F494265

General Info

Members Datasets Scaffolds Average Seq Length
1480 427 1480 149

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100094657|Ga0070708_1000946574
Length 175
Sequence MPDLRELYQEVILEHSKAPRNYGELATANHRAEGYNPLCGDHFTVYLDLEGDSIRDISFQGSGCAISKASASLMTQSVKGKTRAEAARLFDQFHKLVTGQSPANGNRSELGKLAVFSGVSEFPVRVKCATLAWHTLHALLEGNRALCRRSSLSTQSKEKDSYEGSSIWVRVNRSR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
128 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
232 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
239 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
240 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
242 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
281 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
282 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
400 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.09
Metatranscriptomes 7.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 3.51
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1074781 3300001904 Unclassified 530
2 JGI24741J21665_1054123 3300001915 Unclassified 591
3 Ga0058863_10127816 3300004799 Bacteria 7581
4 Ga0058863_11021108 3300004799 Bacteria 1466
5 Ga0058863_11730432 3300004799 Bacteria 685
6 Ga0058863_11860926 3300004799 Bacteria 951
7 Ga0058861_11826821 3300004800 Unclassified 804
8 Ga0058861_12031869 3300004800 Unclassified 1059
9 Ga0058862_10023634 3300004803 Bacteria 1235
10 Ga0058862_10034373 3300004803 Bacteria 7297
11 Ga0058862_10724446 3300004803 Bacteria 1461
12 Ga0058862_12268890 3300004803 Bacteria 1679
13 Ga0058862_12345701 3300004803 Bacteria 970
14 Ga0058862_12473751 3300004803 Unclassified 1123
15 Ga0058862_12782718 3300004803 Bacteria 822
16 Ga0065704_10126818 3300005289 Bacteria 1684
17 Ga0065712_10218621 3300005290 Bacteria 1048
18 Ga0065707_10006434 3300005295 Bacteria 3187
19 Ga0065707_10088310 3300005295 Bacteria 4693
20 Ga0070658_10029956 3300005327 Bacteria 4373
21 Ga0070658_10322621 3300005327 Bacteria 1319
22 Ga0070658_10858312 3300005327 Unclassified 789
23 Ga0070658_11469121 3300005327 Bacteria 591
24 Ga0070676_10253514 3300005328 Bacteria 1175
25 Ga0070676_10534570 3300005328 Bacteria 837
26 Ga0070683_100000027 3300005329 Bacteria 172200
27 Ga0070683_100085855 3300005329 Bacteria 2951
28 Ga0070683_100109102 3300005329 Bacteria 2610
29 Ga0070683_100122376 3300005329 Bacteria 2458
30 Ga0070683_100129470 3300005329 Bacteria 2388
31 Ga0070683_100339897 3300005329 Bacteria 1429
32 Ga0070683_100468908 3300005329 Bacteria 1202
33 Ga0070683_100505926 3300005329 Bacteria 1154
34 Ga0070683_100532233 3300005329 Bacteria 1123
35 Ga0070683_101410228 3300005329 Bacteria 669
36 Ga0070670_100000463 3300005331 Bacteria 32853
37 Ga0070670_100001082 3300005331 Bacteria 21598
38 Ga0070670_100011194 3300005331 Bacteria 7666
39 Ga0070670_100056945 3300005331 Bacteria 3356
40 Ga0070670_100111653 3300005331 Bacteria 2356
41 Ga0068869_100005528 3300005334 Bacteria 7956
42 Ga0068869_100012601 3300005334 Bacteria 5592
43 Ga0068869_100429892 3300005334 Bacteria 1091
44 Ga0068869_100730496 3300005334 Bacteria 846
45 Ga0068869_100744136 3300005334 Bacteria 839
46 Ga0068869_101265702 3300005334 Archaea 650
47 Ga0070666_10067040 3300005335 Bacteria 2437
48 Ga0070666_10105851 3300005335 Bacteria 1943
49 Ga0070680_100018863 3300005336 Bacteria 5457
50 Ga0070680_100019548 3300005336 Bacteria 5369
51 Ga0070680_100030425 3300005336 Bacteria 4337
52 Ga0070680_100033808 3300005336 Bacteria 4123
53 Ga0070680_100039352 3300005336 Bacteria 3827
54 Ga0070680_100153383 3300005336 Bacteria 1935
55 Ga0070680_100190183 3300005336 Bacteria 1729
56 Ga0070680_100283317 3300005336 Bacteria 1404
57 Ga0070680_100303536 3300005336 Bacteria 1354
58 Ga0070680_100680242 3300005336 Bacteria 885
59 Ga0070680_100951763 3300005336 Unclassified 741
60 Ga0070682_100000079 3300005337 Bacteria 87919
61 Ga0070682_100389044 3300005337 Bacteria 1051
62 Ga0070682_100483228 3300005337 Bacteria 956
63 Ga0068868_100001785 3300005338 Bacteria 14749
64 Ga0068868_100030424 3300005338 Bacteria 4140
65 Ga0068868_100040900 3300005338 Unclassified 3610
66 Ga0068868_100041428 3300005338 Bacteria 3588
67 Ga0068868_100052957 3300005338 Bacteria 3196
68 Ga0068868_100094920 3300005338 Bacteria 2407
69 Ga0068868_100141354 3300005338 Bacteria 1976
70 Ga0068868_100216735 3300005338 Bacteria 1601
71 Ga0070660_100014351 3300005339 Bacteria 5704
72 Ga0070660_100349004 3300005339 Bacteria 1218
73 Ga0070689_100000539 3300005340 Bacteria 22556
74 Ga0070689_100037297 3300005340 Bacteria 3717
75 Ga0070689_100382322 3300005340 Bacteria 1187
76 Ga0070689_100387431 3300005340 Bacteria 1179
77 Ga0070689_100404387 3300005340 Bacteria 1155
78 Ga0070689_100624043 3300005340 Bacteria 936
79 Ga0070691_10134081 3300005341 Bacteria 1257
80 Ga0070691_10138763 3300005341 Bacteria 1237
81 Ga0070691_10208907 3300005341 Bacteria 1029
82 Ga0070687_100007147 3300005343 Bacteria 4630
83 Ga0070687_100193374 3300005343 Bacteria 1228
84 Ga0070687_100412902 3300005343 Bacteria 888
85 Ga0070661_100192185 3300005344 Bacteria 1557
86 Ga0070661_100278881 3300005344 Bacteria 1296
87 Ga0070661_100304115 3300005344 Bacteria 1242
88 Ga0070661_100330247 3300005344 Bacteria 1193
89 Ga0070661_100577253 3300005344 Bacteria 907
90 Ga0070692_10042923 3300005345 Bacteria 2324
91 Ga0070675_100000003 3300005354 Bacteria 422595
92 Ga0070675_100655528 3300005354 Bacteria 954
93 Ga0070671_100093791 3300005355 Bacteria 2516
94 Ga0070671_101063623 3300005355 Bacteria 710
95 Ga0070674_100284408 3300005356 Bacteria 1312
96 Ga0070673_100122565 3300005364 Bacteria 2171
97 Ga0070673_100412719 3300005364 Bacteria 1209
98 Ga0070673_100593985 3300005364 Bacteria 1009
99 Ga0070673_100806147 3300005364 Bacteria 867
100 Ga0070688_100639171 3300005365 Bacteria 818
101 Ga0070659_100070558 3300005366 Bacteria 2775
102 Ga0070659_100535689 3300005366 Bacteria 1001
103 Ga0070659_101741935 3300005366 Bacteria 557
104 Ga0070667_100934025 3300005367 Bacteria 808
105 Ga0070709_10032322 3300005434 Bacteria 3154
106 Ga0070709_10083607 3300005434 Bacteria 2088
107 Ga0070709_10248002 3300005434 Bacteria 1281
108 Ga0070709_10547093 3300005434 Bacteria 885
109 Ga0070714_100011335 3300005435 Bacteria 7070
110 Ga0070714_100038531 3300005435 Bacteria 4018
111 Ga0070714_100084049 3300005435 Bacteria 2777
112 Ga0070714_100108019 3300005435 Bacteria 2460
113 Ga0070714_100117911 3300005435 Bacteria 2358
114 Ga0070714_100124991 3300005435 Bacteria 2292
115 Ga0070714_100170309 3300005435 Bacteria 1976
116 Ga0070714_100190225 3300005435 Bacteria 1872
117 Ga0070714_100205182 3300005435 Bacteria 1805
118 Ga0070714_100214234 3300005435 Unclassified 1767
119 Ga0070714_100228055 3300005435 Bacteria 1715
120 Ga0070714_100258622 3300005435 Unclassified 1611
121 Ga0070714_100315914 3300005435 Bacteria 1460
122 Ga0070714_100416420 3300005435 Bacteria 1272
123 Ga0070714_100568576 3300005435 Bacteria 1087
124 Ga0070714_102032589 3300005435 Bacteria 560
125 Ga0070713_100008383 3300005436 Bacteria 7327
126 Ga0070713_100021840 3300005436 Bacteria 4934
127 Ga0070713_100075911 3300005436 Unclassified 2852
128 Ga0070713_100086884 3300005436 Bacteria 2682
129 Ga0070713_100104493 3300005436 Bacteria 2459
130 Ga0070713_100105609 3300005436 Bacteria 2447
131 Ga0070713_100127628 3300005436 Bacteria 2239
132 Ga0070713_100158681 3300005436 Unclassified 2017
133 Ga0070713_100216183 3300005436 Unclassified 1737
134 Ga0070713_100230484 3300005436 Bacteria 1683
135 Ga0070713_100255526 3300005436 Bacteria 1600
136 Ga0070713_100265815 3300005436 Bacteria 1569
137 Ga0070713_100375520 3300005436 Bacteria 1323
138 Ga0070713_100420907 3300005436 Bacteria 1250
139 Ga0070713_100669183 3300005436 Bacteria 990
140 Ga0070713_101502376 3300005436 Bacteria 654
141 Ga0070710_10025235 3300005437 Unclassified 3146
142 Ga0070710_10122967 3300005437 Bacteria 1573
143 Ga0070710_10137726 3300005437 Bacteria 1494
144 Ga0070710_10164143 3300005437 Unclassified 1380
145 Ga0070710_10302698 3300005437 Bacteria 1044
146 Ga0070710_10587852 3300005437 Bacteria 773
147 Ga0070701_10000949 3300005438 Bacteria 10496
148 Ga0070711_100006696 3300005439 Bacteria 6968
149 Ga0070711_100213706 3300005439 Bacteria 1495
150 Ga0070711_100634977 3300005439 Bacteria 894
151 Ga0070711_100848302 3300005439 Unclassified 777
152 Ga0070711_100871893 3300005439 Unclassified 767
153 Ga0070705_101777431 3300005440 Bacteria 522
154 Ga0070700_100000009 3300005441 Bacteria 181474
155 Ga0070708_100001651 3300005445 Bacteria 17109
156 Ga0070708_100002626 3300005445 Bacteria 13911
157 Ga0070708_100094657 3300005445 Bacteria 2725
158 Ga0070708_100109118 3300005445 Bacteria 2542
159 Ga0070708_100189331 3300005445 Bacteria 1924
160 Ga0070708_100205949 3300005445 Bacteria 1843
161 Ga0070708_100428983 3300005445 Bacteria 1247
162 Ga0070708_100600083 3300005445 Unclassified 1038
163 Ga0070708_100644079 3300005445 Bacteria 999
164 Ga0070708_100878610 3300005445 Unclassified 842
165 Ga0070663_100273623 3300005455 Bacteria 1343
166 Ga0070678_100153071 3300005456 Bacteria 1860
167 Ga0070662_100131671 3300005457 Bacteria 1929
168 Ga0070662_100541086 3300005457 Unclassified 975
169 Ga0070681_10003881 3300005458 Bacteria 14072
170 Ga0070681_10009757 3300005458 Bacteria 9448
171 Ga0070681_10023368 3300005458 Bacteria 6217
172 Ga0070681_10048821 3300005458 Bacteria 4227
173 Ga0070681_10054237 3300005458 Bacteria 3994
174 Ga0070681_10212491 3300005458 Unclassified 1850
175 Ga0070681_10230167 3300005458 Bacteria 1768
176 Ga0070681_10321561 3300005458 Unclassified 1457
177 Ga0070681_10614193 3300005458 Bacteria 1002
178 Ga0070681_10674743 3300005458 Bacteria 949
179 Ga0070681_11037795 3300005458 Bacteria 740
180 Ga0068867_100217866 3300005459 Bacteria 1537
181 Ga0068867_100442899 3300005459 Bacteria 1105
182 Ga0068867_100847046 3300005459 Bacteria 819
183 Ga0068867_101851097 3300005459 Bacteria 568
184 Ga0068867_101924074 3300005459 Unclassified 558
185 Ga0070685_10019936 3300005466 Bacteria 3625
186 Ga0070706_100005420 3300005467 Bacteria 12150
187 Ga0070706_100006733 3300005467 Bacteria 10848
188 Ga0070706_100032990 3300005467 Bacteria 4778
189 Ga0070706_100054718 3300005467 Bacteria 3684
190 Ga0070706_100116712 3300005467 Bacteria 2486
191 Ga0070706_100196718 3300005467 Bacteria 1883
192 Ga0070706_100354440 3300005467 Bacteria 1367
193 Ga0070706_100511771 3300005467 Bacteria 1117
194 Ga0070706_101603960 3300005467 Bacteria 594
195 Ga0070707_100010978 3300005468 Bacteria 8437
196 Ga0070707_100019381 3300005468 Bacteria 6409
197 Ga0070707_100031374 3300005468 Bacteria 5062
198 Ga0070707_100069096 3300005468 Bacteria 3400
199 Ga0070707_100199627 3300005468 Bacteria 1949
200 Ga0070707_100486210 3300005468 Bacteria 1196
201 Ga0070707_100503942 3300005468 Bacteria 1172
202 Ga0070707_101023145 3300005468 Bacteria 791
203 Ga0070707_101143239 3300005468 Bacteria 745
204 Ga0070707_101788170 3300005468 Unclassified 582
205 Ga0070698_100002386 3300005471 Bacteria 20723
206 Ga0070698_100041416 3300005471 Bacteria 4728
207 Ga0070698_100091868 3300005471 Bacteria 3017
208 Ga0070698_100308818 3300005471 Bacteria 1512
209 Ga0070698_100318883 3300005471 Bacteria 1485
210 Ga0070698_100511677 3300005471 Bacteria 1139
211 Ga0070698_100870836 3300005471 Unclassified 846
212 Ga0070698_101658750 3300005471 Unclassified 592
213 Ga0070699_100011379 3300005518 Bacteria 7682
214 Ga0070699_100018505 3300005518 Bacteria 5983
215 Ga0070699_100043826 3300005518 Bacteria 3872
216 Ga0070699_100056139 3300005518 Bacteria 3410
217 Ga0070699_100080530 3300005518 Bacteria 2838
218 Ga0070699_100170794 3300005518 Bacteria 1927
219 Ga0070699_100371683 3300005518 Bacteria 1290
220 Ga0070699_100387940 3300005518 Bacteria 1262
221 Ga0070699_100438654 3300005518 Unclassified 1183
222 Ga0070699_100507596 3300005518 Bacteria 1096
223 Ga0070699_100562079 3300005518 Bacteria 1039
224 Ga0070699_100853234 3300005518 Bacteria 834
225 Ga0070679_100002130 3300005530 Bacteria 17837
226 Ga0070679_100017081 3300005530 Bacteria 7014
227 Ga0070679_100021300 3300005530 Bacteria 6327
228 Ga0070679_100041085 3300005530 Bacteria 4604
229 Ga0070679_100043914 3300005530 Bacteria 4451
230 Ga0070679_100051807 3300005530 Bacteria 4089
231 Ga0070679_100059965 3300005530 Bacteria 3792
232 Ga0070679_100105697 3300005530 Bacteria 2801
233 Ga0070679_100191563 3300005530 Bacteria 2013
234 Ga0070679_100659981 3300005530 Bacteria 988
235 Ga0070679_100847722 3300005530 Unclassified 857
236 Ga0070679_100968430 3300005530 Unclassified 794
237 Ga0070679_101006130 3300005530 Unclassified 778
238 Ga0070679_101090234 3300005530 Bacteria 743
239 Ga0070684_100075076 3300005535 Bacteria 2981
240 Ga0070684_100225088 3300005535 Bacteria 1712
241 Ga0070684_100447061 3300005535 Bacteria 1194
242 Ga0070684_100882540 3300005535 Viruses 837
243 Ga0070684_101737285 3300005535 Bacteria 589
244 Ga0070697_100015335 3300005536 Bacteria 6014
245 Ga0070697_100045075 3300005536 Bacteria 3573
246 Ga0070697_100066579 3300005536 Bacteria 2945
247 Ga0070697_100152238 3300005536 Bacteria 1950
248 Ga0070697_100197635 3300005536 Bacteria 1708
249 Ga0070697_100235806 3300005536 Unclassified 1562
250 Ga0070697_100286417 3300005536 Bacteria 1414
251 Ga0070697_100289628 3300005536 Unclassified 1406
252 Ga0070697_100304357 3300005536 Bacteria 1371
253 Ga0070697_100717790 3300005536 Bacteria 882
254 Ga0068853_100030002 3300005539 Bacteria 4590
255 Ga0068853_100096267 3300005539 Bacteria 2611
256 Ga0068853_100103900 3300005539 Bacteria 2515
257 Ga0068853_100472817 3300005539 Bacteria 1181
258 Ga0068853_100961508 3300005539 Bacteria 821
259 Ga0068853_101199116 3300005539 Unclassified 733
260 Ga0070686_100356060 3300005544 Bacteria 1101
261 Ga0070695_100843376 3300005545 Bacteria 737
262 Ga0070696_100040678 3300005546 Bacteria 3210
263 Ga0070696_100688771 3300005546 Unclassified 832
264 Ga0070693_100023038 3300005547 Bacteria 3322
265 Ga0070693_100026169 3300005547 Bacteria 3148
266 Ga0070693_100068527 3300005547 Bacteria 2083
267 Ga0070693_100323126 3300005547 Bacteria 1048
268 Ga0070693_100711938 3300005547 Bacteria 736
269 Ga0070665_100056980 3300005548 Bacteria 3918
270 Ga0070665_100298376 3300005548 Bacteria 1614
271 Ga0070704_100733286 3300005549 Bacteria 879
272 Ga0070704_101168591 3300005549 Bacteria 701
273 Ga0068855_100005920 3300005563 Bacteria 14907
274 Ga0068855_100007209 3300005563 Bacteria 13492
275 Ga0068855_100009704 3300005563 Bacteria 11622
276 Ga0068855_100038946 3300005563 Bacteria 5644
277 Ga0068855_100125566 3300005563 Bacteria 2934
278 Ga0068855_100136459 3300005563 Bacteria 2799
279 Ga0068855_100200944 3300005563 Bacteria 2244
280 Ga0068855_100203048 3300005563 Bacteria 2230
281 Ga0068855_100243731 3300005563 Bacteria 2007
282 Ga0068855_100994968 3300005563 Unclassified 881
283 Ga0068855_101000377 3300005563 Bacteria 878
284 Ga0070664_100000866 3300005564 Bacteria 23426
285 Ga0070664_100093002 3300005564 Bacteria 2612
286 Ga0070664_100653764 3300005564 Unclassified 977
287 Ga0068857_100000411 3300005577 Bacteria 30229
288 Ga0068857_100009678 3300005577 Bacteria 8373
289 Ga0068857_100017406 3300005577 Bacteria 6298
290 Ga0068857_100042347 3300005577 Bacteria 4039
291 Ga0068857_100341179 3300005577 Bacteria 1386
292 Ga0068857_102227422 3300005577 Bacteria 538
293 Ga0068854_100020791 3300005578 Bacteria 4446
294 Ga0068854_100023618 3300005578 Bacteria 4201
295 Ga0068854_100060568 3300005578 Bacteria 2739
296 Ga0068854_100066312 3300005578 Bacteria 2627
297 Ga0068854_100088598 3300005578 Bacteria 2298
298 Ga0068854_100102336 3300005578 Bacteria 2149
299 Ga0068856_100008169 3300005614 Bacteria 10206
300 Ga0068856_100012953 3300005614 Bacteria 8074
301 Ga0068856_100032852 3300005614 Bacteria 5081
302 Ga0068856_100037367 3300005614 Bacteria 4766
303 Ga0068856_100057505 3300005614 Bacteria 3839
304 Ga0068856_100103267 3300005614 Bacteria 2844
305 Ga0068856_100121927 3300005614 Bacteria 2609
306 Ga0068856_100403058 3300005614 Bacteria 1387
307 Ga0068856_100716981 3300005614 Bacteria 1020
308 Ga0070702_100011129 3300005615 Bacteria 4465
309 Ga0070702_100047580 3300005615 Bacteria 2437
310 Ga0070702_100192593 3300005615 Bacteria 1343
311 Ga0070702_100587702 3300005615 Bacteria 832
312 Ga0068852_100012058 3300005616 Bacteria 6542
313 Ga0068852_100032637 3300005616 Bacteria 4313
314 Ga0068852_100112836 3300005616 Bacteria 2474
315 Ga0068852_100422951 3300005616 Bacteria 1314
316 Ga0068852_101237040 3300005616 Bacteria 768
317 Ga0068859_100000001 3300005617 Bacteria 545224
318 Ga0068859_100102667 3300005617 Bacteria 2917
319 Ga0068859_100775216 3300005617 Bacteria 1047
320 Ga0068864_100000001 3300005618 Bacteria 686767
321 Ga0068864_100015763 3300005618 Bacteria 6287
322 Ga0068864_100136078 3300005618 Bacteria 2212
323 Ga0068864_101108302 3300005618 Bacteria 788
324 Ga0068866_10057313 3300005718 Bacteria 2007
325 Ga0068866_10785266 3300005718 Unclassified 661
326 Ga0068870_10059842 3300005840 Bacteria 2043
327 Ga0068870_10402039 3300005840 Bacteria 891
328 Ga0068863_100100913 3300005841 Bacteria 2743
329 Ga0068863_100126026 3300005841 Bacteria 2443
330 Ga0068863_100388966 3300005841 Bacteria 1363
331 Ga0068863_100590054 3300005841 Bacteria 1099
332 Ga0068863_100687900 3300005841 Unclassified 1016
333 Ga0068863_101415259 3300005841 Bacteria 703
334 Ga0068858_100000467 3300005842 Bacteria 42180
335 Ga0068858_100009146 3300005842 Bacteria 9474
336 Ga0068858_100037092 3300005842 Bacteria 4519
337 Ga0068858_100729284 3300005842 Bacteria 965
338 Ga0068860_100127649 3300005843 Bacteria 2438
339 Ga0068860_100208777 3300005843 Bacteria 1894
340 Ga0070717_10000089 3300006028 Bacteria 71898
341 Ga0070717_10003192 3300006028 Bacteria 11711
342 Ga0070717_10003519 3300006028 Bacteria 11221
343 Ga0070717_10007708 3300006028 Bacteria 8008
344 Ga0070717_10109003 3300006028 Bacteria 2360
345 Ga0070717_10154244 3300006028 Bacteria 1989
346 Ga0070717_10176333 3300006028 Bacteria 1861
347 Ga0070717_10178463 3300006028 Unclassified 1850
348 Ga0070717_10246108 3300006028 Unclassified 1578
349 Ga0070717_10255770 3300006028 Bacteria 1548
350 Ga0070717_10311075 3300006028 Bacteria 1402
351 Ga0070717_10439465 3300006028 Bacteria 1175
352 Ga0070717_10442247 3300006028 Bacteria 1171
353 Ga0070717_10452265 3300006028 Bacteria 1157
354 Ga0070717_10499744 3300006028 Bacteria 1099
355 Ga0070717_10505250 3300006028 Bacteria 1093
356 Ga0070717_10554327 3300006028 Bacteria 1041
357 Ga0070717_10762548 3300006028 Bacteria 880
358 Ga0070717_10852097 3300006028 Bacteria 829
359 Ga0070717_10989546 3300006028 Unclassified 766
360 Ga0070717_11006649 3300006028 Bacteria 759
361 Ga0070717_11062232 3300006028 Bacteria 737
362 Ga0070717_11171334 3300006028 Bacteria 699
363 Ga0070717_11226929 3300006028 Unclassified 682
364 Ga0070715_10029831 3300006163 Unclassified 2200
365 Ga0070715_10134463 3300006163 Bacteria 1194
366 Ga0070716_100012539 3300006173 Bacteria 4299
367 Ga0070716_100069089 3300006173 Bacteria 2069
368 Ga0070716_100236640 3300006173 Bacteria 1236
369 Ga0070716_100251525 3300006173 Bacteria 1204
370 Ga0070716_100299575 3300006173 Bacteria 1118
371 Ga0070716_100339365 3300006173 Bacteria 1059
372 Ga0070712_100003532 3300006175 Bacteria 9625
373 Ga0070712_100018655 3300006175 Bacteria 4511
374 Ga0070712_100032656 3300006175 Bacteria 3516
375 Ga0070712_100049048 3300006175 Bacteria 2930
376 Ga0070712_100162949 3300006175 Bacteria 1723
377 Ga0070712_100173972 3300006175 Bacteria 1673
378 Ga0070712_100220913 3300006175 Bacteria 1500
379 Ga0070712_100244025 3300006175 Bacteria 1432
380 Ga0070712_100354583 3300006175 Bacteria 1201
381 Ga0070712_100376087 3300006175 Bacteria 1168
382 Ga0070712_100387133 3300006175 Bacteria 1152
383 Ga0070712_100397837 3300006175 Unclassified 1137
384 Ga0070712_101630862 3300006175 Unclassified 564
385 Ga0097621_100000105 3300006237 Bacteria 47605
386 Ga0097621_100000310 3300006237 Bacteria 32966
387 Ga0097621_100000987 3300006237 Bacteria 19981
388 Ga0097621_100029240 3300006237 Bacteria 4351
389 Ga0097621_100125003 3300006237 Bacteria 2184
390 Ga0097621_100378247 3300006237 Bacteria 1264
391 Ga0097621_100973584 3300006237 Unclassified 793
392 Ga0068871_100000837 3300006358 Bacteria 20609
393 Ga0068871_100003783 3300006358 Bacteria 10419
394 Ga0068871_100009686 3300006358 Bacteria 6994
395 Ga0068871_100197519 3300006358 Bacteria 1735
396 Ga0068871_100705305 3300006358 Bacteria 925
397 Ga0068871_101044475 3300006358 Bacteria 762
398 Ga0075428_100002434 3300006844 Bacteria 20219
399 Ga0075428_100044054 3300006844 Bacteria 4905
