 546 | 3300005530 | Ga0070679_100191563 | Ga0070679_1001915633 | 147 |
| 547 | 3300005530 | Ga0070679_100659981 | Ga0070679_1006599812 | 147 |
| 548 | 3300005530 | Ga0070679_101090234 | Ga0070679_1010902342 | 147 |
| 549 | 3300005535 | Ga0070684_100075076 | Ga0070684_1000750764 | 147 |
| 550 | 3300005535 | Ga0070684_100447061 | Ga0070684_1004470611 | 147 |
| 551 | 3300005535 | Ga0070684_101737285 | Ga0070684_1017372851 | 147 |
| 552 | 3300005536 | Ga0070697_100015335 | Ga0070697_1000153354 | 147 |
| 553 | 3300005536 | Ga0070697_100045075 | Ga0070697_1000450753 | 147 |
| 554 | 3300005536 | Ga0070697_100066579 | Ga0070697_1000665793 | 147 |
| 555 | 3300005536 | Ga0070697_100152238 | Ga0070697_1001522382 | 147 |
| 556 | 3300005536 | Ga0070697_100197635 | Ga0070697_1001976352 | 147 |
| 557 | 3300005536 | Ga0070697_100235806 | Ga0070697_1002358063 | 147 |
| 558 | 3300005536 | Ga0070697_100286417 | Ga0070697_1002864172 | 147 |
| 559 | 3300005536 | Ga0070697_100289628 | Ga0070697_1002896282 | 147 |
| 560 | 3300005536 | Ga0070697_100304357 | Ga0070697_1003043572 | 147 |
| 561 | 3300005536 | Ga0070697_100717790 | Ga0070697_1007177901 | 147 |
| 562 | 3300005539 | Ga0068853_100103900 | Ga0068853_1001039003 | 147 |
| 563 | 3300005539 | Ga0068853_100472817 | Ga0068853_1004728172 | 147 |
| 564 | 3300005539 | Ga0068853_100961508 | Ga0068853_1009615082 | 147 |
| 565 | 3300005544 | Ga0070686_100356060 | Ga0070686_1003560602 | 147 |
| 566 | 3300005546 | Ga0070696_100688771 | Ga0070696_1006887712 | 147 |
| 567 | 3300005547 | Ga0070693_100023038 | Ga0070693_1000230383 | 147 |
| 568 | 3300005547 | Ga0070693_100026169 | Ga0070693_1000261693 | 147 |
| 569 | 3300005547 | Ga0070693_100068527 | Ga0070693_1000685273 | 147 |
| 570 | 3300005547 | Ga0070693_100323126 | Ga0070693_1003231262 | 147 |
| 571 | 3300005547 | Ga0070693_100711938 | Ga0070693_1007119382 | 147 |
| 572 | 3300005548 | Ga0070665_100056980 | Ga0070665_1000569803 | 147 |
| 573 | 3300005548 | Ga0070665_100298376 | Ga0070665_1002983763 | 147 |
| 574 | 3300005549 | Ga0070704_100733286 | Ga0070704_1007332862 | 147 |
| 575 | 3300005563 | Ga0068855_100005920 | Ga0068855_1000059209 | 147 |
| 576 | 3300005563 | Ga0068855_100007209 | Ga0068855_1000072094 | 147 |
| 577 | 3300005563 | Ga0068855_100009704 | Ga0068855_1000097044 | 147 |
| 578 | 3300005563 | Ga0068855_100038946 | Ga0068855_1000389465 | 147 |
| 579 | 3300005563 | Ga0068855_100136459 | Ga0068855_1001364592 | 147 |
| 580 | 3300005563 | Ga0068855_100200944 | Ga0068855_1002009442 | 147 |
| 581 | 3300005564 | Ga0070664_100000866 | Ga0070664_10000086610 | 147 |
| 582 | 3300005564 | Ga0070664_100093002 | Ga0070664_1000930022 | 147 |
| 583 | 3300005564 | Ga0070664_100653764 | Ga0070664_1006537642 | 147 |
| 584 | 3300005577 | Ga0068857_100000411 | Ga0068857_1000004116 | 147 |
| 585 | 3300005577 | Ga0068857_100009678 | Ga0068857_1000096786 | 147 |
| 586 | 3300005577 | Ga0068857_100017406 | Ga0068857_1000174062 | 147 |
| 587 | 3300005577 | Ga0068857_102227422 | Ga0068857_1022274221 | 147 |
| 588 | 3300005578 | Ga0068854_100020791 | Ga0068854_1000207912 | 147 |
| 589 | 3300005578 | Ga0068854_100066312 | Ga0068854_1000663122 | 147 |
| 590 | 3300005578 | Ga0068854_100088598 | Ga0068854_1000885983 | 147 |
| 591 | 3300005578 | Ga0068854_100102336 | Ga0068854_1001023363 | 147 |
| 592 | 3300005614 | Ga0068856_100008169 | Ga0068856_1000081696 | 147 |
| 593 | 3300005614 | Ga0068856_100012953 | Ga0068856_1000129537 | 147 |
| 594 | 3300005614 | Ga0068856_100032852 | Ga0068856_1000328524 | 147 |
| 595 | 3300005614 | Ga0068856_100037367 | Ga0068856_1000373674 | 147 |
| 596 | 3300005614 | Ga0068856_100103267 | Ga0068856_1001032673 | 147 |
| 597 | 3300005614 | Ga0068856_100121927 | Ga0068856_1001219272 | 147 |
| 598 | 3300005614 | Ga0068856_100403058 | Ga0068856_1004030583 | 147 |
| 599 | 3300005614 | Ga0068856_100716981 | Ga0068856_1007169812 | 147 |
| 600 | 3300005615 | Ga0070702_100011129 | Ga0070702_1000111292 | 147 |
| 601 | 3300005615 | Ga0070702_100047580 | Ga0070702_1000475802 | 147 |
| 602 | 3300005615 | Ga0070702_100192593 | Ga0070702_1001925932 | 147 |
| 603 | 3300005616 | Ga0068852_100012058 | Ga0068852_1000120583 | 147 |
| 604 | 3300005616 | Ga0068852_100032637 | Ga0068852_1000326372 | 147 |
| 605 | 3300005616 | Ga0068852_100112836 | Ga0068852_1001128364 | 147 |
| 606 | 3300005616 | Ga0068852_100422951 | Ga0068852_1004229512 | 147 |
| 607 | 3300005617 | Ga0068859_100102667 | Ga0068859_1001026673 | 147 |
| 608 | 3300005617 | Ga0068859_100775216 | Ga0068859_1007752162 | 147 |
| 609 | 3300005618 | Ga0068864_100015763 | Ga0068864_1000157635 | 147 |
| 610 | 3300005618 | Ga0068864_100136078 | Ga0068864_1001360783 | 147 |
| 611 | 3300005618 | Ga0068864_101108302 | Ga0068864_1011083022 | 147 |
| 612 | 3300005718 | Ga0068866_10057313 | Ga0068866_100573132 | 147 |
| 613 | 3300005718 | Ga0068866_10785266 | Ga0068866_107852662 | 147 |
| 614 | 3300005840 | Ga0068870_10059842 | Ga0068870_100598422 | 147 |
| 615 | 3300005840 | Ga0068870_10402039 | Ga0068870_104020391 | 147 |
| 616 | 3300005841 | Ga0068863_100126026 | Ga0068863_1001260262 | 147 |
| 617 | 3300005841 | Ga0068863_100388966 | Ga0068863_1003889662 | 147 |
| 618 | 3300005841 | Ga0068863_100590054 | Ga0068863_1005900542 | 147 |
| 619 | 3300005841 | Ga0068863_100687900 | Ga0068863_1006879002 | 147 |
| 620 | 3300005841 | Ga0068863_101415259 | Ga0068863_1014152592 | 147 |
| 621 | 3300005842 | Ga0068858_100009146 | Ga0068858_1000091462 | 147 |
| 622 | 3300005842 | Ga0068858_100037092 | Ga0068858_1000370925 | 147 |
| 623 | 3300005842 | Ga0068858_100729284 | Ga0068858_1007292842 | 147 |
| 624 | 3300005843 | Ga0068860_100208777 | Ga0068860_1002087773 | 147 |
| 625 | 3300006028 | Ga0070717_10003192 | Ga0070717_100031923 | 147 |
| 626 | 3300006028 | Ga0070717_10003519 | Ga0070717_100035193 | 147 |
| 627 | 3300006028 | Ga0070717_10007708 | Ga0070717_100077083 | 147 |
| 628 | 3300006028 | Ga0070717_10109003 | Ga0070717_101090032 | 147 |
| 629 | 3300006028 | Ga0070717_10154244 | Ga0070717_101542442 | 147 |
| 630 | 3300006028 | Ga0070717_10176333 | Ga0070717_101763332 | 147 |
| 631 | 3300006028 | Ga0070717_10178463 | Ga0070717_101784632 | 147 |
| 632 | 3300006028 | Ga0070717_10246108 | Ga0070717_102461083 | 147 |
| 633 | 3300006028 | Ga0070717_10311075 | Ga0070717_103110752 | 147 |
| 634 | 3300006028 | Ga0070717_10439465 | Ga0070717_104394652 | 147 |
| 635 | 3300006028 | Ga0070717_10442247 | Ga0070717_104422471 | 147 |
| 636 | 3300006028 | Ga0070717_10452265 | Ga0070717_104522652 | 147 |
| 637 | 3300006028 | Ga0070717_10499744 | Ga0070717_104997442 | 147 |
| 638 | 3300006028 | Ga0070717_10762548 | Ga0070717_107625482 | 147 |
| 639 | 3300006028 | Ga0070717_11006649 | Ga0070717_110066492 | 147 |
| 640 | 3300006028 | Ga0070717_11062232 | Ga0070717_110622321 | 147 |
| 641 | 3300006028 | Ga0070717_11171334 | Ga0070717_111713342 | 147 |
| 642 | 3300006163 | Ga0070715_10134463 | Ga0070715_101344632 | 147 |
| 643 | 3300006173 | Ga0070716_100012539 | Ga0070716_1000125393 | 147 |
| 644 | 3300006173 | Ga0070716_100069089 | Ga0070716_1000690892 | 147 |
| 645 | 3300006173 | Ga0070716_100236640 | Ga0070716_1002366402 | 147 |
| 646 | 3300006173 | Ga0070716_100251525 | Ga0070716_1002515252 | 147 |
| 647 | 3300006175 | Ga0070712_100003532 | Ga0070712_1000035321 | 147 |
| 648 | 3300006175 | Ga0070712_100049048 | Ga0070712_1000490483 | 147 |
| 649 | 3300006175 | Ga0070712_100162949 | Ga0070712_1001629493 | 147 |
| 650 | 3300006175 | Ga0070712_100220913 | Ga0070712_1002209132 | 147 |
| 651 | 3300006175 | Ga0070712_100354583 | Ga0070712_1003545832 | 147 |
| 652 | 3300006175 | Ga0070712_101630862 | Ga0070712_1016308621 | 147 |
| 653 | 3300006237 | Ga0097621_100000105 | Ga0097621_10000010537 | 147 |
| 654 | 3300006237 | Ga0097621_100000310 | Ga0097621_10000031020 | 147 |
| 655 | 3300006237 | Ga0097621_100000987 | Ga0097621_1000009874 | 147 |
| 656 | 3300006237 | Ga0097621_100029240 | Ga0097621_1000292402 | 147 |
| 657 | 3300006237 | Ga0097621_100125003 | Ga0097621_1001250032 | 147 |
| 658 | 3300006237 | Ga0097621_100973584 | Ga0097621_1009735841 | 147 |
| 659 | 3300006358 | Ga0068871_100000837 | Ga0068871_10000083711 | 147 |
| 660 | 3300006358 | Ga0068871_100003783 | Ga0068871_1000037832 | 147 |
| 661 | 3300006358 | Ga0068871_100009686 | Ga0068871_1000096865 | 147 |
| 662 | 3300006358 | Ga0068871_100197519 | Ga0068871_1001975192 | 147 |
| 663 | 3300006358 | Ga0068871_100705305 | Ga0068871_1007053051 | 147 |
| 664 | 3300006844 | Ga0075428_100002434 | Ga0075428_10000243417 | 147 |
| 665 | 3300006844 | Ga0075428_100087764 | Ga0075428_1000877642 | 147 |
| 666 | 3300006844 | Ga0075428_100950193 | Ga0075428_1009501932 | 147 |