400 Ga0075428_100087764 3300006844 Bacteria 3393
401 Ga0075428_100565788 3300006844 Bacteria 1215
402 Ga0075428_100950193 3300006844 Bacteria 911
403 Ga0075430_100068934 3300006846 Bacteria 2968
404 Ga0075430_100312390 3300006846 Bacteria 1300
405 Ga0075430_100926302 3300006846 Unclassified 718
406 Ga0075430_101192108 3300006846 Bacteria 627
407 Ga0075431_100017617 3300006847 Bacteria 7261
408 Ga0075431_100047210 3300006847 Bacteria 4439
409 Ga0075433_10008295 3300006852 Bacteria 8282
410 Ga0075433_10304686 3300006852 Bacteria 1411
411 Ga0075433_10786556 3300006852 Bacteria 832
412 Ga0075433_10964406 3300006852 Bacteria 743
413 Ga0075434_100016559 3300006871 Bacteria 7089
414 Ga0075434_100018244 3300006871 Bacteria 6777
415 Ga0075434_100090357 3300006871 Bacteria 3064
416 Ga0075434_100100266 3300006871 Unclassified 2902
417 Ga0075434_100128993 3300006871 Bacteria 2547
418 Ga0075434_100245724 3300006871 Unclassified 1809
419 Ga0075434_100390522 3300006871 Bacteria 1413
420 Ga0075434_100629290 3300006871 Bacteria 1092
421 Ga0075434_100782837 3300006871 Unclassified 970
422 Ga0075429_100336049 3300006880 Bacteria 1322
423 Ga0075429_100685577 3300006880 Bacteria 898
424 Ga0068865_100079200 3300006881 Bacteria 2353
425 Ga0068865_100197831 3300006881 Bacteria 1559
426 Ga0068865_100850751 3300006881 Bacteria 790
427 Ga0075436_100003427 3300006914 Bacteria 10872
428 Ga0075436_100009672 3300006914 Bacteria 6599
429 Ga0075436_100012530 3300006914 Bacteria 5811
430 Ga0075436_100022071 3300006914 Bacteria 4371
431 Ga0075436_100036783 3300006914 Bacteria 3380
432 Ga0075436_100105033 3300006914 Bacteria 1969
433 Ga0075436_100270051 3300006914 Bacteria 1214
434 Ga0075436_100271612 3300006914 Bacteria 1211
435 Ga0075436_100301844 3300006914 Bacteria 1148
436 Ga0097620_100000001 3300006931 Bacteria 545224
437 Ga0097620_100102673 3300006931 Bacteria 2917
438 Ga0097620_100775339 3300006931 Bacteria 1047
439 Ga0075435_100000187 3300007076 Bacteria 37010
440 Ga0075435_100012620 3300007076 Bacteria 6259
441 Ga0075435_100025300 3300007076 Bacteria 4620
442 Ga0075435_100051127 3300007076 Bacteria 3328
443 Ga0075435_100147251 3300007076 Bacteria 1978
444 Ga0075435_100286265 3300007076 Unclassified 1407
445 Ga0075435_100309842 3300007076 Bacteria 1351
446 Ga0075435_100688686 3300007076 Bacteria 888
447 Ga0099795_10069494 3300007788 Bacteria 1325
448 Ga0099795_10086882 3300007788 Bacteria 1206
449 Ga0105240_10013038 3300009093 Bacteria 11442
450 Ga0105240_10024899 3300009093 Bacteria 7878
451 Ga0105240_10044258 3300009093 Bacteria 5659
452 Ga0105240_10047167 3300009093 Bacteria 5453
453 Ga0105240_10053697 3300009093 Bacteria 5056
454 Ga0105240_10060071 3300009093 Bacteria 4741
455 Ga0105240_10061933 3300009093 Bacteria 4660
456 Ga0105240_10070273 3300009093 Bacteria 4332
457 Ga0105240_10096593 3300009093 Bacteria 3601
458 Ga0105240_10265016 3300009093 Bacteria 1981
459 Ga0105240_10385121 3300009093 Bacteria 1583
460 Ga0105240_10413961 3300009093 Bacteria 1516
461 Ga0105240_10521960 3300009093 Bacteria 1318
462 Ga0105240_10564658 3300009093 Bacteria 1257
463 Ga0105240_10789909 3300009093 Bacteria 1029
464 Ga0105240_11934558 3300009093 Unclassified 613
465 Ga0111539_10000003 3300009094 Bacteria 880006
466 Ga0111539_10189545 3300009094 Unclassified 2400
467 Ga0111539_10361181 3300009094 Bacteria 1690
468 Ga0105245_10000010 3300009098 Bacteria 278233
469 Ga0105245_10000376 3300009098 Bacteria 41489
470 Ga0105245_10000598 3300009098 Bacteria 32661
471 Ga0105245_10001899 3300009098 Bacteria 18994
472 Ga0105245_10033851 3300009098 Bacteria 4528
473 Ga0105245_10727007 3300009098 Bacteria 1027
474 Ga0114129_10084367 3300009147 Bacteria 4411
475 Ga0114129_10114023 3300009147 Bacteria 3727
476 Ga0114129_10614802 3300009147 Bacteria 1406
477 Ga0114129_10831647 3300009147 Unclassified 1175
478 Ga0114129_11940937 3300009147 Bacteria 713
479 Ga0105241_10056519 3300009174 Bacteria 3009
480 Ga0105241_10659924 3300009174 Bacteria 951
481 Ga0105241_10899135 3300009174 Bacteria 822
482 Ga0105242_10003591 3300009176 Bacteria 12063
483 Ga0105242_10085585 3300009176 Bacteria 2644
484 Ga0105242_10090010 3300009176 Bacteria 2581
485 Ga0105242_11209705 3300009176 Bacteria 775
486 Ga0105248_10005773 3300009177 Bacteria 13599
487 Ga0105248_10083969 3300009177 Bacteria 3582
488 Ga0105248_10164874 3300009177 Bacteria 2498
489 Ga0105248_10203691 3300009177 Bacteria 2230
490 Ga0105248_10312224 3300009177 Bacteria 1771
491 Ga0105248_11732161 3300009177 Bacteria 708
492 Ga0105237_10020063 3300009545 Bacteria 6900
493 Ga0105237_10054701 3300009545 Bacteria 3999
494 Ga0105237_10253081 3300009545 Bacteria 1763
495 Ga0105237_10327000 3300009545 Bacteria 1537
496 Ga0105237_10682122 3300009545 Bacteria 1034
497 Ga0105237_11001398 3300009545 Bacteria 842
498 Ga0105237_11385806 3300009545 Bacteria 709
499 Ga0105238_10000002 3300009551 Bacteria 772711
500 Ga0105238_10001073 3300009551 Bacteria 27609
501 Ga0105238_10022389 3300009551 Bacteria 6440
502 Ga0105238_10030613 3300009551 Bacteria 5479
503 Ga0105238_10265593 3300009551 Bacteria 1696
504 Ga0105238_10349329 3300009551 Bacteria 1468
505 Ga0105238_10354724 3300009551 Bacteria 1456
506 Ga0105238_10936092 3300009551 Bacteria 886
507 Ga0105238_11085244 3300009551 Bacteria 823
508 Ga0105238_11318511 3300009551 Bacteria 748
509 Ga0105238_11624685 3300009551 Bacteria 676
510 Ga0105249_10276614 3300009553 Bacteria 1675
511 Ga0105239_10046171 3300010375 Bacteria 4773
512 Ga0105239_10047898 3300010375 Bacteria 4685
513 Ga0105239_10150288 3300010375 Bacteria 2599
514 Ga0105239_10669464 3300010375 Bacteria 1186
515 Ga0105239_10675359 3300010375 Bacteria 1180
516 Ga0105239_11132276 3300010375 Bacteria 901
517 Ga0105246_10125623 3300011119 Bacteria 1908
518 Ga0157373_10035076 3300013100 Bacteria 3603
519 Ga0157373_10041467 3300013100 Bacteria 3293
520 Ga0157373_10095981 3300013100 Bacteria 2087
521 Ga0157373_11252787 3300013100 Unclassified 560
522 Ga0157371_10013642 3300013102 Bacteria 6167
523 Ga0157371_10059203 3300013102 Bacteria 2715
524 Ga0157371_10151287 3300013102 Bacteria 1655
525 Ga0157371_10157590 3300013102 Bacteria 1621
526 Ga0157371_10197060 3300013102 Bacteria 1443
527 Ga0157370_10047428 3300013104 Bacteria 4118
528 Ga0157370_10060753 3300013104 Bacteria 3587
529 Ga0157370_10137920 3300013104 Bacteria 2273
530 Ga0157370_10142918 3300013104 Bacteria 2229
531 Ga0157370_10225299 3300013104 Bacteria 1736
532 Ga0157370_10259732 3300013104 Bacteria 1605
533 Ga0157370_10285221 3300013104 Unclassified 1525
534 Ga0157370_10303636 3300013104 Bacteria 1473
535 Ga0157370_10349405 3300013104 Unclassified 1363
536 Ga0157370_10743664 3300013104 Bacteria 894
537 Ga0157369_10000226 3300013105 Bacteria 77681
538 Ga0157369_10000589 3300013105 Bacteria 47375
539 Ga0157369_10036635 3300013105 Bacteria 5373
540 Ga0157369_10050121 3300013105 Bacteria 4523
541 Ga0157369_10050515 3300013105 Bacteria 4503
542 Ga0157369_10051610 3300013105 Bacteria 4450
543 Ga0157369_10052618 3300013105 Bacteria 4405
544 Ga0157369_10065221 3300013105 Bacteria 3920
545 Ga0157369_10119470 3300013105 Bacteria 2797
546 Ga0157369_10144184 3300013105 Bacteria 2518
547 Ga0157369_10216440 3300013105 Unclassified 2006
548 Ga0157369_10224513 3300013105 Bacteria 1965
549 Ga0157369_10250432 3300013105 Bacteria 1849
550 Ga0157369_10262051 3300013105 Bacteria 1803
551 Ga0157369_10336609 3300013105 Unclassified 1568
552 Ga0157369_10422859 3300013105 Bacteria 1381
553 Ga0157374_10000354 3300013296 Bacteria 42454
554 Ga0157374_10000422 3300013296 Bacteria 38332
555 Ga0157374_10009945 3300013296 Bacteria 8167
556 Ga0157374_10019238 3300013296 Bacteria 6041
557 Ga0157374_10063273 3300013296 Bacteria 3470
558 Ga0157374_10065197 3300013296 Bacteria 3420
559 Ga0157374_10147550 3300013296 Bacteria 2285
560 Ga0157374_11218271 3300013296 Bacteria 774
561 Ga0157378_10000328 3300013297 Bacteria 46856
562 Ga0157378_10000383 3300013297 Bacteria 43831
563 Ga0157378_10000545 3300013297 Bacteria 35778
564 Ga0157378_10000678 3300013297 Bacteria 31999
565 Ga0157378_10001262 3300013297 Bacteria 22775
566 Ga0157378_10012420 3300013297 Bacteria 7457
567 Ga0157378_10065860 3300013297 Bacteria 3243
568 Ga0157378_10943603 3300013297 Bacteria 895
569 Ga0157378_11307456 3300013297 Bacteria 766
570 Ga0157378_11461715 3300013297 Bacteria 727
571 Ga0163162_10028742 3300013306 Bacteria 5503
572 Ga0163162_10107826 3300013306 Bacteria 2881
573 Ga0157372_10000068 3300013307 Bacteria 111270
574 Ga0157372_10000321 3300013307 Bacteria 52711
575 Ga0157372_10000536 3300013307 Bacteria 41814
576 Ga0157372_10014991 3300013307 Bacteria 8295
577 Ga0157372_10016084 3300013307 Bacteria 8026
578 Ga0157372_10022300 3300013307 Bacteria 6850
579 Ga0157372_10025353 3300013307 Bacteria 6445
580 Ga0157372_10053320 3300013307 Unclassified 4507
581 Ga0157372_10057899 3300013307 Bacteria 4332
582 Ga0157372_10105486 3300013307 Bacteria 3223
583 Ga0157372_10151250 3300013307 Bacteria 2679
584 Ga0157372_10268494 3300013307 Bacteria 1982
585 Ga0157372_10441398 3300013307 Bacteria 1517
586 Ga0157372_10617735 3300013307 Bacteria 1263
587 Ga0157372_10650161 3300013307 Bacteria 1228
588 Ga0157372_10860540 3300013307 Bacteria 1052
589 Ga0157372_11076825 3300013307 Bacteria 930
590 Ga0157372_11442667 3300013307 Unclassified 793
591 Ga0157372_11633122 3300013307 Bacteria 742
592 Ga0157372_11818785 3300013307 Bacteria 700
593 Ga0157372_11902674 3300013307 Unclassified 684
594 Ga0157375_10000010 3300013308 Bacteria 361011
595 Ga0157375_10000077 3300013308 Bacteria 100528
596 Ga0157375_10000604 3300013308 Bacteria 31871
597 Ga0157375_10108529 3300013308 Bacteria 2870
598 Ga0157375_10411848 3300013308 Bacteria 1518
599 Ga0157375_10953423 3300013308 Unclassified 1000
600 Ga0157375_11389103 3300013308 Bacteria 827
601 Ga0163163_10198346 3300014325 Bacteria 2055
602 Ga0163163_12041774 3300014325 Bacteria 633
603 Ga0157380_10036241 3300014326 Bacteria 3815
604 Ga0157380_10747290 3300014326 Bacteria 989
605 Ga0157377_10000004 3300014745 Bacteria 430019
606 Ga0157377_10000183 3300014745 Bacteria 36240
607 Ga0157377_10325296 3300014745 Bacteria 1023
608 Ga0157377_11144423 3300014745 Bacteria 599
609 Ga0157379_10067740 3300014968 Bacteria 3191
610 Ga0157379_10586753 3300014968 Bacteria 1039
611 Ga0157379_11115941 3300014968 Unclassified 756
612 Ga0157376_10000003 3300014969 Bacteria 568634
613 Ga0157376_10008017 3300014969 Bacteria 7584
614 Ga0157376_10081920 3300014969 Bacteria 2771
615 Ga0157376_10953333 3300014969 Bacteria 879
616 Ga0182006_1154264 3300015261 Bacteria 777
617 Ga0163161_10024299 3300017792 Bacteria 4281
618 Ga0184602_129751 3300019161 Unclassified 774
619 Ga0184596_108408 3300019176 Unclassified 971
620 Ga0184601_108260 3300019183 Bacteria 1593
621 Ga0184599_128580 3300019188 Bacteria 1258
622 Ga0184600_107366 3300019190 Bacteria 1216
623 Ga0184600_123562 3300019190 Bacteria 699
624 Ga0197907_10379512 3300020069 Bacteria 1015
625 Ga0197907_10425626 3300020069 Bacteria 1369
626 Ga0197907_10539006 3300020069 Bacteria 1276
627 Ga0197907_10540100 3300020069 Bacteria 1338
628 Ga0197907_10717659 3300020069 Bacteria 893
629 Ga0197907_10796502 3300020069 Bacteria 1967
630 Ga0197907_10869068 3300020069 Bacteria 1978
631 Ga0197907_11005754 3300020069 Bacteria 1868
632 Ga0206356_10374345 3300020070 Bacteria 965
633 Ga0206356_10433137 3300020070 Bacteria 1226
634 Ga0206356_10684346 3300020070 Bacteria 953
635 Ga0206356_11395039 3300020070 Bacteria 702
636 Ga0206356_11397745 3300020070 Bacteria 2384
637 Ga0206349_1634275 3300020075 Bacteria 1289
638 Ga0206349_1888706 3300020075 Unclassified 1312
639 Ga0206355_1217712 3300020076 Unclassified 650
640 Ga0206355_1435135 3300020076 Bacteria 1679
641 Ga0206351_10110990 3300020077 Bacteria 776
642 Ga0206351_10169684 3300020077 Bacteria 569
643 Ga0206351_10303434 3300020077 Bacteria 2371
644 Ga0206351_10402462 3300020077 Bacteria 1758
645 Ga0206351_10782694 3300020077 Bacteria 952
646 Ga0206351_10911997 3300020077 Bacteria 674
647 Ga0206352_10548939 3300020078 Unclassified 1329
648 Ga0206352_10742236 3300020078 Bacteria 1330
649 Ga0206352_10814601 3300020078 Unclassified 622
650 Ga0206352_10853031 3300020078 Bacteria 657
651 Ga0206350_10417453 3300020080 Unclassified 622
652 Ga0206350_10694412 3300020080 Bacteria 1657
653 Ga0206350_10704807 3300020080 Bacteria 877
654 Ga0206350_10783616 3300020080 Bacteria 1043
655 Ga0206350_11500735 3300020080 Unclassified 859
656 Ga0206354_10345737 3300020081 Bacteria 958
657 Ga0206354_11268864 3300020081 Bacteria 1405
658 Ga0206353_10839656 3300020082 Bacteria 808
659 Ga0206353_11764120 3300020082 Bacteria 507
660 Ga0206353_11887567 3300020082 Unclassified 830
661 Ga0206353_11971794 3300020082 Bacteria 1565
662 Ga0154015_1009766 3300020610 Unclassified 734
663 Ga0154015_1182847 3300020610 Bacteria 1063
664 Ga0213873_10000001 3300021358 Bacteria 1657979
665 Ga0213873_10000358 3300021358 Bacteria 7542
666 Ga0213874_10197723 3300021377 Bacteria 722
667 Ga0213876_10000015 3300021384 Bacteria 304025
668 Ga0213876_10000203 3300021384 Bacteria 60770
669 Ga0213876_10008965 3300021384 Bacteria 5395
670 Ga0213876_10015149 3300021384 Bacteria 4084
671 Ga0224712_10010154 3300022467 Bacteria 2868
672 Ga0224712_10025251 3300022467 Bacteria 2086
673 Ga0224712_10069648 3300022467 Bacteria 1425
674 Ga0224712_10081856 3300022467 Unclassified 1334
675 Ga0224712_10097294 3300022467 Bacteria 1242
676 Ga0224712_10166174 3300022467 Unclassified 987
677 Ga0224712_10230023 3300022467 Bacteria 851
678 Ga0224712_10602424 3300022467 Bacteria 536
679 Ga0224712_10621586 3300022467 Unclassified 528
680 Ga0247555_100578 3300023539 Bacteria 984
681 Ga0247553_100294 3300023672 Bacteria 1728
682 Ga0224572_1042095 3300024225 Unclassified 859
683 Ga0228598_1001498 3300024227 Bacteria 5125
684 Ga0228598_1026759 3300024227 Bacteria 1135
685 Ga0207656_10025741 3300025321 Bacteria 2392
686 Ga0207682_10469931 3300025893 Unclassified 596
687 Ga0207692_10031523 3300025898 Bacteria 2540
688 Ga0207692_10143764 3300025898 Bacteria 1359
689 Ga0207692_10794131 3300025898 Bacteria 619
690 Ga0207642_10131415 3300025899 Unclassified 1307
691 Ga0207642_10500581 3300025899 Unclassified 744
692 Ga0207688_10084127 3300025901 Bacteria 1821
693 Ga0207680_10087293 3300025903 Bacteria 1975
694 Ga0207647_10002357 3300025904 Bacteria 14349
695 Ga0207685_10028724 3300025905 Bacteria 1962
696 Ga0207685_10032655 3300025905 Bacteria 1874
697 Ga0207685_10035964 3300025905 Bacteria 1812
698 Ga0207699_10009273 3300025906 Unclassified 4892
699 Ga0207699_10165984 3300025906 Bacteria 1474
700 Ga0207699_10501426 3300025906 Unclassified 876
701 Ga0207699_10589220 3300025906 Bacteria 809
702 Ga0207699_10786717 3300025906 Bacteria 699
703 Ga0207645_10021974 3300025907 Bacteria 4156
704 Ga0207645_10157090 3300025907 Bacteria 1486
705 Ga0207645_10527792 3300025907 Bacteria 800
706 Ga0207643_10042578 3300025908 Bacteria 2560
707 Ga0207643_10220968 3300025908 Bacteria 1159
708 Ga0207705_10000465 3300025909 Bacteria 34700
709 Ga0207705_10013917 3300025909 Bacteria 5801
710 Ga0207705_10079084 3300025909 Bacteria 2394
711 Ga0207705_10191530 3300025909 Bacteria 1547
712 Ga0207684_10002137 3300025910 Bacteria 20256
713 Ga0207684_10019277 3300025910 Bacteria 5837
714 Ga0207684_10027313 3300025910 Bacteria 4865
715 Ga0207684_10039142 3300025910 Bacteria 4023
716 Ga0207684_10177588 3300025910 Bacteria 1836
717 Ga0207684_10350683 3300025910 Bacteria 1270
718 Ga0207684_10353952 3300025910 Bacteria 1264
719 Ga0207654_10252553 3300025911 Bacteria 1183
720 Ga0207654_10384908 3300025911 Bacteria 972
721 Ga0207707_10009163 3300025912 Bacteria 8598
722 Ga0207707_10009842 3300025912 Bacteria 8289
723 Ga0207707_10010547 3300025912 Bacteria 8022
724 Ga0207707_10015240 3300025912 Bacteria 6693
725 Ga0207707_10040973 3300025912 Bacteria 4044
726 Ga0207707_10191234 3300025912 Unclassified 1786
727 Ga0207707_10222196 3300025912 Bacteria 1644
728 Ga0207707_10425647 3300025912 Bacteria 1138
729 Ga0207707_10477695 3300025912 Bacteria 1065
730 Ga0207707_10563947 3300025912 Bacteria 966
731 Ga0207707_11157218 3300025912 Bacteria 628
732 Ga0207695_10001894 3300025913 Bacteria 32659
733 Ga0207695_10004033 3300025913 Bacteria 20203
734 Ga0207695_10054696 3300025913 Bacteria 4165
735 Ga0207695_10056717 3300025913 Bacteria 4075
736 Ga0207695_10082572 3300025913 Bacteria 3248
737 Ga0207695_10202755 3300025913 Bacteria 1897
738 Ga0207695_10263281 3300025913 Bacteria 1621
739 Ga0207695_10487441 3300025913 Unclassified 1115
740 Ga0207695_10513928 3300025913 Bacteria 1079
741 Ga0207695_10528046 3300025913 Bacteria 1062
742 Ga0207695_11012185 3300025913 Bacteria 711
743 Ga0207695_11137974 3300025913 Bacteria 660
744 Ga0207671_10128012 3300025914 Bacteria 1947
745 Ga0207671_10224068 3300025914 Unclassified 1474
746 Ga0207671_10397732 3300025914 Bacteria 1096
747 Ga0207693_10002022 3300025915 Bacteria 17794
748 Ga0207693_10011730 3300025915 Bacteria 7086
749 Ga0207693_10048525 3300025915 Bacteria 3334
750 Ga0207693_10056621 3300025915 Bacteria 3073
751 Ga0207693_10069057 3300025915 Bacteria 2766
752 Ga0207693_10241705 3300025915 Unclassified 1417
753 Ga0207693_10259381 3300025915 Bacteria 1363
754 Ga0207693_10323002 3300025915 Bacteria 1208
755 Ga0207693_10413674 3300025915 Bacteria 1054
756 Ga0207693_10761552 3300025915 Bacteria 748
757 Ga0207663_10001864 3300025916 Bacteria 9977
758 Ga0207663_10028448 3300025916 Bacteria 3272
759 Ga0207663_10075435 3300025916 Bacteria 2188
760 Ga0207663_10090428 3300025916 Unclassified 2029
761 Ga0207663_10102907 3300025916 Bacteria 1922
762 Ga0207663_10127400 3300025916 Unclassified 1753
763 Ga0207663_10235345 3300025916 Bacteria 1340
764 Ga0207663_10246497 3300025916 Bacteria 1313
765 Ga0207663_10695439 3300025916 Unclassified 805
766 Ga0207660_10000046 3300025917 Bacteria 61187
767 Ga0207660_10016552 3300025917 Bacteria 4882
768 Ga0207660_10018783 3300025917 Bacteria 4614
769 Ga0207660_10042097 3300025917 Bacteria 3204
770 Ga0207660_10135597 3300025917 Bacteria 1878
771 Ga0207660_10164831 3300025917 Bacteria 1712
772 Ga0207660_10252536 3300025917 Bacteria 1392
773 Ga0207660_10804381 3300025917 Bacteria 767
774 Ga0207660_10995453 3300025917 Bacteria 684
775 Ga0207660_11101635 3300025917 Bacteria 647
776 Ga0207662_10012231 3300025918 Bacteria 4777
777 Ga0207662_10080969 3300025918 Bacteria 1982
778 Ga0207657_10002434 3300025919 Bacteria 20096
779 Ga0207657_10004942 3300025919 Bacteria 14024
780 Ga0207657_10233686 3300025919 Bacteria 1470
781 Ga0207649_10210518 3300025920 Bacteria 1379
782 Ga0207649_11122139 3300025920 Unclassified 621
783 Ga0207652_10007259 3300025921 Bacteria 8929
784 Ga0207652_10021650 3300025921 Bacteria 5306
785 Ga0207652_10030873 3300025921 Bacteria 4493
786 Ga0207652_10041598 3300025921 Bacteria 3907
787 Ga0207652_10080997 3300025921 Bacteria 2839
788 Ga0207652_10108104 3300025921 Bacteria 2464
789 Ga0207652_10241217 3300025921 Bacteria 1629
790 Ga0207652_10384970 3300025921 Unclassified 1266
791 Ga0207652_10514521 3300025921 Bacteria 1077
792 Ga0207652_10520628 3300025921 Bacteria 1070
793 Ga0207652_11043225 3300025921 Bacteria 717
794 Ga0207646_10004008 3300025922 Bacteria 16295
795 Ga0207646_10004874 3300025922 Bacteria 14380
796 Ga0207646_10102318 3300025922 Bacteria 2568
797 Ga0207646_10156938 3300025922 Bacteria 2053
798 Ga0207646_10235893 3300025922 Bacteria 1653
799 Ga0207646_10276655 3300025922 Bacteria 1517
800 Ga0207646_10289890 3300025922 Bacteria 1479
801 Ga0207646_10302817 3300025922 Bacteria 1444
802 Ga0207646_10312355 3300025922 Bacteria 1420
803 Ga0207646_10324743 3300025922 Unclassified 1390
804 Ga0207646_11336553 3300025922 Unclassified 625
805 Ga0207694_10000001 3300025924 Bacteria 4078485
806 Ga0207694_10010846 3300025924 Bacteria 6878
807 Ga0207694_10025697 3300025924 Bacteria 4477
808 Ga0207694_10042291 3300025924 Bacteria 3515
809 Ga0207694_10218421 3300025924 Bacteria 1554
810 Ga0207694_10506208 3300025924 Bacteria 1011
811 Ga0207694_10527582 3300025924 Bacteria 990
812 Ga0207650_10000453 3300025925 Bacteria 34778
813 Ga0207650_10001518 3300025925 Bacteria 16598
814 Ga0207650_10038864 3300025925 Bacteria 3478
815 Ga0207650_10052864 3300025925 Bacteria 3010
816 Ga0207659_10000006 3300025926 Bacteria 384976
817 Ga0207687_10000005 3300025927 Bacteria 770649
818 Ga0207687_10000266 3300025927 Bacteria 35609
819 Ga0207687_10000753 3300025927 Bacteria 21897
820 Ga0207687_10001541 3300025927 Bacteria 15813
821 Ga0207687_10050541 3300025927 Bacteria 2894
822 Ga0207687_10232101 3300025927 Bacteria 1458
823 Ga0207700_10006682 3300025928 Bacteria 6996
824 Ga0207700_10021316 3300025928 Unclassified 4422
825 Ga0207700_10027264 3300025928 Bacteria 3998
826 Ga0207700_10027562 3300025928 Bacteria 3981
827 Ga0207700_10079211 3300025928 Bacteria 2558
828 Ga0207700_10079893 3300025928 Bacteria 2548
829 Ga0207700_10179225 3300025928 Bacteria 1773
830 Ga0207700_10189294 3300025928 Bacteria 1728
831 Ga0207700_10295414 3300025928 Bacteria 1397
832 Ga0207700_10377751 3300025928 Bacteria 1239
833 Ga0207700_10718342 3300025928 Bacteria 892
834 Ga0207700_10881985 3300025928 Unclassified 801
835 Ga0207664_10023253 3300025929 Bacteria 4640
836 Ga0207664_10106371 3300025929 Bacteria 2326
837 Ga0207664_10163918 3300025929 Bacteria 1898
838 Ga0207664_10164663 3300025929 Bacteria 1893
839 Ga0207664_10180610 3300025929 Bacteria 1811
840 Ga0207664_10229970 3300025929 Bacteria 1612
841 Ga0207664_10233341 3300025929 Bacteria 1600
842 Ga0207664_10260055 3300025929 Bacteria 1518
843 Ga0207664_10334653 3300025929 Bacteria 1338
844 Ga0207664_10419261 3300025929 Bacteria 1192
845 Ga0207664_10670069 3300025929 Unclassified 933
846 Ga0207644_10285796 3300025931 Bacteria 1325
847 Ga0207644_10896507 3300025931 Bacteria 743
848 Ga0207690_10305492 3300025932 Bacteria 1246
849 Ga0207706_10352804 3300025933 Bacteria 1279
850 Ga0207686_10003600 3300025934 Bacteria 8298
851 Ga0207686_10070463 3300025934 Bacteria 2246
852 Ga0207686_10093474 3300025934 Bacteria 1991
853 Ga0207709_10101715 3300025935 Bacteria 1901
854 Ga0207670_10066653 3300025936 Bacteria 2474
855 Ga0207670_10235209 3300025936 Bacteria 1409
856 Ga0207670_10364784 3300025936 Bacteria 1147
857 Ga0207670_10386608 3300025936 Bacteria 1116
858 Ga0207704_10142310 3300025938 Bacteria 1680
859 Ga0207704_10446628 3300025938 Bacteria 1031
860 Ga0207704_10460936 3300025938 Unclassified 1016
861 Ga0207665_10002075 3300025939 Bacteria 13523
862 Ga0207665_10011933 3300025939 Bacteria 5707
863 Ga0207665_10073967 3300025939 Bacteria 2332
864 Ga0207665_10081528 3300025939 Bacteria 2228
865 Ga0207665_10105979 3300025939 Bacteria 1969
866 Ga0207665_10132174 3300025939 Bacteria 1773
867 Ga0207665_10140563 3300025939 Bacteria 1721
868 Ga0207665_10150408 3300025939 Bacteria 1667
869 Ga0207665_10225328 3300025939 Bacteria 1376
870 Ga0207665_10313127 3300025939 Bacteria 1176
871 Ga0207665_10849123 3300025939 Bacteria 723
872 Ga0207665_10949755 3300025939 Bacteria 683
873 Ga0207691_10000966 3300025940 Bacteria 28538
874 Ga0207691_10982452 3300025940 Bacteria 705
875 Ga0207711_10119056 3300025941 Bacteria 2356
876 Ga0207711_10132375 3300025941 Bacteria 2237
877 Ga0207711_10237181 3300025941 Bacteria 1672
878 Ga0207711_10602066 3300025941 Bacteria 1025
879 Ga0207689_10006874 3300025942 Bacteria 10004
880 Ga0207689_10018488 3300025942 Bacteria 5881
881 Ga0207689_10281643 3300025942 Bacteria 1377
882 Ga0207689_10330797 3300025942 Bacteria 1265
883 Ga0207689_10574034 3300025942 Bacteria 948
884 Ga0207661_10000015 3300025944 Bacteria 318960
885 Ga0207661_10021016 3300025944 Bacteria 4887
886 Ga0207661_10043662 3300025944 Bacteria 3539
887 Ga0207661_10050671 3300025944 Bacteria 3309
888 Ga0207661_10077751 3300025944 Bacteria 2730
889 Ga0207661_10128482 3300025944 Bacteria 2167
890 Ga0207661_10779229 3300025944 Bacteria 880
891 Ga0207661_10957476 3300025944 Bacteria 788
892 Ga0207661_12019695 3300025944 Bacteria 522
893 Ga0207679_10029894 3300025945 Bacteria 3798
894 Ga0207679_10067574 3300025945 Bacteria 2682
895 Ga0207679_10226355 3300025945 Bacteria 1576
896 Ga0207679_10918620 3300025945 Unclassified 801
897 Ga0207667_10000544 3300025949 Bacteria 49743
898 Ga0207667_10004693 3300025949 Bacteria 16723
899 Ga0207667_10004714 3300025949 Bacteria 16691
900 Ga0207667_10019963 3300025949 Bacteria 7466
901 Ga0207667_10023906 3300025949 Bacteria 6722
902 Ga0207667_10035982 3300025949 Bacteria 5309
903 Ga0207667_10134958 3300025949 Bacteria 2541
904 Ga0207667_10367248 3300025949 Bacteria 1467
905 Ga0207667_10411266 3300025949 Unclassified 1377
906 Ga0207667_10816217 3300025949 Unclassified 929
907 Ga0207667_10990293 3300025949 Bacteria 828
908 Ga0207651_10012516 3300025960 Bacteria 4807
909 Ga0207651_11156184 3300025960 Bacteria 694
910 Ga0207640_10067872 3300025981 Bacteria 2388
911 Ga0207640_10083398 3300025981 Bacteria 2192
912 Ga0207640_10116473 3300025981 Bacteria 1905
913 Ga0207640_10122448 3300025981 Bacteria 1866
914 Ga0207640_10166203 3300025981 Bacteria 1638
915 Ga0207677_10000003 3300026023 Bacteria 450061
916 Ga0207677_10000048 3300026023 Bacteria 101555
917 Ga0207677_10022339 3300026023 Bacteria 3887
918 Ga0207677_10096482 3300026023 Bacteria 2163
919 Ga0207677_10362870 3300026023 Bacteria 1217
920 Ga0207703_10000085 3300026035 Bacteria 107333
921 Ga0207703_10079566 3300026035 Bacteria 2727
922 Ga0207703_10704102 3300026035 Bacteria 961
923 Ga0207703_10872020 3300026035 Bacteria 861
924 Ga0207639_10000048 3300026041 Bacteria 124627
925 Ga0207639_10034616 3300026041 Bacteria 3734
926 Ga0207639_10062525 3300026041 Unclassified 2879
927 Ga0207639_10066138 3300026041 Bacteria 2808
928 Ga0207639_10653303 3300026041 Bacteria 973
929 Ga0207639_11051752 3300026041 Bacteria 763
930 Ga0207678_10017836 3300026067 Bacteria 6233
931 Ga0207708_10000003 3300026075 Bacteria 324662
932 Ga0207708_10650088 3300026075 Bacteria 897
933 Ga0207702_10009517 3300026078 Bacteria 8160
934 Ga0207702_10020916 3300026078 Bacteria 5415
935 Ga0207702_10037516 3300026078 Bacteria 4057
936 Ga0207702_10050507 3300026078 Bacteria 3511
937 Ga0207702_10154004 3300026078 Bacteria 2094
938 Ga0207702_10190319 3300026078 Bacteria 1895
939 Ga0207702_10359150 3300026078 Bacteria 1396
940 Ga0207702_10361563 3300026078 Bacteria 1391
941 Ga0207702_11074128 3300026078 Unclassified 799
942 Ga0207641_10086268 3300026088 Bacteria 2737
943 Ga0207641_10250043 3300026088 Bacteria 1655
944 Ga0207641_10532967 3300026088 Unclassified 1143
945 Ga0207641_11336605 3300026088 Bacteria 717
946 Ga0207641_11429058 3300026088 Bacteria 693
947 Ga0207648_10050715 3300026089 Bacteria 3628
948 Ga0207648_10143437 3300026089 Bacteria 2106
949 Ga0207648_10624225 3300026089 Unclassified 995
950 Ga0207648_11650553 3300026089 Bacteria 602
951 Ga0207648_11799043 3300026089 Unclassified 574
952 Ga0207676_10000002 3300026095 Bacteria 1198607
953 Ga0207676_10029988 3300026095 Bacteria 4077
954 Ga0207676_10079087 3300026095 Bacteria 2665
955 Ga0207676_10926724 3300026095 Bacteria 856
956 Ga0207676_11076245 3300026095 Bacteria 794
957 Ga0207676_11657726 3300026095 Bacteria 638
958 Ga0207674_10002393 3300026116 Bacteria 23705
959 Ga0207674_10018430 3300026116 Bacteria 7587
960 Ga0207674_10030121 3300026116 Bacteria 5709
961 Ga0207674_10061585 3300026116 Bacteria 3792
962 Ga0207674_10493518 3300026116 Bacteria 1183
963 Ga0207674_10792649 3300026116 Bacteria 914
964 Ga0207675_100119172 3300026118 Bacteria 2496
965 Ga0207683_10052189 3300026121 Bacteria 3582
966 Ga0207683_10802781 3300026121 Bacteria 873
967 Ga0207698_10012820 3300026142 Bacteria 5505
968 Ga0207698_10121277 3300026142 Bacteria 2214
969 Ga0207698_10490831 3300026142 Bacteria 1193
970 Ga0207698_10997268 3300026142 Unclassified 848
971 Ga0209998_10046853 3300027717 Bacteria 993
972 Ga0207428_10000001 3300027907 Bacteria 1034622
973 Ga0265356_1000382 3300028017 Bacteria 8040
974 Ga0268266_10011258 3300028379 Bacteria 7786
975 Ga0268264_10012706 3300028381 Bacteria 6929
976 Ga0268264_10177468 3300028381 Bacteria 1932
977 Ga0268264_10270964 3300028381 Bacteria 1586
978 Ga0265319_1045307 3300028563 Bacteria 1470
979 Ga0265322_10000052 3300028654 Bacteria 58413
980 Ga0265338_10022692 3300028800 Bacteria 6482
981 Ga0265338_10070036 3300028800 Bacteria 3010
982 Ga0265338_10121979 3300028800 Bacteria 2075
983 Ga0265338_10350355 3300028800 Bacteria 1062
984 Ga0265762_1009357 3300030760 Bacteria 1747
985 Ga0265767_102183 3300030836 Bacteria 1029
986 Ga0265766_1000450 3300030863 Bacteria 1776
987 Ga0265777_102316 3300030877 Unclassified 1096
988 Ga0265770_1041509 3300030878 Unclassified 806
989 Ga0265765_1008197 3300030879 Bacteria 1135
990 Ga0265765_1056890 3300030879 Unclassified 546
991 Ga0265773_1003081 3300031018 Unclassified 1067
992 Ga0265779_106989 3300031043 Unclassified 641
993 Ga0265760_10018687 3300031090 Bacteria 1996
994 Ga0265760_10053779 3300031090 Bacteria 1215
995 Ga0265760_10152571 3300031090 Bacteria 758
996 Ga0265760_10170304 3300031090 Bacteria 723
997 Ga0265330_10000781 3300031235 Bacteria 20009
998 Ga0265330_10433842 3300031235 Bacteria 557
999 Ga0265325_10001352 3300031241 Bacteria 17364
1000 Ga0265325_10006355 3300031241 Bacteria 7180
1001 Ga0265340_10053709 3300031247 Bacteria 1945
1002 Ga0265340_10075885 3300031247 Bacteria 1588
1003 Ga0265340_10142687 3300031247 Bacteria 1095
1004 Ga0265339_10000581 3300031249 Bacteria 28517
1005 Ga0265339_10046055 3300031249 Bacteria 2399
1006 Ga0265339_10154003 3300031249 Bacteria 1160
1007 Ga0265339_10182866 3300031249 Bacteria 1043
1008 Ga0265331_10022616 3300031250 Bacteria 3206
1009 Ga0265316_10031546 3300031344 Bacteria 4331
1010 Ga0265316_10085635 3300031344 Bacteria 2411
1011 Ga0265316_10166914 3300031344 Bacteria 1644
1012 Ga0307408_100119927 3300031548 Bacteria 2036
1013 Ga0307408_100762074 3300031548 Bacteria 875
1014 Ga0265313_10016516 3300031595 Bacteria 4240
1015 Ga0265313_10063426 3300031595 Bacteria 1723
1016 Ga0316575_10010260 3300031665 Bacteria 3436
1017 Ga0316575_10010428 3300031665 Bacteria 3415
1018 Ga0265314_10230674 3300031711 Bacteria 1074
1019 Ga0265342_10019690 3300031712 Bacteria 4344
1020 Ga0265342_10041034 3300031712 Bacteria 2804
1021 Ga0265342_10203217 3300031712 Unclassified 1075
1022 Ga0265342_10410353 3300031712 Bacteria 699
1023 Ga0316576_10000849 3300031727 Bacteria 15507
1024 Ga0316576_10034159 3300031727 Bacteria 3624
1025 Ga0316576_10067827 3300031727 Bacteria 2627
1026 Ga0316576_10142392 3300031727 Bacteria 1805
1027 Ga0316576_10183821 3300031727 Bacteria 1576
1028 Ga0316576_10555620 3300031727 Bacteria 841
1029 Ga0316578_10005100 3300031728 Bacteria 6322
1030 Ga0316578_10022136 3300031728 Bacteria 3539
1031 Ga0316578_10459041 3300031728 Unclassified 752
1032 Ga0316578_10590527 3300031728 Bacteria 651
1033 Ga0316577_10143662 3300031733 Bacteria 1344
1034 Ga0316577_10743115 3300031733 Bacteria 557
1035 Ga0307406_10763701 3300031901 Bacteria 813
1036 Ga0307409_101869289 3300031995 Bacteria 630
1037 Ga0307416_100160167 3300032002 Bacteria 2079
1038 Ga0307416_100734687 3300032002 Bacteria 1079
1039 Ga0307416_100816860 3300032002 Bacteria 1029
1040 Ga0316053_100535 3300032120 Bacteria 1775
1041 Ga0316053_100897 3300032120 Bacteria 1478
1042 Ga0316583_10016100 3300032133 Bacteria 2692
1043 Ga0316583_10126559 3300032133 Bacteria 891
1044 Ga0316585_10008305 3300032137 Bacteria 3010
1045 Ga0316585_10174561 3300032137 Bacteria 710
1046 Ga0316580_10014263 3300032139 Bacteria 2426
1047 Ga0316593_10000495 3300032168 Bacteria 7321
1048 Ga0316214_1042550 3300033545 Bacteria 653
1049 Ga0373926_0008040 3300035083 Bacteria 3513
1050 Ga0373926_0038855 3300035083 Bacteria 1696
1051 Ga0373934_0008649 3300035086 Bacteria 3797
1052 Ga0373944_0078045 3300035089 Bacteria 1089
1053 Ga0373923_0106353 3300035111 Bacteria 1242
1054 Ga0373923_0139461 3300035111 Bacteria 1095
1055 Ga0373923_0352395 3300035111 Bacteria 703
1056 Ga0373932_0015857 3300035112 Bacteria 1916
1057 Ga0373936_0001853 3300035113 Bacteria 7795
1058 Ga0373936_0045310 3300035113 Bacteria 1771
1059 Ga0373936_0127143 3300035113 Bacteria 1093
1060 Ga0373941_0040822 3300035115 Bacteria 1433
1061 Ga0373945_0001941 3300035116 Bacteria 6419
1062 Ga0373954_0113716 3300035118 Bacteria 1310
1063 Ga0373956_0004323 3300035119 Bacteria 5702
1064 Ga0373956_0016550 3300035119 Bacteria 3098
1065 Ga0373956_0108016 3300035119 Bacteria 1294
1066 Ga0373956_0476175 3300035119 Unclassified 596
1067 Ga0373957_0538051 3300035120 Bacteria 510
1068 Ga0373960_0070317 3300035121 Bacteria 1081
1069 Ga0373943_0006453 3300035170 Bacteria 5269
1070 Ga0373943_0007607 3300035170 Bacteria 4866
1071 Ga0373943_0023234 3300035170 Bacteria 2882
1072 Ga0373943_0034837 3300035170 Bacteria 2403
1073 Ga0373943_0058763 3300035170 Bacteria 1915
1074 Ga0373946_0065260 3300035171 Bacteria 1558
1075 Ga0373946_0195655 3300035171 Bacteria 966
1076 Ga0373946_0205609 3300035171 Bacteria 945
1077 Ga0373955_0074221 3300035172 Bacteria 1908
1078 Ga0373955_0212843 3300035172 Unclassified 1153
1079 Ga0373955_0220524 3300035172 Unclassified 1133
1080 Ga0373955_0295973 3300035172 Bacteria 975
1081 Ga0373955_0491704 3300035172 Unclassified 749
1082 Ga0316574_0001193 3300035398 Bacteria 12063
1083 Ga0316574_0004738 3300035398 Bacteria 7181
1084 Ga0316574_0053555 3300035398 Bacteria 2519
1085 Ga0316574_0229932 3300035398 Bacteria 1187
1086 Ga0316574_0278081 3300035398 Bacteria 1067
1087 Ga0316574_0806010 3300035398 Bacteria 571
1088 Ga0373924_0000274 3300035410 Bacteria 15809
1089 Ga0373924_0014296 3300035410 Bacteria 2998
1090 Ga0373924_0207276 3300035410 Bacteria 865
1091 Ga0373924_0307721 3300035410 Unclassified 704
1092 Ga0373931_0278980 3300035691 Unclassified 1025
1093 Ga0373931_0579336 3300035691 Bacteria 732
1094 Ga0373935_0010120 3300035692 Bacteria 5648
1095 Ga0373935_0024337 3300035692 Bacteria 3727
1096 Ga0373935_0170640 3300035692 Bacteria 1488
1097 Ga0373935_0210668 3300035692 Bacteria 1346
1098 Ga0373935_0554407 3300035692 Bacteria 838
1099 Ga0373927_0006641 3300035695 Bacteria 7874
1100 Ga0373927_0274241 3300035695 Bacteria 1109
1101 Ga0373927_0474516 3300035695 Bacteria 827
1102 Ga0373927_0839530 3300035695 Unclassified 607
1103 Ga0373927_1127685 3300035695 Bacteria 517
1104 Ga0373933_0003213 3300035724 Bacteria 9123
1105 Ga0373933_0114686 3300035724 Bacteria 1683
1106 Ga0373933_0457624 3300035724 Bacteria 835
1107 Ga0373933_1034400 3300035724 Unclassified 541
1108 Ga0373947_0009153 3300035725 Bacteria 5693
1109 Ga0373947_0102011 3300035725 Bacteria 1804
1110 Ga0373947_0173877 3300035725 Bacteria 1399
1111 Ga0373947_0308227 3300035725 Bacteria 1057
1112 Ga0373937_0000455 3300036401 Bacteria 37834
1113 Ga0373937_0001803 3300036401 Bacteria 17999
1114 Ga0373937_0030189 3300036401 Bacteria 4910
1115 Ga0373937_0073694 3300036401 Unclassified 3150
1116 Ga0373937_0092209 3300036401 Bacteria 2808
1117 Ga0373937_0291908 3300036401 Bacteria 1541
1118 Ga0373937_0366409 3300036401 Bacteria 1366
1119 Ga0373937_0451882 3300036401 Bacteria 1220
1120 Ga0373937_0499063 3300036401 Bacteria 1156
1121 Ga0373937_0541482 3300036401 Unclassified 1106
1122 Ga0373937_0682105 3300036401 Bacteria 974
1123 Ga0373937_0701993 3300036401 Bacteria 958
1124 Ga0373937_0922960 3300036401 Bacteria 822
1125 Ga0316582_0043565 3300036647 Bacteria 2816
1126 Ga0316582_0137662 3300036647 Bacteria 1644
1127 Ga0316582_0292794 3300036647 Bacteria 1118
1128 Ga0316584_0129011 3300036712 Bacteria 1888
1129 Ga0373925_0008739 3300037068 Bacteria 7378
1130 Ga0373925_0021012 3300037068 Bacteria 4757
1131 Ga0373925_0098621 3300037068 Bacteria 2243
1132 Ga0373925_0216974 3300037068 Bacteria 1526
1133 Ga0373925_0888056 3300037068 Bacteria 735
1134 Ga0373925_1775294 3300037068 Bacteria 503
1135 Ga0395900_0205792 3300037418 Bacteria 1989
1136 Ga0395898_0016476 3300037466 Bacteria 7561
1137 Ga0395898_0662158 3300037466 Bacteria 986
1138 Ga0436364_1340096 3300037853 Bacteria 4413
1139 Ga0395901_0190034 3300038443 Bacteria 2154
1140 Ga0395901_0424127 3300038443 Unclassified 1364
1141 Ga0400490_14648 3300038726 Bacteria 3599
1142 Ga0436365_0151500 3300039437 Bacteria 70579
1143 Ga0436365_0236781 3300039437 Bacteria 970
1144 Ga0436365_0968862 3300039437 Bacteria 3322
1145 Ga0436365_1407004 3300039437 Bacteria 3392
1146 Ga0436365_1524178 3300039437 Bacteria 77408
1147 Ga0436365_1664004 3300039437 Bacteria 6048
1148 Ga0436365_1692853 3300039437 Bacteria 1529
1149 Ga0436363_0387793 3300039450 Bacteria 745
1150 Ga0436362_0273161 3300039453 Bacteria 561309
1151 Ga0436362_0948018 3300039453 Bacteria 6477
1152 Ga0451807_0349962 3300041486 Bacteria 1956
1153 Ga0451853_3382037 3300041512 Bacteria 992
1154 Ga0450920_028141 3300042122 Bacteria 1101
1155 Ga0450923_002993 3300042125 Bacteria 2497
1156 Ga0450923_024509 3300042125 Bacteria 1197
1157 Ga0450894_000599 3300042131 Bacteria 6070
1158 Ga0450896_003252 3300042133 Bacteria 2150
1159 Ga0450898_020528 3300042134 Bacteria 1159
1160 Ga0439435_0088581 3300042436 Bacteria 937
1161 Ga0450918_014259 3300042531 Bacteria 1381
1162 Ga0451577_0000614 3300042876 Bacteria 57427
1163 Ga0451577_0079314 3300042876 Bacteria 2927
1164 Ga0451577_0087542 3300042876 Bacteria 2779
1165 Ga0451577_0320960 3300042876 Bacteria 1404
1166 Ga0453683_0140146 3300044673 Bacteria 1526
1167 Ga0453683_0158874 3300044673 Bacteria 1430
1168 Ga0466966_0421313 3300044684 Unclassified 802
1169 Ga0466961_0457910 3300044693 Bacteria 772
1170 Ga0466963_0073051 3300044694 Bacteria 2312
1171 Ga0466963_0086757 3300044694 Unclassified 2127
1172 Ga0466963_0095891 3300044694 Bacteria 2026
1173 Ga0466964_0275436 3300044706 Unclassified 839
1174 Ga0453684_0001797 3300044712 Bacteria 56922
1175 Ga0453684_0047620 3300044712 Bacteria 5682
1176 Ga0453684_0394087 3300044712 Bacteria 1552
1177 Ga0466971_0589174 3300044719 Bacteria 554
1178 Ga0466968_0107957 3300044735 Bacteria 1249
1179 Ga0466968_0212272 3300044735 Bacteria 910
1180 Ga0466970_0466226 3300044765 Unclassified 725
1181 Ga0466957_0000055 3300044842 Bacteria 42244
1182 Ga0466957_0115774 3300044842 Unclassified 1705
1183 Ga0466957_0960957 3300044842 Unclassified 612
1184 Ga0466959_0046896 3300045049 Bacteria 3180
1185 Ga0466959_0112706 3300045049 Bacteria 1940
1186 Ga0466959_0419766 3300045049 Bacteria 908
1187 Ga0451576_0317271 3300045051 Bacteria 1631
1188 Ga0451576_0873320 3300045051 Bacteria 944
1189 Ga0451576_1204279 3300045051 Unclassified 791
1190 Ga0451576_1392512 3300045051 Bacteria 730
1191 Ga0466958_0034374 3300045836 Bacteria 3024
1192 Ga0466958_0276360 3300045836 Bacteria 1076
1193 Ga0466967_0027554 3300045976 Bacteria 4728
1194 Ga0466967_0033460 3300045976 Bacteria 4352
1195 Ga0466967_0046854 3300045976 Bacteria 3766
1196 Ga0466967_1556224 3300045976 Bacteria 658
1197 Ga0495603_0130161 3300046455 Bacteria 1466
1198 Ga0495629_1048308 3300046459 Bacteria 529
1199 Ga0495651_0002665 3300046462 Bacteria 13856
1200 Ga0495651_0011592 3300046462 Bacteria 6774
1201 Ga0495653_0257489 3300046463 Bacteria 1155
1202 Ga0495580_0000634 3300046472 Bacteria 29763
1203 Ga0495580_0023089 3300046472 Bacteria 4572
1204 Ga0495580_0068416 3300046472 Bacteria 2483
1205 Ga0495580_0071624 3300046472 Bacteria 2421
1206 Ga0495580_0183504 3300046472 Unclassified 1444
1207 Ga0495580_0380215 3300046472 Bacteria 954
1208 Ga0495580_0466016 3300046472 Bacteria 846
1209 Ga0495582_0012769 3300046473 Bacteria 4627
1210 Ga0495582_0023662 3300046473 Bacteria 3359
1211 Ga0495582_0256428 3300046473 Bacteria 1003
1212 Ga0495639_0043201 3300046475 Bacteria 2035
1213 Ga0495639_0053642 3300046475 Bacteria 1837
1214 Ga0495664_0248387 3300046477 Bacteria 1076
1215 Ga0495584_0225488 3300046491 Bacteria 952
1216 Ga0495594_0406313 3300046499 Bacteria 775
1217 Ga0495594_0409091 3300046499 Bacteria 772
1218 Ga0495608_0197387 3300046511 Unclassified 1269
1219 Ga0495608_0281384 3300046511 Bacteria 1032
1220 Ga0495620_0006479 3300046515 Bacteria 6429
1221 Ga0495628_0193333 3300046516 Bacteria 1536
1222 Ga0495628_0356074 3300046516 Bacteria 1075
1223 Ga0495628_0622625 3300046516 Bacteria 769
1224 Ga0495630_0252278 3300046517 Unclassified 1348
1225 Ga0495630_0596485 3300046517 Bacteria 847
1226 Ga0495630_0600783 3300046517 Bacteria 843
1227 Ga0495666_0047763 3300046526 Bacteria 2062
1228 Ga0495652_0035479 3300046529 Bacteria 4341
1229 Ga0495652_0108432 3300046529 Unclassified 2238
1230 Ga0495665_0015678 3300046531 Bacteria 4079
1231 Ga0495665_0449390 3300046531 Bacteria 651
1232 Ga0495586_0083397 3300046535 Bacteria 1759
1233 Ga0495587_0005061 3300046536 Bacteria 8621
1234 Ga0495587_0348400 3300046536 Unclassified 826
1235 Ga0495598_0274727 3300046537 Unclassified 631
1236 Ga0495621_0043692 3300046539 Bacteria 1581
1237 Ga0495621_0144405 3300046539 Bacteria 933
1238 Ga0495645_0524722 3300046543 Bacteria 737
1239 Ga0495633_0414888 3300046558 Bacteria 609
1240 Ga0495667_0144941 3300046559 Bacteria 1530
1241 Ga0495667_0500433 3300046559 Bacteria 761
1242 Ga0495635_0594547 3300046663 Bacteria 723
1243 Ga0495588_0203002 3300046674 Bacteria 1047
1244 Ga0495588_0362818 3300046674 Unclassified 761
1245 Ga0495657_0185235 3300046675 Unclassified 1275
1246 Ga0495657_0223452 3300046675 Bacteria 1141
1247 Ga0495657_0285258 3300046675 Bacteria 987