| 667 | 3300006847 | Ga0075431_100017617 | Ga0075431_1000176177 | 147 |
| 668 | 3300006852 | Ga0075433_10008295 | Ga0075433_1000829512 | 147 |
| 669 | 3300006852 | Ga0075433_10304686 | Ga0075433_103046862 | 147 |
| 670 | 3300006852 | Ga0075433_10786556 | Ga0075433_107865561 | 147 |
| 671 | 3300006852 | Ga0075433_10964406 | Ga0075433_109644061 | 147 |
| 672 | 3300006871 | Ga0075434_100016559 | Ga0075434_10001655910 | 147 |
| 673 | 3300006871 | Ga0075434_100018244 | Ga0075434_1000182443 | 147 |
| 674 | 3300006871 | Ga0075434_100090357 | Ga0075434_1000903576 | 147 |
| 675 | 3300006871 | Ga0075434_100100266 | Ga0075434_1001002662 | 147 |
| 676 | 3300006871 | Ga0075434_100128993 | Ga0075434_1001289932 | 147 |
| 677 | 3300006871 | Ga0075434_100390522 | Ga0075434_1003905222 | 147 |
| 678 | 3300006871 | Ga0075434_100629290 | Ga0075434_1006292902 | 147 |
| 679 | 3300006871 | Ga0075434_100782837 | Ga0075434_1007828372 | 147 |
| 680 | 3300006880 | Ga0075429_100336049 | Ga0075429_1003360492 | 147 |
| 681 | 3300006880 | Ga0075429_100685577 | Ga0075429_1006855772 | 147 |
| 682 | 3300006881 | Ga0068865_100079200 | Ga0068865_1000792002 | 147 |
| 683 | 3300006881 | Ga0068865_100197831 | Ga0068865_1001978312 | 147 |
| 684 | 3300006881 | Ga0068865_100850751 | Ga0068865_1008507512 | 147 |
| 685 | 3300006914 | Ga0075436_100009672 | Ga0075436_1000096728 | 147 |
| 686 | 3300006914 | Ga0075436_100012530 | Ga0075436_1000125305 | 147 |
| 687 | 3300006914 | Ga0075436_100271612 | Ga0075436_1002716122 | 147 |
| 688 | 3300006914 | Ga0075436_100301844 | Ga0075436_1003018441 | 147 |
| 689 | 3300006931 | Ga0097620_100102673 | Ga0097620_1001026733 | 147 |
| 690 | 3300006931 | Ga0097620_100775339 | Ga0097620_1007753392 | 147 |
| 691 | 3300007076 | Ga0075435_100000187 | Ga0075435_10000018729 | 147 |
| 692 | 3300007076 | Ga0075435_100012620 | Ga0075435_1000126203 | 147 |
| 693 | 3300007076 | Ga0075435_100025300 | Ga0075435_1000253004 | 147 |
| 694 | 3300007076 | Ga0075435_100051127 | Ga0075435_1000511272 | 147 |
| 695 | 3300007076 | Ga0075435_100147251 | Ga0075435_1001472511 | 147 |
| 696 | 3300007788 | Ga0099795_10069494 | Ga0099795_100694942 | 147 |
| 697 | 3300007788 | Ga0099795_10086882 | Ga0099795_100868822 | 147 |
| 698 | 3300009093 | Ga0105240_10013038 | Ga0105240_100130383 | 147 |
| 699 | 3300009093 | Ga0105240_10024899 | Ga0105240_100248996 | 147 |
| 700 | 3300009093 | Ga0105240_10044258 | Ga0105240_100442588 | 147 |
| 701 | 3300009093 | Ga0105240_10060071 | Ga0105240_100600713 | 147 |
| 702 | 3300009093 | Ga0105240_10061933 | Ga0105240_100619337 | 147 |
| 703 | 3300009093 | Ga0105240_10070273 | Ga0105240_100702733 | 147 |
| 704 | 3300009093 | Ga0105240_10096593 | Ga0105240_100965933 | 147 |
| 705 | 3300009093 | Ga0105240_10385121 | Ga0105240_103851213 | 147 |
| 706 | 3300009093 | Ga0105240_10413961 | Ga0105240_104139612 | 147 |
| 707 | 3300009093 | Ga0105240_10521960 | Ga0105240_105219602 | 147 |
| 708 | 3300009094 | Ga0111539_10000003 | Ga0111539_10000003390 | 147 |
| 709 | 3300009094 | Ga0111539_10361181 | Ga0111539_103611813 | 147 |
| 710 | 3300009098 | Ga0105245_10000010 | Ga0105245_10000010117 | 147 |
| 711 | 3300009098 | Ga0105245_10000376 | Ga0105245_1000037612 | 147 |
| 712 | 3300009098 | Ga0105245_10001899 | Ga0105245_100018995 | 147 |
| 713 | 3300009098 | Ga0105245_10727007 | Ga0105245_107270072 | 147 |
| 714 | 3300009147 | Ga0114129_10084367 | Ga0114129_100843674 | 147 |
| 715 | 3300009147 | Ga0114129_10114023 | Ga0114129_101140232 | 147 |
| 716 | 3300009147 | Ga0114129_10614802 | Ga0114129_106148022 | 147 |
| 717 | 3300009147 | Ga0114129_11940937 | Ga0114129_119409372 | 147 |
| 718 | 3300009174 | Ga0105241_10659924 | Ga0105241_106599241 | 147 |
| 719 | 3300009174 | Ga0105241_10899135 | Ga0105241_108991352 | 147 |
| 720 | 3300009176 | Ga0105242_10003591 | Ga0105242_100035918 | 147 |
| 721 | 3300009176 | Ga0105242_10085585 | Ga0105242_100855851 | 147 |
| 722 | 3300009176 | Ga0105242_10090010 | Ga0105242_100900103 | 147 |
| 723 | 3300009176 | Ga0105242_11209705 | Ga0105242_112097052 | 147 |
| 724 | 3300009177 | Ga0105248_10005773 | Ga0105248_100057734 | 147 |
| 725 | 3300009177 | Ga0105248_10083969 | Ga0105248_100839692 | 147 |
| 726 | 3300009177 | Ga0105248_10164874 | Ga0105248_101648742 | 147 |
| 727 | 3300009177 | Ga0105248_10203691 | Ga0105248_102036912 | 147 |
| 728 | 3300009177 | Ga0105248_10312224 | Ga0105248_103122242 | 147 |
| 729 | 3300009177 | Ga0105248_11732161 | Ga0105248_117321611 | 147 |
| 730 | 3300009545 | Ga0105237_10020063 | Ga0105237_100200633 | 147 |
| 731 | 3300009545 | Ga0105237_10253081 | Ga0105237_102530812 | 147 |
| 732 | 3300009545 | Ga0105237_11001398 | Ga0105237_110013982 | 147 |
| 733 | 3300009545 | Ga0105237_11385806 | Ga0105237_113858061 | 147 |
| 734 | 3300009551 | Ga0105238_10000002 | Ga0105238_10000002172 | 147 |
| 735 | 3300009551 | Ga0105238_10001073 | Ga0105238_100010734 | 147 |
| 736 | 3300009551 | Ga0105238_10022389 | Ga0105238_100223894 | 147 |
| 737 | 3300009551 | Ga0105238_10030613 | Ga0105238_100306133 | 147 |
| 738 | 3300009551 | Ga0105238_10265593 | Ga0105238_102655932 | 147 |
| 739 | 3300009551 | Ga0105238_10349329 | Ga0105238_103493292 | 147 |
| 740 | 3300009551 | Ga0105238_11085244 | Ga0105238_110852441 | 147 |
| 741 | 3300010375 | Ga0105239_10046171 | Ga0105239_100461712 | 147 |
| 742 | 3300010375 | Ga0105239_10047898 | Ga0105239_100478985 | 147 |
| 743 | 3300010375 | Ga0105239_10150288 | Ga0105239_101502883 | 147 |
| 744 | 3300010375 | Ga0105239_10675359 | Ga0105239_106753592 | 147 |
| 745 | 3300010375 | Ga0105239_11132276 | Ga0105239_111322762 | 147 |
| 746 | 3300011119 | Ga0105246_10125623 | Ga0105246_101256232 | 147 |
| 747 | 3300013100 | Ga0157373_10035076 | Ga0157373_100350763 | 147 |
| 748 | 3300013102 | Ga0157371_10013642 | Ga0157371_100136425 | 147 |
| 749 | 3300013102 | Ga0157371_10059203 | Ga0157371_100592032 | 147 |
| 750 | 3300013102 | Ga0157371_10151287 | Ga0157371_101512872 | 147 |
| 751 | 3300013102 | Ga0157371_10157590 | Ga0157371_101575902 | 147 |
| 752 | 3300013104 | Ga0157370_10047428 | Ga0157370_100474284 | 147 |
| 753 | 3300013104 | Ga0157370_10137920 | Ga0157370_101379203 | 147 |
| 754 | 3300013104 | Ga0157370_10142918 | Ga0157370_101429183 | 147 |
| 755 | 3300013104 | Ga0157370_10285221 | Ga0157370_102852212 | 147 |
| 756 | 3300013104 | Ga0157370_10349405 | Ga0157370_103494053 | 147 |
| 757 | 3300013105 | Ga0157369_10000226 | Ga0157369_1000022645 | 147 |
| 758 | 3300013105 | Ga0157369_10000589 | Ga0157369_1000058932 | 147 |
| 759 | 3300013105 | Ga0157369_10036635 | Ga0157369_100366353 | 147 |
| 760 | 3300013105 | Ga0157369_10050121 | Ga0157369_100501213 | 147 |
| 761 | 3300013105 | Ga0157369_10050515 | Ga0157369_100505153 | 147 |
| 762 | 3300013105 | Ga0157369_10051610 | Ga0157369_100516102 | 147 |
| 763 | 3300013105 | Ga0157369_10052618 | Ga0157369_100526183 | 147 |
| 764 | 3300013105 | Ga0157369_10065221 | Ga0157369_100652214 | 147 |
| 765 | 3300013105 | Ga0157369_10144184 | Ga0157369_101441842 | 147 |
| 766 | 3300013105 | Ga0157369_10336609 | Ga0157369_103366093 | 147 |
| 767 | 3300013105 | Ga0157369_10422859 | Ga0157369_104228592 | 147 |
| 768 | 3300013296 | Ga0157374_10000354 | Ga0157374_1000035435 | 147 |
| 769 | 3300013296 | Ga0157374_10000422 | Ga0157374_100004226 | 147 |
| 770 | 3300013296 | Ga0157374_10009945 | Ga0157374_100099458 | 147 |
| 771 | 3300013296 | Ga0157374_10019238 | Ga0157374_100192382 | 147 |
| 772 | 3300013296 | Ga0157374_10063273 | Ga0157374_100632733 | 147 |
| 773 | 3300013296 | Ga0157374_10065197 | Ga0157374_100651972 | 147 |
| 774 | 3300013296 | Ga0157374_11218271 | Ga0157374_112182711 | 147 |
| 775 | 3300013297 | Ga0157378_10000328 | Ga0157378_100003286 | 147 |
| 776 | 3300013297 | Ga0157378_10000383 | Ga0157378_1000038337 | 147 |
| 777 | 3300013297 | Ga0157378_10000545 | Ga0157378_1000054511 | 147 |
| 778 | 3300013297 | Ga0157378_10000678 | Ga0157378_1000067814 | 147 |
| 779 | 3300013297 | Ga0157378_10001262 | Ga0157378_1000126212 | 147 |
| 780 | 3300013297 | Ga0157378_10065860 | Ga0157378_100658602 | 147 |
| 781 | 3300013297 | Ga0157378_10943603 | Ga0157378_109436032 | 147 |
| 782 | 3300013297 | Ga0157378_11461715 | Ga0157378_114617152 | 147 |
| 783 | 3300013306 | Ga0163162_10028742 | Ga0163162_100287424 | 147 |
| 784 | 3300013306 | Ga0163162_10107826 | Ga0163162_101078264 | 147 |
| 785 | 3300013307 | Ga0157372_10000068 | Ga0157372_1000006874 | 147 |
| 786 | 3300013307 | Ga0157372_10000321 | Ga0157372_1000032113 | 147 |
| 787 | 3300013307 | Ga0157372_10000536 | Ga0157372_100005368 | 147 |
| 788 | 3300013307 | Ga0157372_10014991 | Ga0157372_100149913 | 147 |
| 789 | 3300013307 | Ga0157372_10016084 | Ga0157372_100160846 | 147 |
| 790 | 3300013307 | Ga0157372_10025353 | Ga0157372_100253532 | 147 |