1248 Ga0495657_0725626 3300046675 Unclassified 570
1249 Ga0495623_0114176 3300046679 Bacteria 1633
1250 Ga0495623_0133257 3300046679 Bacteria 1485
1251 Ga0495623_0325356 3300046679 Bacteria 843
1252 Ga0495647_0130840 3300046681 Bacteria 1063
1253 Ga0495647_0197263 3300046681 Bacteria 882
1254 Ga0495658_0113098 3300046683 Bacteria 1634
1255 Ga0495669_0121672 3300046684 Bacteria 1223
1256 Ga0495600_0261042 3300046809 Bacteria 1100
1257 Ga0495581_0039807 3300047315 Bacteria 2721
1258 Ga0495604_0167692 3300047317 Bacteria 1547
1259 Ga0495674_0164604 3300047319 Bacteria 1854
1260 Ga0495674_0446866 3300047319 Bacteria 1039
1261 Ga0495674_0706141 3300047319 Bacteria 791
1262 Ga0495674_0764077 3300047319 Bacteria 754
1263 Ga0495676_0682745 3300047321 Bacteria 665
1264 Ga0495680_0221712 3300047322 Bacteria 1350
1265 Ga0495680_0318677 3300047322 Unclassified 1088
1266 Ga0495675_0012326 3300047444 Bacteria 5380
1267 Ga0495675_0037102 3300047444 Bacteria 3105
1268 Ga0495675_0056274 3300047444 Bacteria 2494
1269 Ga0495675_0262963 3300047444 Unclassified 1033
1270 Ga0495684_0549167 3300047471 Bacteria 787
1271 Ga0495593_0038862 3300047673 Bacteria 2569
1272 Ga0495602_0000191 3300048088 Bacteria 58052
1273 Ga0495602_0075891 3300048088 Bacteria 2851
1274 Ga0495602_0154200 3300048088 Unclassified 1801
1275 Ga0495602_0308267 3300048088 Bacteria 1156
1276 Ga0495602_0509148 3300048088 Bacteria 840
1277 Ga0495602_0528292 3300048088 Bacteria 821
1278 Ga0496100_0057755 3300048903 Bacteria 2543
1279 Ga0496100_0073346 3300048903 Bacteria 2290
1280 Ga0496100_0101387 3300048903 Bacteria 1985
1281 Ga0496101_0145139 3300048904 Bacteria 1812
1282 Ga0496101_0324190 3300048904 Bacteria 1209
1283 Ga0496102_0402142 3300048905 Bacteria 1287
1284 Ga0496102_0886777 3300048905 Bacteria 814
1285 Ga0496102_0930936 3300048905 Bacteria 790
1286 Ga0496102_1427125 3300048905 Bacteria 611
1287 Ga0496104_0004317 3300048907 Bacteria 12368
1288 Ga0496104_0065499 3300048907 Bacteria 3448
1289 Ga0496104_0074475 3300048907 Bacteria 3232
1290 Ga0496104_0199151 3300048907 Bacteria 1915
1291 Ga0496104_0395530 3300048907 Bacteria 1294
1292 Ga0496104_0520395 3300048907 Bacteria 1101
1293 Ga0496104_0596568 3300048907 Bacteria 1015
1294 Ga0496104_0753595 3300048907 Bacteria 881
1295 Ga0496104_0868662 3300048907 Bacteria 807
1296 Ga0496105_0001295 3300048908 Bacteria 17503
1297 Ga0496105_0153234 3300048908 Bacteria 1894
1298 Ga0496105_0756181 3300048908 Unclassified 742
1299 Ga0496106_0092821 3300048909 Bacteria 2332
1300 Ga0496106_0717609 3300048909 Unclassified 796
1301 Ga0496107_0240967 3300048910 Bacteria 1346
1302 Ga0496107_0313798 3300048910 Bacteria 1167
1303 Ga0496108_0192152 3300048911 Bacteria 1769
1304 Ga0496108_1394384 3300048911 Bacteria 586
1305 Ga0496108_1401939 3300048911 Unclassified 584
1306 Ga0496109_0050587 3300048912 Bacteria 3784
1307 Ga0496110_0033571 3300048913 Bacteria 4440
1308 Ga0496110_0106151 3300048913 Bacteria 2520
1309 Ga0496111_0001171 3300048914 Bacteria 14598
1310 Ga0496111_0132068 3300048914 Bacteria 1848
1311 Ga0496112_0001167 3300048915 Bacteria 19657
1312 Ga0496112_0003245 3300048915 Bacteria 13406
1313 Ga0496112_0015233 3300048915 Bacteria 7167
1314 Ga0496112_0018055 3300048915 Bacteria 6639
1315 Ga0496112_0054419 3300048915 Bacteria 3932
1316 Ga0496112_0151175 3300048915 Bacteria 2289
1317 Ga0496112_0279704 3300048915 Bacteria 1616
1318 Ga0496112_0561788 3300048915 Bacteria 1075
1319 Ga0496112_0596943 3300048915 Unclassified 1036
1320 Ga0496112_0930510 3300048915 Unclassified 791
1321 Ga0496112_1936527 3300048915 Unclassified 501
1322 Ga0496113_0000290 3300048916 Bacteria 23756
1323 Ga0496113_0267572 3300048916 Bacteria 1366
1324 Ga0496113_0576116 3300048916 Bacteria 902
1325 Ga0496114_0001818 3300048917 Bacteria 16184
1326 Ga0496114_0112225 3300048917 Bacteria 2336
1327 Ga0496114_0814271 3300048917 Unclassified 813
1328 Ga0496115_0521612 3300048918 Unclassified 953
1329 Ga0501299_144080 3300049522 Bacteria 595
1330 Ga0501031_0293436 3300049568 Bacteria 1054
1331 Ga0501031_0605746 3300049568 Bacteria 705
1332 Ga0501032_0207149 3300049569 Bacteria 1279
1333 Ga0501032_0674262 3300049569 Bacteria 656
1334 Ga0501033_0384565 3300049570 Bacteria 980
1335 Ga0501036_0037085 3300049572 Bacteria 4124
1336 Ga0501036_0110920 3300049572 Bacteria 2318
1337 Ga0501036_1312625 3300049572 Unclassified 588
1338 Ga0501038_0100946 3300049574 Bacteria 2403
1339 Ga0501038_0193406 3300049574 Bacteria 1636
1340 Ga0501038_0790347 3300049574 Bacteria 706
1341 Ga0501039_0027910 3300049575 Bacteria 4341
1342 Ga0501039_0456679 3300049575 Bacteria 1003
1343 Ga0501039_0615539 3300049575 Bacteria 851
1344 Ga0501040_0014732 3300049576 Bacteria 5158
1345 Ga0501040_0223517 3300049576 Bacteria 1340
1346 Ga0501040_1262847 3300049576 Bacteria 536
1347 Ga0501041_0000881 3300049577 Bacteria 16230
1348 Ga0501041_0124950 3300049577 Bacteria 1601
1349 Ga0501041_1025713 3300049577 Unclassified 531
1350 Ga0501042_0002368 3300049578 Bacteria 11557
1351 Ga0501042_0047477 3300049578 Bacteria 3062
1352 Ga0501043_0764846 3300049579 Unclassified 701
1353 Ga0501046_0219952 3300049580 Bacteria 1406
1354 Ga0501047_0112172 3300049581 Bacteria 2609
1355 Ga0501047_0148420 3300049581 Bacteria 2221
1356 Ga0501048_0047770 3300049582 Bacteria 3054
1357 Ga0501048_0146512 3300049582 Bacteria 1670
1358 Ga0501068_0017200 3300049584 Bacteria 4178
1359 Ga0501069_0465927 3300049585 Bacteria 752
1360 Ga0501070_0083015 3300049586 Bacteria 2652
1361 Ga0501070_0327788 3300049586 Bacteria 1245
1362 Ga0501071_0004621 3300049587 Bacteria 8737
1363 Ga0501071_0011873 3300049587 Bacteria 5883
1364 Ga0501071_1105275 3300049587 Bacteria 612
1365 Ga0501071_1594294 3300049587 Unclassified 504
1366 Ga0501072_0002447 3300049588 Bacteria 13910
1367 Ga0501072_0429990 3300049588 Bacteria 1046
1368 Ga0501073_0009228 3300049589 Bacteria 7273
1369 Ga0501073_0025682 3300049589 Bacteria 4222
1370 Ga0501073_0159639 3300049589 Bacteria 1562
1371 Ga0501073_0400178 3300049589 Bacteria 949
1372 Ga0501074_0044233 3300049590 Bacteria 3224
1373 Ga0501074_0424060 3300049590 Bacteria 943
1374 Ga0501075_0001143 3300049591 Bacteria 17114
1375 Ga0501075_0354285 3300049591 Unclassified 1118
1376 Ga0501075_0565336 3300049591 Bacteria 868
1377 Ga0501075_1348289 3300049591 Bacteria 540
1378 Ga0501076_0007665 3300049592 Bacteria 7861
1379 Ga0501076_0056818 3300049592 Bacteria 3106
1380 Ga0501076_0397190 3300049592 Bacteria 1134
1381 Ga0501076_0435693 3300049592 Bacteria 1079
1382 Ga0501077_0035059 3300049593 Bacteria 3194
1383 Ga0501079_0007802 3300049741 Bacteria 8104
1384 Ga0501079_0098301 3300049741 Bacteria 2269
1385 Ga0501080_0069849 3300049742 Bacteria 3267
1386 Ga0501080_0079413 3300049742 Bacteria 3051
1387 Ga0501080_0388636 3300049742 Bacteria 1256
1388 Ga0501081_0004261 3300049743 Bacteria 9169
1389 Ga0501083_0065970 3300049744 Bacteria 2411
1390 Ga0501035_0157846 3300049822 Bacteria 1965
1391 Ga0501045_0097965 3300049824 Bacteria 2169
1392 Ga0501045_0113152 3300049824 Bacteria 2013
1393 nmdc:mga05p37_189585_c1 3300050507 Bacteria 2497
1394 nmdc:mga05p37_603568_c1 3300050507 Bacteria 1238
1395 nmdc:mga05p37_682605_c1 3300050507 Unclassified 1144
1396 nmdc:mga05p37_8536_c1 3300050507 Bacteria 4974
1397 nmdc:mga09592_343599_c1 3300050508 Bacteria 1292
1398 nmdc:mga09592_705629_c1 3300050508 Unclassified 858
1399 nmdc:mga0qj67_286368_c1 3300050509 Bacteria 1335
1400 nmdc:mga0qj67_406834_c1 3300050509 Bacteria 1098
1401 nmdc:mga0qj67_854832_c1 3300050509 Unclassified 718
1402 nmdc:mga06r32_108250_c1 3300050510 Bacteria 2732
1403 nmdc:mga06r32_2354_c1 3300050510 Bacteria 16931
1404 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
1405 nmdc:mga08y16_284736_c1 3300050511 Bacteria 1704
1406 nmdc:mga0n895_1043056_c1 3300050512 Bacteria 797
1407 nmdc:mga0n895_1313065_c1 3300050512 Bacteria 694
1408 nmdc:mga0n895_16332_c1 3300050512 Bacteria 6808
1409 nmdc:mga0n895_170166_c1 3300050512 Bacteria 2210
1410 nmdc:mga0n895_19859_c1 3300050512 Bacteria 6254
1411 nmdc:mga0n895_238734_c1 3300050512 Bacteria 1844
1412 nmdc:mga0n895_360054_c1 3300050512 Bacteria 1473
1413 nmdc:mga0n895_866273_c1 3300050512 Bacteria 890
1414 nmdc:mga0rr50_1265604_c1 3300050513 Unclassified 626
1415 nmdc:mga0rr50_156066_c1 3300050513 Bacteria 1849
1416 nmdc:mga0rr50_1807_c1 3300050513 Bacteria 11826
1417 nmdc:mga0rr50_41509_c1 3300050513 Bacteria 3353
1418 nmdc:mga0rr50_432089_c1 3300050513 Bacteria 1115
1419 nmdc:mga0rr50_7195_c1 3300050513 Bacteria 6839
1420 nmdc:mga08x19_142954_c1 3300050514 Bacteria 1617
1421 nmdc:mga08x19_1679_c1 3300050514 Bacteria 13617
1422 nmdc:mga08x19_2609_c1 3300050514 Bacteria 10933
1423 nmdc:mga08x19_27429_c1 3300050514 Bacteria 3562
1424 nmdc:mga08x19_688297_c1 3300050514 Bacteria 726
1425 nmdc:mga08x19_7721_c1 3300050514 Bacteria 6389
1426 nmdc:mga08x19_93793_c1 3300050514 Bacteria 1984
1427 nmdc:mga08x19_96720_c1 3300050514 Bacteria 1955
1428 nmdc:mga0a205_11707_c1 3300050515 Bacteria 8090
1429 nmdc:mga0a205_901298_c1 3300050515 Bacteria 731
1430 Ga0495601_0001368 3300053077 Bacteria 13415
1431 Ga0495601_0029406 3300053077 Bacteria 3408
1432 Ga0495601_0283714 3300053077 Bacteria 1080
1433 Ga0495612_0286979 3300053078 Bacteria 736
1434 Ga0495612_0617504 3300053078 Unclassified 501
1435 Ga0495655_0000287 3300053083 Bacteria 9217
1436 Ga0495595_0096456 3300053084 Bacteria 1423
1437 Ga0495619_0024573 3300053085 Bacteria 3865
1438 Ga0495619_0524999 3300053085 Bacteria 813
1439 Ga0500590_122855 3300053148 Bacteria 1214
1440 Ga0501084_0013954 3300054114 Bacteria 6650
1441 Ga0587084_015300 3300059477 Unclassified 1081
1442 Ga0587093_000692 3300059478 Bacteria 2512
1443 Ga0587066_014595 3300059490 Bacteria 1210
1444 Ga0587066_138035 3300059490 Unclassified 592
1445 Ga0587070_001449 3300059491 Bacteria 2453
1446 Ga0587070_015526 3300059491 Bacteria 1207
1447 Ga0587073_0016559 3300059492 Bacteria 1347
1448 Ga0587077_001212 3300059493 Unclassified 2689
1449 Ga0587085_014007 3300059506 Bacteria 1125
1450 Ga0587085_017002 3300059506 Unclassified 1060
1451 Ga0587086_008478 3300059507 Unclassified 1202
1452 Ga0587086_028327 3300059507 Unclassified 809
1453 Ga0587091_003320 3300059511 Bacteria 2013
1454 Ga0587091_012597 3300059511 Bacteria 1342
1455 Ga0587092_025904 3300059512 Bacteria 939
1456 Ga0587094_008397 3300059513 Unclassified 1292
1457 Ga0587099_004327 3300059622 Unclassified 1226
1458 Ga0587101_009866 3300059623 Unclassified 1188
1459 Ga0587113_005354 3300059625 Bacteria 1055
1460 Ga0587128_002833 3300059630 Bacteria 1852
1461 Ga0587128_033757 3300059630 Bacteria 862
1462 Ga0587067_036706 3300059640 Unclassified 933
1463 Ga0587069_007244 3300059642 Bacteria 1364
1464 Ga0587075_001635 3300059644 Bacteria 2215
1465 Ga0587076_046883 3300059645 Bacteria 829
1466 Ga0587078_000650 3300059646 Bacteria 2745
1467 Ga0587107_005299 3300059652 Unclassified 1358
1468 Ga0587114_001009 3300059655 Unclassified 2199
1469 Ga0587114_036039 3300059655 Bacteria 781
1470 Ga0587114_065311 3300059655 Bacteria 648
1471 Ga0587071_003502 3300060344 Bacteria 2258
1472 Ga0501082_0001055 3300060353 Bacteria 24399
1473 Ga0501082_0166228 3300060353 Bacteria 1917
1474 Ga0501082_0180877 3300060353 Bacteria 1834
1475 Ga0501082_1318309 3300060353 Bacteria 631
1476 Ga0466962_0240908 3300061719 Bacteria 888
1477 Ga0466962_0282852 3300061719 Bacteria 819
1478 Ga0466962_0447746 3300061719 Bacteria 650
1479 Ga0530510_0089182 3300061734 Bacteria 2248
1480 Ga0530510_0747336 3300061734 Unclassified 746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0229932 Ga0316574_0229932_10_384 119
2 3300035398 Ga0316574_0806010 Ga0316574_0806010_27_404 119
3 3300037068 Ga0373925_1775294 Ga0373925_1775294_35_409 121
4 3300059490 Ga0587066_138035 Ga0587066_138035_126_506 123
5 3300049568 Ga0501031_0605746 Ga0501031_0605746_306_689 127
6 3300026075 Ga0207708_10650088 Ga0207708_106500882 130
7 3300035410 Ga0373924_0307721 Ga0373924_0307721_10_423 136
8 3300025949 Ga0207667_10816217 Ga0207667_108162172 139
9 3300041486 Ga0451807_0349962 Ga0451807_0349962_106_528 139
10 3300041512 Ga0451853_3382037 Ga0451853_3382037_256_678 139
11 3300005615 Ga0070702_100587702 Ga0070702_1005877022 140
12 3300013297 Ga0157378_11307456 Ga0157378_113074562 140
13 3300035695 Ga0373927_0474516 Ga0373927_0474516_236_688 141
14 3300037068 Ga0373925_0888056 Ga0373925_0888056_70_522 141
15 3300049574 Ga0501038_0790347 Ga0501038_0790347_30_476 141
16 3300049577 Ga0501041_1025713 Ga0501041_1025713_47_493 141
17 3300049591 Ga0501075_0354285 Ga0501075_0354285_136_582 141
18 3300049592 Ga0501076_0435693 Ga0501076_0435693_132_578 141
19 3300027717 Ga0209998_10046853 Ga0209998_100468532 142
20 3300031727 Ga0316576_10000849 Ga0316576_100008494 142
21 3300031727 Ga0316576_10142392 Ga0316576_101423922 142
22 3300038726 Ga0400490_14648 Ga0400490_14648_764_1213 142
23 3300044673 Ga0453683_0158874 Ga0453683_0158874_801_1244 142
24 3300006844 Ga0075428_100565788 Ga0075428_1005657881 143
25 3300006846 Ga0075430_100926302 Ga0075430_1009263022 143
26 3300007076 Ga0075435_100286265 Ga0075435_1002862652 143
27 3300009094 Ga0111539_10189545 Ga0111539_101895452 143
28 3300009147 Ga0114129_10831647 Ga0114129_108316472 143
29 3300031090 Ga0265760_10018687 Ga0265760_100186873 143
30 3300031665 Ga0316575_10010260 Ga0316575_100102603 143
31 3300031665 Ga0316575_10010428 Ga0316575_100104283 143
32 3300031727 Ga0316576_10034159 Ga0316576_100341593 143
33 3300031727 Ga0316576_10067827 Ga0316576_100678273 143
34 3300031727 Ga0316576_10183821 Ga0316576_101838212 143
35 3300031727 Ga0316576_10555620 Ga0316576_105556202 143
36 3300031728 Ga0316578_10005100 Ga0316578_100051002 143
37 3300031728 Ga0316578_10022136 Ga0316578_100221363 143
38 3300031728 Ga0316578_10459041 Ga0316578_104590411 143
39 3300031733 Ga0316577_10143662 Ga0316577_101436622 143
40 3300032133 Ga0316583_10016100 Ga0316583_100161002 143
41 3300032137 Ga0316585_10008305 Ga0316585_100083053 143
42 3300032137 Ga0316585_10174561 Ga0316585_101745611 143
43 3300032139 Ga0316580_10014263 Ga0316580_100142633 143
44 3300032168 Ga0316593_10000495 Ga0316593_100004955 143
45 3300035398 Ga0316574_0001193 Ga0316574_0001193_6614_7060 143
46 3300035398 Ga0316574_0004738 Ga0316574_0004738_5941_6384 143
47 3300035398 Ga0316574_0053555 Ga0316574_0053555_819_1265 143
48 3300035398 Ga0316574_0278081 Ga0316574_0278081_348_797 143
49 3300036647 Ga0316582_0043565 Ga0316582_0043565_260_706 143
50 3300036647 Ga0316582_0137662 Ga0316582_0137662_776_1222 143
51 3300036647 Ga0316582_0292794 Ga0316582_0292794_549_995 143
52 3300036712 Ga0316584_0129011 Ga0316584_0129011_592_1038 143
53 3300050507 nmdc:mga05p37_682605_c1 nmdc:mga05p37_682605_c1_197_637 143
54 3300050509 nmdc:mga0qj67_854832_c1 nmdc:mga0qj67_854832_c1_171_611 143
55 3300005440 Ga0070705_101777431 Ga0070705_1017774311 144
56 3300005539 Ga0068853_101199116 Ga0068853_1011991162 144
57 3300005563 Ga0068855_100994968 Ga0068855_1009949681 144
58 3300005618 Ga0068864_100000001 Ga0068864_100000001219 144
59 3300005841 Ga0068863_100100913 Ga0068863_1001009134 144
60 3300006871 Ga0075434_100245724 Ga0075434_1002457243 144
61 3300009551 Ga0105238_11624685 Ga0105238_116246852 144
62 3300026041 Ga0207639_11051752 Ga0207639_110517522 144
63 3300026088 Ga0207641_10086268 Ga0207641_100862684 144
64 3300026095 Ga0207676_10000002 Ga0207676_10000002615 144
65 3300026095 Ga0207676_11657726 Ga0207676_116577261 144
66 3300035119 Ga0373956_0476175 Ga0373956_0476175_46_489 144
67 3300035172 Ga0373955_0212843 Ga0373955_0212843_450_893 144
68 3300048905 Ga0496102_0886777 Ga0496102_0886777_109_552 144
69 3300048907 Ga0496104_0395530 Ga0496104_0395530_359_802 144
70 3300048915 Ga0496112_0151175 Ga0496112_0151175_605_1048 144
71 3300050512 nmdc:mga0n895_238734_c1 nmdc:mga0n895_238734_c1_591_1034 144
72 3300004799 Ga0058863_11860926 Ga0058863_118609261 145
73 3300004803 Ga0058862_12782718 Ga0058862_127827182 145
74 3300005336 Ga0070680_100039352 Ga0070680_1000393522 145
75 3300005439 Ga0070711_100848302 Ga0070711_1008483022 145
76 3300005458 Ga0070681_10321561 Ga0070681_103215612 145
77 3300005530 Ga0070679_100059965 Ga0070679_1000599654 145
78 3300005549 Ga0070704_101168591 Ga0070704_1011685911 145
79 3300005617 Ga0068859_100000001 Ga0068859_100000001290 145
80 3300005843 Ga0068860_100127649 Ga0068860_1001276492 145
81 3300006844 Ga0075428_100044054 Ga0075428_1000440542 145
82 3300006846 Ga0075430_100068934 Ga0075430_1000689343 145
83 3300006846 Ga0075430_101192108 Ga0075430_1011921082 145
84 3300006847 Ga0075431_100047210 Ga0075431_1000472103 145
85 3300006931 Ga0097620_100000001 Ga0097620_100000001290 145
86 3300009553 Ga0105249_10276614 Ga0105249_102766142 145
87 3300013100 Ga0157373_11252787 Ga0157373_112527871 145
88 3300013307 Ga0157372_11076825 Ga0157372_110768252 145
89 3300013308 Ga0157375_10000077 Ga0157375_1000007774 145
90 3300014326 Ga0157380_10036241 Ga0157380_100362417 145
91 3300020069 Ga0197907_10425626 Ga0197907_104256262 145
92 3300020070 Ga0206356_10684346 Ga0206356_106843462 145
93 3300020076 Ga0206355_1217712 Ga0206355_12177121 145
94 3300020077 Ga0206351_10110990 Ga0206351_101109901 145
95 3300020082 Ga0206353_11971794 Ga0206353_119717942 145
96 3300020610 Ga0154015_1182847 Ga0154015_11828472 145
97 3300022467 Ga0224712_10097294 Ga0224712_100972942 145
98 3300025893 Ga0207682_10469931 Ga0207682_104699312 145
99 3300025912 Ga0207707_10425647 Ga0207707_104256472 145
100 3300025921 Ga0207652_10108104 Ga0207652_101081042 145
101 3300025938 Ga0207704_10142310 Ga0207704_101423102 145
102 3300025940 Ga0207691_10000966 Ga0207691_100009663 145
103 3300028381 Ga0268264_10012706 Ga0268264_100127068 145
104 3300031995 Ga0307409_101869289 Ga0307409_1018692892 145
105 3300035119 Ga0373956_0108016 Ga0373956_0108016_592_1038 145
106 3300035695 Ga0373927_1127685 Ga0373927_1127685_12_461 145
107 3300036401 Ga0373937_0541482 Ga0373937_0541482_508_954 145
108 3300039437 Ga0436365_0236781 Ga0436365_0236781_389_838 145
109 3300042876 Ga0451577_0087542 Ga0451577_0087542_1182_1628 145
110 3300044673 Ga0453683_0140146 Ga0453683_0140146_907_1356 145
111 3300046499 Ga0495594_0409091 Ga0495594_0409091_32_487 145
112 3300047319 Ga0495674_0706141 Ga0495674_0706141_56_502 145
113 3300048915 Ga0496112_0561788 Ga0496112_0561788_355_804 145
114 3300049581 Ga0501047_0112172 Ga0501047_0112172_936_1397 145
115 3300049585 Ga0501069_0465927 Ga0501069_0465927_65_520 145
116 3300049589 Ga0501073_0400178 Ga0501073_0400178_310_765 145
117 3300050509 nmdc:mga0qj67_286368_c1 nmdc:mga0qj67_286368_c1_737_1186 145
118 3300050510 nmdc:mga06r32_108250_c1 nmdc:mga06r32_108250_c1_1354_1803 145
119 3300004799 Ga0058863_10127816 Ga0058863_101278166 146
120 3300004799 Ga0058863_11021108 Ga0058863_110211082 146
121 3300004799 Ga0058863_11730432 Ga0058863_117304321 146
122 3300004803 Ga0058862_10023634 Ga0058862_100236342 146
123 3300004803 Ga0058862_10034373 Ga0058862_100343736 146
124 3300004803 Ga0058862_10724446 Ga0058862_107244463 146
125 3300005329 Ga0070683_100122376 Ga0070683_1001223762 146
126 3300005336 Ga0070680_100033808 Ga0070680_1000338082 146
127 3300005336 Ga0070680_100153383 Ga0070680_1001533832 146
128 3300005336 Ga0070680_100190183 Ga0070680_1001901834 146
129 3300005336 Ga0070680_100680242 Ga0070680_1006802421 146
130 3300005336 Ga0070680_100951763 Ga0070680_1009517632 146
131 3300005337 Ga0070682_100000079 Ga0070682_1000000795 146
132 3300005340 Ga0070689_100000539 Ga0070689_10000053916 146
133 3300005344 Ga0070661_100278881 Ga0070661_1002788811 146
134 3300005364 Ga0070673_100412719 Ga0070673_1004127192 146
135 3300005434 Ga0070709_10032322 Ga0070709_100323224 146
136 3300005434 Ga0070709_10083607 Ga0070709_100836072 146
137 3300005435 Ga0070714_100084049 Ga0070714_1000840494 146
138 3300005435 Ga0070714_100124991 Ga0070714_1001249912 146
139 3300005435 Ga0070714_100258622 Ga0070714_1002586222 146
140 3300005435 Ga0070714_100315914 Ga0070714_1003159142 146
141 3300005435 Ga0070714_100416420 Ga0070714_1004164202 146
142 3300005436 Ga0070713_100021840 Ga0070713_1000218404 146
143 3300005436 Ga0070713_100105609 Ga0070713_1001056092 146
144 3300005436 Ga0070713_100216183 Ga0070713_1002161833 146
145 3300005436 Ga0070713_100255526 Ga0070713_1002555262 146
146 3300005436 Ga0070713_100420907 Ga0070713_1004209072 146
147 3300005436 Ga0070713_101502376 Ga0070713_1015023762 146
148 3300005437 Ga0070710_10137726 Ga0070710_101377262 146
149 3300005437 Ga0070710_10164143 Ga0070710_101641432 146
150 3300005438 Ga0070701_10000949 Ga0070701_1000094911 146
151 3300005439 Ga0070711_100006696 Ga0070711_1000066965 146
152 3300005439 Ga0070711_100871893 Ga0070711_1008718932 146
153 3300005458 Ga0070681_10054237 Ga0070681_100542374 146
154 3300005458 Ga0070681_10230167 Ga0070681_102301672 146
155 3300005458 Ga0070681_10614193 Ga0070681_106141932 146
156 3300005467 Ga0070706_100196718 Ga0070706_1001967182 146
157 3300005530 Ga0070679_100017081 Ga0070679_1000170812 146
158 3300005530 Ga0070679_100041085 Ga0070679_1000410854 146
159 3300005530 Ga0070679_100847722 Ga0070679_1008477222 146
160 3300005530 Ga0070679_100968430 Ga0070679_1009684302 146
161 3300005530 Ga0070679_101006130 Ga0070679_1010061302 146
162 3300005535 Ga0070684_100882540 Ga0070684_1008825401 146
163 3300005539 Ga0068853_100096267 Ga0068853_1000962677 146
164 3300005545 Ga0070695_100843376 Ga0070695_1008433762 146
165 3300005546 Ga0070696_100040678 Ga0070696_1000406781 146
166 3300005563 Ga0068855_100125566 Ga0068855_1001255664 146
167 3300005563 Ga0068855_100203048 Ga0068855_1002030482 146
168 3300005577 Ga0068857_100341179 Ga0068857_1003411792 146
169 3300005578 Ga0068854_100060568 Ga0068854_1000605683 146
170 3300005614 Ga0068856_100057505 Ga0068856_1000575052 146
171 3300005842 Ga0068858_100000467 Ga0068858_10000046729 146
172 3300006028 Ga0070717_10000089 Ga0070717_1000008945 146
173 3300006028 Ga0070717_10255770 Ga0070717_102557702 146
174 3300006028 Ga0070717_10505250 Ga0070717_105052502 146
175 3300006028 Ga0070717_10554327 Ga0070717_105543272 146
176 3300006028 Ga0070717_10852097 Ga0070717_108520972 146
177 3300006028 Ga0070717_10989546 Ga0070717_109895462 146
178 3300006028 Ga0070717_11226929 Ga0070717_112269291 146
179 3300006163 Ga0070715_10029831 Ga0070715_100298312 146
180 3300006173 Ga0070716_100299575 Ga0070716_1002995752 146
181 3300006173 Ga0070716_100339365 Ga0070716_1003393652 146
182 3300006175 Ga0070712_100018655 Ga0070712_1000186552 146
183 3300006175 Ga0070712_100032656 Ga0070712_1000326564 146
184 3300006175 Ga0070712_100173972 Ga0070712_1001739722 146
185 3300006175 Ga0070712_100244025 Ga0070712_1002440252 146
186 3300006175 Ga0070712_100376087 Ga0070712_1003760872 146
187 3300006175 Ga0070712_100387133 Ga0070712_1003871331 146
188 3300006175 Ga0070712_100397837 Ga0070712_1003978372 146
189 3300006237 Ga0097621_100378247 Ga0097621_1003782472 146
190 3300006358 Ga0068871_101044475 Ga0068871_1010444751 146
191 3300006846 Ga0075430_100312390 Ga0075430_1003123902 146
192 3300006914 Ga0075436_100003427 Ga0075436_1000034272 146
193 3300006914 Ga0075436_100022071 Ga0075436_1000220715 146
194 3300006914 Ga0075436_100036783 Ga0075436_1000367832 146
195 3300006914 Ga0075436_100105033 Ga0075436_1001050332 146
196 3300006914 Ga0075436_100270051 Ga0075436_1002700512 146
197 3300007076 Ga0075435_100309842 Ga0075435_1003098422 146
198 3300007076 Ga0075435_100688686 Ga0075435_1006886862 146
199 3300009093 Ga0105240_10047167 Ga0105240_100471672 146
200 3300009093 Ga0105240_10265016 Ga0105240_102650162 146
201 3300009093 Ga0105240_10564658 Ga0105240_105646582 146
202 3300009093 Ga0105240_10789909 Ga0105240_107899092 146
203 3300009093 Ga0105240_11934558 Ga0105240_119345581 146
204 3300009098 Ga0105245_10000598 Ga0105245_1000059810 146
205 3300009098 Ga0105245_10033851 Ga0105245_100338516 146
206 3300009174 Ga0105241_10056519 Ga0105241_100565192 146
207 3300009545 Ga0105237_10327000 Ga0105237_103270002 146
208 3300009545 Ga0105237_10682122 Ga0105237_106821222 146
209 3300009551 Ga0105238_10354724 Ga0105238_103547242 146
210 3300009551 Ga0105238_11318511 Ga0105238_113185112 146
211 3300010375 Ga0105239_10669464 Ga0105239_106694642 146
212 3300013100 Ga0157373_10041467 Ga0157373_100414673 146
213 3300013100 Ga0157373_10095981 Ga0157373_100959812 146
214 3300013102 Ga0157371_10197060 Ga0157371_101970602 146
215 3300013104 Ga0157370_10060753 Ga0157370_100607532 146
216 3300013104 Ga0157370_10225299 Ga0157370_102252992 146
217 3300013104 Ga0157370_10259732 Ga0157370_102597322 146
218 3300013104 Ga0157370_10303636 Ga0157370_103036362 146
219 3300013105 Ga0157369_10119470 Ga0157369_101194702 146
220 3300013105 Ga0157369_10216440 Ga0157369_102164403 146
221 3300013105 Ga0157369_10224513 Ga0157369_102245132 146
222 3300013105 Ga0157369_10250432 Ga0157369_102504323 146
223 3300013296 Ga0157374_10147550 Ga0157374_101475501 146
224 3300013297 Ga0157378_10012420 Ga0157378_100124204 146
225 3300013307 Ga0157372_10053320 Ga0157372_100533202 146
226 3300013307 Ga0157372_10057899 Ga0157372_100578994 146
227 3300013307 Ga0157372_10441398 Ga0157372_104413981 146
228 3300013307 Ga0157372_10617735 Ga0157372_106177352 146
229 3300013307 Ga0157372_10650161 Ga0157372_106501612 146
230 3300013307 Ga0157372_11442667 Ga0157372_114426672 146
231 3300014326 Ga0157380_10747290 Ga0157380_107472902 146
232 3300014745 Ga0157377_10000183 Ga0157377_1000018332 146
233 3300014745 Ga0157377_11144423 Ga0157377_111444231 146
234 3300015261 Ga0182006_1154264 Ga0182006_11542642 146
235 3300020069 Ga0197907_10379512 Ga0197907_103795122 146
236 3300020069 Ga0197907_11005754 Ga0197907_110057542 146
237 3300020070 Ga0206356_10374345 Ga0206356_103743451 146
238 3300020070 Ga0206356_11395039 Ga0206356_113950391 146
239 3300020081 Ga0206354_10345737 Ga0206354_103457372 146
240 3300020082 Ga0206353_11887567 Ga0206353_118875671 146
241 3300021384 Ga0213876_10008965 Ga0213876_100089653 146
242 3300022467 Ga0224712_10010154 Ga0224712_100101543 146
243 3300022467 Ga0224712_10230023 Ga0224712_102300231 146
244 3300022467 Ga0224712_10602424 Ga0224712_106024241 146
245 3300025321 Ga0207656_10025741 Ga0207656_100257411 146
246 3300025906 Ga0207699_10165984 Ga0207699_101659842 146
247 3300025906 Ga0207699_10501426 Ga0207699_105014261 146
248 3300025906 Ga0207699_10589220 Ga0207699_105892202 146
249 3300025908 Ga0207643_10042578 Ga0207643_100425783 146
250 3300025910 Ga0207684_10350683 Ga0207684_103506832 146
251 3300025911 Ga0207654_10252553 Ga0207654_102525532 146
252 3300025912 Ga0207707_10009842 Ga0207707_100098428 146
253 3300025912 Ga0207707_10015240 Ga0207707_100152407 146
254 3300025912 Ga0207707_10191234 Ga0207707_101912343 146
255 3300025912 Ga0207707_10477695 Ga0207707_104776951 146
256 3300025913 Ga0207695_11012185 Ga0207695_110121851 146
257 3300025913 Ga0207695_11137974 Ga0207695_111379741 146
258 3300025915 Ga0207693_10002022 Ga0207693_1000202220 146
259 3300025915 Ga0207693_10069057 Ga0207693_100690573 146
260 3300025915 Ga0207693_10259381 Ga0207693_102593812 146
261 3300025915 Ga0207693_10323002 Ga0207693_103230022 146
262 3300025916 Ga0207663_10001864 Ga0207663_100018648 146
263 3300025916 Ga0207663_10090428 Ga0207663_100904282 146
264 3300025916 Ga0207663_10235345 Ga0207663_102353452 146
265 3300025916 Ga0207663_10695439 Ga0207663_106954392 146
266 3300025917 Ga0207660_10000046 Ga0207660_1000004614 146
267 3300025917 Ga0207660_10042097 Ga0207660_100420972 146
268 3300025917 Ga0207660_10135597 Ga0207660_101355972 146
269 3300025917 Ga0207660_11101635 Ga0207660_111016352 146
270 3300025920 Ga0207649_10210518 Ga0207649_102105183 146
271 3300025921 Ga0207652_10021650 Ga0207652_100216505 146
272 3300025921 Ga0207652_10080997 Ga0207652_100809974 146
273 3300025921 Ga0207652_10384970 Ga0207652_103849702 146
274 3300025921 Ga0207652_10514521 Ga0207652_105145212 146
275 3300025927 Ga0207687_10000753 Ga0207687_1000075317 146
276 3300025927 Ga0207687_10001541 Ga0207687_1000154110 146
277 3300025928 Ga0207700_10006682 Ga0207700_100066822 146
278 3300025928 Ga0207700_10079211 Ga0207700_100792113 146
279 3300025928 Ga0207700_10179225 Ga0207700_101792253 146
280 3300025928 Ga0207700_10189294 Ga0207700_101892942 146
281 3300025928 Ga0207700_10295414 Ga0207700_102954142 146
282 3300025929 Ga0207664_10106371 Ga0207664_101063713 146
283 3300025929 Ga0207664_10163918 Ga0207664_101639182 146
284 3300025929 Ga0207664_10260055 Ga0207664_102600552 146
285 3300025929 Ga0207664_10670069 Ga0207664_106700692 146
286 3300025939 Ga0207665_10011933 Ga0207665_100119332 146
287 3300025939 Ga0207665_10313127 Ga0207665_103131272 146
288 3300025942 Ga0207689_10281643 Ga0207689_102816432 146
289 3300025944 Ga0207661_10128482 Ga0207661_101284823 146
290 3300025949 Ga0207667_10019963 Ga0207667_1001996312 146
291 3300025949 Ga0207667_10367248 Ga0207667_103672482 146
292 3300025960 Ga0207651_10012516 Ga0207651_100125163 146
293 3300025981 Ga0207640_10122448 Ga0207640_101224482 146
294 3300026035 Ga0207703_10000085 Ga0207703_1000008552 146
295 3300026041 Ga0207639_10062525 Ga0207639_100625252 146
296 3300026078 Ga0207702_10190319 Ga0207702_101903192 146
297 3300026116 Ga0207674_10493518 Ga0207674_104935182 146
298 3300026142 Ga0207698_10997268 Ga0207698_109972682 146
299 3300035086 Ga0373934_0008649 Ga0373934_0008649_1015_1464 146
300 3300035111 Ga0373923_0139461 Ga0373923_0139461_420_866 146
301 3300035111 Ga0373923_0352395 Ga0373923_0352395_148_600 146
302 3300035119 Ga0373956_0004323 Ga0373956_0004323_2608_3057 146
303 3300035119 Ga0373956_0016550 Ga0373956_0016550_530_982 146
304 3300035121 Ga0373960_0070317 Ga0373960_0070317_458_904 146
305 3300035172 Ga0373955_0295973 Ga0373955_0295973_396_845 146
306 3300035410 Ga0373924_0014296 Ga0373924_0014296_1310_1762 146
307 3300035691 Ga0373931_0579336 Ga0373931_0579336_220_666 146
308 3300035692 Ga0373935_0170640 Ga0373935_0170640_284_730 146
309 3300035724 Ga0373933_0003213 Ga0373933_0003213_2644_3093 146
310 3300035724 Ga0373933_1034400 Ga0373933_1034400_79_531 146
311 3300035725 Ga0373947_0173877 Ga0373947_0173877_852_1298 146
312 3300036401 Ga0373937_0000455 Ga0373937_0000455_12702_13151 146
313 3300036401 Ga0373937_0001803 Ga0373937_0001803_12383_12835 146
314 3300036401 Ga0373937_0073694 Ga0373937_0073694_183_635 146
315 3300036401 Ga0373937_0451882 Ga0373937_0451882_233_682 146
316 3300036401 Ga0373937_0701993 Ga0373937_0701993_205_654 146
317 3300037068 Ga0373925_0008739 Ga0373925_0008739_4414_4860 146
318 3300038443 Ga0395901_0424127 Ga0395901_0424127_872_1324 146
319 3300039437 Ga0436365_0968862 Ga0436365_0968862_315_764 146
320 3300039437 Ga0436365_1692853 Ga0436365_1692853_310_759 146
321 3300042876 Ga0451577_0320960 Ga0451577_0320960_391_840 146
322 3300044684 Ga0466966_0421313 Ga0466966_0421313_239_685 146
323 3300044693 Ga0466961_0457910 Ga0466961_0457910_220_666 146
324 3300044712 Ga0453684_0047620 Ga0453684_0047620_3234_3683 146
325 3300044719 Ga0466971_0589174 Ga0466971_0589174_67_513 146
326 3300044735 Ga0466968_0107957 Ga0466968_0107957_775_1221 146
327 3300044842 Ga0466957_0960957 Ga0466957_0960957_58_504 146
328 3300045976 Ga0466967_0027554 Ga0466967_0027554_1937_2389 146
329 3300045976 Ga0466967_0033460 Ga0466967_0033460_2463_2909 146
330 3300045976 Ga0466967_1556224 Ga0466967_1556224_79_525 146
331 3300046462 Ga0495651_0002665 Ga0495651_0002665_10837_11286 146
332 3300046463 Ga0495653_0257489 Ga0495653_0257489_63_512 146
333 3300046472 Ga0495580_0380215 Ga0495580_0380215_268_714 146
334 3300046516 Ga0495628_0356074 Ga0495628_0356074_35_487 146
335 3300046529 Ga0495652_0035479 Ga0495652_0035479_2812_3261 146
336 3300046529 Ga0495652_0108432 Ga0495652_0108432_1444_1896 146
337 3300046536 Ga0495587_0005061 Ga0495587_0005061_5077_5526 146
338 3300046536 Ga0495587_0348400 Ga0495587_0348400_307_759 146
339 3300046539 Ga0495621_0043692 Ga0495621_0043692_184_630 146
340 3300046543 Ga0495645_0524722 Ga0495645_0524722_240_689 146
341 3300046674 Ga0495588_0203002 Ga0495588_0203002_154_600 146
342 3300046675 Ga0495657_0285258 Ga0495657_0285258_17_466 146
343 3300046679 Ga0495623_0114176 Ga0495623_0114176_448_897 146
344 3300047317 Ga0495604_0167692 Ga0495604_0167692_226_675 146
345 3300047444 Ga0495675_0012326 Ga0495675_0012326_3410_3859 146
346 3300048088 Ga0495602_0000191 Ga0495602_0000191_24643_25092 146
347 3300048088 Ga0495602_0528292 Ga0495602_0528292_89_532 146
348 3300048903 Ga0496100_0073346 Ga0496100_0073346_492_944 146
349 3300048905 Ga0496102_1427125 Ga0496102_1427125_52_504 146
350 3300048907 Ga0496104_0199151 Ga0496104_0199151_169_612 146
351 3300048907 Ga0496104_0520395 Ga0496104_0520395_249_701 146
352 3300048907 Ga0496104_0596568 Ga0496104_0596568_430_876 146
353 3300048908 Ga0496105_0001295 Ga0496105_0001295_950_1402 146
354 3300048908 Ga0496105_0756181 Ga0496105_0756181_100_543 146
355 3300048914 Ga0496111_0132068 Ga0496111_0132068_930_1382 146
356 3300048915 Ga0496112_0018055 Ga0496112_0018055_369_815 146
357 3300048915 Ga0496112_0930510 Ga0496112_0930510_85_537 146
358 3300049576 Ga0501040_1262847 Ga0501040_1262847_76_525 146
359 3300050509 nmdc:mga0qj67_406834_c1 nmdc:mga0qj67_406834_c1_521_973 146
360 3300050513 nmdc:mga0rr50_1265604_c1 nmdc:mga0rr50_1265604_c1_129_581 146
361 3300050513 nmdc:mga0rr50_432089_c1 nmdc:mga0rr50_432089_c1_230_679 146
362 3300050514 nmdc:mga08x19_142954_c1 nmdc:mga08x19_142954_c1_559_1005 146
363 3300050514 nmdc:mga08x19_2609_c1 nmdc:mga08x19_2609_c1_920_1366 146
364 3300050514 nmdc:mga08x19_688297_c1 nmdc:mga08x19_688297_c1_210_659 146
365 3300050514 nmdc:mga08x19_7721_c1 nmdc:mga08x19_7721_c1_5737_6186 146
366 3300050514 nmdc:mga08x19_93793_c1 nmdc:mga08x19_93793_c1_513_962 146
367 3300050514 nmdc:mga08x19_96720_c1 nmdc:mga08x19_96720_c1_68_517 146
368 3300059492 Ga0587073_0016559 Ga0587073_0016559_570_1022 146
369 3300059630 Ga0587128_002833 Ga0587128_002833_861_1304 146
370 3300059655 Ga0587114_036039 Ga0587114_036039_228_680 146
371 3300061719 Ga0466962_0240908 Ga0466962_0240908_206_658 146
372 3300061719 Ga0466962_0282852 Ga0466962_0282852_48_494 146
373 3300004800 Ga0058861_11826821 Ga0058861_118268212 147
374 3300004800 Ga0058861_12031869 Ga0058861_120318692 147
375 3300004803 Ga0058862_12268890 Ga0058862_122688902 147
376 3300004803 Ga0058862_12345701 Ga0058862_123457012 147
377 3300004803 Ga0058862_12473751 Ga0058862_124737512 147
378 3300005289 Ga0065704_10126818 Ga0065704_101268182 147
379 3300005290 Ga0065712_10218621 Ga0065712_102186212 147
380 3300005295 Ga0065707_10006434 Ga0065707_100064342 147
381 3300005295 Ga0065707_10088310 Ga0065707_100883105 147
382 3300005327 Ga0070658_10029956 Ga0070658_100299564 147
383 3300005327 Ga0070658_10322621 Ga0070658_103226212 147
384 3300005327 Ga0070658_10858312 Ga0070658_108583121 147
385 3300005328 Ga0070676_10253514 Ga0070676_102535142 147
386 3300005328 Ga0070676_10534570 Ga0070676_105345701 147
387 3300005329 Ga0070683_100000027 Ga0070683_100000027133 147
388 3300005329 Ga0070683_100085855 Ga0070683_1000858554 147
389 3300005329 Ga0070683_100129470 Ga0070683_1001294703 147
390 3300005329 Ga0070683_100339897 Ga0070683_1003398973 147
391 3300005329 Ga0070683_100468908 Ga0070683_1004689082 147
392 3300005329 Ga0070683_100505926 Ga0070683_1005059261 147
393 3300005329 Ga0070683_100532233 Ga0070683_1005322332 147
394 3300005329 Ga0070683_101410228 Ga0070683_1014102282 147
395 3300005331 Ga0070670_100000463 Ga0070670_10000046321 147
396 3300005331 Ga0070670_100001082 Ga0070670_10000108215 147
397 3300005331 Ga0070670_100011194 Ga0070670_1000111946 147
398 3300005331 Ga0070670_100056945 Ga0070670_1000569453 147
399 3300005331 Ga0070670_100111653 Ga0070670_1001116533 147
400 3300005334 Ga0068869_100005528 Ga0068869_1000055287 147
401 3300005334 Ga0068869_100012601 Ga0068869_1000126013 147
402 3300005334 Ga0068869_100429892 Ga0068869_1004298922 147
403 3300005334 Ga0068869_100730496 Ga0068869_1007304961 147
404 3300005334 Ga0068869_100744136 Ga0068869_1007441362 147
405 3300005334 Ga0068869_101265702 Ga0068869_1012657021 147
406 3300005335 Ga0070666_10067040 Ga0070666_100670401 147
407 3300005335 Ga0070666_10105851 Ga0070666_101058512 147
408 3300005336 Ga0070680_100018863 Ga0070680_1000188632 147
409 3300005336 Ga0070680_100019548 Ga0070680_1000195483 147
410 3300005336 Ga0070680_100283317 Ga0070680_1002833172 147
411 3300005336 Ga0070680_100303536 Ga0070680_1003035361 147
412 3300005337 Ga0070682_100389044 Ga0070682_1003890441 147
413 3300005337 Ga0070682_100483228 Ga0070682_1004832282 147
414 3300005338 Ga0068868_100001785 Ga0068868_10000178510 147
415 3300005338 Ga0068868_100030424 Ga0068868_1000304242 147
416 3300005338 Ga0068868_100040900 Ga0068868_1000409006 147
417 3300005338 Ga0068868_100041428 Ga0068868_1000414283 147
418 3300005338 Ga0068868_100052957 Ga0068868_1000529573 147
419 3300005338 Ga0068868_100094920 Ga0068868_1000949203 147
420 3300005338 Ga0068868_100141354 Ga0068868_1001413543 147
421 3300005338 Ga0068868_100216735 Ga0068868_1002167352 147
422 3300005339 Ga0070660_100349004 Ga0070660_1003490041 147
423 3300005340 Ga0070689_100037297 Ga0070689_1000372973 147
424 3300005340 Ga0070689_100382322 Ga0070689_1003823222 147
425 3300005340 Ga0070689_100387431 Ga0070689_1003874312 147
426 3300005340 Ga0070689_100404387 Ga0070689_1004043871 147
427 3300005340 Ga0070689_100624043 Ga0070689_1006240431 147
428 3300005341 Ga0070691_10134081 Ga0070691_101340813 147
429 3300005341 Ga0070691_10138763 Ga0070691_101387631 147
430 3300005341 Ga0070691_10208907 Ga0070691_102089071 147
431 3300005343 Ga0070687_100007147 Ga0070687_1000071472 147
432 3300005343 Ga0070687_100193374 Ga0070687_1001933742 147
433 3300005343 Ga0070687_100412902 Ga0070687_1004129022 147
434 3300005344 Ga0070661_100192185 Ga0070661_1001921852 147
435 3300005344 Ga0070661_100304115 Ga0070661_1003041152 147
436 3300005344 Ga0070661_100577253 Ga0070661_1005772532 147
437 3300005345 Ga0070692_10042923 Ga0070692_100429232 147
438 3300005354 Ga0070675_100000003 Ga0070675_100000003109 147
439 3300005354 Ga0070675_100655528 Ga0070675_1006555282 147
440 3300005355 Ga0070671_100093791 Ga0070671_1000937914 147
441 3300005355 Ga0070671_101063623 Ga0070671_1010636232 147
442 3300005356 Ga0070674_100284408 Ga0070674_1002844083 147
443 3300005364 Ga0070673_100122565 Ga0070673_1001225651 147
444 3300005364 Ga0070673_100593985 Ga0070673_1005939852 147
445 3300005364 Ga0070673_100806147 Ga0070673_1008061472 147
446 3300005365 Ga0070688_100639171 Ga0070688_1006391712 147
447 3300005366 Ga0070659_100535689 Ga0070659_1005356892 147
448 3300005367 Ga0070667_100934025 Ga0070667_1009340252 147
449 3300005434 Ga0070709_10248002 Ga0070709_102480022 147
450 3300005434 Ga0070709_10547093 Ga0070709_105470932 147
451 3300005435 Ga0070714_100011335 Ga0070714_1000113354 147
452 3300005435 Ga0070714_100038531 Ga0070714_1000385312 147
453 3300005435 Ga0070714_100108019 Ga0070714_1001080193 147
454 3300005435 Ga0070714_100117911 Ga0070714_1001179112 147
455 3300005435 Ga0070714_100170309 Ga0070714_1001703093 147
456 3300005435 Ga0070714_100190225 Ga0070714_1001902252 147
457 3300005435 Ga0070714_100205182 Ga0070714_1002051822 147
458 3300005435 Ga0070714_100214234 Ga0070714_1002142342 147
459 3300005435 Ga0070714_100228055 Ga0070714_1002280552 147
460 3300005435 Ga0070714_100568576 Ga0070714_1005685762 147
461 3300005435 Ga0070714_102032589 Ga0070714_1020325891 147
462 3300005436 Ga0070713_100008383 Ga0070713_1000083832 147
463 3300005436 Ga0070713_100075911 Ga0070713_1000759112 147
464 3300005436 Ga0070713_100086884 Ga0070713_1000868842 147
465 3300005436 Ga0070713_100104493 Ga0070713_1001044932 147
466 3300005436 Ga0070713_100127628 Ga0070713_1001276282 147
467 3300005436 Ga0070713_100158681 Ga0070713_1001586811 147
468 3300005436 Ga0070713_100230484 Ga0070713_1002304842 147
469 3300005436 Ga0070713_100265815 Ga0070713_1002658152 147
470 3300005436 Ga0070713_100375520 Ga0070713_1003755201 147
471 3300005436 Ga0070713_100669183 Ga0070713_1006691832 147
472 3300005437 Ga0070710_10025235 Ga0070710_100252352 147
473 3300005437 Ga0070710_10122967 Ga0070710_101229672 147
474 3300005437 Ga0070710_10302698 Ga0070710_103026982 147
475 3300005437 Ga0070710_10587852 Ga0070710_105878522 147
476 3300005439 Ga0070711_100213706 Ga0070711_1002137062 147
477 3300005439 Ga0070711_100634977 Ga0070711_1006349771 147
478 3300005441 Ga0070700_100000009 Ga0070700_10000000974 147
479 3300005445 Ga0070708_100001651 Ga0070708_1000016512 147
480 3300005445 Ga0070708_100002626 Ga0070708_10000262611 147
481 3300005445 Ga0070708_100094657 Ga0070708_1000946574 147
482 3300005445 Ga0070708_100109118 Ga0070708_1001091183 147
483 3300005445 Ga0070708_100189331 Ga0070708_1001893313 147
484 3300005445 Ga0070708_100205949 Ga0070708_1002059492 147
485 3300005445 Ga0070708_100428983 Ga0070708_1004289832 147
486 3300005445 Ga0070708_100600083 Ga0070708_1006000832 147
487 3300005445 Ga0070708_100644079 Ga0070708_1006440792 147
488 3300005445 Ga0070708_100878610 Ga0070708_1008786102 147
489 3300005456 Ga0070678_100153071 Ga0070678_1001530713 147
490 3300005457 Ga0070662_100131671 Ga0070662_1001316712 147
491 3300005457 Ga0070662_100541086 Ga0070662_1005410861 147