| 791 | 3300013307 | Ga0157372_10105486 | Ga0157372_101054862 | 147 |
| 792 | 3300013307 | Ga0157372_10268494 | Ga0157372_102684943 | 147 |
| 793 | 3300013307 | Ga0157372_10860540 | Ga0157372_108605402 | 147 |
| 794 | 3300013307 | Ga0157372_11633122 | Ga0157372_116331221 | 147 |
| 795 | 3300013307 | Ga0157372_11818785 | Ga0157372_118187852 | 147 |
| 796 | 3300013307 | Ga0157372_11902674 | Ga0157372_119026742 | 147 |
| 797 | 3300013308 | Ga0157375_10000010 | Ga0157375_1000001074 | 147 |
| 798 | 3300013308 | Ga0157375_10000604 | Ga0157375_1000060426 | 147 |
| 799 | 3300013308 | Ga0157375_10108529 | Ga0157375_101085292 | 147 |
| 800 | 3300013308 | Ga0157375_10411848 | Ga0157375_104118482 | 147 |
| 801 | 3300013308 | Ga0157375_10953423 | Ga0157375_109534232 | 147 |
| 802 | 3300013308 | Ga0157375_11389103 | Ga0157375_113891032 | 147 |
| 803 | 3300014325 | Ga0163163_10198346 | Ga0163163_101983462 | 147 |
| 804 | 3300014325 | Ga0163163_12041774 | Ga0163163_120417741 | 147 |
| 805 | 3300014745 | Ga0157377_10000004 | Ga0157377_10000004251 | 147 |
| 806 | 3300014745 | Ga0157377_10325296 | Ga0157377_103252962 | 147 |
| 807 | 3300014968 | Ga0157379_10067740 | Ga0157379_100677402 | 147 |
| 808 | 3300014968 | Ga0157379_10586753 | Ga0157379_105867532 | 147 |
| 809 | 3300014968 | Ga0157379_11115941 | Ga0157379_111159412 | 147 |
| 810 | 3300014969 | Ga0157376_10000003 | Ga0157376_1000000329 | 147 |
| 811 | 3300014969 | Ga0157376_10008017 | Ga0157376_100080177 | 147 |
| 812 | 3300014969 | Ga0157376_10081920 | Ga0157376_100819203 | 147 |
| 813 | 3300014969 | Ga0157376_10953333 | Ga0157376_109533332 | 147 |
| 814 | 3300017792 | Ga0163161_10024299 | Ga0163161_100242992 | 147 |
| 815 | 3300019161 | Ga0184602_129751 | Ga0184602_1297511 | 147 |
| 816 | 3300019176 | Ga0184596_108408 | Ga0184596_1084081 | 147 |
| 817 | 3300019183 | Ga0184601_108260 | Ga0184601_1082602 | 147 |
| 818 | 3300019188 | Ga0184599_128580 | Ga0184599_1285802 | 147 |
| 819 | 3300019190 | Ga0184600_107366 | Ga0184600_1073662 | 147 |
| 820 | 3300019190 | Ga0184600_123562 | Ga0184600_1235622 | 147 |
| 821 | 3300020069 | Ga0197907_10539006 | Ga0197907_105390061 | 147 |
| 822 | 3300020069 | Ga0197907_10540100 | Ga0197907_105401002 | 147 |
| 823 | 3300020069 | Ga0197907_10717659 | Ga0197907_107176592 | 147 |
| 824 | 3300020069 | Ga0197907_10796502 | Ga0197907_107965022 | 147 |
| 825 | 3300020069 | Ga0197907_10869068 | Ga0197907_108690682 | 147 |
| 826 | 3300020070 | Ga0206356_10433137 | Ga0206356_104331372 | 147 |
| 827 | 3300020070 | Ga0206356_11397745 | Ga0206356_113977452 | 147 |
| 828 | 3300020075 | Ga0206349_1634275 | Ga0206349_16342752 | 147 |
| 829 | 3300020075 | Ga0206349_1888706 | Ga0206349_18887062 | 147 |
| 830 | 3300020076 | Ga0206355_1435135 | Ga0206355_14351353 | 147 |
| 831 | 3300020077 | Ga0206351_10303434 | Ga0206351_103034342 | 147 |
| 832 | 3300020077 | Ga0206351_10402462 | Ga0206351_104024622 | 147 |
| 833 | 3300020077 | Ga0206351_10782694 | Ga0206351_107826942 | 147 |
| 834 | 3300020077 | Ga0206351_10911997 | Ga0206351_109119972 | 147 |
| 835 | 3300020078 | Ga0206352_10548939 | Ga0206352_105489392 | 147 |
| 836 | 3300020078 | Ga0206352_10742236 | Ga0206352_107422361 | 147 |
| 837 | 3300020078 | Ga0206352_10814601 | Ga0206352_108146012 | 147 |
| 838 | 3300020078 | Ga0206352_10853031 | Ga0206352_108530311 | 147 |
| 839 | 3300020080 | Ga0206350_10417453 | Ga0206350_104174531 | 147 |
| 840 | 3300020080 | Ga0206350_10694412 | Ga0206350_106944122 | 147 |
| 841 | 3300020080 | Ga0206350_10704807 | Ga0206350_107048071 | 147 |
| 842 | 3300020080 | Ga0206350_10783616 | Ga0206350_107836161 | 147 |
| 843 | 3300020080 | Ga0206350_11500735 | Ga0206350_115007352 | 147 |
| 844 | 3300020081 | Ga0206354_11268864 | Ga0206354_112688642 | 147 |
| 845 | 3300020082 | Ga0206353_10839656 | Ga0206353_108396562 | 147 |
| 846 | 3300020082 | Ga0206353_11764120 | Ga0206353_117641201 | 147 |
| 847 | 3300020610 | Ga0154015_1009766 | Ga0154015_10097662 | 147 |
| 848 | 3300021358 | Ga0213873_10000001 | Ga0213873_10000001331 | 147 |
| 849 | 3300021358 | Ga0213873_10000358 | Ga0213873_100003582 | 147 |
| 850 | 3300021377 | Ga0213874_10197723 | Ga0213874_101977231 | 147 |
| 851 | 3300021384 | Ga0213876_10000015 | Ga0213876_10000015139 | 147 |
| 852 | 3300021384 | Ga0213876_10000203 | Ga0213876_1000020342 | 147 |
| 853 | 3300021384 | Ga0213876_10015149 | Ga0213876_100151493 | 147 |
| 854 | 3300022467 | Ga0224712_10025251 | Ga0224712_100252512 | 147 |
| 855 | 3300022467 | Ga0224712_10069648 | Ga0224712_100696482 | 147 |
| 856 | 3300022467 | Ga0224712_10081856 | Ga0224712_100818562 | 147 |
| 857 | 3300022467 | Ga0224712_10166174 | Ga0224712_101661741 | 147 |
| 858 | 3300022467 | Ga0224712_10621586 | Ga0224712_106215861 | 147 |
| 859 | 3300023539 | Ga0247555_100578 | Ga0247555_1005782 | 147 |
| 860 | 3300023672 | Ga0247553_100294 | Ga0247553_1002942 | 147 |
| 861 | 3300024225 | Ga0224572_1042095 | Ga0224572_10420952 | 147 |
| 862 | 3300024227 | Ga0228598_1001498 | Ga0228598_10014982 | 147 |
| 863 | 3300024227 | Ga0228598_1026759 | Ga0228598_10267592 | 147 |
| 864 | 3300025898 | Ga0207692_10031523 | Ga0207692_100315234 | 147 |
| 865 | 3300025898 | Ga0207692_10143764 | Ga0207692_101437642 | 147 |
| 866 | 3300025898 | Ga0207692_10794131 | Ga0207692_107941311 | 147 |
| 867 | 3300025899 | Ga0207642_10131415 | Ga0207642_101314152 | 147 |
| 868 | 3300025899 | Ga0207642_10500581 | Ga0207642_105005812 | 147 |
| 869 | 3300025901 | Ga0207688_10084127 | Ga0207688_100841272 | 147 |
| 870 | 3300025903 | Ga0207680_10087293 | Ga0207680_100872933 | 147 |
| 871 | 3300025905 | Ga0207685_10028724 | Ga0207685_100287243 | 147 |
| 872 | 3300025905 | Ga0207685_10032655 | Ga0207685_100326553 | 147 |
| 873 | 3300025905 | Ga0207685_10035964 | Ga0207685_100359643 | 147 |
| 874 | 3300025906 | Ga0207699_10009273 | Ga0207699_100092732 | 147 |
| 875 | 3300025906 | Ga0207699_10786717 | Ga0207699_107867172 | 147 |
| 876 | 3300025907 | Ga0207645_10021974 | Ga0207645_100219744 | 147 |
| 877 | 3300025907 | Ga0207645_10157090 | Ga0207645_101570902 | 147 |
| 878 | 3300025907 | Ga0207645_10527792 | Ga0207645_105277922 | 147 |
| 879 | 3300025908 | Ga0207643_10220968 | Ga0207643_102209682 | 147 |
| 880 | 3300025909 | Ga0207705_10013917 | Ga0207705_100139174 | 147 |
| 881 | 3300025909 | Ga0207705_10079084 | Ga0207705_100790842 | 147 |
| 882 | 3300025909 | Ga0207705_10191530 | Ga0207705_101915301 | 147 |
| 883 | 3300025910 | Ga0207684_10002137 | Ga0207684_100021379 | 147 |
| 884 | 3300025910 | Ga0207684_10019277 | Ga0207684_100192775 | 147 |
| 885 | 3300025910 | Ga0207684_10027313 | Ga0207684_100273135 | 147 |
| 886 | 3300025910 | Ga0207684_10039142 | Ga0207684_100391425 | 147 |
| 887 | 3300025910 | Ga0207684_10177588 | Ga0207684_101775882 | 147 |
| 888 | 3300025910 | Ga0207684_10353952 | Ga0207684_103539522 | 147 |
| 889 | 3300025911 | Ga0207654_10384908 | Ga0207654_103849082 | 147 |
| 890 | 3300025912 | Ga0207707_10009163 | Ga0207707_100091634 | 147 |
| 891 | 3300025912 | Ga0207707_10010547 | Ga0207707_100105474 | 147 |
| 892 | 3300025912 | Ga0207707_10222196 | Ga0207707_102221961 | 147 |
| 893 | 3300025912 | Ga0207707_10563947 | Ga0207707_105639472 | 147 |
| 894 | 3300025912 | Ga0207707_11157218 | Ga0207707_111572181 | 147 |
| 895 | 3300025913 | Ga0207695_10001894 | Ga0207695_1000189413 | 147 |
| 896 | 3300025913 | Ga0207695_10004033 | Ga0207695_100040332 | 147 |
| 897 | 3300025913 | Ga0207695_10054696 | Ga0207695_100546963 | 147 |
| 898 | 3300025913 | Ga0207695_10056717 | Ga0207695_100567173 | 147 |
| 899 | 3300025913 | Ga0207695_10082572 | Ga0207695_100825724 | 147 |
| 900 | 3300025913 | Ga0207695_10202755 | Ga0207695_102027551 | 147 |
| 901 | 3300025913 | Ga0207695_10263281 | Ga0207695_102632813 | 147 |
| 902 | 3300025913 | Ga0207695_10487441 | Ga0207695_104874412 | 147 |
| 903 | 3300025913 | Ga0207695_10513928 | Ga0207695_105139282 | 147 |
| 904 | 3300025914 | Ga0207671_10224068 | Ga0207671_102240682 | 147 |
| 905 | 3300025914 | Ga0207671_10397732 | Ga0207671_103977322 | 147 |
| 906 | 3300025915 | Ga0207693_10011730 | Ga0207693_100117302 | 147 |
| 907 | 3300025915 | Ga0207693_10048525 | Ga0207693_100485253 | 147 |
| 908 | 3300025915 | Ga0207693_10056621 | Ga0207693_100566212 | 147 |
| 909 | 3300025915 | Ga0207693_10241705 | Ga0207693_102417053 | 147 |
| 910 | 3300025915 | Ga0207693_10413674 | Ga0207693_104136742 | 147 |
| 911 | 3300025915 | Ga0207693_10761552 | Ga0207693_107615521 | 147 |
| 912 | 3300025916 | Ga0207663_10028448 | Ga0207663_100284483 | 147 |
| 913 | 3300025916 | Ga0207663_10075435 | Ga0207663_100754353 | 147 |
| 914 | 3300025916 | Ga0207663_10102907 | Ga0207663_101029071 | 147 |