492 3300005458 Ga0070681_10003881 Ga0070681_100038815 147
493 3300005458 Ga0070681_10009757 Ga0070681_100097573 147
494 3300005458 Ga0070681_10023368 Ga0070681_100233685 147
495 3300005458 Ga0070681_10212491 Ga0070681_102124911 147
496 3300005458 Ga0070681_10674743 Ga0070681_106747432 147
497 3300005458 Ga0070681_11037795 Ga0070681_110377952 147
498 3300005459 Ga0068867_100217866 Ga0068867_1002178661 147
499 3300005459 Ga0068867_100442899 Ga0068867_1004428992 147
500 3300005459 Ga0068867_100847046 Ga0068867_1008470462 147
501 3300005459 Ga0068867_101851097 Ga0068867_1018510971 147
502 3300005459 Ga0068867_101924074 Ga0068867_1019240741 147
503 3300005466 Ga0070685_10019936 Ga0070685_100199365 147
504 3300005467 Ga0070706_100005420 Ga0070706_1000054209 147
505 3300005467 Ga0070706_100006733 Ga0070706_1000067337 147
506 3300005467 Ga0070706_100032990 Ga0070706_1000329902 147
507 3300005467 Ga0070706_100054718 Ga0070706_1000547183 147
508 3300005467 Ga0070706_100116712 Ga0070706_1001167123 147
509 3300005467 Ga0070706_100354440 Ga0070706_1003544402 147
510 3300005467 Ga0070706_100511771 Ga0070706_1005117712 147
511 3300005467 Ga0070706_101603960 Ga0070706_1016039601 147
512 3300005468 Ga0070707_100010978 Ga0070707_1000109788 147
513 3300005468 Ga0070707_100019381 Ga0070707_1000193814 147
514 3300005468 Ga0070707_100031374 Ga0070707_1000313742 147
515 3300005468 Ga0070707_100069096 Ga0070707_1000690963 147
516 3300005468 Ga0070707_100199627 Ga0070707_1001996272 147
517 3300005468 Ga0070707_100486210 Ga0070707_1004862102 147
518 3300005468 Ga0070707_100503942 Ga0070707_1005039421 147
519 3300005468 Ga0070707_101023145 Ga0070707_1010231452 147
520 3300005468 Ga0070707_101143239 Ga0070707_1011432391 147
521 3300005468 Ga0070707_101788170 Ga0070707_1017881701 147
522 3300005471 Ga0070698_100002386 Ga0070698_10000238610 147
523 3300005471 Ga0070698_100041416 Ga0070698_1000414162 147
524 3300005471 Ga0070698_100091868 Ga0070698_1000918684 147
525 3300005471 Ga0070698_100308818 Ga0070698_1003088182 147
526 3300005471 Ga0070698_100318883 Ga0070698_1003188832 147
527 3300005471 Ga0070698_100511677 Ga0070698_1005116772 147
528 3300005471 Ga0070698_100870836 Ga0070698_1008708362 147
529 3300005471 Ga0070698_101658750 Ga0070698_1016587501 147
530 3300005518 Ga0070699_100011379 Ga0070699_1000113797 147
531 3300005518 Ga0070699_100018505 Ga0070699_1000185055 147
532 3300005518 Ga0070699_100043826 Ga0070699_1000438265 147
533 3300005518 Ga0070699_100056139 Ga0070699_1000561393 147
534 3300005518 Ga0070699_100080530 Ga0070699_1000805303 147
535 3300005518 Ga0070699_100170794 Ga0070699_1001707944 147
536 3300005518 Ga0070699_100371683 Ga0070699_1003716832 147
537 3300005518 Ga0070699_100387940 Ga0070699_1003879402 147
538 3300005518 Ga0070699_100438654 Ga0070699_1004386542 147
539 3300005518 Ga0070699_100507596 Ga0070699_1005075962 147
540 3300005518 Ga0070699_100562079 Ga0070699_1005620792 147
541 3300005518 Ga0070699_100853234 Ga0070699_1008532341 147
542 3300005530 Ga0070679_100002130 Ga0070679_10000213013 147
543 3300005530 Ga0070679_100043914 Ga0070679_1000439144 147
544 3300005530 Ga0070679_100051807 Ga0070679_1000518074 147
545 3300005530 Ga0070679_100105697 Ga0070679_1001056974 147
546 3300005530 Ga0070679_100191563 Ga0070679_1001915633 147
547 3300005530 Ga0070679_100659981 Ga0070679_1006599812 147
548 3300005530 Ga0070679_101090234 Ga0070679_1010902342 147
549 3300005535 Ga0070684_100075076 Ga0070684_1000750764 147
550 3300005535 Ga0070684_100447061 Ga0070684_1004470611 147
551 3300005535 Ga0070684_101737285 Ga0070684_1017372851 147
552 3300005536 Ga0070697_100015335 Ga0070697_1000153354 147
553 3300005536 Ga0070697_100045075 Ga0070697_1000450753 147
554 3300005536 Ga0070697_100066579 Ga0070697_1000665793 147
555 3300005536 Ga0070697_100152238 Ga0070697_1001522382 147
556 3300005536 Ga0070697_100197635 Ga0070697_1001976352 147
557 3300005536 Ga0070697_100235806 Ga0070697_1002358063 147
558 3300005536 Ga0070697_100286417 Ga0070697_1002864172 147
559 3300005536 Ga0070697_100289628 Ga0070697_1002896282 147
560 3300005536 Ga0070697_100304357 Ga0070697_1003043572 147
561 3300005536 Ga0070697_100717790 Ga0070697_1007177901 147
562 3300005539 Ga0068853_100103900 Ga0068853_1001039003 147
563 3300005539 Ga0068853_100472817 Ga0068853_1004728172 147
564 3300005539 Ga0068853_100961508 Ga0068853_1009615082 147
565 3300005544 Ga0070686_100356060 Ga0070686_1003560602 147
566 3300005546 Ga0070696_100688771 Ga0070696_1006887712 147
567 3300005547 Ga0070693_100023038 Ga0070693_1000230383 147
568 3300005547 Ga0070693_100026169 Ga0070693_1000261693 147
569 3300005547 Ga0070693_100068527 Ga0070693_1000685273 147
570 3300005547 Ga0070693_100323126 Ga0070693_1003231262 147
571 3300005547 Ga0070693_100711938 Ga0070693_1007119382 147
572 3300005548 Ga0070665_100056980 Ga0070665_1000569803 147
573 3300005548 Ga0070665_100298376 Ga0070665_1002983763 147
574 3300005549 Ga0070704_100733286 Ga0070704_1007332862 147
575 3300005563 Ga0068855_100005920 Ga0068855_1000059209 147
576 3300005563 Ga0068855_100007209 Ga0068855_1000072094 147
577 3300005563 Ga0068855_100009704 Ga0068855_1000097044 147
578 3300005563 Ga0068855_100038946 Ga0068855_1000389465 147
579 3300005563 Ga0068855_100136459 Ga0068855_1001364592 147
580 3300005563 Ga0068855_100200944 Ga0068855_1002009442 147
581 3300005564 Ga0070664_100000866 Ga0070664_10000086610 147
582 3300005564 Ga0070664_100093002 Ga0070664_1000930022 147
583 3300005564 Ga0070664_100653764 Ga0070664_1006537642 147
584 3300005577 Ga0068857_100000411 Ga0068857_1000004116 147
585 3300005577 Ga0068857_100009678 Ga0068857_1000096786 147
586 3300005577 Ga0068857_100017406 Ga0068857_1000174062 147
587 3300005577 Ga0068857_102227422 Ga0068857_1022274221 147
588 3300005578 Ga0068854_100020791 Ga0068854_1000207912 147
589 3300005578 Ga0068854_100066312 Ga0068854_1000663122 147
590 3300005578 Ga0068854_100088598 Ga0068854_1000885983 147
591 3300005578 Ga0068854_100102336 Ga0068854_1001023363 147
592 3300005614 Ga0068856_100008169 Ga0068856_1000081696 147
593 3300005614 Ga0068856_100012953 Ga0068856_1000129537 147
594 3300005614 Ga0068856_100032852 Ga0068856_1000328524 147
595 3300005614 Ga0068856_100037367 Ga0068856_1000373674 147
596 3300005614 Ga0068856_100103267 Ga0068856_1001032673 147
597 3300005614 Ga0068856_100121927 Ga0068856_1001219272 147
598 3300005614 Ga0068856_100403058 Ga0068856_1004030583 147
599 3300005614 Ga0068856_100716981 Ga0068856_1007169812 147
600 3300005615 Ga0070702_100011129 Ga0070702_1000111292 147
601 3300005615 Ga0070702_100047580 Ga0070702_1000475802 147
602 3300005615 Ga0070702_100192593 Ga0070702_1001925932 147
603 3300005616 Ga0068852_100012058 Ga0068852_1000120583 147
604 3300005616 Ga0068852_100032637 Ga0068852_1000326372 147
605 3300005616 Ga0068852_100112836 Ga0068852_1001128364 147
606 3300005616 Ga0068852_100422951 Ga0068852_1004229512 147
607 3300005617 Ga0068859_100102667 Ga0068859_1001026673 147
608 3300005617 Ga0068859_100775216 Ga0068859_1007752162 147
609 3300005618 Ga0068864_100015763 Ga0068864_1000157635 147
610 3300005618 Ga0068864_100136078 Ga0068864_1001360783 147
611 3300005618 Ga0068864_101108302 Ga0068864_1011083022 147
612 3300005718 Ga0068866_10057313 Ga0068866_100573132 147
613 3300005718 Ga0068866_10785266 Ga0068866_107852662 147
614 3300005840 Ga0068870_10059842 Ga0068870_100598422 147
615 3300005840 Ga0068870_10402039 Ga0068870_104020391 147
616 3300005841 Ga0068863_100126026 Ga0068863_1001260262 147
617 3300005841 Ga0068863_100388966 Ga0068863_1003889662 147
618 3300005841 Ga0068863_100590054 Ga0068863_1005900542 147
619 3300005841 Ga0068863_100687900 Ga0068863_1006879002 147
620 3300005841 Ga0068863_101415259 Ga0068863_1014152592 147
621 3300005842 Ga0068858_100009146 Ga0068858_1000091462 147
622 3300005842 Ga0068858_100037092 Ga0068858_1000370925 147
623 3300005842 Ga0068858_100729284 Ga0068858_1007292842 147
624 3300005843 Ga0068860_100208777 Ga0068860_1002087773 147
625 3300006028 Ga0070717_10003192 Ga0070717_100031923 147
626 3300006028 Ga0070717_10003519 Ga0070717_100035193 147
627 3300006028 Ga0070717_10007708 Ga0070717_100077083 147
628 3300006028 Ga0070717_10109003 Ga0070717_101090032 147
629 3300006028 Ga0070717_10154244 Ga0070717_101542442 147
630 3300006028 Ga0070717_10176333 Ga0070717_101763332 147
631 3300006028 Ga0070717_10178463 Ga0070717_101784632 147
632 3300006028 Ga0070717_10246108 Ga0070717_102461083 147
633 3300006028 Ga0070717_10311075 Ga0070717_103110752 147
634 3300006028 Ga0070717_10439465 Ga0070717_104394652 147
635 3300006028 Ga0070717_10442247 Ga0070717_104422471 147
636 3300006028 Ga0070717_10452265 Ga0070717_104522652 147
637 3300006028 Ga0070717_10499744 Ga0070717_104997442 147
638 3300006028 Ga0070717_10762548 Ga0070717_107625482 147
639 3300006028 Ga0070717_11006649 Ga0070717_110066492 147
640 3300006028 Ga0070717_11062232 Ga0070717_110622321 147
641 3300006028 Ga0070717_11171334 Ga0070717_111713342 147
642 3300006163 Ga0070715_10134463 Ga0070715_101344632 147
643 3300006173 Ga0070716_100012539 Ga0070716_1000125393 147
644 3300006173 Ga0070716_100069089 Ga0070716_1000690892 147
645 3300006173 Ga0070716_100236640 Ga0070716_1002366402 147
646 3300006173 Ga0070716_100251525 Ga0070716_1002515252 147
647 3300006175 Ga0070712_100003532 Ga0070712_1000035321 147
648 3300006175 Ga0070712_100049048 Ga0070712_1000490483 147
649 3300006175 Ga0070712_100162949 Ga0070712_1001629493 147
650 3300006175 Ga0070712_100220913 Ga0070712_1002209132 147
651 3300006175 Ga0070712_100354583 Ga0070712_1003545832 147
652 3300006175 Ga0070712_101630862 Ga0070712_1016308621 147
653 3300006237 Ga0097621_100000105 Ga0097621_10000010537 147
654 3300006237 Ga0097621_100000310 Ga0097621_10000031020 147
655 3300006237 Ga0097621_100000987 Ga0097621_1000009874 147
656 3300006237 Ga0097621_100029240 Ga0097621_1000292402 147
657 3300006237 Ga0097621_100125003 Ga0097621_1001250032 147
658 3300006237 Ga0097621_100973584 Ga0097621_1009735841 147
659 3300006358 Ga0068871_100000837 Ga0068871_10000083711 147
660 3300006358 Ga0068871_100003783 Ga0068871_1000037832 147
661 3300006358 Ga0068871_100009686 Ga0068871_1000096865 147
662 3300006358 Ga0068871_100197519 Ga0068871_1001975192 147
663 3300006358 Ga0068871_100705305 Ga0068871_1007053051 147
664 3300006844 Ga0075428_100002434 Ga0075428_10000243417 147
665 3300006844 Ga0075428_100087764 Ga0075428_1000877642 147
666 3300006844 Ga0075428_100950193 Ga0075428_1009501932 147
667 3300006847 Ga0075431_100017617 Ga0075431_1000176177 147
668 3300006852 Ga0075433_10008295 Ga0075433_1000829512 147
669 3300006852 Ga0075433_10304686 Ga0075433_103046862 147
670 3300006852 Ga0075433_10786556 Ga0075433_107865561 147
671 3300006852 Ga0075433_10964406 Ga0075433_109644061 147
672 3300006871 Ga0075434_100016559 Ga0075434_10001655910 147
673 3300006871 Ga0075434_100018244 Ga0075434_1000182443 147
674 3300006871 Ga0075434_100090357 Ga0075434_1000903576 147
675 3300006871 Ga0075434_100100266 Ga0075434_1001002662 147
676 3300006871 Ga0075434_100128993 Ga0075434_1001289932 147
677 3300006871 Ga0075434_100390522 Ga0075434_1003905222 147
678 3300006871 Ga0075434_100629290 Ga0075434_1006292902 147
679 3300006871 Ga0075434_100782837 Ga0075434_1007828372 147
680 3300006880 Ga0075429_100336049 Ga0075429_1003360492 147
681 3300006880 Ga0075429_100685577 Ga0075429_1006855772 147
682 3300006881 Ga0068865_100079200 Ga0068865_1000792002 147
683 3300006881 Ga0068865_100197831 Ga0068865_1001978312 147
684 3300006881 Ga0068865_100850751 Ga0068865_1008507512 147
685 3300006914 Ga0075436_100009672 Ga0075436_1000096728 147
686 3300006914 Ga0075436_100012530 Ga0075436_1000125305 147
687 3300006914 Ga0075436_100271612 Ga0075436_1002716122 147
688 3300006914 Ga0075436_100301844 Ga0075436_1003018441 147
689 3300006931 Ga0097620_100102673 Ga0097620_1001026733 147
690 3300006931 Ga0097620_100775339 Ga0097620_1007753392 147
691 3300007076 Ga0075435_100000187 Ga0075435_10000018729 147
692 3300007076 Ga0075435_100012620 Ga0075435_1000126203 147
693 3300007076 Ga0075435_100025300 Ga0075435_1000253004 147
694 3300007076 Ga0075435_100051127 Ga0075435_1000511272 147
695 3300007076 Ga0075435_100147251 Ga0075435_1001472511 147
696 3300007788 Ga0099795_10069494 Ga0099795_100694942 147
697 3300007788 Ga0099795_10086882 Ga0099795_100868822 147
698 3300009093 Ga0105240_10013038 Ga0105240_100130383 147
699 3300009093 Ga0105240_10024899 Ga0105240_100248996 147
700 3300009093 Ga0105240_10044258 Ga0105240_100442588 147
701 3300009093 Ga0105240_10060071 Ga0105240_100600713 147
702 3300009093 Ga0105240_10061933 Ga0105240_100619337 147
703 3300009093 Ga0105240_10070273 Ga0105240_100702733 147
704 3300009093 Ga0105240_10096593 Ga0105240_100965933 147
705 3300009093 Ga0105240_10385121 Ga0105240_103851213 147
706 3300009093 Ga0105240_10413961 Ga0105240_104139612 147
707 3300009093 Ga0105240_10521960 Ga0105240_105219602 147
708 3300009094 Ga0111539_10000003 Ga0111539_10000003390 147
709 3300009094 Ga0111539_10361181 Ga0111539_103611813 147
710 3300009098 Ga0105245_10000010 Ga0105245_10000010117 147
711 3300009098 Ga0105245_10000376 Ga0105245_1000037612 147
712 3300009098 Ga0105245_10001899 Ga0105245_100018995 147
713 3300009098 Ga0105245_10727007 Ga0105245_107270072 147
714 3300009147 Ga0114129_10084367 Ga0114129_100843674 147
715 3300009147 Ga0114129_10114023 Ga0114129_101140232 147
716 3300009147 Ga0114129_10614802 Ga0114129_106148022 147
717 3300009147 Ga0114129_11940937 Ga0114129_119409372 147
718 3300009174 Ga0105241_10659924 Ga0105241_106599241 147
719 3300009174 Ga0105241_10899135 Ga0105241_108991352 147
720 3300009176 Ga0105242_10003591 Ga0105242_100035918 147
721 3300009176 Ga0105242_10085585 Ga0105242_100855851 147
722 3300009176 Ga0105242_10090010 Ga0105242_100900103 147
723 3300009176 Ga0105242_11209705 Ga0105242_112097052 147
724 3300009177 Ga0105248_10005773 Ga0105248_100057734 147
725 3300009177 Ga0105248_10083969 Ga0105248_100839692 147
726 3300009177 Ga0105248_10164874 Ga0105248_101648742 147
727 3300009177 Ga0105248_10203691 Ga0105248_102036912 147
728 3300009177 Ga0105248_10312224 Ga0105248_103122242 147
729 3300009177 Ga0105248_11732161 Ga0105248_117321611 147
730 3300009545 Ga0105237_10020063 Ga0105237_100200633 147
731 3300009545 Ga0105237_10253081 Ga0105237_102530812 147
732 3300009545 Ga0105237_11001398 Ga0105237_110013982 147
733 3300009545 Ga0105237_11385806 Ga0105237_113858061 147
734 3300009551 Ga0105238_10000002 Ga0105238_10000002172 147
735 3300009551 Ga0105238_10001073 Ga0105238_100010734 147
736 3300009551 Ga0105238_10022389 Ga0105238_100223894 147
737 3300009551 Ga0105238_10030613 Ga0105238_100306133 147
738 3300009551 Ga0105238_10265593 Ga0105238_102655932 147
739 3300009551 Ga0105238_10349329 Ga0105238_103493292 147
740 3300009551 Ga0105238_11085244 Ga0105238_110852441 147
741 3300010375 Ga0105239_10046171 Ga0105239_100461712 147
742 3300010375 Ga0105239_10047898 Ga0105239_100478985 147
743 3300010375 Ga0105239_10150288 Ga0105239_101502883 147
744 3300010375 Ga0105239_10675359 Ga0105239_106753592 147
745 3300010375 Ga0105239_11132276 Ga0105239_111322762 147
746 3300011119 Ga0105246_10125623 Ga0105246_101256232 147
747 3300013100 Ga0157373_10035076 Ga0157373_100350763 147
748 3300013102 Ga0157371_10013642 Ga0157371_100136425 147
749 3300013102 Ga0157371_10059203 Ga0157371_100592032 147
750 3300013102 Ga0157371_10151287 Ga0157371_101512872 147
751 3300013102 Ga0157371_10157590 Ga0157371_101575902 147
752 3300013104 Ga0157370_10047428 Ga0157370_100474284 147
753 3300013104 Ga0157370_10137920 Ga0157370_101379203 147
754 3300013104 Ga0157370_10142918 Ga0157370_101429183 147
755 3300013104 Ga0157370_10285221 Ga0157370_102852212 147
756 3300013104 Ga0157370_10349405 Ga0157370_103494053 147
757 3300013105 Ga0157369_10000226 Ga0157369_1000022645 147
758 3300013105 Ga0157369_10000589 Ga0157369_1000058932 147
759 3300013105 Ga0157369_10036635 Ga0157369_100366353 147
760 3300013105 Ga0157369_10050121 Ga0157369_100501213 147
761 3300013105 Ga0157369_10050515 Ga0157369_100505153 147
762 3300013105 Ga0157369_10051610 Ga0157369_100516102 147
763 3300013105 Ga0157369_10052618 Ga0157369_100526183 147
764 3300013105 Ga0157369_10065221 Ga0157369_100652214 147
765 3300013105 Ga0157369_10144184 Ga0157369_101441842 147
766 3300013105 Ga0157369_10336609 Ga0157369_103366093 147
767 3300013105 Ga0157369_10422859 Ga0157369_104228592 147
768 3300013296 Ga0157374_10000354 Ga0157374_1000035435 147
769 3300013296 Ga0157374_10000422 Ga0157374_100004226 147
770 3300013296 Ga0157374_10009945 Ga0157374_100099458 147
771 3300013296 Ga0157374_10019238 Ga0157374_100192382 147
772 3300013296 Ga0157374_10063273 Ga0157374_100632733 147
773 3300013296 Ga0157374_10065197 Ga0157374_100651972 147
774 3300013296 Ga0157374_11218271 Ga0157374_112182711 147
775 3300013297 Ga0157378_10000328 Ga0157378_100003286 147
776 3300013297 Ga0157378_10000383 Ga0157378_1000038337 147
777 3300013297 Ga0157378_10000545 Ga0157378_1000054511 147
778 3300013297 Ga0157378_10000678 Ga0157378_1000067814 147
779 3300013297 Ga0157378_10001262 Ga0157378_1000126212 147
780 3300013297 Ga0157378_10065860 Ga0157378_100658602 147
781 3300013297 Ga0157378_10943603 Ga0157378_109436032 147
782 3300013297 Ga0157378_11461715 Ga0157378_114617152 147
783 3300013306 Ga0163162_10028742 Ga0163162_100287424 147
784 3300013306 Ga0163162_10107826 Ga0163162_101078264 147
785 3300013307 Ga0157372_10000068 Ga0157372_1000006874 147
786 3300013307 Ga0157372_10000321 Ga0157372_1000032113 147
787 3300013307 Ga0157372_10000536 Ga0157372_100005368 147
788 3300013307 Ga0157372_10014991 Ga0157372_100149913 147
789 3300013307 Ga0157372_10016084 Ga0157372_100160846 147
790 3300013307 Ga0157372_10025353 Ga0157372_100253532 147
791 3300013307 Ga0157372_10105486 Ga0157372_101054862 147
792 3300013307 Ga0157372_10268494 Ga0157372_102684943 147
793 3300013307 Ga0157372_10860540 Ga0157372_108605402 147
794 3300013307 Ga0157372_11633122 Ga0157372_116331221 147
795 3300013307 Ga0157372_11818785 Ga0157372_118187852 147
796 3300013307 Ga0157372_11902674 Ga0157372_119026742 147
797 3300013308 Ga0157375_10000010 Ga0157375_1000001074 147
798 3300013308 Ga0157375_10000604 Ga0157375_1000060426 147
799 3300013308 Ga0157375_10108529 Ga0157375_101085292 147
800 3300013308 Ga0157375_10411848 Ga0157375_104118482 147
801 3300013308 Ga0157375_10953423 Ga0157375_109534232 147
802 3300013308 Ga0157375_11389103 Ga0157375_113891032 147
803 3300014325 Ga0163163_10198346 Ga0163163_101983462 147
804 3300014325 Ga0163163_12041774 Ga0163163_120417741 147
805 3300014745 Ga0157377_10000004 Ga0157377_10000004251 147
806 3300014745 Ga0157377_10325296 Ga0157377_103252962 147
807 3300014968 Ga0157379_10067740 Ga0157379_100677402 147
808 3300014968 Ga0157379_10586753 Ga0157379_105867532 147
809 3300014968 Ga0157379_11115941 Ga0157379_111159412 147
810 3300014969 Ga0157376_10000003 Ga0157376_1000000329 147
811 3300014969 Ga0157376_10008017 Ga0157376_100080177 147
812 3300014969 Ga0157376_10081920 Ga0157376_100819203 147
813 3300014969 Ga0157376_10953333 Ga0157376_109533332 147
814 3300017792 Ga0163161_10024299 Ga0163161_100242992 147
815 3300019161 Ga0184602_129751 Ga0184602_1297511 147
816 3300019176 Ga0184596_108408 Ga0184596_1084081 147
817 3300019183 Ga0184601_108260 Ga0184601_1082602 147
818 3300019188 Ga0184599_128580 Ga0184599_1285802 147
819 3300019190 Ga0184600_107366 Ga0184600_1073662 147
820 3300019190 Ga0184600_123562 Ga0184600_1235622 147
821 3300020069 Ga0197907_10539006 Ga0197907_105390061 147
822 3300020069 Ga0197907_10540100 Ga0197907_105401002 147
823 3300020069 Ga0197907_10717659 Ga0197907_107176592 147
824 3300020069 Ga0197907_10796502 Ga0197907_107965022 147
825 3300020069 Ga0197907_10869068 Ga0197907_108690682 147
826 3300020070 Ga0206356_10433137 Ga0206356_104331372 147
827 3300020070 Ga0206356_11397745 Ga0206356_113977452 147
828 3300020075 Ga0206349_1634275 Ga0206349_16342752 147
829 3300020075 Ga0206349_1888706 Ga0206349_18887062 147
830 3300020076 Ga0206355_1435135 Ga0206355_14351353 147
831 3300020077 Ga0206351_10303434 Ga0206351_103034342 147
832 3300020077 Ga0206351_10402462 Ga0206351_104024622 147
833 3300020077 Ga0206351_10782694 Ga0206351_107826942 147
834 3300020077 Ga0206351_10911997 Ga0206351_109119972 147
835 3300020078 Ga0206352_10548939 Ga0206352_105489392 147
836 3300020078 Ga0206352_10742236 Ga0206352_107422361 147
837 3300020078 Ga0206352_10814601 Ga0206352_108146012 147
838 3300020078 Ga0206352_10853031 Ga0206352_108530311 147
839 3300020080 Ga0206350_10417453 Ga0206350_104174531 147
840 3300020080 Ga0206350_10694412 Ga0206350_106944122 147
841 3300020080 Ga0206350_10704807 Ga0206350_107048071 147
842 3300020080 Ga0206350_10783616 Ga0206350_107836161 147
843 3300020080 Ga0206350_11500735 Ga0206350_115007352 147
844 3300020081 Ga0206354_11268864 Ga0206354_112688642 147
845 3300020082 Ga0206353_10839656 Ga0206353_108396562 147
846 3300020082 Ga0206353_11764120 Ga0206353_117641201 147
847 3300020610 Ga0154015_1009766 Ga0154015_10097662 147
848 3300021358 Ga0213873_10000001 Ga0213873_10000001331 147
849 3300021358 Ga0213873_10000358 Ga0213873_100003582 147
850 3300021377 Ga0213874_10197723 Ga0213874_101977231 147
851 3300021384 Ga0213876_10000015 Ga0213876_10000015139 147
852 3300021384 Ga0213876_10000203 Ga0213876_1000020342 147
853 3300021384 Ga0213876_10015149 Ga0213876_100151493 147
854 3300022467 Ga0224712_10025251 Ga0224712_100252512 147
855 3300022467 Ga0224712_10069648 Ga0224712_100696482 147
856 3300022467 Ga0224712_10081856 Ga0224712_100818562 147
857 3300022467 Ga0224712_10166174 Ga0224712_101661741 147
858 3300022467 Ga0224712_10621586 Ga0224712_106215861 147
859 3300023539 Ga0247555_100578 Ga0247555_1005782 147
860 3300023672 Ga0247553_100294 Ga0247553_1002942 147
861 3300024225 Ga0224572_1042095 Ga0224572_10420952 147
862 3300024227 Ga0228598_1001498 Ga0228598_10014982 147
863 3300024227 Ga0228598_1026759 Ga0228598_10267592 147
864 3300025898 Ga0207692_10031523 Ga0207692_100315234 147
865 3300025898 Ga0207692_10143764 Ga0207692_101437642 147
866 3300025898 Ga0207692_10794131 Ga0207692_107941311 147
867 3300025899 Ga0207642_10131415 Ga0207642_101314152 147
868 3300025899 Ga0207642_10500581 Ga0207642_105005812 147
869 3300025901 Ga0207688_10084127 Ga0207688_100841272 147
870 3300025903 Ga0207680_10087293 Ga0207680_100872933 147
871 3300025905 Ga0207685_10028724 Ga0207685_100287243 147
872 3300025905 Ga0207685_10032655 Ga0207685_100326553 147
873 3300025905 Ga0207685_10035964 Ga0207685_100359643 147
874 3300025906 Ga0207699_10009273 Ga0207699_100092732 147
875 3300025906 Ga0207699_10786717 Ga0207699_107867172 147
876 3300025907 Ga0207645_10021974 Ga0207645_100219744 147
877 3300025907 Ga0207645_10157090 Ga0207645_101570902 147
878 3300025907 Ga0207645_10527792 Ga0207645_105277922 147
879 3300025908 Ga0207643_10220968 Ga0207643_102209682 147
880 3300025909 Ga0207705_10013917 Ga0207705_100139174 147
881 3300025909 Ga0207705_10079084 Ga0207705_100790842 147
882 3300025909 Ga0207705_10191530 Ga0207705_101915301 147
883 3300025910 Ga0207684_10002137 Ga0207684_100021379 147
884 3300025910 Ga0207684_10019277 Ga0207684_100192775 147
885 3300025910 Ga0207684_10027313 Ga0207684_100273135 147
886 3300025910 Ga0207684_10039142 Ga0207684_100391425 147
887 3300025910 Ga0207684_10177588 Ga0207684_101775882 147
888 3300025910 Ga0207684_10353952 Ga0207684_103539522 147
889 3300025911 Ga0207654_10384908 Ga0207654_103849082 147
890 3300025912 Ga0207707_10009163 Ga0207707_100091634 147
891 3300025912 Ga0207707_10010547 Ga0207707_100105474 147
892 3300025912 Ga0207707_10222196 Ga0207707_102221961 147
893 3300025912 Ga0207707_10563947 Ga0207707_105639472 147
894 3300025912 Ga0207707_11157218 Ga0207707_111572181 147
895 3300025913 Ga0207695_10001894 Ga0207695_1000189413 147
896 3300025913 Ga0207695_10004033 Ga0207695_100040332 147
897 3300025913 Ga0207695_10054696 Ga0207695_100546963 147
898 3300025913 Ga0207695_10056717 Ga0207695_100567173 147
899 3300025913 Ga0207695_10082572 Ga0207695_100825724 147
900 3300025913 Ga0207695_10202755 Ga0207695_102027551 147
901 3300025913 Ga0207695_10263281 Ga0207695_102632813 147
902 3300025913 Ga0207695_10487441 Ga0207695_104874412 147
903 3300025913 Ga0207695_10513928 Ga0207695_105139282 147
904 3300025914 Ga0207671_10224068 Ga0207671_102240682 147
905 3300025914 Ga0207671_10397732 Ga0207671_103977322 147
906 3300025915 Ga0207693_10011730 Ga0207693_100117302 147
907 3300025915 Ga0207693_10048525 Ga0207693_100485253 147
908 3300025915 Ga0207693_10056621 Ga0207693_100566212 147
909 3300025915 Ga0207693_10241705 Ga0207693_102417053 147
910 3300025915 Ga0207693_10413674 Ga0207693_104136742 147
911 3300025915 Ga0207693_10761552 Ga0207693_107615521 147
912 3300025916 Ga0207663_10028448 Ga0207663_100284483 147
913 3300025916 Ga0207663_10075435 Ga0207663_100754353 147
914 3300025916 Ga0207663_10102907 Ga0207663_101029071 147
915 3300025916 Ga0207663_10127400 Ga0207663_101274002 147
916 3300025916 Ga0207663_10246497 Ga0207663_102464971 147
917 3300025917 Ga0207660_10018783 Ga0207660_100187833 147
918 3300025917 Ga0207660_10164831 Ga0207660_101648312 147
919 3300025917 Ga0207660_10252536 Ga0207660_102525362 147
920 3300025917 Ga0207660_10804381 Ga0207660_108043811 147
921 3300025917 Ga0207660_10995453 Ga0207660_109954532 147
922 3300025918 Ga0207662_10012231 Ga0207662_100122311 147
923 3300025918 Ga0207662_10080969 Ga0207662_100809692 147
924 3300025919 Ga0207657_10004942 Ga0207657_100049422 147
925 3300025919 Ga0207657_10233686 Ga0207657_102336862 147
926 3300025920 Ga0207649_11122139 Ga0207649_111221391 147
927 3300025921 Ga0207652_10007259 Ga0207652_100072592 147
928 3300025921 Ga0207652_10030873 Ga0207652_100308734 147
929 3300025921 Ga0207652_10041598 Ga0207652_100415984 147
930 3300025921 Ga0207652_10520628 Ga0207652_105206282 147
931 3300025921 Ga0207652_11043225 Ga0207652_110432252 147
932 3300025922 Ga0207646_10004008 Ga0207646_1000400810 147
933 3300025922 Ga0207646_10004874 Ga0207646_100048745 147
934 3300025922 Ga0207646_10102318 Ga0207646_101023182 147
935 3300025922 Ga0207646_10156938 Ga0207646_101569385 147
936 3300025922 Ga0207646_10235893 Ga0207646_102358932 147
937 3300025922 Ga0207646_10276655 Ga0207646_102766552 147
938 3300025922 Ga0207646_10289890 Ga0207646_102898902 147
939 3300025922 Ga0207646_10302817 Ga0207646_103028172 147
940 3300025922 Ga0207646_10312355 Ga0207646_103123552 147
941 3300025922 Ga0207646_10324743 Ga0207646_103247432 147
942 3300025922 Ga0207646_11336553 Ga0207646_113365531 147
943 3300025924 Ga0207694_10000001 Ga0207694_10000001173 147
944 3300025924 Ga0207694_10010846 Ga0207694_100108463 147
945 3300025924 Ga0207694_10025697 Ga0207694_100256973 147
946 3300025924 Ga0207694_10042291 Ga0207694_100422912 147
947 3300025924 Ga0207694_10218421 Ga0207694_102184212 147
948 3300025924 Ga0207694_10506208 Ga0207694_105062082 147
949 3300025924 Ga0207694_10527582 Ga0207694_105275821 147
950 3300025925 Ga0207650_10000453 Ga0207650_100004538 147
951 3300025925 Ga0207650_10001518 Ga0207650_1000151810 147
952 3300025925 Ga0207650_10038864 Ga0207650_100388644 147
953 3300025925 Ga0207650_10052864 Ga0207650_100528642 147
954 3300025926 Ga0207659_10000006 Ga0207659_10000006260 147
955 3300025927 Ga0207687_10000005 Ga0207687_10000005554 147
956 3300025927 Ga0207687_10000266 Ga0207687_100002666 147
957 3300025927 Ga0207687_10050541 Ga0207687_100505412 147
958 3300025927 Ga0207687_10232101 Ga0207687_102321011 147
959 3300025928 Ga0207700_10021316 Ga0207700_100213166 147
960 3300025928 Ga0207700_10027264 Ga0207700_100272644 147
961 3300025928 Ga0207700_10027562 Ga0207700_100275622 147
962 3300025928 Ga0207700_10079893 Ga0207700_100798932 147
963 3300025928 Ga0207700_10377751 Ga0207700_103777511 147
964 3300025928 Ga0207700_10718342 Ga0207700_107183422 147
965 3300025928 Ga0207700_10881985 Ga0207700_108819852 147
966 3300025929 Ga0207664_10023253 Ga0207664_100232535 147
967 3300025929 Ga0207664_10164663 Ga0207664_101646632 147
968 3300025929 Ga0207664_10180610 Ga0207664_101806102 147
969 3300025929 Ga0207664_10229970 Ga0207664_102299702 147
970 3300025929 Ga0207664_10233341 Ga0207664_102333412 147
971 3300025929 Ga0207664_10334653 Ga0207664_103346532 147
972 3300025931 Ga0207644_10285796 Ga0207644_102857963 147
973 3300025931 Ga0207644_10896507 Ga0207644_108965071 147
974 3300025933 Ga0207706_10352804 Ga0207706_103528042 147
975 3300025934 Ga0207686_10003600 Ga0207686_100036008 147
976 3300025934 Ga0207686_10070463 Ga0207686_100704632 147
977 3300025934 Ga0207686_10093474 Ga0207686_100934742 147
978 3300025935 Ga0207709_10101715 Ga0207709_101017152 147
979 3300025936 Ga0207670_10066653 Ga0207670_100666533 147
980 3300025936 Ga0207670_10235209 Ga0207670_102352092 147
981 3300025936 Ga0207670_10364784 Ga0207670_103647842 147
982 3300025936 Ga0207670_10386608 Ga0207670_103866082 147
983 3300025938 Ga0207704_10446628 Ga0207704_104466282 147
984 3300025938 Ga0207704_10460936 Ga0207704_104609362 147
985 3300025939 Ga0207665_10002075 Ga0207665_100020756 147
986 3300025939 Ga0207665_10073967 Ga0207665_100739673 147
987 3300025939 Ga0207665_10081528 Ga0207665_100815281 147
988 3300025939 Ga0207665_10105979 Ga0207665_101059792 147
989 3300025939 Ga0207665_10132174 Ga0207665_101321742 147
990 3300025939 Ga0207665_10140563 Ga0207665_101405632 147
991 3300025939 Ga0207665_10150408 Ga0207665_101504081 147
992 3300025939 Ga0207665_10225328 Ga0207665_102253282 147
993 3300025939 Ga0207665_10849123 Ga0207665_108491232 147
994 3300025939 Ga0207665_10949755 Ga0207665_109497551 147
995 3300025940 Ga0207691_10982452 Ga0207691_109824522 147
996 3300025941 Ga0207711_10119056 Ga0207711_101190563 147
997 3300025941 Ga0207711_10132375 Ga0207711_101323753 147
998 3300025941 Ga0207711_10237181 Ga0207711_102371812 147
999 3300025941 Ga0207711_10602066 Ga0207711_106020662 147
1000 3300025942 Ga0207689_10006874 Ga0207689_100068747 147
1001 3300025942 Ga0207689_10018488 Ga0207689_100184885 147
1002 3300025942 Ga0207689_10330797 Ga0207689_103307972 147
1003 3300025942 Ga0207689_10574034 Ga0207689_105740342 147
1004 3300025944 Ga0207661_10000015 Ga0207661_1000001551 147
1005 3300025944 Ga0207661_10021016 Ga0207661_100210164 147
1006 3300025944 Ga0207661_10043662 Ga0207661_100436624 147
1007 3300025944 Ga0207661_10077751 Ga0207661_100777512 147
1008 3300025944 Ga0207661_10779229 Ga0207661_107792291 147
1009 3300025944 Ga0207661_10957476 Ga0207661_109574762 147
1010 3300025944 Ga0207661_12019695 Ga0207661_120196951 147
1011 3300025945 Ga0207679_10029894 Ga0207679_100298943 147
1012 3300025945 Ga0207679_10067574 Ga0207679_100675742 147
1013 3300025945 Ga0207679_10226355 Ga0207679_102263552 147
1014 3300025945 Ga0207679_10918620 Ga0207679_109186201 147
1015 3300025949 Ga0207667_10000544 Ga0207667_1000054419 147
1016 3300025949 Ga0207667_10004693 Ga0207667_1000469311 147
1017 3300025949 Ga0207667_10004714 Ga0207667_1000471411 147
1018 3300025949 Ga0207667_10023906 Ga0207667_100239063 147
1019 3300025949 Ga0207667_10134958 Ga0207667_101349583 147
1020 3300025949 Ga0207667_10990293 Ga0207667_109902931 147
1021 3300025960 Ga0207651_11156184 Ga0207651_111561842 147
1022 3300025981 Ga0207640_10067872 Ga0207640_100678724 147
1023 3300025981 Ga0207640_10083398 Ga0207640_100833983 147
1024 3300025981 Ga0207640_10116473 Ga0207640_101164732 147
1025 3300026023 Ga0207677_10000003 Ga0207677_10000003281 147
1026 3300026023 Ga0207677_10000048 Ga0207677_100000487 147
1027 3300026023 Ga0207677_10022339 Ga0207677_100223392 147
1028 3300026023 Ga0207677_10096482 Ga0207677_100964822 147
1029 3300026023 Ga0207677_10362870 Ga0207677_103628702 147
1030 3300026035 Ga0207703_10079566 Ga0207703_100795663 147
1031 3300026035 Ga0207703_10704102 Ga0207703_107041022 147
1032 3300026035 Ga0207703_10872020 Ga0207703_108720202 147
1033 3300026041 Ga0207639_10000048 Ga0207639_1000004891 147
1034 3300026041 Ga0207639_10034616 Ga0207639_100346163 147
1035 3300026041 Ga0207639_10653303 Ga0207639_106533032 147
1036 3300026075 Ga0207708_10000003 Ga0207708_1000000374 147
1037 3300026078 Ga0207702_10009517 Ga0207702_100095176 147
1038 3300026078 Ga0207702_10020916 Ga0207702_100209162 147
1039 3300026078 Ga0207702_10037516 Ga0207702_100375163 147
1040 3300026078 Ga0207702_10050507 Ga0207702_100505074 147
1041 3300026078 Ga0207702_10154004 Ga0207702_101540043 147
1042 3300026078 Ga0207702_10359150 Ga0207702_103591501 147
1043 3300026078 Ga0207702_10361563 Ga0207702_103615631 147
1044 3300026078 Ga0207702_11074128 Ga0207702_110741281 147
1045 3300026088 Ga0207641_10250043 Ga0207641_102500432 147
1046 3300026088 Ga0207641_10532967 Ga0207641_105329672 147
1047 3300026088 Ga0207641_11336605 Ga0207641_113366052 147
1048 3300026088 Ga0207641_11429058 Ga0207641_114290581 147
1049 3300026089 Ga0207648_10050715 Ga0207648_100507152 147
1050 3300026089 Ga0207648_10143437 Ga0207648_101434372 147
1051 3300026089 Ga0207648_10624225 Ga0207648_106242252 147
1052 3300026089 Ga0207648_11650553 Ga0207648_116505532 147
1053 3300026089 Ga0207648_11799043 Ga0207648_117990431 147
1054 3300026095 Ga0207676_10029988 Ga0207676_100299882 147
1055 3300026095 Ga0207676_10079087 Ga0207676_100790873 147
1056 3300026095 Ga0207676_10926724 Ga0207676_109267242 147
1057 3300026095 Ga0207676_11076245 Ga0207676_110762452 147
1058 3300026116 Ga0207674_10018430 Ga0207674_1001843010 147
1059 3300026116 Ga0207674_10030121 Ga0207674_100301213 147
1060 3300026116 Ga0207674_10061585 Ga0207674_100615853 147
1061 3300026116 Ga0207674_10792649 Ga0207674_107926492 147
1062 3300026118 Ga0207675_100119172 Ga0207675_1001191723 147
1063 3300026121 Ga0207683_10052189 Ga0207683_100521895 147
1064 3300026121 Ga0207683_10802781 Ga0207683_108027812 147
1065 3300026142 Ga0207698_10012820 Ga0207698_100128203 147
1066 3300026142 Ga0207698_10121277 Ga0207698_101212771 147
1067 3300026142 Ga0207698_10490831 Ga0207698_104908312 147
1068 3300027907 Ga0207428_10000001 Ga0207428_10000001539 147
1069 3300028017 Ga0265356_1000382 Ga0265356_10003826 147
1070 3300028379 Ga0268266_10011258 Ga0268266_100112587 147
1071 3300028381 Ga0268264_10177468 Ga0268264_101774682 147
1072 3300028381 Ga0268264_10270964 Ga0268264_102709642 147
1073 3300028563 Ga0265319_1045307 Ga0265319_10453072 147
1074 3300028654 Ga0265322_10000052 Ga0265322_1000005249 147
1075 3300028800 Ga0265338_10022692 Ga0265338_100226922 147
1076 3300028800 Ga0265338_10070036 Ga0265338_100700363 147
1077 3300028800 Ga0265338_10121979 Ga0265338_101219792 147
1078 3300028800 Ga0265338_10350355 Ga0265338_103503551 147
1079 3300030760 Ga0265762_1009357 Ga0265762_10093572 147
1080 3300030836 Ga0265767_102183 Ga0265767_1021831 147
1081 3300030863 Ga0265766_1000450 Ga0265766_10004502 147
1082 3300030877 Ga0265777_102316 Ga0265777_1023162 147
1083 3300030878 Ga0265770_1041509 Ga0265770_10415092 147
1084 3300030879 Ga0265765_1008197 Ga0265765_10081972 147
1085 3300030879 Ga0265765_1056890 Ga0265765_10568902 147
1086 3300031018 Ga0265773_1003081 Ga0265773_10030812 147
1087 3300031043 Ga0265779_106989 Ga0265779_1069891 147
1088 3300031090 Ga0265760_10053779 Ga0265760_100537792 147
1089 3300031090 Ga0265760_10152571 Ga0265760_101525712 147
1090 3300031090 Ga0265760_10170304 Ga0265760_101703042 147
1091 3300031235 Ga0265330_10000781 Ga0265330_1000078111 147
1092 3300031235 Ga0265330_10433842 Ga0265330_104338421 147
1093 3300031241 Ga0265325_10001352 Ga0265325_100013527 147
1094 3300031241 Ga0265325_10006355 Ga0265325_100063557 147
1095 3300031247 Ga0265340_10053709 Ga0265340_100537092 147
1096 3300031247 Ga0265340_10075885 Ga0265340_100758852 147
1097 3300031247 Ga0265340_10142687 Ga0265340_101426872 147
1098 3300031249 Ga0265339_10000581 Ga0265339_1000058119 147
1099 3300031249 Ga0265339_10046055 Ga0265339_100460552 147
1100 3300031249 Ga0265339_10154003 Ga0265339_101540032 147
1101 3300031249 Ga0265339_10182866 Ga0265339_101828662 147
1102 3300031250 Ga0265331_10022616 Ga0265331_100226162 147
1103 3300031344 Ga0265316_10031546 Ga0265316_100315462 147
1104 3300031344 Ga0265316_10085635 Ga0265316_100856351 147
1105 3300031344 Ga0265316_10166914 Ga0265316_101669142 147
1106 3300031548 Ga0307408_100119927 Ga0307408_1001199272 147
1107 3300031548 Ga0307408_100762074 Ga0307408_1007620742 147
1108 3300031595 Ga0265313_10016516 Ga0265313_100165162 147
1109 3300031595 Ga0265313_10063426 Ga0265313_100634262 147
1110 3300031711 Ga0265314_10230674 Ga0265314_102306742 147
1111 3300031712 Ga0265342_10019690 Ga0265342_100196906 147
1112 3300031712 Ga0265342_10041034 Ga0265342_100410343 147
1113 3300031712 Ga0265342_10203217 Ga0265342_102032172 147
1114 3300031712 Ga0265342_10410353 Ga0265342_104103532 147
1115 3300031728 Ga0316578_10590527 Ga0316578_105905272 147
1116 3300031733 Ga0316577_10743115 Ga0316577_107431151 147
1117 3300031901 Ga0307406_10763701 Ga0307406_107637012 147
1118 3300032002 Ga0307416_100160167 Ga0307416_1001601672 147
1119 3300032002 Ga0307416_100734687 Ga0307416_1007346871 147
1120 3300032002 Ga0307416_100816860 Ga0307416_1008168602 147
1121 3300032120 Ga0316053_100535 Ga0316053_1005352 147
1122 3300032120 Ga0316053_100897 Ga0316053_1008972 147
1123 3300032133 Ga0316583_10126559 Ga0316583_101265592 147
1124 3300033545 Ga0316214_1042550 Ga0316214_10425502 147
1125 3300035083 Ga0373926_0008040 Ga0373926_0008040_2295_2750 147
1126 3300035083 Ga0373926_0038855 Ga0373926_0038855_159_611 147
1127 3300035089 Ga0373944_0078045 Ga0373944_0078045_219_674 147
1128 3300035111 Ga0373923_0106353 Ga0373923_0106353_674_1126 147
1129 3300035112 Ga0373932_0015857 Ga0373932_0015857_342_791 147
1130 3300035113 Ga0373936_0001853 Ga0373936_0001853_1905_2357 147
1131 3300035113 Ga0373936_0045310 Ga0373936_0045310_779_1234 147
1132 3300035113 Ga0373936_0127143 Ga0373936_0127143_98_550 147
1133 3300035115 Ga0373941_0040822 Ga0373941_0040822_923_1372 147
1134 3300035116 Ga0373945_0001941 Ga0373945_0001941_5647_6102 147
1135 3300035118 Ga0373954_0113716 Ga0373954_0113716_548_1000 147
1136 3300035120 Ga0373957_0538051 Ga0373957_0538051_27_479 147
1137 3300035170 Ga0373943_0006453 Ga0373943_0006453_1846_2301 147
1138 3300035170 Ga0373943_0007607 Ga0373943_0007607_3202_3654 147
1139 3300035170 Ga0373943_0023234 Ga0373943_0023234_227_679 147
1140 3300035170 Ga0373943_0034837 Ga0373943_0034837_1108_1557 147
1141 3300035170 Ga0373943_0058763 Ga0373943_0058763_1101_1550 147
1142 3300035171 Ga0373946_0065260 Ga0373946_0065260_14_469 147
1143 3300035171 Ga0373946_0195655 Ga0373946_0195655_117_569 147
1144 3300035171 Ga0373946_0205609 Ga0373946_0205609_246_698 147
1145 3300035172 Ga0373955_0074221 Ga0373955_0074221_146_598 147
1146 3300035172 Ga0373955_0220524 Ga0373955_0220524_68_514 147
1147 3300035172 Ga0373955_0491704 Ga0373955_0491704_268_717 147
1148 3300035410 Ga0373924_0000274 Ga0373924_0000274_4328_4783 147
1149 3300035410 Ga0373924_0207276 Ga0373924_0207276_402_854 147
1150 3300035691 Ga0373931_0278980 Ga0373931_0278980_366_812 147
1151 3300035692 Ga0373935_0010120 Ga0373935_0010120_3010_3462 147
1152 3300035692 Ga0373935_0024337 Ga0373935_0024337_471_920 147
1153 3300035692 Ga0373935_0210668 Ga0373935_0210668_770_1225 147
1154 3300035692 Ga0373935_0554407 Ga0373935_0554407_150_608 147
1155 3300035695 Ga0373927_0006641 Ga0373927_0006641_374_826 147
1156 3300035695 Ga0373927_0274241 Ga0373927_0274241_309_761 147
1157 3300035695 Ga0373927_0839530 Ga0373927_0839530_132_584 147
1158 3300035724 Ga0373933_0114686 Ga0373933_0114686_410_862 147
1159 3300035724 Ga0373933_0457624 Ga0373933_0457624_50_496 147
1160 3300035725 Ga0373947_0009153 Ga0373947_0009153_4117_4569 147
1161 3300035725 Ga0373947_0102011 Ga0373947_0102011_1177_1629 147
1162 3300035725 Ga0373947_0308227 Ga0373947_0308227_84_536 147
1163 3300036401 Ga0373937_0030189 Ga0373937_0030189_3789_4235 147
1164 3300036401 Ga0373937_0092209 Ga0373937_0092209_2293_2745 147
1165 3300036401 Ga0373937_0291908 Ga0373937_0291908_1048_1497 147
1166 3300036401 Ga0373937_0366409 Ga0373937_0366409_205_663 147
1167 3300036401 Ga0373937_0499063 Ga0373937_0499063_600_1049 147
1168 3300036401 Ga0373937_0682105 Ga0373937_0682105_239_685 147
1169 3300036401 Ga0373937_0922960 Ga0373937_0922960_300_749 147
1170 3300037068 Ga0373925_0021012 Ga0373925_0021012_1898_2350 147
1171 3300037068 Ga0373925_0098621 Ga0373925_0098621_1529_1981 147
1172 3300037068 Ga0373925_0216974 Ga0373925_0216974_274_726 147
1173 3300037418 Ga0395900_0205792 Ga0395900_0205792_714_1157 147
1174 3300037466 Ga0395898_0016476 Ga0395898_0016476_4452_4895 147
1175 3300037466 Ga0395898_0662158 Ga0395898_0662158_57_500 147
1176 3300037853 Ga0436364_1340096 Ga0436364_1340096_816_1262 147
1177 3300038443 Ga0395901_0190034 Ga0395901_0190034_556_999 147
1178 3300039437 Ga0436365_0151500 Ga0436365_0151500_3050_3499 147
1179 3300039437 Ga0436365_1407004 Ga0436365_1407004_377_823 147
1180 3300039437 Ga0436365_1524178 Ga0436365_1524178_73734_74183 147
1181 3300039437 Ga0436365_1664004 Ga0436365_1664004_2788_3237 147
1182 3300039450 Ga0436363_0387793 Ga0436363_0387793_69_518 147
1183 3300039453 Ga0436362_0273161 Ga0436362_0273161_463410_463859 147
1184 3300039453 Ga0436362_0948018 Ga0436362_0948018_4138_4587 147
1185 3300042122 Ga0450920_028141 Ga0450920_028141_12_464 147
1186 3300042125 Ga0450923_002993 Ga0450923_002993_1624_2076 147
1187 3300042125 Ga0450923_024509 Ga0450923_024509_171_629 147
1188 3300042131 Ga0450894_000599 Ga0450894_000599_4324_4776 147
1189 3300042133 Ga0450896_003252 Ga0450896_003252_94_546 147
1190 3300042134 Ga0450898_020528 Ga0450898_020528_522_974 147
1191 3300042436 Ga0439435_0088581 Ga0439435_0088581_218_670 147
1192 3300042531 Ga0450918_014259 Ga0450918_014259_325_777 147
1193 3300042876 Ga0451577_0000614 Ga0451577_0000614_41563_42015 147
1194 3300042876 Ga0451577_0079314 Ga0451577_0079314_212_661 147
1195 3300044694 Ga0466963_0073051 Ga0466963_0073051_1771_2220 147
1196 3300044694 Ga0466963_0086757 Ga0466963_0086757_866_1312 147
1197 3300044694 Ga0466963_0095891 Ga0466963_0095891_199_648 147
1198 3300044706 Ga0466964_0275436 Ga0466964_0275436_264_713 147
1199 3300044712 Ga0453684_0001797 Ga0453684_0001797_45375_45827 147
1200 3300044712 Ga0453684_0394087 Ga0453684_0394087_844_1296 147
1201 3300044735 Ga0466968_0212272 Ga0466968_0212272_15_464 147
1202 3300044765 Ga0466970_0466226 Ga0466970_0466226_20_466 147
1203 3300044842 Ga0466957_0000055 Ga0466957_0000055_5466_5912 147
1204 3300044842 Ga0466957_0115774 Ga0466957_0115774_53_499 147
1205 3300045049 Ga0466959_0046896 Ga0466959_0046896_1481_1927 147
1206 3300045049 Ga0466959_0419766 Ga0466959_0419766_374_823 147
1207 3300045051 Ga0451576_0317271 Ga0451576_0317271_769_1215 147
1208 3300045051 Ga0451576_0873320 Ga0451576_0873320_61_516 147
1209 3300045051 Ga0451576_1204279 Ga0451576_1204279_320_766 147
1210 3300045051 Ga0451576_1392512 Ga0451576_1392512_19_474 147
1211 3300045836 Ga0466958_0034374 Ga0466958_0034374_1076_1522 147
1212 3300045836 Ga0466958_0276360 Ga0466958_0276360_426_872 147
1213 3300045976 Ga0466967_0046854 Ga0466967_0046854_1101_1550 147
1214 3300046455 Ga0495603_0130161 Ga0495603_0130161_854_1306 147
1215 3300046459 Ga0495629_1048308 Ga0495629_1048308_25_483 147
1216 3300046462 Ga0495651_0011592 Ga0495651_0011592_3983_4432 147
1217 3300046472 Ga0495580_0000634 Ga0495580_0000634_24622_25074 147
1218 3300046472 Ga0495580_0023089 Ga0495580_0023089_1295_1747 147
1219 3300046472 Ga0495580_0068416 Ga0495580_0068416_1278_1727 147
1220 3300046472 Ga0495580_0071624 Ga0495580_0071624_1663_2112 147
1221 3300046472 Ga0495580_0183504 Ga0495580_0183504_962_1414 147
1222 3300046472 Ga0495580_0466016 Ga0495580_0466016_71_520 147
1223 3300046473 Ga0495582_0012769 Ga0495582_0012769_1802_2254 147
1224 3300046473 Ga0495582_0023662 Ga0495582_0023662_1075_1530 147
1225 3300046473 Ga0495582_0256428 Ga0495582_0256428_179_637 147
1226 3300046475 Ga0495639_0043201 Ga0495639_0043201_1420_1875 147
1227 3300046475 Ga0495639_0053642 Ga0495639_0053642_1056_1508 147
1228 3300046477 Ga0495664_0248387 Ga0495664_0248387_564_1010 147
1229 3300046491 Ga0495584_0225488 Ga0495584_0225488_16_468 147
1230 3300046499 Ga0495594_0406313 Ga0495594_0406313_167_622 147
1231 3300046511 Ga0495608_0197387 Ga0495608_0197387_161_607 147
1232 3300046511 Ga0495608_0281384 Ga0495608_0281384_119_574 147
1233 3300046515 Ga0495620_0006479 Ga0495620_0006479_5273_5722 147
1234 3300046516 Ga0495628_0193333 Ga0495628_0193333_485_937 147
1235 3300046516 Ga0495628_0622625 Ga0495628_0622625_236_682 147
1236 3300046517 Ga0495630_0252278 Ga0495630_0252278_238_690 147
1237 3300046517 Ga0495630_0596485 Ga0495630_0596485_157_603 147
1238 3300046517 Ga0495630_0600783 Ga0495630_0600783_11_466 147
1239 3300046526 Ga0495666_0047763 Ga0495666_0047763_1419_1871 147
1240 3300046531 Ga0495665_0015678 Ga0495665_0015678_2358_2810 147
1241 3300046531 Ga0495665_0449390 Ga0495665_0449390_78_533 147
1242 3300046535 Ga0495586_0083397 Ga0495586_0083397_1125_1580 147
1243 3300046537 Ga0495598_0274727 Ga0495598_0274727_64_531 147
1244 3300046539 Ga0495621_0144405 Ga0495621_0144405_300_767 147
1245 3300046558 Ga0495633_0414888 Ga0495633_0414888_140_592 147
1246 3300046559 Ga0495667_0144941 Ga0495667_0144941_536_991 147
1247 3300046559 Ga0495667_0500433 Ga0495667_0500433_126_584 147
1248 3300046663 Ga0495635_0594547 Ga0495635_0594547_40_498 147
1249 3300046674 Ga0495588_0362818 Ga0495588_0362818_23_475 147
1250 3300046675 Ga0495657_0185235 Ga0495657_0185235_209_655 147
1251 3300046675 Ga0495657_0223452 Ga0495657_0223452_43_498 147
1252 3300046675 Ga0495657_0725626 Ga0495657_0725626_24_473 147
1253 3300046679 Ga0495623_0133257 Ga0495623_0133257_704_1153 147
1254 3300046679 Ga0495623_0325356 Ga0495623_0325356_307_753 147
1255 3300046681 Ga0495647_0130840 Ga0495647_0130840_397_855 147
1256 3300046681 Ga0495647_0197263 Ga0495647_0197263_387_842 147
1257 3300046683 Ga0495658_0113098 Ga0495658_0113098_237_692 147
1258 3300046684 Ga0495669_0121672 Ga0495669_0121672_396_848 147
1259 3300046809 Ga0495600_0261042 Ga0495600_0261042_198_656 147
1260 3300047315 Ga0495581_0039807 Ga0495581_0039807_435_890 147
1261 3300047319 Ga0495674_0164604 Ga0495674_0164604_1297_1749 147
1262 3300047319 Ga0495674_0446866 Ga0495674_0446866_69_527 147
1263 3300047319 Ga0495674_0764077 Ga0495674_0764077_225_671 147
1264 3300047321 Ga0495676_0682745 Ga0495676_0682745_103_558 147
1265 3300047322 Ga0495680_0221712 Ga0495680_0221712_622_1080 147
1266 3300047322 Ga0495680_0318677 Ga0495680_0318677_71_520 147
1267 3300047444 Ga0495675_0037102 Ga0495675_0037102_259_705 147
1268 3300047444 Ga0495675_0056274 Ga0495675_0056274_525_974 147
1269 3300047444 Ga0495675_0262963 Ga0495675_0262963_339_794 147
1270 3300047471 Ga0495684_0549167 Ga0495684_0549167_244_690 147
1271 3300047673 Ga0495593_0038862 Ga0495593_0038862_1255_1710 147
1272 3300048088 Ga0495602_0075891 Ga0495602_0075891_2042_2491 147
1273 3300048088 Ga0495602_0154200 Ga0495602_0154200_1303_1749 147
1274 3300048088 Ga0495602_0308267 Ga0495602_0308267_172_618 147
1275 3300048088 Ga0495602_0509148 Ga0495602_0509148_148_597 147
1276 3300048903 Ga0496100_0057755 Ga0496100_0057755_833_1291 147
1277 3300048903 Ga0496100_0101387 Ga0496100_0101387_821_1273 147
1278 3300048904 Ga0496101_0145139 Ga0496101_0145139_368_826 147
1279 3300048904 Ga0496101_0324190 Ga0496101_0324190_15_470 147
1280 3300048905 Ga0496102_0402142 Ga0496102_0402142_45_500 147
1281 3300048905 Ga0496102_0930936 Ga0496102_0930936_101_556 147
1282 3300048907 Ga0496104_0004317 Ga0496104_0004317_5131_5586 147
1283 3300048907 Ga0496104_0065499 Ga0496104_0065499_2775_3230 147
1284 3300048907 Ga0496104_0074475 Ga0496104_0074475_2333_2779 147
1285 3300048907 Ga0496104_0753595 Ga0496104_0753595_26_478 147
1286 3300048907 Ga0496104_0868662 Ga0496104_0868662_171_629 147
1287 3300048908 Ga0496105_0153234 Ga0496105_0153234_177_623 147
1288 3300048909 Ga0496106_0092821 Ga0496106_0092821_1435_1884 147
1289 3300048909 Ga0496106_0717609 Ga0496106_0717609_304_750 147
1290 3300048910 Ga0496107_0240967 Ga0496107_0240967_266_724 147
1291 3300048910 Ga0496107_0313798 Ga0496107_0313798_375_839 147
1292 3300048911 Ga0496108_0192152 Ga0496108_0192152_842_1300 147
1293 3300048911 Ga0496108_1394384 Ga0496108_1394384_33_485 147
1294 3300048911 Ga0496108_1401939 Ga0496108_1401939_82_528 147
1295 3300048912 Ga0496109_0050587 Ga0496109_0050587_1394_1840 147
1296 3300048913 Ga0496110_0033571 Ga0496110_0033571_3081_3530 147
1297 3300048913 Ga0496110_0106151 Ga0496110_0106151_374_829 147
1298 3300048914 Ga0496111_0001171 Ga0496111_0001171_3080_3529 147
1299 3300048915 Ga0496112_0001167 Ga0496112_0001167_9718_10164 147
1300 3300048915 Ga0496112_0003245 Ga0496112_0003245_4442_4897 147
1301 3300048915 Ga0496112_0015233 Ga0496112_0015233_2290_2736 147
1302 3300048915 Ga0496112_0054419 Ga0496112_0054419_587_1033 147
1303 3300048915 Ga0496112_0279704 Ga0496112_0279704_483_929 147
1304 3300048915 Ga0496112_0596943 Ga0496112_0596943_280_735 147
1305 3300048915 Ga0496112_1936527 Ga0496112_1936527_25_480 147
1306 3300048916 Ga0496113_0000290 Ga0496113_0000290_12769_13224 147
1307 3300048916 Ga0496113_0267572 Ga0496113_0267572_759_1205 147
1308 3300048916 Ga0496113_0576116 Ga0496113_0576116_403_852 147
1309 3300048917 Ga0496114_0001818 Ga0496114_0001818_5695_6153 147
1310 3300048917 Ga0496114_0112225 Ga0496114_0112225_852_1310 147
1311 3300048917 Ga0496114_0814271 Ga0496114_0814271_54_500 147
1312 3300048918 Ga0496115_0521612 Ga0496115_0521612_130_576 147
1313 3300049522 Ga0501299_144080 Ga0501299_144080_38_487 147
1314 3300049568 Ga0501031_0293436 Ga0501031_0293436_57_509 147
1315 3300049569 Ga0501032_0207149 Ga0501032_0207149_555_1007 147
1316 3300049570 Ga0501033_0384565 Ga0501033_0384565_176_628 147
1317 3300049572 Ga0501036_0037085 Ga0501036_0037085_924_1376 147
1318 3300049572 Ga0501036_0110920 Ga0501036_0110920_867_1319 147
1319 3300049572 Ga0501036_1312625 Ga0501036_1312625_53_505 147
1320 3300049574 Ga0501038_0193406 Ga0501038_0193406_1052_1504 147
1321 3300049575 Ga0501039_0027910 Ga0501039_0027910_2208_2660 147
1322 3300049575 Ga0501039_0456679 Ga0501039_0456679_66_518 147
1323 3300049576 Ga0501040_0014732 Ga0501040_0014732_896_1348 147
1324 3300049576 Ga0501040_0223517 Ga0501040_0223517_212_664 147
1325 3300049577 Ga0501041_0000881 Ga0501041_0000881_4740_5192 147
1326 3300049577 Ga0501041_0124950 Ga0501041_0124950_380_832 147
1327 3300049578 Ga0501042_0002368 Ga0501042_0002368_4858_5310 147
1328 3300049578 Ga0501042_0047477 Ga0501042_0047477_2433_2885 147
1329 3300049580 Ga0501046_0219952 Ga0501046_0219952_176_628 147
1330 3300049582 Ga0501048_0047770 Ga0501048_0047770_546_998 147
1331 3300049582 Ga0501048_0146512 Ga0501048_0146512_705_1157 147
1332 3300049584 Ga0501068_0017200 Ga0501068_0017200_2328_2780 147
1333 3300049586 Ga0501070_0327788 Ga0501070_0327788_660_1103 147
1334 3300049587 Ga0501071_0004621 Ga0501071_0004621_7176_7628 147
1335 3300049587 Ga0501071_0011873 Ga0501071_0011873_4144_4596 147
1336 3300049587 Ga0501071_1105275 Ga0501071_1105275_23_475 147
1337 3300049587 Ga0501071_1594294 Ga0501071_1594294_13_465 147
1338 3300049588 Ga0501072_0002447 Ga0501072_0002447_9992_10444 147
1339 3300049588 Ga0501072_0429990 Ga0501072_0429990_141_593 147
1340 3300049589 Ga0501073_0009228 Ga0501073_0009228_2423_2872 147
1341 3300049589 Ga0501073_0159639 Ga0501073_0159639_205_657 147
1342 3300049590 Ga0501074_0044233 Ga0501074_0044233_2211_2663 147
1343 3300049590 Ga0501074_0424060 Ga0501074_0424060_214_663 147
1344 3300049591 Ga0501075_0001143 Ga0501075_0001143_4969_5421 147
1345 3300049591 Ga0501075_0565336 Ga0501075_0565336_70_522 147
1346 3300049591 Ga0501075_1348289 Ga0501075_1348289_22_471 147
1347 3300049592 Ga0501076_0007665 Ga0501076_0007665_4822_5274 147
1348 3300049592 Ga0501076_0056818 Ga0501076_0056818_1763_2215 147
1349 3300049592 Ga0501076_0397190 Ga0501076_0397190_627_1079 147
1350 3300049593 Ga0501077_0035059 Ga0501077_0035059_266_718 147
1351 3300049741 Ga0501079_0007802 Ga0501079_0007802_4917_5369 147
1352 3300049742 Ga0501080_0069849 Ga0501080_0069849_143_595 147
1353 3300049742 Ga0501080_0079413 Ga0501080_0079413_2289_2741 147
1354 3300049743 Ga0501081_0004261 Ga0501081_0004261_6241_6693 147
1355 3300049744 Ga0501083_0065970 Ga0501083_0065970_355_807 147
1356 3300049822 Ga0501035_0157846 Ga0501035_0157846_402_854 147
1357 3300049824 Ga0501045_0097965 Ga0501045_0097965_894_1346 147
1358 3300049824 Ga0501045_0113152 Ga0501045_0113152_1155_1607 147
1359 3300050507 nmdc:mga05p37_189585_c1 nmdc:mga05p37_189585_c1_517_972 147
1360 3300050507 nmdc:mga05p37_603568_c1 nmdc:mga05p37_603568_c1_20_469 147
1361 3300050507 nmdc:mga05p37_8536_c1 nmdc:mga05p37_8536_c1_694_1161 147
1362 3300050508 nmdc:mga09592_343599_c1 nmdc:mga09592_343599_c1_470_937 147
1363 3300050508 nmdc:mga09592_705629_c1 nmdc:mga09592_705629_c1_180_629 147
1364 3300050510 nmdc:mga06r32_2354_c1 nmdc:mga06r32_2354_c1_11052_11501 147
1365 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_442015_442464 147
1366 3300050511 nmdc:mga08y16_284736_c1 nmdc:mga08y16_284736_c1_930_1397 147
1367 3300050512 nmdc:mga0n895_1043056_c1 nmdc:mga0n895_1043056_c1_162_611 147
1368 3300050512 nmdc:mga0n895_1313065_c1 nmdc:mga0n895_1313065_c1_42_491 147
1369 3300050512 nmdc:mga0n895_16332_c1 nmdc:mga0n895_16332_c1_5153_5605 147
1370 3300050512 nmdc:mga0n895_170166_c1 nmdc:mga0n895_170166_c1_589_1038 147
1371 3300050512 nmdc:mga0n895_19859_c1 nmdc:mga0n895_19859_c1_385_834 147
1372 3300050512 nmdc:mga0n895_360054_c1 nmdc:mga0n895_360054_c1_706_1218 147
1373 3300050512 nmdc:mga0n895_866273_c1 nmdc:mga0n895_866273_c1_28_477 147
1374 3300050513 nmdc:mga0rr50_156066_c1 nmdc:mga0rr50_156066_c1_1354_1803 147
1375 3300050513 nmdc:mga0rr50_1807_c1 nmdc:mga0rr50_1807_c1_7675_8130 147
1376 3300050513 nmdc:mga0rr50_41509_c1 nmdc:mga0rr50_41509_c1_2369_2821 147
1377 3300050513 nmdc:mga0rr50_7195_c1 nmdc:mga0rr50_7195_c1_4776_5228 147
1378 3300050514 nmdc:mga08x19_1679_c1 nmdc:mga08x19_1679_c1_1605_2060 147
1379 3300050514 nmdc:mga08x19_27429_c1 nmdc:mga08x19_27429_c1_2252_2704 147
1380 3300050515 nmdc:mga0a205_11707_c1 nmdc:mga0a205_11707_c1_7593_8045 147
1381 3300050515 nmdc:mga0a205_901298_c1 nmdc:mga0a205_901298_c1_222_671 147
1382 3300053077 Ga0495601_0001368 Ga0495601_0001368_11418_11867 147
1383 3300053077 Ga0495601_0029406 Ga0495601_0029406_2338_2796 147
1384 3300053077 Ga0495601_0283714 Ga0495601_0283714_586_1044 147
1385 3300053078 Ga0495612_0286979 Ga0495612_0286979_273_725 147
1386 3300053078 Ga0495612_0617504 Ga0495612_0617504_32_478 147
1387 3300053083 Ga0495655_0000287 Ga0495655_0000287_1323_1778 147
1388 3300053084 Ga0495595_0096456 Ga0495595_0096456_556_1014 147
1389 3300053085 Ga0495619_0024573 Ga0495619_0024573_2317_2775 147
1390 3300053085 Ga0495619_0524999 Ga0495619_0524999_278_727 147
1391 3300053148 Ga0500590_122855 Ga0500590_122855_72_524 147
1392 3300054114 Ga0501084_0013954 Ga0501084_0013954_2803_3255 147
1393 3300059477 Ga0587084_015300 Ga0587084_015300_417_872 147
1394 3300059478 Ga0587093_000692 Ga0587093_000692_1317_1772 147
1395 3300059490 Ga0587066_014595 Ga0587066_014595_625_1071 147
1396 3300059491 Ga0587070_001449 Ga0587070_001449_132_578 147
1397 3300059491 Ga0587070_015526 Ga0587070_015526_247_702 147
1398 3300059493 Ga0587077_001212 Ga0587077_001212_2018_2473 147
1399 3300059506 Ga0587085_014007 Ga0587085_014007_103_558 147
1400 3300059506 Ga0587085_017002 Ga0587085_017002_383_838 147
1401 3300059507 Ga0587086_008478 Ga0587086_008478_665_1120 147
1402 3300059507 Ga0587086_028327 Ga0587086_028327_150_605 147
1403 3300059511 Ga0587091_003320 Ga0587091_003320_1286_1741 147
1404 3300059511 Ga0587091_012597 Ga0587091_012597_164_619 147
1405 3300059512 Ga0587092_025904 Ga0587092_025904_274_729 147
1406 3300059513 Ga0587094_008397 Ga0587094_008397_696_1151 147
1407 3300059622 Ga0587099_004327 Ga0587099_004327_544_999 147
1408 3300059623 Ga0587101_009866 Ga0587101_009866_328_783 147
1409 3300059625 Ga0587113_005354 Ga0587113_005354_523_978 147
1410 3300059630 Ga0587128_033757 Ga0587128_033757_256_711 147
1411 3300059640 Ga0587067_036706 Ga0587067_036706_239_694 147
1412 3300059642 Ga0587069_007244 Ga0587069_007244_126_581 147
1413 3300059644 Ga0587075_001635 Ga0587075_001635_1140_1595 147
1414 3300059645 Ga0587076_046883 Ga0587076_046883_226_672 147
1415 3300059646 Ga0587078_000650 Ga0587078_000650_804_1259 147
1416 3300059652 Ga0587107_005299 Ga0587107_005299_630_1085 147
1417 3300059655 Ga0587114_001009 Ga0587114_001009_1082_1537 147
1418 3300059655 Ga0587114_065311 Ga0587114_065311_64_510 147
1419 3300060344 Ga0587071_003502 Ga0587071_003502_1784_2230 147
1420 3300060353 Ga0501082_0001055 Ga0501082_0001055_11899_12351 147
1421 3300060353 Ga0501082_0166228 Ga0501082_0166228_700_1152 147
1422 3300060353 Ga0501082_1318309 Ga0501082_1318309_70_522 147
1423 3300061734 Ga0530510_0089182 Ga0530510_0089182_944_1396 147
1424 3300049575 Ga0501039_0615539 Ga0501039_0615539_64_522 148
1425 3300049579 Ga0501043_0764846 Ga0501043_0764846_158_616 148
1426 3300049741 Ga0501079_0098301 Ga0501079_0098301_1090_1548 148
1427 3300060353 Ga0501082_0180877 Ga0501082_0180877_255_713 148
1428 3300061734 Ga0530510_0747336 Ga0530510_0747336_86_544 148
1429 3300001904 JGI24736J21556_1074781 JGI24736J21556_10747811 151
1430 3300001915 JGI24741J21665_1054123 JGI24741J21665_10541231 151
1431 3300005327 Ga0070658_11469121 Ga0070658_114691211 151
1432 3300005329 Ga0070683_100109102 Ga0070683_1001091022 151
1433 3300005336 Ga0070680_100030425 Ga0070680_1000304254 151
1434 3300005339 Ga0070660_100014351 Ga0070660_1000143513 151
1435 3300005344 Ga0070661_100330247 Ga0070661_1003302472 151
1436 3300005366 Ga0070659_100070558 Ga0070659_1000705584 151
1437 3300005366 Ga0070659_101741935 Ga0070659_1017419351 151
1438 3300005455 Ga0070663_100273623 Ga0070663_1002736232 151
1439 3300005458 Ga0070681_10048821 Ga0070681_100488214 151
1440 3300005530 Ga0070679_100021300 Ga0070679_1000213003 151
1441 3300005535 Ga0070684_100225088 Ga0070684_1002250882 151
1442 3300005539 Ga0068853_100030002 Ga0068853_1000300024 151
1443 3300005563 Ga0068855_100243731 Ga0068855_1002437313 151
1444 3300005563 Ga0068855_101000377 Ga0068855_1010003772 151
1445 3300005577 Ga0068857_100042347 Ga0068857_1000423472 151
1446 3300005578 Ga0068854_100023618 Ga0068854_1000236184 151
1447 3300005616 Ga0068852_101237040 Ga0068852_1012370402 151
1448 3300009093 Ga0105240_10053697 Ga0105240_100536974 151
1449 3300009545 Ga0105237_10054701 Ga0105237_100547012 151
1450 3300009551 Ga0105238_10936092 Ga0105238_109360922 151
1451 3300013104 Ga0157370_10743664 Ga0157370_107436641 151
1452 3300013105 Ga0157369_10262051 Ga0157369_102620512 151
1453 3300013307 Ga0157372_10022300 Ga0157372_100223003 151
1454 3300013307 Ga0157372_10151250 Ga0157372_101512502 151
1455 3300020077 Ga0206351_10169684 Ga0206351_101696842 151
1456 3300025904 Ga0207647_10002357 Ga0207647_100023575 151
1457 3300025909 Ga0207705_10000465 Ga0207705_1000046514 151
1458 3300025912 Ga0207707_10040973 Ga0207707_100409734 151
1459 3300025913 Ga0207695_10528046 Ga0207695_105280462 151
1460 3300025914 Ga0207671_10128012 Ga0207671_101280122 151
1461 3300025917 Ga0207660_10016552 Ga0207660_100165525 151
1462 3300025919 Ga0207657_10002434 Ga0207657_100024345 151
1463 3300025921 Ga0207652_10241217 Ga0207652_102412172 151
1464 3300025929 Ga0207664_10419261 Ga0207664_104192612 151
1465 3300025932 Ga0207690_10305492 Ga0207690_103054922 151
1466 3300025944 Ga0207661_10050671 Ga0207661_100506714 151
1467 3300025949 Ga0207667_10035982 Ga0207667_100359824 151
1468 3300025949 Ga0207667_10411266 Ga0207667_104112662 151
1469 3300025981 Ga0207640_10166203 Ga0207640_101662032 151
1470 3300026041 Ga0207639_10066138 Ga0207639_100661383 151
1471 3300026067 Ga0207678_10017836 Ga0207678_100178364 151
1472 3300026116 Ga0207674_10002393 Ga0207674_1000239311 151
1473 3300045049 Ga0466959_0112706 Ga0466959_0112706_696_1154 151
1474 3300049569 Ga0501032_0674262 Ga0501032_0674262_78_533 151
1475 3300049574 Ga0501038_0100946 Ga0501038_0100946_1611_2066 151
1476 3300049581 Ga0501047_0148420 Ga0501047_0148420_585_1040 151
1477 3300049586 Ga0501070_0083015 Ga0501070_0083015_1433_1888 151
1478 3300049589 Ga0501073_0025682 Ga0501073_0025682_813_1268 151
1479 3300049742 Ga0501080_0388636 Ga0501080_0388636_510_965 151
1480 3300061719 Ga0466962_0447746 Ga0466962_0447746_19_477 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

7

129

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9592 1 142
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9451 1 142
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9421 2 143
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9236 2 142
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9226 1 142
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9461 2 142 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9327 2 142 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8982 1 146 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8965 3 141 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8837 3 141 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A7W1K4Z9-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9906 4 89 GO:0005506
GO:0016226
GO:0051536
AF-A0A3D3D5D7-F1-model_v4 deleted 0.9883 1 93
AF-A0A349K914-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9718 1 89 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C5ZN38-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9672 23 144 GO:0005506
GO:0016226
GO:0051536
AF-A0A1F4HKU6-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9664 1 143 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
87.36 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map