| 915 | 3300025916 | Ga0207663_10127400 | Ga0207663_101274002 | 147 |
| 916 | 3300025916 | Ga0207663_10246497 | Ga0207663_102464971 | 147 |
| 917 | 3300025917 | Ga0207660_10018783 | Ga0207660_100187833 | 147 |
| 918 | 3300025917 | Ga0207660_10164831 | Ga0207660_101648312 | 147 |
| 919 | 3300025917 | Ga0207660_10252536 | Ga0207660_102525362 | 147 |
| 920 | 3300025917 | Ga0207660_10804381 | Ga0207660_108043811 | 147 |
| 921 | 3300025917 | Ga0207660_10995453 | Ga0207660_109954532 | 147 |
| 922 | 3300025918 | Ga0207662_10012231 | Ga0207662_100122311 | 147 |
| 923 | 3300025918 | Ga0207662_10080969 | Ga0207662_100809692 | 147 |
| 924 | 3300025919 | Ga0207657_10004942 | Ga0207657_100049422 | 147 |
| 925 | 3300025919 | Ga0207657_10233686 | Ga0207657_102336862 | 147 |
| 926 | 3300025920 | Ga0207649_11122139 | Ga0207649_111221391 | 147 |
| 927 | 3300025921 | Ga0207652_10007259 | Ga0207652_100072592 | 147 |
| 928 | 3300025921 | Ga0207652_10030873 | Ga0207652_100308734 | 147 |
| 929 | 3300025921 | Ga0207652_10041598 | Ga0207652_100415984 | 147 |
| 930 | 3300025921 | Ga0207652_10520628 | Ga0207652_105206282 | 147 |
| 931 | 3300025921 | Ga0207652_11043225 | Ga0207652_110432252 | 147 |
| 932 | 3300025922 | Ga0207646_10004008 | Ga0207646_1000400810 | 147 |
| 933 | 3300025922 | Ga0207646_10004874 | Ga0207646_100048745 | 147 |
| 934 | 3300025922 | Ga0207646_10102318 | Ga0207646_101023182 | 147 |
| 935 | 3300025922 | Ga0207646_10156938 | Ga0207646_101569385 | 147 |
| 936 | 3300025922 | Ga0207646_10235893 | Ga0207646_102358932 | 147 |
| 937 | 3300025922 | Ga0207646_10276655 | Ga0207646_102766552 | 147 |
| 938 | 3300025922 | Ga0207646_10289890 | Ga0207646_102898902 | 147 |
| 939 | 3300025922 | Ga0207646_10302817 | Ga0207646_103028172 | 147 |
| 940 | 3300025922 | Ga0207646_10312355 | Ga0207646_103123552 | 147 |
| 941 | 3300025922 | Ga0207646_10324743 | Ga0207646_103247432 | 147 |
| 942 | 3300025922 | Ga0207646_11336553 | Ga0207646_113365531 | 147 |
| 943 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001173 | 147 |
| 944 | 3300025924 | Ga0207694_10010846 | Ga0207694_100108463 | 147 |
| 945 | 3300025924 | Ga0207694_10025697 | Ga0207694_100256973 | 147 |
| 946 | 3300025924 | Ga0207694_10042291 | Ga0207694_100422912 | 147 |
| 947 | 3300025924 | Ga0207694_10218421 | Ga0207694_102184212 | 147 |
| 948 | 3300025924 | Ga0207694_10506208 | Ga0207694_105062082 | 147 |
| 949 | 3300025924 | Ga0207694_10527582 | Ga0207694_105275821 | 147 |
| 950 | 3300025925 | Ga0207650_10000453 | Ga0207650_100004538 | 147 |
| 951 | 3300025925 | Ga0207650_10001518 | Ga0207650_1000151810 | 147 |
| 952 | 3300025925 | Ga0207650_10038864 | Ga0207650_100388644 | 147 |
| 953 | 3300025925 | Ga0207650_10052864 | Ga0207650_100528642 | 147 |
| 954 | 3300025926 | Ga0207659_10000006 | Ga0207659_10000006260 | 147 |
| 955 | 3300025927 | Ga0207687_10000005 | Ga0207687_10000005554 | 147 |
| 956 | 3300025927 | Ga0207687_10000266 | Ga0207687_100002666 | 147 |
| 957 | 3300025927 | Ga0207687_10050541 | Ga0207687_100505412 | 147 |
| 958 | 3300025927 | Ga0207687_10232101 | Ga0207687_102321011 | 147 |
| 959 | 3300025928 | Ga0207700_10021316 | Ga0207700_100213166 | 147 |
| 960 | 3300025928 | Ga0207700_10027264 | Ga0207700_100272644 | 147 |
| 961 | 3300025928 | Ga0207700_10027562 | Ga0207700_100275622 | 147 |
| 962 | 3300025928 | Ga0207700_10079893 | Ga0207700_100798932 | 147 |
| 963 | 3300025928 | Ga0207700_10377751 | Ga0207700_103777511 | 147 |
| 964 | 3300025928 | Ga0207700_10718342 | Ga0207700_107183422 | 147 |
| 965 | 3300025928 | Ga0207700_10881985 | Ga0207700_108819852 | 147 |
| 966 | 3300025929 | Ga0207664_10023253 | Ga0207664_100232535 | 147 |
| 967 | 3300025929 | Ga0207664_10164663 | Ga0207664_101646632 | 147 |
| 968 | 3300025929 | Ga0207664_10180610 | Ga0207664_101806102 | 147 |
| 969 | 3300025929 | Ga0207664_10229970 | Ga0207664_102299702 | 147 |
| 970 | 3300025929 | Ga0207664_10233341 | Ga0207664_102333412 | 147 |
| 971 | 3300025929 | Ga0207664_10334653 | Ga0207664_103346532 | 147 |
| 972 | 3300025931 | Ga0207644_10285796 | Ga0207644_102857963 | 147 |
| 973 | 3300025931 | Ga0207644_10896507 | Ga0207644_108965071 | 147 |
| 974 | 3300025933 | Ga0207706_10352804 | Ga0207706_103528042 | 147 |
| 975 | 3300025934 | Ga0207686_10003600 | Ga0207686_100036008 | 147 |
| 976 | 3300025934 | Ga0207686_10070463 | Ga0207686_100704632 | 147 |
| 977 | 3300025934 | Ga0207686_10093474 | Ga0207686_100934742 | 147 |
| 978 | 3300025935 | Ga0207709_10101715 | Ga0207709_101017152 | 147 |
| 979 | 3300025936 | Ga0207670_10066653 | Ga0207670_100666533 | 147 |
| 980 | 3300025936 | Ga0207670_10235209 | Ga0207670_102352092 | 147 |
| 981 | 3300025936 | Ga0207670_10364784 | Ga0207670_103647842 | 147 |
| 982 | 3300025936 | Ga0207670_10386608 | Ga0207670_103866082 | 147 |
| 983 | 3300025938 | Ga0207704_10446628 | Ga0207704_104466282 | 147 |
| 984 | 3300025938 | Ga0207704_10460936 | Ga0207704_104609362 | 147 |
| 985 | 3300025939 | Ga0207665_10002075 | Ga0207665_100020756 | 147 |
| 986 | 3300025939 | Ga0207665_10073967 | Ga0207665_100739673 | 147 |
| 987 | 3300025939 | Ga0207665_10081528 | Ga0207665_100815281 | 147 |
| 988 | 3300025939 | Ga0207665_10105979 | Ga0207665_101059792 | 147 |
| 989 | 3300025939 | Ga0207665_10132174 | Ga0207665_101321742 | 147 |
| 990 | 3300025939 | Ga0207665_10140563 | Ga0207665_101405632 | 147 |
| 991 | 3300025939 | Ga0207665_10150408 | Ga0207665_101504081 | 147 |
| 992 | 3300025939 | Ga0207665_10225328 | Ga0207665_102253282 | 147 |
| 993 | 3300025939 | Ga0207665_10849123 | Ga0207665_108491232 | 147 |
| 994 | 3300025939 | Ga0207665_10949755 | Ga0207665_109497551 | 147 |
| 995 | 3300025940 | Ga0207691_10982452 | Ga0207691_109824522 | 147 |
| 996 | 3300025941 | Ga0207711_10119056 | Ga0207711_101190563 | 147 |
| 997 | 3300025941 | Ga0207711_10132375 | Ga0207711_101323753 | 147 |
| 998 | 3300025941 | Ga0207711_10237181 | Ga0207711_102371812 | 147 |
| 999 | 3300025941 | Ga0207711_10602066 | Ga0207711_106020662 | 147 |
| 1000 | 3300025942 | Ga0207689_10006874 | Ga0207689_100068747 | 147 |
| 1001 | 3300025942 | Ga0207689_10018488 | Ga0207689_100184885 | 147 |
| 1002 | 3300025942 | Ga0207689_10330797 | Ga0207689_103307972 | 147 |
| 1003 | 3300025942 | Ga0207689_10574034 | Ga0207689_105740342 | 147 |
| 1004 | 3300025944 | Ga0207661_10000015 | Ga0207661_1000001551 | 147 |
| 1005 | 3300025944 | Ga0207661_10021016 | Ga0207661_100210164 | 147 |
| 1006 | 3300025944 | Ga0207661_10043662 | Ga0207661_100436624 | 147 |
| 1007 | 3300025944 | Ga0207661_10077751 | Ga0207661_100777512 | 147 |
| 1008 | 3300025944 | Ga0207661_10779229 | Ga0207661_107792291 | 147 |
| 1009 | 3300025944 | Ga0207661_10957476 | Ga0207661_109574762 | 147 |
| 1010 | 3300025944 | Ga0207661_12019695 | Ga0207661_120196951 | 147 |
| 1011 | 3300025945 | Ga0207679_10029894 | Ga0207679_100298943 | 147 |
| 1012 | 3300025945 | Ga0207679_10067574 | Ga0207679_100675742 | 147 |
| 1013 | 3300025945 | Ga0207679_10226355 | Ga0207679_102263552 | 147 |
| 1014 | 3300025945 | Ga0207679_10918620 | Ga0207679_109186201 | 147 |
| 1015 | 3300025949 | Ga0207667_10000544 | Ga0207667_1000054419 | 147 |
| 1016 | 3300025949 | Ga0207667_10004693 | Ga0207667_1000469311 | 147 |
| 1017 | 3300025949 | Ga0207667_10004714 | Ga0207667_1000471411 | 147 |
| 1018 | 3300025949 | Ga0207667_10023906 | Ga0207667_100239063 | 147 |
| 1019 | 3300025949 | Ga0207667_10134958 | Ga0207667_101349583 | 147 |
| 1020 | 3300025949 | Ga0207667_10990293 | Ga0207667_109902931 | 147 |
| 1021 | 3300025960 | Ga0207651_11156184 | Ga0207651_111561842 | 147 |
| 1022 | 3300025981 | Ga0207640_10067872 | Ga0207640_100678724 | 147 |
| 1023 | 3300025981 | Ga0207640_10083398 | Ga0207640_100833983 | 147 |
| 1024 | 3300025981 | Ga0207640_10116473 | Ga0207640_101164732 | 147 |
| 1025 | 3300026023 | Ga0207677_10000003 | Ga0207677_10000003281 | 147 |
| 1026 | 3300026023 | Ga0207677_10000048 | Ga0207677_100000487 | 147 |
| 1027 | 3300026023 | Ga0207677_10022339 | Ga0207677_100223392 | 147 |
| 1028 | 3300026023 | Ga0207677_10096482 | Ga0207677_100964822 | 147 |
| 1029 | 3300026023 | Ga0207677_10362870 | Ga0207677_103628702 | 147 |
| 1030 | 3300026035 | Ga0207703_10079566 | Ga0207703_100795663 | 147 |
| 1031 | 3300026035 | Ga0207703_10704102 | Ga0207703_107041022 | 147 |
| 1032 | 3300026035 | Ga0207703_10872020 | Ga0207703_108720202 | 147 |
| 1033 | 3300026041 | Ga0207639_10000048 | Ga0207639_1000004891 | 147 |
| 1034 | 3300026041 | Ga0207639_10034616 | Ga0207639_100346163 | 147 |
| 1035 | 3300026041 | Ga0207639_10653303 | Ga0207639_106533032 | 147 |
| 1036 | 3300026075 | Ga0207708_10000003 | Ga0207708_1000000374 | 147 |
| 1037 | 3300026078 | Ga0207702_10009517 | Ga0207702_100095176 | 147 |
| 1038 | 3300026078 | Ga0207702_10020916 | Ga0207702_100209162 | 147 |
| 1039 | 3300026078 | Ga0207702_10037516 | Ga0207702_100375163 | 147 |
| 1040 | 3300026078 | Ga0207702_10050507 | Ga0207702_100505074 | 147 |
| 1041 | 3300026078 | Ga0207702_10154004 | Ga0207702_101540043 | 147 |
| 1042 | 3300026078 | Ga0207702_10359150 | Ga0207702_103591501 | 147 |
| 1043 | 3300026078 | Ga0207702_10361563 | Ga0207702_103615631 | 147 |
| 1044 | 3300026078 | Ga0207702_11074128 | Ga0207702_110741281 | 147 |
| 1045 | 3300026088 | Ga0207641_10250043 | Ga0207641_102500432 | 147 |
| 1046 | 3300026088 | Ga0207641_10532967 | Ga0207641_105329672 | 147 |
| 1047 | 3300026088 | Ga0207641_11336605 | Ga0207641_113366052 | 147 |
| 1048 | 3300026088 | Ga0207641_11429058 | Ga0207641_114290581 | 147 |
| 1049 | 3300026089 | Ga0207648_10050715 | Ga0207648_100507152 | 147 |
| 1050 | 3300026089 | Ga0207648_10143437 | Ga0207648_101434372 | 147 |
| 1051 | 3300026089 | Ga0207648_10624225 | Ga0207648_106242252 | 147 |
| 1052 | 3300026089 | Ga0207648_11650553 | Ga0207648_116505532 | 147 |
| 1053 | 3300026089 | Ga0207648_11799043 | Ga0207648_117990431 | 147 |
| 1054 | 3300026095 | Ga0207676_10029988 | Ga0207676_100299882 | 147 |
| 1055 | 3300026095 | Ga0207676_10079087 | Ga0207676_100790873 | 147 |
| 1056 | 3300026095 | Ga0207676_10926724 | Ga0207676_109267242 | 147 |
| 1057 | 3300026095 | Ga0207676_11076245 | Ga0207676_110762452 | 147 |
| 1058 | 3300026116 | Ga0207674_10018430 | Ga0207674_1001843010 | 147 |
| 1059 | 3300026116 | Ga0207674_10030121 | Ga0207674_100301213 | 147 |
| 1060 | 3300026116 | Ga0207674_10061585 | Ga0207674_100615853 | 147 |
| 1061 | 3300026116 | Ga0207674_10792649 | Ga0207674_107926492 | 147 |
| 1062 | 3300026118 | Ga0207675_100119172 | Ga0207675_1001191723 | 147 |
| 1063 | 3300026121 | Ga0207683_10052189 | Ga0207683_100521895 | 147 |
| 1064 | 3300026121 | Ga0207683_10802781 | Ga0207683_108027812 | 147 |
| 1065 | 3300026142 | Ga0207698_10012820 | Ga0207698_100128203 | 147 |
| 1066 | 3300026142 | Ga0207698_10121277 | Ga0207698_101212771 | 147 |
| 1067 | 3300026142 | Ga0207698_10490831 | Ga0207698_104908312 | 147 |
| 1068 | 3300027907 | Ga0207428_10000001 | Ga0207428_10000001539 | 147 |
| 1069 | 3300028017 | Ga0265356_1000382 | Ga0265356_10003826 | 147 |
| 1070 | 3300028379 | Ga0268266_10011258 | Ga0268266_100112587 | 147 |
| 1071 | 3300028381 | Ga0268264_10177468 | Ga0268264_101774682 | 147 |
| 1072 | 3300028381 | Ga0268264_10270964 | Ga0268264_102709642 | 147 |
| 1073 | 3300028563 | Ga0265319_1045307 | Ga0265319_10453072 | 147 |
| 1074 | 3300028654 | Ga0265322_10000052 | Ga0265322_1000005249 | 147 |
| 1075 | 3300028800 | Ga0265338_10022692 | Ga0265338_100226922 | 147 |
| 1076 | 3300028800 | Ga0265338_10070036 | Ga0265338_100700363 | 147 |
| 1077 | 3300028800 | Ga0265338_10121979 | Ga0265338_101219792 | 147 |
| 1078 | 3300028800 | Ga0265338_10350355 | Ga0265338_103503551 | 147 |
| 1079 | 3300030760 | Ga0265762_1009357 | Ga0265762_10093572 | 147 |
| 1080 | 3300030836 | Ga0265767_102183 | Ga0265767_1021831 | 147 |
| 1081 | 3300030863 | Ga0265766_1000450 | Ga0265766_10004502 | 147 |
| 1082 | 3300030877 | Ga0265777_102316 | Ga0265777_1023162 | 147 |
| 1083 | 3300030878 | Ga0265770_1041509 | Ga0265770_10415092 | 147 |
| 1084 | 3300030879 | Ga0265765_1008197 | Ga0265765_10081972 | 147 |
| 1085 | 3300030879 | Ga0265765_1056890 | Ga0265765_10568902 | 147 |
| 1086 | 3300031018 | Ga0265773_1003081 | Ga0265773_10030812 | 147 |
| 1087 | 3300031043 | Ga0265779_106989 | Ga0265779_1069891 | 147 |
| 1088 | 3300031090 | Ga0265760_10053779 | Ga0265760_100537792 | 147 |
| 1089 | 3300031090 | Ga0265760_10152571 | Ga0265760_101525712 | 147 |
| 1090 | 3300031090 | Ga0265760_10170304 | Ga0265760_101703042 | 147 |
| 1091 | 3300031235 | Ga0265330_10000781 | Ga0265330_1000078111 | 147 |
| 1092 | 3300031235 | Ga0265330_10433842 | Ga0265330_104338421 | 147 |
| 1093 | 3300031241 | Ga0265325_10001352 | Ga0265325_100013527 | 147 |
| 1094 | 3300031241 | Ga0265325_10006355 | Ga0265325_100063557 | 147 |
| 1095 | 3300031247 | Ga0265340_10053709 | Ga0265340_100537092 | 147 |
| 1096 | 3300031247 | Ga0265340_10075885 | Ga0265340_100758852 | 147 |
| 1097 | 3300031247 | Ga0265340_10142687 | Ga0265340_101426872 | 147 |
| 1098 | 3300031249 | Ga0265339_10000581 | Ga0265339_1000058119 | 147 |
| 1099 | 3300031249 | Ga0265339_10046055 | Ga0265339_100460552 | 147 |
| 1100 | 3300031249 | Ga0265339_10154003 | Ga0265339_101540032 | 147 |
| 1101 | 3300031249 | Ga0265339_10182866 | Ga0265339_101828662 | 147 |
| 1102 | 3300031250 | Ga0265331_10022616 | Ga0265331_100226162 | 147 |
| 1103 | 3300031344 | Ga0265316_10031546 | Ga0265316_100315462 | 147 |
| 1104 | 3300031344 | Ga0265316_10085635 | Ga0265316_100856351 | 147 |
| 1105 | 3300031344 | Ga0265316_10166914 | Ga0265316_101669142 | 147 |
| 1106 | 3300031548 | Ga0307408_100119927 | Ga0307408_1001199272 | 147 |
| 1107 | 3300031548 | Ga0307408_100762074 | Ga0307408_1007620742 | 147 |
| 1108 | 3300031595 | Ga0265313_10016516 | Ga0265313_100165162 | 147 |
| 1109 | 3300031595 | Ga0265313_10063426 | Ga0265313_100634262 | 147 |
| 1110 | 3300031711 | Ga0265314_10230674 | Ga0265314_102306742 | 147 |
| 1111 | 3300031712 | Ga0265342_10019690 | Ga0265342_100196906 | 147 |
| 1112 | 3300031712 | Ga0265342_10041034 | Ga0265342_100410343 | 147 |
| 1113 | 3300031712 | Ga0265342_10203217 | Ga0265342_102032172 | 147 |
| 1114 | 3300031712 | Ga0265342_10410353 | Ga0265342_104103532 | 147 |
| 1115 | 3300031728 | Ga0316578_10590527 | Ga0316578_105905272 | 147 |
| 1116 | 3300031733 | Ga0316577_10743115 | Ga0316577_107431151 | 147 |
| 1117 | 3300031901 | Ga0307406_10763701 | Ga0307406_107637012 | 147 |
| 1118 | 3300032002 | Ga0307416_100160167 | Ga0307416_1001601672 | 147 |
| 1119 | 3300032002 | Ga0307416_100734687 | Ga0307416_1007346871 | 147 |
| 1120 | 3300032002 | Ga0307416_100816860 | Ga0307416_1008168602 | 147 |
| 1121 | 3300032120 | Ga0316053_100535 | Ga0316053_1005352 | 147 |
| 1122 | 3300032120 | Ga0316053_100897 | Ga0316053_1008972 | 147 |
| 1123 | 3300032133 | Ga0316583_10126559 | Ga0316583_101265592 | 147 |
| 1124 | 3300033545 | Ga0316214_1042550 | Ga0316214_10425502 | 147 |
| 1125 | 3300035083 | Ga0373926_0008040 | Ga0373926_0008040_2295_2750 | 147 |
| 1126 | 3300035083 | Ga0373926_0038855 | Ga0373926_0038855_159_611 | 147 |
| 1127 | 3300035089 | Ga0373944_0078045 | Ga0373944_0078045_219_674 | 147 |
| 1128 | 3300035111 | Ga0373923_0106353 | Ga0373923_0106353_674_1126 | 147 |
| 1129 | 3300035112 | Ga0373932_0015857 | Ga0373932_0015857_342_791 | 147 |
| 1130 | 3300035113 | Ga0373936_0001853 | Ga0373936_0001853_1905_2357 | 147 |
| 1131 | 3300035113 | Ga0373936_0045310 | Ga0373936_0045310_779_1234 | 147 |
| 1132 | 3300035113 | Ga0373936_0127143 | Ga0373936_0127143_98_550 | 147 |
| 1133 | 3300035115 | Ga0373941_0040822 | Ga0373941_0040822_923_1372 | 147 |
| 1134 | 3300035116 | Ga0373945_0001941 | Ga0373945_0001941_5647_6102 | 147 |
| 1135 | 3300035118 | Ga0373954_0113716 | Ga0373954_0113716_548_1000 | 147 |
| 1136 | 3300035120 | Ga0373957_0538051 | Ga0373957_0538051_27_479 | 147 |
| 1137 | 3300035170 | Ga0373943_0006453 | Ga0373943_0006453_1846_2301 | 147 |
| 1138 | 3300035170 | Ga0373943_0007607 | Ga0373943_0007607_3202_3654 | 147 |
| 1139 | 3300035170 | Ga0373943_0023234 | Ga0373943_0023234_227_679 | 147 |
| 1140 | 3300035170 | Ga0373943_0034837 | Ga0373943_0034837_1108_1557 | 147 |
| 1141 | 3300035170 | Ga0373943_0058763 | Ga0373943_0058763_1101_1550 | 147 |
| 1142 | 3300035171 | Ga0373946_0065260 | Ga0373946_0065260_14_469 | 147 |
| 1143 | 3300035171 | Ga0373946_0195655 | Ga0373946_0195655_117_569 | 147 |
| 1144 | 3300035171 | Ga0373946_0205609 | Ga0373946_0205609_246_698 | 147 |
| 1145 | 3300035172 | Ga0373955_0074221 | Ga0373955_0074221_146_598 | 147 |
| 1146 | 3300035172 | Ga0373955_0220524 | Ga0373955_0220524_68_514 | 147 |
| 1147 | 3300035172 | Ga0373955_0491704 | Ga0373955_0491704_268_717 | 147 |
| 1148 | 3300035410 | Ga0373924_0000274 | Ga0373924_0000274_4328_4783 | 147 |
| 1149 | 3300035410 | Ga0373924_0207276 | Ga0373924_0207276_402_854 | 147 |
| 1150 | 3300035691 | Ga0373931_0278980 | Ga0373931_0278980_366_812 | 147 |
| 1151 | 3300035692 | Ga0373935_0010120 | Ga0373935_0010120_3010_3462 | 147 |
| 1152 | 3300035692 | Ga0373935_0024337 | Ga0373935_0024337_471_920 | 147 |
| 1153 | 3300035692 | Ga0373935_0210668 | Ga0373935_0210668_770_1225 | 147 |
| 1154 | 3300035692 | Ga0373935_0554407 | Ga0373935_0554407_150_608 | 147 |
| 1155 | 3300035695 | Ga0373927_0006641 | Ga0373927_0006641_374_826 | 147 |
| 1156 | 3300035695 | Ga0373927_0274241 | Ga0373927_0274241_309_761 | 147 |
| 1157 | 3300035695 | Ga0373927_0839530 | Ga0373927_0839530_132_584 | 147 |
| 1158 | 3300035724 | Ga0373933_0114686 | Ga0373933_0114686_410_862 | 147 |
| 1159 | 3300035724 | Ga0373933_0457624 | Ga0373933_0457624_50_496 | 147 |
| 1160 | 3300035725 | Ga0373947_0009153 | Ga0373947_0009153_4117_4569 | 147 |
| 1161 | 3300035725 | Ga0373947_0102011 | Ga0373947_0102011_1177_1629 | 147 |
| 1162 | 3300035725 | Ga0373947_0308227 | Ga0373947_0308227_84_536 | 147 |
| 1163 | 3300036401 | Ga0373937_0030189 | Ga0373937_0030189_3789_4235 | 147 |
| 1164 | 3300036401 | Ga0373937_0092209 | Ga0373937_0092209_2293_2745 | 147 |
| 1165 | 3300036401 | Ga0373937_0291908 | Ga0373937_0291908_1048_1497 | 147 |
| 1166 | 3300036401 | Ga0373937_0366409 | Ga0373937_0366409_205_663 | 147 |
| 1167 | 3300036401 | Ga0373937_0499063 | Ga0373937_0499063_600_1049 | 147 |
| 1168 | 3300036401 | Ga0373937_0682105 | Ga0373937_0682105_239_685 | 147 |
| 1169 | 3300036401 | Ga0373937_0922960 | Ga0373937_0922960_300_749 | 147 |
| 1170 | 3300037068 | Ga0373925_0021012 | Ga0373925_0021012_1898_2350 | 147 |
| 1171 | 3300037068 | Ga0373925_0098621 | Ga0373925_0098621_1529_1981 | 147 |
| 1172 | 3300037068 | Ga0373925_0216974 | Ga0373925_0216974_274_726 | 147 |
| 1173 | 3300037418 | Ga0395900_0205792 | Ga0395900_0205792_714_1157 | 147 |
| 1174 | 3300037466 | Ga0395898_0016476 | Ga0395898_0016476_4452_4895 | 147 |
| 1175 | 3300037466 | Ga0395898_0662158 | Ga0395898_0662158_57_500 | 147 |
| 1176 | 3300037853 | Ga0436364_1340096 | Ga0436364_1340096_816_1262 | 147 |
| 1177 | 3300038443 | Ga0395901_0190034 | Ga0395901_0190034_556_999 | 147 |
| 1178 | 3300039437 | Ga0436365_0151500 | Ga0436365_0151500_3050_3499 | 147 |
| 1179 | 3300039437 | Ga0436365_1407004 | Ga0436365_1407004_377_823 | 147 |
| 1180 | 3300039437 | Ga0436365_1524178 | Ga0436365_1524178_73734_74183 | 147 |
| 1181 | 3300039437 | Ga0436365_1664004 | Ga0436365_1664004_2788_3237 | 147 |
| 1182 | 3300039450 | Ga0436363_0387793 | Ga0436363_0387793_69_518 | 147 |
| 1183 | 3300039453 | Ga0436362_0273161 | Ga0436362_0273161_463410_463859 | 147 |
| 1184 | 3300039453 | Ga0436362_0948018 | Ga0436362_0948018_4138_4587 | 147 |
| 1185 | 3300042122 | Ga0450920_028141 | Ga0450920_028141_12_464 | 147 |
| 1186 | 3300042125 | Ga0450923_002993 | Ga0450923_002993_1624_2076 | 147 |
| 1187 | 3300042125 | Ga0450923_024509 | Ga0450923_024509_171_629 | 147 |
| 1188 | 3300042131 | Ga0450894_000599 | Ga0450894_000599_4324_4776 | 147 |
| 1189 | 3300042133 | Ga0450896_003252 | Ga0450896_003252_94_546 | 147 |
| 1190 | 3300042134 | Ga0450898_020528 | Ga0450898_020528_522_974 | 147 |
| 1191 | 3300042436 | Ga0439435_0088581 | Ga0439435_0088581_218_670 | 147 |
| 1192 | 3300042531 | Ga0450918_014259 | Ga0450918_014259_325_777 | 147 |
| 1193 | 3300042876 | Ga0451577_0000614 | Ga0451577_0000614_41563_42015 | 147 |
| 1194 | 3300042876 | Ga0451577_0079314 | Ga0451577_0079314_212_661 | 147 |
| 1195 | 3300044694 | Ga0466963_0073051 | Ga0466963_0073051_1771_2220 | 147 |
| 1196 | 3300044694 | Ga0466963_0086757 | Ga0466963_0086757_866_1312 | 147 |
| 1197 | 3300044694 | Ga0466963_0095891 | Ga0466963_0095891_199_648 | 147 |
| 1198 | 3300044706 | Ga0466964_0275436 | Ga0466964_0275436_264_713 | 147 |
| 1199 | 3300044712 | Ga0453684_0001797 | Ga0453684_0001797_45375_45827 | 147 |
| 1200 | 3300044712 | Ga0453684_0394087 | Ga0453684_0394087_844_1296 | 147 |
| 1201 | 3300044735 | Ga0466968_0212272 | Ga0466968_0212272_15_464 | 147 |
| 1202 | 3300044765 | Ga0466970_0466226 | Ga0466970_0466226_20_466 | 147 |
| 1203 | 3300044842 | Ga0466957_0000055 | Ga0466957_0000055_5466_5912 | 147 |
| 1204 | 3300044842 | Ga0466957_0115774 | Ga0466957_0115774_53_499 | 147 |
| 1205 | 3300045049 | Ga0466959_0046896 | Ga0466959_0046896_1481_1927 | 147 |
| 1206 | 3300045049 | Ga0466959_0419766 | Ga0466959_0419766_374_823 | 147 |
| 1207 | 3300045051 | Ga0451576_0317271 | Ga0451576_0317271_769_1215 | 147 |
| 1208 | 3300045051 | Ga0451576_0873320 | Ga0451576_0873320_61_516 | 147 |
| 1209 | 3300045051 | Ga0451576_1204279 | Ga0451576_1204279_320_766 | 147 |
| 1210 | 3300045051 | Ga0451576_1392512 | Ga0451576_1392512_19_474 | 147 |
| 1211 | 3300045836 | Ga0466958_0034374 | Ga0466958_0034374_1076_1522 | 147 |
| 1212 | 3300045836 | Ga0466958_0276360 | Ga0466958_0276360_426_872 | 147 |
| 1213 | 3300045976 | Ga0466967_0046854 | Ga0466967_0046854_1101_1550 | 147 |
| 1214 | 3300046455 | Ga0495603_0130161 | Ga0495603_0130161_854_1306 | 147 |
| 1215 | 3300046459 | Ga0495629_1048308 | Ga0495629_1048308_25_483 | 147 |
| 1216 | 3300046462 | Ga0495651_0011592 | Ga0495651_0011592_3983_4432 | 147 |
| 1217 | 3300046472 | Ga0495580_0000634 | Ga0495580_0000634_24622_25074 | 147 |
| 1218 | 3300046472 | Ga0495580_0023089 | Ga0495580_0023089_1295_1747 | 147 |
| 1219 | 3300046472 | Ga0495580_0068416 | Ga0495580_0068416_1278_1727 | 147 |
| 1220 | 3300046472 | Ga0495580_0071624 | Ga0495580_0071624_1663_2112 | 147 |
| 1221 | 3300046472 | Ga0495580_0183504 | Ga0495580_0183504_962_1414 | 147 |
| 1222 | 3300046472 | Ga0495580_0466016 | Ga0495580_0466016_71_520 | 147 |
| 1223 | 3300046473 | Ga0495582_0012769 | Ga0495582_0012769_1802_2254 | 147 |
| 1224 | 3300046473 | Ga0495582_0023662 | Ga0495582_0023662_1075_1530 | 147 |
| 1225 | 3300046473 | Ga0495582_0256428 | Ga0495582_0256428_179_637 | 147 |
| 1226 | 3300046475 | Ga0495639_0043201 | Ga0495639_0043201_1420_1875 | 147 |
| 1227 | 3300046475 | Ga0495639_0053642 | Ga0495639_0053642_1056_1508 | 147 |
| 1228 | 3300046477 | Ga0495664_0248387 | Ga0495664_0248387_564_1010 | 147 |
| 1229 | 3300046491 | Ga0495584_0225488 | Ga0495584_0225488_16_468 | 147 |
| 1230 | 3300046499 | Ga0495594_0406313 | Ga0495594_0406313_167_622 | 147 |
| 1231 | 3300046511 | Ga0495608_0197387 | Ga0495608_0197387_161_607 | 147 |
| 1232 | 3300046511 | Ga0495608_0281384 | Ga0495608_0281384_119_574 | 147 |
| 1233 | 3300046515 | Ga0495620_0006479 | Ga0495620_0006479_5273_5722 | 147 |
| 1234 | 3300046516 | Ga0495628_0193333 | Ga0495628_0193333_485_937 | 147 |
| 1235 | 3300046516 | Ga0495628_0622625 | Ga0495628_0622625_236_682 | 147 |
| 1236 | 3300046517 | Ga0495630_0252278 | Ga0495630_0252278_238_690 | 147 |
| 1237 | 3300046517 | Ga0495630_0596485 | Ga0495630_0596485_157_603 | 147 |
| 1238 | 3300046517 | Ga0495630_0600783 | Ga0495630_0600783_11_466 | 147 |
| 1239 | 3300046526 | Ga0495666_0047763 | Ga0495666_0047763_1419_1871 | 147 |
| 1240 | 3300046531 | Ga0495665_0015678 | Ga0495665_0015678_2358_2810 | 147 |
| 1241 | 3300046531 | Ga0495665_0449390 | Ga0495665_0449390_78_533 | 147 |
| 1242 | 3300046535 | Ga0495586_0083397 | Ga0495586_0083397_1125_1580 | 147 |
| 1243 | 3300046537 | Ga0495598_0274727 | Ga0495598_0274727_64_531 | 147 |
| 1244 | 3300046539 | Ga0495621_0144405 | Ga0495621_0144405_300_767 | 147 |
| 1245 | 3300046558 | Ga0495633_0414888 | Ga0495633_0414888_140_592 | 147 |
| 1246 | 3300046559 | Ga0495667_0144941 | Ga0495667_0144941_536_991 | 147 |
| 1247 | 3300046559 | Ga0495667_0500433 | Ga0495667_0500433_126_584 | 147 |
| 1248 | 3300046663 | Ga0495635_0594547 | Ga0495635_0594547_40_498 | 147 |
| 1249 | 3300046674 | Ga0495588_0362818 | Ga0495588_0362818_23_475 | 147 |
| 1250 | 3300046675 | Ga0495657_0185235 | Ga0495657_0185235_209_655 | 147 |
| 1251 | 3300046675 | Ga0495657_0223452 | Ga0495657_0223452_43_498 | 147 |
| 1252 | 3300046675 | Ga0495657_0725626 | Ga0495657_0725626_24_473 | 147 |
| 1253 | 3300046679 | Ga0495623_0133257 | Ga0495623_0133257_704_1153 | 147 |
| 1254 | 3300046679 | Ga0495623_0325356 | Ga0495623_0325356_307_753 | 147 |
| 1255 | 3300046681 | Ga0495647_0130840 | Ga0495647_0130840_397_855 | 147 |
| 1256 | 3300046681 | Ga0495647_0197263 | Ga0495647_0197263_387_842 | 147 |
| 1257 | 3300046683 | Ga0495658_0113098 | Ga0495658_0113098_237_692 | 147 |
| 1258 | 3300046684 | Ga0495669_0121672 | Ga0495669_0121672_396_848 | 147 |
| 1259 | 3300046809 | Ga0495600_0261042 | Ga0495600_0261042_198_656 | 147 |
| 1260 | 3300047315 | Ga0495581_0039807 | Ga0495581_0039807_435_890 | 147 |
| 1261 | 3300047319 | Ga0495674_0164604 | Ga0495674_0164604_1297_1749 | 147 |
| 1262 | 3300047319 | Ga0495674_0446866 | Ga0495674_0446866_69_527 | 147 |
| 1263 | 3300047319 | Ga0495674_0764077 | Ga0495674_0764077_225_671 | 147 |
| 1264 | 3300047321 | Ga0495676_0682745 | Ga0495676_0682745_103_558 | 147 |
| 1265 | 3300047322 | Ga0495680_0221712 | Ga0495680_0221712_622_1080 | 147 |
| 1266 | 3300047322 | Ga0495680_0318677 | Ga0495680_0318677_71_520 | 147 |
| 1267 | 3300047444 | Ga0495675_0037102 | Ga0495675_0037102_259_705 | 147 |
| 1268 | 3300047444 | Ga0495675_0056274 | Ga0495675_0056274_525_974 | 147 |
| 1269 | 3300047444 | Ga0495675_0262963 | Ga0495675_0262963_339_794 | 147 |
| 1270 | 3300047471 | Ga0495684_0549167 | Ga0495684_0549167_244_690 | 147 |
| 1271 | 3300047673 | Ga0495593_0038862 | Ga0495593_0038862_1255_1710 | 147 |
| 1272 | 3300048088 | Ga0495602_0075891 | Ga0495602_0075891_2042_2491 | 147 |
| 1273 | 3300048088 | Ga0495602_0154200 | Ga0495602_0154200_1303_1749 | 147 |
| 1274 | 3300048088 | Ga0495602_0308267 | Ga0495602_0308267_172_618 | 147 |
| 1275 | 3300048088 | Ga0495602_0509148 | Ga0495602_0509148_148_597 | 147 |
| 1276 | 3300048903 | Ga0496100_0057755 | Ga0496100_0057755_833_1291 | 147 |
| 1277 | 3300048903 | Ga0496100_0101387 | Ga0496100_0101387_821_1273 | 147 |
| 1278 | 3300048904 | Ga0496101_0145139 | Ga0496101_0145139_368_826 | 147 |
| 1279 | 3300048904 | Ga0496101_0324190 | Ga0496101_0324190_15_470 | 147 |
| 1280 | 3300048905 | Ga0496102_0402142 | Ga0496102_0402142_45_500 | 147 |
| 1281 | 3300048905 | Ga0496102_0930936 | Ga0496102_0930936_101_556 | 147 |
| 1282 | 3300048907 | Ga0496104_0004317 | Ga0496104_0004317_5131_5586 | 147 |
| 1283 | 3300048907 | Ga0496104_0065499 | Ga0496104_0065499_2775_3230 | 147 |
| 1284 | 3300048907 | Ga0496104_0074475 | Ga0496104_0074475_2333_2779 | 147 |
| 1285 | 3300048907 | Ga0496104_0753595 | Ga0496104_0753595_26_478 | 147 |
| 1286 | 3300048907 | Ga0496104_0868662 | Ga0496104_0868662_171_629 | 147 |
| 1287 | 3300048908 | Ga0496105_0153234 | Ga0496105_0153234_177_623 | 147 |
| 1288 | 3300048909 | Ga0496106_0092821 | Ga0496106_0092821_1435_1884 | 147 |
| 1289 | 3300048909 | Ga0496106_0717609 | Ga0496106_0717609_304_750 | 147 |
| 1290 | 3300048910 | Ga0496107_0240967 | Ga0496107_0240967_266_724 | 147 |
| 1291 | 3300048910 | Ga0496107_0313798 | Ga0496107_0313798_375_839 | 147 |
| 1292 | 3300048911 | Ga0496108_0192152 | Ga0496108_0192152_842_1300 | 147 |
| 1293 | 3300048911 | Ga0496108_1394384 | Ga0496108_1394384_33_485 | 147 |
| 1294 | 3300048911 | Ga0496108_1401939 | Ga0496108_1401939_82_528 | 147 |
| 1295 | 3300048912 | Ga0496109_0050587 | Ga0496109_0050587_1394_1840 | 147 |
| 1296 | 3300048913 | Ga0496110_0033571 | Ga0496110_0033571_3081_3530 | 147 |
| 1297 | 3300048913 | Ga0496110_0106151 | Ga0496110_0106151_374_829 | 147 |
| 1298 | 3300048914 | Ga0496111_0001171 | Ga0496111_0001171_3080_3529 | 147 |
| 1299 | 3300048915 | Ga0496112_0001167 | Ga0496112_0001167_9718_10164 | 147 |
| 1300 | 3300048915 | Ga0496112_0003245 | Ga0496112_0003245_4442_4897 | 147 |
| 1301 | 3300048915 | Ga0496112_0015233 | Ga0496112_0015233_2290_2736 | 147 |
| 1302 | 3300048915 | Ga0496112_0054419 | Ga0496112_0054419_587_1033 | 147 |
| 1303 | 3300048915 | Ga0496112_0279704 | Ga0496112_0279704_483_929 | 147 |
| 1304 | 3300048915 | Ga0496112_0596943 | Ga0496112_0596943_280_735 | 147 |
| 1305 | 3300048915 | Ga0496112_1936527 | Ga0496112_1936527_25_480 | 147 |
| 1306 | 3300048916 | Ga0496113_0000290 | Ga0496113_0000290_12769_13224 | 147 |
| 1307 | 3300048916 | Ga0496113_0267572 | Ga0496113_0267572_759_1205 | 147 |
| 1308 | 3300048916 | Ga0496113_0576116 | Ga0496113_0576116_403_852 | 147 |
| 1309 | 3300048917 | Ga0496114_0001818 | Ga0496114_0001818_5695_6153 | 147 |
| 1310 | 3300048917 | Ga0496114_0112225 | Ga0496114_0112225_852_1310 | 147 |
| 1311 | 3300048917 | Ga0496114_0814271 | Ga0496114_0814271_54_500 | 147 |
| 1312 | 3300048918 | Ga0496115_0521612 | Ga0496115_0521612_130_576 | 147 |
| 1313 | 3300049522 | Ga0501299_144080 | Ga0501299_144080_38_487 | 147 |
| 1314 | 3300049568 | Ga0501031_0293436 | Ga0501031_0293436_57_509 | 147 |
| 1315 | 3300049569 | Ga0501032_0207149 | Ga0501032_0207149_555_1007 | 147 |
| 1316 | 3300049570 | Ga0501033_0384565 | Ga0501033_0384565_176_628 | 147 |
| 1317 | 3300049572 | Ga0501036_0037085 | Ga0501036_0037085_924_1376 | 147 |
| 1318 | 3300049572 | Ga0501036_0110920 | Ga0501036_0110920_867_1319 | 147 |
| 1319 | 3300049572 | Ga0501036_1312625 | Ga0501036_1312625_53_505 | 147 |
| 1320 | 3300049574 | Ga0501038_0193406 | Ga0501038_0193406_1052_1504 | 147 |
| 1321 | 3300049575 | Ga0501039_0027910 | Ga0501039_0027910_2208_2660 | 147 |
| 1322 | 3300049575 | Ga0501039_0456679 | Ga0501039_0456679_66_518 | 147 |
| 1323 | 3300049576 | Ga0501040_0014732 | Ga0501040_0014732_896_1348 | 147 |
| 1324 | 3300049576 | Ga0501040_0223517 | Ga0501040_0223517_212_664 | 147 |
| 1325 | 3300049577 | Ga0501041_0000881 | Ga0501041_0000881_4740_5192 | 147 |
| 1326 | 3300049577 | Ga0501041_0124950 | Ga0501041_0124950_380_832 | 147 |
| 1327 | 3300049578 | Ga0501042_0002368 | Ga0501042_0002368_4858_5310 | 147 |
| 1328 | 3300049578 | Ga0501042_0047477 | Ga0501042_0047477_2433_2885 | 147 |
| 1329 | 3300049580 | Ga0501046_0219952 | Ga0501046_0219952_176_628 | 147 |
| 1330 | 3300049582 | Ga0501048_0047770 | Ga0501048_0047770_546_998 | 147 |
| 1331 | 3300049582 | Ga0501048_0146512 | Ga0501048_0146512_705_1157 | 147 |
| 1332 | 3300049584 | Ga0501068_0017200 | Ga0501068_0017200_2328_2780 | 147 |
| 1333 | 3300049586 | Ga0501070_0327788 | Ga0501070_0327788_660_1103 | 147 |
| 1334 | 3300049587 | Ga0501071_0004621 | Ga0501071_0004621_7176_7628 | 147 |
| 1335 | 3300049587 | Ga0501071_0011873 | Ga0501071_0011873_4144_4596 | 147 |
| 1336 | 3300049587 | Ga0501071_1105275 | Ga0501071_1105275_23_475 | 147 |
| 1337 | 3300049587 | Ga0501071_1594294 | Ga0501071_1594294_13_465 | 147 |
| 1338 | 3300049588 | Ga0501072_0002447 | Ga0501072_0002447_9992_10444 | 147 |
| 1339 | 3300049588 | Ga0501072_0429990 | Ga0501072_0429990_141_593 | 147 |
| 1340 | 3300049589 | Ga0501073_0009228 | Ga0501073_0009228_2423_2872 | 147 |
| 1341 | 3300049589 | Ga0501073_0159639 | Ga0501073_0159639_205_657 | 147 |
| 1342 | 3300049590 | Ga0501074_0044233 | Ga0501074_0044233_2211_2663 | 147 |
| 1343 | 3300049590 | Ga0501074_0424060 | Ga0501074_0424060_214_663 | 147 |
| 1344 | 3300049591 | Ga0501075_0001143 | Ga0501075_0001143_4969_5421 | 147 |
| 1345 | 3300049591 | Ga0501075_0565336 | Ga0501075_0565336_70_522 | 147 |
| 1346 | 3300049591 | Ga0501075_1348289 | Ga0501075_1348289_22_471 | 147 |
| 1347 | 3300049592 | Ga0501076_0007665 | Ga0501076_0007665_4822_5274 | 147 |
| 1348 | 3300049592 | Ga0501076_0056818 | Ga0501076_0056818_1763_2215 | 147 |
| 1349 | 3300049592 | Ga0501076_0397190 | Ga0501076_0397190_627_1079 | 147 |
| 1350 | 3300049593 | Ga0501077_0035059 | Ga0501077_0035059_266_718 | 147 |
| 1351 | 3300049741 | Ga0501079_0007802 | Ga0501079_0007802_4917_5369 | 147 |
| 1352 | 3300049742 | Ga0501080_0069849 | Ga0501080_0069849_143_595 | 147 |
| 1353 | 3300049742 | Ga0501080_0079413 | Ga0501080_0079413_2289_2741 | 147 |
| 1354 | 3300049743 | Ga0501081_0004261 | Ga0501081_0004261_6241_6693 | 147 |
| 1355 | 3300049744 | Ga0501083_0065970 | Ga0501083_0065970_355_807 | 147 |
| 1356 | 3300049822 | Ga0501035_0157846 | Ga0501035_0157846_402_854 | 147 |
| 1357 | 3300049824 | Ga0501045_0097965 | Ga0501045_0097965_894_1346 | 147 |
| 1358 | 3300049824 | Ga0501045_0113152 | Ga0501045_0113152_1155_1607 | 147 |
| 1359 | 3300050507 | nmdc:mga05p37_189585_c1 | nmdc:mga05p37_189585_c1_517_972 | 147 |
| 1360 | 3300050507 | nmdc:mga05p37_603568_c1 | nmdc:mga05p37_603568_c1_20_469 | 147 |
| 1361 | 3300050507 | nmdc:mga05p37_8536_c1 | nmdc:mga05p37_8536_c1_694_1161 | 147 |
| 1362 | 3300050508 | nmdc:mga09592_343599_c1 | nmdc:mga09592_343599_c1_470_937 | 147 |
| 1363 | 3300050508 | nmdc:mga09592_705629_c1 | nmdc:mga09592_705629_c1_180_629 | 147 |
| 1364 | 3300050510 | nmdc:mga06r32_2354_c1 | nmdc:mga06r32_2354_c1_11052_11501 | 147 |
| 1365 | 3300050511 | nmdc:mga08y16_1_c1 | nmdc:mga08y16_1_c1_442015_442464 | 147 |
| 1366 | 3300050511 | nmdc:mga08y16_284736_c1 | nmdc:mga08y16_284736_c1_930_1397 | 147 |
| 1367 | 3300050512 | nmdc:mga0n895_1043056_c1 | nmdc:mga0n895_1043056_c1_162_611 | 147 |
| 1368 | 3300050512 | nmdc:mga0n895_1313065_c1 | nmdc:mga0n895_1313065_c1_42_491 | 147 |
| 1369 | 3300050512 | nmdc:mga0n895_16332_c1 | nmdc:mga0n895_16332_c1_5153_5605 | 147 |
| 1370 | 3300050512 | nmdc:mga0n895_170166_c1 | nmdc:mga0n895_170166_c1_589_1038 | 147 |
| 1371 | 3300050512 | nmdc:mga0n895_19859_c1 | nmdc:mga0n895_19859_c1_385_834 | 147 |
| 1372 | 3300050512 | nmdc:mga0n895_360054_c1 | nmdc:mga0n895_360054_c1_706_1218 | 147 |
| 1373 | 3300050512 | nmdc:mga0n895_866273_c1 | nmdc:mga0n895_866273_c1_28_477 | 147 |
| 1374 | 3300050513 | nmdc:mga0rr50_156066_c1 | nmdc:mga0rr50_156066_c1_1354_1803 | 147 |
| 1375 | 3300050513 | nmdc:mga0rr50_1807_c1 | nmdc:mga0rr50_1807_c1_7675_8130 | 147 |
| 1376 | 3300050513 | nmdc:mga0rr50_41509_c1 | nmdc:mga0rr50_41509_c1_2369_2821 | 147 |
| 1377 | 3300050513 | nmdc:mga0rr50_7195_c1 | nmdc:mga0rr50_7195_c1_4776_5228 | 147 |
| 1378 | 3300050514 | nmdc:mga08x19_1679_c1 | nmdc:mga08x19_1679_c1_1605_2060 | 147 |
| 1379 | 3300050514 | nmdc:mga08x19_27429_c1 | nmdc:mga08x19_27429_c1_2252_2704 | 147 |
| 1380 | 3300050515 | nmdc:mga0a205_11707_c1 | nmdc:mga0a205_11707_c1_7593_8045 | 147 |
| 1381 | 3300050515 | nmdc:mga0a205_901298_c1 | nmdc:mga0a205_901298_c1_222_671 | 147 |
| 1382 | 3300053077 | Ga0495601_0001368 | Ga0495601_0001368_11418_11867 | 147 |
| 1383 | 3300053077 | Ga0495601_0029406 | Ga0495601_0029406_2338_2796 | 147 |
| 1384 | 3300053077 | Ga0495601_0283714 | Ga0495601_0283714_586_1044 | 147 |
| 1385 | 3300053078 | Ga0495612_0286979 | Ga0495612_0286979_273_725 | 147 |
| 1386 | 3300053078 | Ga0495612_0617504 | Ga0495612_0617504_32_478 | 147 |
| 1387 | 3300053083 | Ga0495655_0000287 | Ga0495655_0000287_1323_1778 | 147 |
| 1388 | 3300053084 | Ga0495595_0096456 | Ga0495595_0096456_556_1014 | 147 |
| 1389 | 3300053085 | Ga0495619_0024573 | Ga0495619_0024573_2317_2775 | 147 |
| 1390 | 3300053085 | Ga0495619_0524999 | Ga0495619_0524999_278_727 | 147 |
| 1391 | 3300053148 | Ga0500590_122855 | Ga0500590_122855_72_524 | 147 |
| 1392 | 3300054114 | Ga0501084_0013954 | Ga0501084_0013954_2803_3255 | 147 |
| 1393 | 3300059477 | Ga0587084_015300 | Ga0587084_015300_417_872 | 147 |
| 1394 | 3300059478 | Ga0587093_000692 | Ga0587093_000692_1317_1772 | 147 |
| 1395 | 3300059490 | Ga0587066_014595 | Ga0587066_014595_625_1071 | 147 |
| 1396 | 3300059491 | Ga0587070_001449 | Ga0587070_001449_132_578 | 147 |
| 1397 | 3300059491 | Ga0587070_015526 | Ga0587070_015526_247_702 | 147 |
| 1398 | 3300059493 | Ga0587077_001212 | Ga0587077_001212_2018_2473 | 147 |
| 1399 | 3300059506 | Ga0587085_014007 | Ga0587085_014007_103_558 | 147 |
| 1400 | 3300059506 | Ga0587085_017002 | Ga0587085_017002_383_838 | 147 |
| 1401 | 3300059507 | Ga0587086_008478 | Ga0587086_008478_665_1120 | 147 |
| 1402 | 3300059507 | Ga0587086_028327 | Ga0587086_028327_150_605 | 147 |
| 1403 | 3300059511 | Ga0587091_003320 | Ga0587091_003320_1286_1741 | 147 |
| 1404 | 3300059511 | Ga0587091_012597 | Ga0587091_012597_164_619 | 147 |
| 1405 | 3300059512 | Ga0587092_025904 | Ga0587092_025904_274_729 | 147 |
| 1406 | 3300059513 | Ga0587094_008397 | Ga0587094_008397_696_1151 | 147 |
| 1407 | 3300059622 | Ga0587099_004327 | Ga0587099_004327_544_999 | 147 |
| 1408 | 3300059623 | Ga0587101_009866 | Ga0587101_009866_328_783 | 147 |
| 1409 | 3300059625 | Ga0587113_005354 | Ga0587113_005354_523_978 | 147 |
| 1410 | 3300059630 | Ga0587128_033757 | Ga0587128_033757_256_711 | 147 |
| 1411 | 3300059640 | Ga0587067_036706 | Ga0587067_036706_239_694 | 147 |
| 1412 | 3300059642 | Ga0587069_007244 | Ga0587069_007244_126_581 | 147 |
| 1413 | 3300059644 | Ga0587075_001635 | Ga0587075_001635_1140_1595 | 147 |
| 1414 | 3300059645 | Ga0587076_046883 | Ga0587076_046883_226_672 | 147 |
| 1415 | 3300059646 | Ga0587078_000650 | Ga0587078_000650_804_1259 | 147 |
| 1416 | 3300059652 | Ga0587107_005299 | Ga0587107_005299_630_1085 | 147 |
| 1417 | 3300059655 | Ga0587114_001009 | Ga0587114_001009_1082_1537 | 147 |
| 1418 | 3300059655 | Ga0587114_065311 | Ga0587114_065311_64_510 | 147 |
| 1419 | 3300060344 | Ga0587071_003502 | Ga0587071_003502_1784_2230 | 147 |
| 1420 | 3300060353 | Ga0501082_0001055 | Ga0501082_0001055_11899_12351 | 147 |
| 1421 | 3300060353 | Ga0501082_0166228 | Ga0501082_0166228_700_1152 | 147 |
| 1422 | 3300060353 | Ga0501082_1318309 | Ga0501082_1318309_70_522 | 147 |
| 1423 | 3300061734 | Ga0530510_0089182 | Ga0530510_0089182_944_1396 | 147 |
| 1424 | 3300049575 | Ga0501039_0615539 | Ga0501039_0615539_64_522 | 148 |
| 1425 | 3300049579 | Ga0501043_0764846 | Ga0501043_0764846_158_616 | 148 |
| 1426 | 3300049741 | Ga0501079_0098301 | Ga0501079_0098301_1090_1548 | 148 |
| 1427 | 3300060353 | Ga0501082_0180877 | Ga0501082_0180877_255_713 | 148 |
| 1428 | 3300061734 | Ga0530510_0747336 | Ga0530510_0747336_86_544 | 148 |
| 1429 | 3300001904 | JGI24736J21556_1074781 | JGI24736J21556_10747811 | 151 |
| 1430 | 3300001915 | JGI24741J21665_1054123 | JGI24741J21665_10541231 | 151 |
| 1431 | 3300005327 | Ga0070658_11469121 | Ga0070658_114691211 | 151 |
| 1432 | 3300005329 | Ga0070683_100109102 | Ga0070683_1001091022 | 151 |
| 1433 | 3300005336 | Ga0070680_100030425 | Ga0070680_1000304254 | 151 |
| 1434 | 3300005339 | Ga0070660_100014351 | Ga0070660_1000143513 | 151 |
| 1435 | 3300005344 | Ga0070661_100330247 | Ga0070661_1003302472 | 151 |
| 1436 | 3300005366 | Ga0070659_100070558 | Ga0070659_1000705584 | 151 |
| 1437 | 3300005366 | Ga0070659_101741935 | Ga0070659_1017419351 | 151 |
| 1438 | 3300005455 | Ga0070663_100273623 | Ga0070663_1002736232 | 151 |
| 1439 | 3300005458 | Ga0070681_10048821 | Ga0070681_100488214 | 151 |
| 1440 | 3300005530 | Ga0070679_100021300 | Ga0070679_1000213003 | 151 |
| 1441 | 3300005535 | Ga0070684_100225088 | Ga0070684_1002250882 | 151 |
| 1442 | 3300005539 | Ga0068853_100030002 | Ga0068853_1000300024 | 151 |
| 1443 | 3300005563 | Ga0068855_100243731 | Ga0068855_1002437313 | 151 |
| 1444 | 3300005563 | Ga0068855_101000377 | Ga0068855_1010003772 | 151 |
| 1445 | 3300005577 | Ga0068857_100042347 | Ga0068857_1000423472 | 151 |
| 1446 | 3300005578 | Ga0068854_100023618 | Ga0068854_1000236184 | 151 |
| 1447 | 3300005616 | Ga0068852_101237040 | Ga0068852_1012370402 | 151 |
| 1448 | 3300009093 | Ga0105240_10053697 | Ga0105240_100536974 | 151 |
| 1449 | 3300009545 | Ga0105237_10054701 | Ga0105237_100547012 | 151 |
| 1450 | 3300009551 | Ga0105238_10936092 | Ga0105238_109360922 | 151 |
| 1451 | 3300013104 | Ga0157370_10743664 | Ga0157370_107436641 | 151 |
| 1452 | 3300013105 | Ga0157369_10262051 | Ga0157369_102620512 | 151 |
| 1453 | 3300013307 | Ga0157372_10022300 | Ga0157372_100223003 | 151 |
| 1454 | 3300013307 | Ga0157372_10151250 | Ga0157372_101512502 | 151 |
| 1455 | 3300020077 | Ga0206351_10169684 | Ga0206351_101696842 | 151 |
| 1456 | 3300025904 | Ga0207647_10002357 | Ga0207647_100023575 | 151 |
| 1457 | 3300025909 | Ga0207705_10000465 | Ga0207705_1000046514 | 151 |
| 1458 | 3300025912 | Ga0207707_10040973 | Ga0207707_100409734 | 151 |
| 1459 | 3300025913 | Ga0207695_10528046 | Ga0207695_105280462 | 151 |
| 1460 | 3300025914 | Ga0207671_10128012 | Ga0207671_101280122 | 151 |
| 1461 | 3300025917 | Ga0207660_10016552 | Ga0207660_100165525 | 151 |
| 1462 | 3300025919 | Ga0207657_10002434 | Ga0207657_100024345 | 151 |
| 1463 | 3300025921 | Ga0207652_10241217 | Ga0207652_102412172 | 151 |
| 1464 | 3300025929 | Ga0207664_10419261 | Ga0207664_104192612 | 151 |
| 1465 | 3300025932 | Ga0207690_10305492 | Ga0207690_103054922 | 151 |
| 1466 | 3300025944 | Ga0207661_10050671 | Ga0207661_100506714 | 151 |
| 1467 | 3300025949 | Ga0207667_10035982 | Ga0207667_100359824 | 151 |
| 1468 | 3300025949 | Ga0207667_10411266 | Ga0207667_104112662 | 151 |
| 1469 | 3300025981 | Ga0207640_10166203 | Ga0207640_101662032 | 151 |
| 1470 | 3300026041 | Ga0207639_10066138 | Ga0207639_100661383 | 151 |
| 1471 | 3300026067 | Ga0207678_10017836 | Ga0207678_100178364 | 151 |
| 1472 | 3300026116 | Ga0207674_10002393 | Ga0207674_1000239311 | 151 |
| 1473 | 3300045049 | Ga0466959_0112706 | Ga0466959_0112706_696_1154 | 151 |
| 1474 | 3300049569 | Ga0501032_0674262 | Ga0501032_0674262_78_533 | 151 |
| 1475 | 3300049574 | Ga0501038_0100946 | Ga0501038_0100946_1611_2066 | 151 |
| 1476 | 3300049581 | Ga0501047_0148420 | Ga0501047_0148420_585_1040 | 151 |
| 1477 | 3300049586 | Ga0501070_0083015 | Ga0501070_0083015_1433_1888 | 151 |
| 1478 | 3300049589 | Ga0501073_0025682 | Ga0501073_0025682_813_1268 | 151 |
| 1479 | 3300049742 | Ga0501080_0388636 | Ga0501080_0388636_510_965 | 151 |
| 1480 | 3300061719 | Ga0466962_0447746 | Ga0466962_0447746_19_477 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9592 | 1 | 142 |
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9451 | 1 | 142 |
| 6jzv-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis | 0.9421 | 2 | 143 |
| 2qq4-assembly2.cif.gz_D | crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 | 0.9236 | 2 | 142 |
| 6jzw-assembly2.cif.gz_B | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9226 | 1 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9461 | 2 | 142 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9327 | 2 | 142 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8982 | 1 | 146 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8965 | 3 | 141 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8837 | 3 | 141 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1K4Z9-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9906 | 4 | 89 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A3D3D5D7-F1-model_v4 | deleted | 0.9883 | 1 | 93 |
|
| AF-A0A349K914-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9718 | 1 | 89 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7C5ZN38-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9672 | 23 | 144 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A1F4HKU6-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9664 | 1 | 143 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar