F494200

General Info

Members Datasets Scaffolds Average Seq Length
1470 449 1434 193

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10122506|Ga0268265_101225062
Length 217
Sequence MSPDLVALFLSALVTFVVVIDPPGCAPIFASLTAGTTPAHRRAMAVRSVAVASVVLILFSLFGEAFLDMLGISLAAFRIAGGIMLFLIAIDMVFEKRTQRREERAEEISKRAADEHRPLEAEDISVFPMGIPMIAGPGSIATAMLLTSRANGWMEGGIVLGALAATLLLTLLALLAAGPLMNALGHKVEAMITRVLGVILAALAVQFVIDGLKASFG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
12 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
13 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
14 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
15 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
16 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
17 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
18 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
19 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
20 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
21 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
22 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
23 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
24 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
25 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
26 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
27 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
28 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
29 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
30 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
31 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
32 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
33 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
34 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
35 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
36 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
37 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
38 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
39 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
46 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
47 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
48 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
56 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
130 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
131 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
153 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
247 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
285 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
288 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
293 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
294 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
295 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
296 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
297 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
298 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
304 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
327 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
328 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
399 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
400 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
401 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
402 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
403 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
404 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
405 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
406 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
419 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
420 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
421 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
425 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
426 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
429 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
430 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
434 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
438 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
439 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
440 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
443 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
444 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
445 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
446 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
447 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
448 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
449 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.07
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 6.87
Nodule 0.14
Rhizoplane 2.79
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1673102 2162886007 Bacteria 13823
2 SwRhRL2b_contig_1893398 2162886007 Bacteria 12143
3 SwRhRL2b_contig_67628 2162886007 Bacteria 1414
4 JGI24736J21556_1001983 3300001904 Bacteria 3633
5 JGI24736J21556_1005378 3300001904 Bacteria 2163
6 JGI24741J21665_1000122 3300001915 Bacteria 20977
7 JGI24741J21665_1039325 3300001915 Bacteria 699
8 JGI24752J21851_1001492 3300001976 Bacteria 3157
9 JGI24747J21853_1004386 3300001978 Bacteria 1263
10 JGI24740J21852_10010138 3300001979 Bacteria 3644
11 JGI24740J21852_10025066 3300001979 Bacteria 2015
12 JGI24740J21852_10046169 3300001979 Bacteria 1280
13 JGI24740J21852_10074931 3300001979 Bacteria 897
14 JGI24740J21852_10082943 3300001979 Bacteria 837
15 JGI24739J22299_10000391 3300001989 Bacteria 15156
16 JGI24739J22299_10002839 3300001989 Bacteria 6655
17 JGI24739J22299_10003277 3300001989 Bacteria 6175
18 JGI24739J22299_10008673 3300001989 Bacteria 3792
19 JGI24739J22299_10010024 3300001989 Bacteria 3522
20 JGI24739J22299_10020971 3300001989 Bacteria 2331
21 JGI24737J22298_10001243 3300001990 Bacteria 9004
22 JGI24737J22298_10004308 3300001990 Bacteria 4970
23 JGI24737J22298_10042356 3300001990 Bacteria 1395
24 JGI24737J22298_10050139 3300001990 Bacteria 1269
25 JGI24743J22301_10019238 3300001991 Bacteria 1296
26 JGI24735J21928_10002241 3300002067 Bacteria 6764
27 JGI24735J21928_10004078 3300002067 Bacteria 4929
28 JGI24735J21928_10007186 3300002067 Bacteria 3634
29 JGI24735J21928_10026692 3300002067 Bacteria 1734
30 JGI24735J21928_10043417 3300002067 Bacteria 1307
31 JGI24735J21928_10192644 3300002067 Bacteria 591
32 JGI24738J21930_10000436 3300002075 Bacteria 11806
33 JGI24738J21930_10011972 3300002075 Bacteria 1899
34 JGI24738J21930_10022102 3300002075 Bacteria 1317
35 JGI24738J21930_10052632 3300002075 Bacteria 831
36 JGI24749J21850_1000069 3300002076 Bacteria 18624
37 JGI24744J21845_10007524 3300002077 Bacteria 2250
38 JGI24744J21845_10038565 3300002077 Bacteria 898
39 JGI24742J22300_10039055 3300002244 Bacteria 843
40 JGI24751J29686_10000391 3300002459 Bacteria 14670
41 JGI24751J29686_10037791 3300002459 Bacteria 999
42 JGI25165J46597_1000071 3300003214 Bacteria 193222
43 JGI25153J46596_10000007 3300003215 Bacteria 377573
44 rootH2_10174559 3300003320 Bacteria 1998
45 rootH1_10040862 3300003323 Bacteria 5300
46 rootH1_10162866 3300003323 Bacteria 1025
47 Ga0055525_1000127 3300003759 Bacteria 113683
48 Ga0055542_1000038 3300003762 Bacteria 224625
49 Ga0055542_1001654 3300003762 Bacteria 9990
50 Ga0055529_1000002 3300003763 Bacteria 537914
51 Ga0055529_1000021 3300003763 Bacteria 321484
52 Ga0055536_1003088 3300003781 Bacteria 9071
53 Ga0055536_1006967 3300003781 Bacteria 5147
54 Ga0055534_1008222 3300003784 Bacteria 2385
55 Ga0055530_10000048 3300003791 Bacteria 107993
56 Ga0055530_10011789 3300003791 Bacteria 3107
57 Ga0055531_10000929 3300003794 Bacteria 23705
58 Ga0055531_10004331 3300003794 Bacteria 8683
59 Ga0065165_1004328 3300005262 Bacteria 8919
60 Ga0065165_1053500 3300005262 Bacteria 1136
61 Ga0065704_10070193 3300005289 Bacteria 98570
62 Ga0065704_10094687 3300005289 Bacteria 2530
63 Ga0065704_10127076 3300005289 Bacteria 1680
64 Ga0065704_10173616 3300005289 Bacteria 1277
65 Ga0065715_10007711 3300005293 Bacteria 4049
66 Ga0065707_10081811 3300005295 Bacteria 37556
67 Ga0065707_10105390 3300005295 Bacteria 2647
68 Ga0065707_10260882 3300005295 Bacteria 1097
69 Ga0070658_10000377 3300005327 Bacteria 38853
70 Ga0070658_10000716 3300005327 Bacteria 28749
71 Ga0070658_10003584 3300005327 Bacteria 12730
72 Ga0070658_10003723 3300005327 Bacteria 12473
73 Ga0070658_10004008 3300005327 Bacteria 12067
74 Ga0070658_10007308 3300005327 Bacteria 8922
75 Ga0070658_10021861 3300005327 Bacteria 5128
76 Ga0070658_10075150 3300005327 Bacteria 2771
77 Ga0070658_10153726 3300005327 Bacteria 1928
78 Ga0070676_10001215 3300005328 Bacteria 12921
79 Ga0070676_10005501 3300005328 Bacteria 6745
80 Ga0070676_10176436 3300005328 Bacteria 1386
81 Ga0070676_10652559 3300005328 Bacteria 764
82 Ga0070683_100001819 3300005329 Bacteria 16631
83 Ga0070683_100018052 3300005329 Bacteria 6241
84 Ga0070683_100168475 3300005329 Bacteria 2079
85 Ga0070690_100128620 3300005330 Bacteria 1708
86 Ga0070670_100000027 3300005331 Bacteria 186072
87 Ga0070670_100000047 3300005331 Bacteria 136625
88 Ga0070670_100012449 3300005331 Bacteria 7280
89 Ga0070670_100042597 3300005331 Bacteria 3903
90 Ga0070670_100302451 3300005331 Bacteria 1399
91 Ga0070670_100775340 3300005331 Bacteria 865
92 Ga0070677_10000079 3300005333 Bacteria 30894
93 Ga0070677_10011544 3300005333 Bacteria 3049
94 Ga0070677_10034331 3300005333 Bacteria 1959
95 Ga0068869_100000031 3300005334 Bacteria 60884
96 Ga0070666_10000779 3300005335 Bacteria 19305
97 Ga0070666_10054458 3300005335 Bacteria 2699
98 Ga0070666_10093259 3300005335 Bacteria 2070
99 Ga0070666_10581678 3300005335 Bacteria 816
100 Ga0070680_100000177 3300005336 Bacteria 41002
101 Ga0070680_100003469 3300005336 Bacteria 11774
102 Ga0070680_100245996 3300005336 Bacteria 1512
103 Ga0070680_100602927 3300005336 Bacteria 942
104 Ga0070682_100058066 3300005337 Bacteria 2439
105 Ga0070682_100128504 3300005337 Bacteria 1712
106 Ga0070682_101075427 3300005337 Bacteria 672
107 Ga0068868_100000060 3300005338 Bacteria 61952
108 Ga0068868_100058542 3300005338 Bacteria 3045
109 Ga0068868_100192305 3300005338 Bacteria 1697
110 Ga0068868_100202519 3300005338 Bacteria 1655
111 Ga0070660_100000751 3300005339 Bacteria 21524
112 Ga0070660_100000986 3300005339 Bacteria 19065
113 Ga0070660_100002934 3300005339 Bacteria 11737
114 Ga0070660_100005512 3300005339 Bacteria 8765
115 Ga0070660_100009089 3300005339 Bacteria 6976
116 Ga0070660_100016075 3300005339 Bacteria 5423
117 Ga0070660_100024083 3300005339 Bacteria 4516
118 Ga0070660_100111630 3300005339 Bacteria 2175
119 Ga0070660_100273648 3300005339 Bacteria 1381
120 Ga0070660_100347733 3300005339 Bacteria 1220
121 Ga0070687_100111831 3300005343 Bacteria 1547
122 Ga0070687_100150704 3300005343 Bacteria 1365
123 Ga0070661_100000156 3300005344 Bacteria 55675
124 Ga0070661_100000187 3300005344 Bacteria 51095
125 Ga0070661_100006527 3300005344 Bacteria 8049
126 Ga0070661_100021041 3300005344 Bacteria 4657
127 Ga0070661_100032184 3300005344 Bacteria 3795
128 Ga0070661_100036795 3300005344 Bacteria 3557
129 Ga0070661_100069996 3300005344 Bacteria 2580
130 Ga0070661_100284668 3300005344 Bacteria 1283
131 Ga0070661_100726035 3300005344 Bacteria 811
132 Ga0070692_10033345 3300005345 Bacteria 2594
133 Ga0070692_10268070 3300005345 Bacteria 1029
134 Ga0070668_100016101 3300005347 Bacteria 5596
135 Ga0070668_100018871 3300005347 Bacteria 5181
136 Ga0070668_100033002 3300005347 Bacteria 3940
137 Ga0070668_100078104 3300005347 Bacteria 2588
138 Ga0070668_100089092 3300005347 Bacteria 2430
139 Ga0070668_100100733 3300005347 Bacteria 2288
140 Ga0070668_100114109 3300005347 Bacteria 2153
141 Ga0070668_100125621 3300005347 Bacteria 2054
142 Ga0070668_100167545 3300005347 Bacteria 1786
143 Ga0070669_100000072 3300005353 Bacteria 99184
144 Ga0070669_100000470 3300005353 Bacteria 30618
145 Ga0070669_100030653 3300005353 Bacteria 3882
146 Ga0070669_100075371 3300005353 Bacteria 2502
147 Ga0070669_100133445 3300005353 Bacteria 1907
148 Ga0070669_100147500 3300005353 Bacteria 1819
149 Ga0070669_100177785 3300005353 Bacteria 1663
150 Ga0070669_100660071 3300005353 Bacteria 880
151 Ga0070675_100005311 3300005354 Bacteria 9842
152 Ga0070675_100014931 3300005354 Bacteria 6133
153 Ga0070675_100246966 3300005354 Bacteria 1561
154 Ga0070671_100000845 3300005355 Bacteria 22289
155 Ga0070671_100039002 3300005355 Bacteria 3943
156 Ga0070671_100054381 3300005355 Bacteria 3329
157 Ga0070671_100080339 3300005355 Bacteria 2726
158 Ga0070671_100241581 3300005355 Bacteria 1533
159 Ga0070671_100352852 3300005355 Bacteria 1255
160 Ga0070671_100489394 3300005355 Bacteria 1057
161 Ga0070674_100000209 3300005356 Bacteria 28138
162 Ga0070674_100027045 3300005356 Bacteria 3755
163 Ga0070674_100127342 3300005356 Bacteria 1894
164 Ga0070673_100000009 3300005364 Bacteria 155005
165 Ga0070673_100031597 3300005364 Bacteria 3976
166 Ga0070673_100226433 3300005364 Bacteria 1621
167 Ga0070673_100658848 3300005364 Bacteria 959
168 Ga0070659_100000191 3300005366 Bacteria 47035
169 Ga0070659_100017756 3300005366 Bacteria 5358
170 Ga0070659_100033034 3300005366 Bacteria 4018
171 Ga0070659_100039493 3300005366 Bacteria 3685
172 Ga0070659_100043632 3300005366 Bacteria 3507
173 Ga0070659_100066651 3300005366 Bacteria 2853
174 Ga0070659_100067036 3300005366 Bacteria 2846
175 Ga0070659_100423186 3300005366 Bacteria 1126
176 Ga0070659_100448781 3300005366 Bacteria 1094
177 Ga0070667_100000143 3300005367 Bacteria 90358
178 Ga0070667_100000286 3300005367 Bacteria 57006
179 Ga0070667_100000367 3300005367 Bacteria 49149
180 Ga0070667_100000725 3300005367 Bacteria 31653
181 Ga0070667_100034211 3300005367 Bacteria 4250
182 Ga0070667_100038587 3300005367 Bacteria 4004
183 Ga0070667_100265935 3300005367 Bacteria 1537
184 Ga0070667_100533049 3300005367 Bacteria 1078
185 Ga0070709_10016498 3300005434 Bacteria 4218
186 Ga0070714_100011330 3300005435 Bacteria 7071
187 Ga0070714_100156723 3300005435 Bacteria 2056
188 Ga0070713_100064528 3300005436 Bacteria 3074
189 Ga0070713_100087188 3300005436 Bacteria 2677
190 Ga0070713_100165627 3300005436 Bacteria 1976
191 Ga0070694_100086015 3300005444 Bacteria 2196
192 Ga0070663_100004783 3300005455 Bacteria 7986
193 Ga0070663_100008779 3300005455 Bacteria 6234
194 Ga0070663_100046160 3300005455 Bacteria 3081
195 Ga0070663_100083683 3300005455 Bacteria 2350
196 Ga0070663_100236458 3300005455 Bacteria 1441
197 Ga0070663_100377050 3300005455 Bacteria 1154
198 Ga0070678_100001063 3300005456 Bacteria 14344
199 Ga0070678_100033684 3300005456 Bacteria 3560
200 Ga0070678_100299879 3300005456 Bacteria 1365
201 Ga0070678_100334470 3300005456 Bacteria 1297
202 Ga0070662_100000012 3300005457 Bacteria 129380
203 Ga0070662_100001324 3300005457 Bacteria 15218
204 Ga0070662_100001565 3300005457 Bacteria 14148
205 Ga0070662_100002043 3300005457 Bacteria 12365
206 Ga0070662_100026436 3300005457 Bacteria 4020
207 Ga0070662_100049752 3300005457 Bacteria 3023
208 Ga0070662_100165319 3300005457 Bacteria 1733
209 Ga0070662_100827040 3300005457 Bacteria 788
210 Ga0070681_10006366 3300005458 Bacteria 11476
211 Ga0070681_10010175 3300005458 Bacteria 9277
212 Ga0068867_100000002 3300005459 Bacteria 247206
213 Ga0068867_100006572 3300005459 Bacteria 8214
214 Ga0068867_100071011 3300005459 Bacteria 2604
215 Ga0068867_100133018 3300005459 Bacteria 1935
216 Ga0070685_10077284 3300005466 Bacteria 1987
217 Ga0070679_100000001 3300005530 Bacteria 764811
218 Ga0070679_100005339 3300005530 Bacteria 11892
219 Ga0070679_100006705 3300005530 Bacteria 10738
220 Ga0070679_100080732 3300005530 Bacteria 3242
221 Ga0070679_100100254 3300005530 Bacteria 2883
222 Ga0070679_100589659 3300005530 Bacteria 1055
223 Ga0070684_100009174 3300005535 Bacteria 7780
224 Ga0070684_100559518 3300005535 Bacteria 1062
225 Ga0068853_100000032 3300005539 Bacteria 114306
226 Ga0068853_100003550 3300005539 Bacteria 11929
227 Ga0068853_100014991 3300005539 Bacteria 6368
228 Ga0068853_100065019 3300005539 Bacteria 3165
229 Ga0068853_100174373 3300005539 Bacteria 1947
230 Ga0070672_100224484 3300005543 Bacteria 1576
231 Ga0070672_100643002 3300005543 Bacteria 926
232 Ga0070695_100100790 3300005545 Bacteria 1945
233 Ga0070693_100000332 3300005547 Bacteria 21624
234 Ga0070693_100036501 3300005547 Bacteria 2733
235 Ga0070665_100000079 3300005548 Bacteria 186925
236 Ga0070665_100000084 3300005548 Bacteria 180481
237 Ga0070665_100003604 3300005548 Bacteria 16399
238 Ga0070665_100012237 3300005548 Bacteria 8649
239 Ga0070665_100034424 3300005548 Bacteria 5094
240 Ga0070665_100080538 3300005548 Bacteria 3262
241 Ga0068855_100000591 3300005563 Bacteria 44412
242 Ga0068855_100001164 3300005563 Bacteria 32603
243 Ga0068855_100007295 3300005563 Bacteria 13389
244 Ga0068855_100018573 3300005563 Bacteria 8362
245 Ga0068855_100032731 3300005563 Bacteria 6207
246 Ga0068855_100034640 3300005563 Bacteria 6018
247 Ga0068855_100095837 3300005563 Bacteria 3420
248 Ga0068855_100153975 3300005563 Bacteria 2613
249 Ga0068855_100245833 3300005563 Bacteria 1997
250 Ga0068855_100449134 3300005563 Bacteria 1407
251 Ga0068855_100789685 3300005563 Bacteria 1010
252 Ga0070664_100000187 3300005564 Bacteria 43750
253 Ga0070664_100002928 3300005564 Bacteria 13816
254 Ga0070664_100016865 3300005564 Bacteria 5993
255 Ga0070664_100025790 3300005564 Bacteria 4872
256 Ga0070664_100073402 3300005564 Bacteria 2935
257 Ga0070664_100177595 3300005564 Bacteria 1891
258 Ga0070664_100767854 3300005564 Bacteria 900
259 Ga0068857_100007902 3300005577 Bacteria 9175
260 Ga0068857_100190219 3300005577 Bacteria 1869
261 Ga0068857_100436038 3300005577 Bacteria 1223
262 Ga0068857_100542997 3300005577 Bacteria 1094
263 Ga0068854_100003204 3300005578 Bacteria 10212
264 Ga0068854_100007226 3300005578 Bacteria 7091
265 Ga0068854_100026804 3300005578 Bacteria 3965
266 Ga0068854_100090117 3300005578 Bacteria 2280
267 Ga0068854_100111295 3300005578 Bacteria 2066
268 Ga0068854_100112344 3300005578 Bacteria 2057
269 Ga0068854_100252199 3300005578 Bacteria 1409
270 Ga0068854_100336372 3300005578 Bacteria 1232
271 Ga0068854_100552291 3300005578 Bacteria 977
272 Ga0068856_100000291 3300005614 Bacteria 54890
273 Ga0068856_100005719 3300005614 Bacteria 12247
274 Ga0068856_100143419 3300005614 Bacteria 2396
275 Ga0068852_100000906 3300005616 Bacteria 19629
276 Ga0068852_100001541 3300005616 Bacteria 15633
277 Ga0068852_100058362 3300005616 Bacteria 3343
278 Ga0068852_100137652 3300005616 Bacteria 2256
279 Ga0068852_100476231 3300005616 Bacteria 1240
280 Ga0068852_100647544 3300005616 Bacteria 1064
281 Ga0068852_101080088 3300005616 Bacteria 822
282 Ga0068859_100008247 3300005617 Bacteria 10565
283 Ga0068859_100090073 3300005617 Bacteria 3118
284 Ga0068859_100310836 3300005617 Bacteria 1669
285 Ga0068859_100603103 3300005617 Bacteria 1191
286 Ga0068864_100000051 3300005618 Bacteria 136621
287 Ga0068864_100000100 3300005618 Bacteria 85101
288 Ga0068864_100034890 3300005618 Bacteria 4281
289 Ga0068864_100104055 3300005618 Bacteria 2521
290 Ga0068864_100113092 3300005618 Bacteria 2420
291 Ga0068866_10096709 3300005718 Bacteria 1620
292 Ga0068861_100038439 3300005719 Bacteria 3564
293 Ga0068851_10010180 3300005834 Bacteria 4384
294 Ga0068851_10019263 3300005834 Bacteria 3296
295 Ga0068851_10019743 3300005834 Bacteria 3257
296 Ga0068851_10090672 3300005834 Bacteria 1609
297 Ga0068851_10096921 3300005834 Bacteria 1560
298 Ga0068851_10335431 3300005834 Bacteria 876
299 Ga0068870_10039947 3300005840 Bacteria 2430
300 Ga0068870_10262608 3300005840 Bacteria 1075
301 Ga0068863_100000025 3300005841 Bacteria 186072
302 Ga0068863_100000168 3300005841 Bacteria 70935
303 Ga0068863_100001489 3300005841 Bacteria 23203
304 Ga0068863_100058470 3300005841 Bacteria 3648
305 Ga0068863_100081951 3300005841 Bacteria 3057
306 Ga0068863_100193604 3300005841 Bacteria 1954
307 Ga0068858_100000673 3300005842 Bacteria 35672
308 Ga0068858_100000848 3300005842 Bacteria 31661
309 Ga0068858_100023512 3300005842 Bacteria 5740
310 Ga0068858_100043159 3300005842 Bacteria 4181
311 Ga0068858_100052186 3300005842 Bacteria 3783
312 Ga0068858_100071318 3300005842 Bacteria 3222
313 Ga0068858_100665973 3300005842 Bacteria 1012
314 Ga0068860_100000181 3300005843 Bacteria 101627
315 Ga0068860_100027199 3300005843 Bacteria 5511
316 Ga0068860_100067993 3300005843 Bacteria 3385
317 Ga0068860_100096161 3300005843 Bacteria 2823
318 Ga0068860_100166266 3300005843 Bacteria 2129
319 Ga0068862_100000027 3300005844 Bacteria 186072
320 Ga0068862_100000036 3300005844 Bacteria 173453
321 Ga0068862_100004531 3300005844 Bacteria 11717
322 Ga0068862_100024495 3300005844 Bacteria 5064
323 Ga0068862_100386147 3300005844 Bacteria 1307
324 Ga0068862_100431342 3300005844 Bacteria 1239
325 Ga0068862_100749193 3300005844 Bacteria 950
326 Ga0081540_1099998 3300005983 Bacteria 1251
327 Ga0081539_10008794 3300005985 Bacteria 8651
328 Ga0081539_10019519 3300005985 Bacteria 4633
329 Ga0070717_10004794 3300006028 Bacteria 9837
330 Ga0070717_10109103 3300006028 Bacteria 2358
331 Ga0075368_10000304 3300006042 Bacteria 14246
332 Ga0075368_10000450 3300006042 Bacteria 12161
333 Ga0075363_100093715 3300006048 Bacteria 1655
334 Ga0075364_10341720 3300006051 Bacteria 1020
335 Ga0070716_100017029 3300006173 Bacteria 3761
336 Ga0070716_100129508 3300006173 Bacteria 1593
337 Ga0070712_100043513 3300006175 Bacteria 3091
338 Ga0070712_100203183 3300006175 Bacteria 1558
339 Ga0075362_10001064 3300006177 Bacteria 8483
340 Ga0075362_10034007 3300006177 Bacteria 2220
341 Ga0075367_10007487 3300006178 Bacteria 5593
342 Ga0075367_10022925 3300006178 Bacteria 3508
343 Ga0075369_10005423 3300006186 Bacteria 4766
344 Ga0075369_10096406 3300006186 Bacteria 1324
345 Ga0075366_10087603 3300006195 Bacteria 1864
346 Ga0097621_100001876 3300006237 Bacteria 14391
347 Ga0097621_100081758 3300006237 Bacteria 2689
348 Ga0097621_100104675 3300006237 Bacteria 2385
349 Ga0097621_100202373 3300006237 Bacteria 1724
350 Ga0097621_100244043 3300006237 Bacteria 1571
351 Ga0097621_100397715 3300006237 Bacteria 1233
352 Ga0068871_100007505 3300006358 Bacteria 7797
353 Ga0068871_100062791 3300006358 Bacteria 3037
354 Ga0068871_100120505 3300006358 Bacteria 2216
355 Ga0068871_100224978 3300006358 Bacteria 1627
356 Ga0068871_100672249 3300006358 Bacteria 947
357 Ga0075429_100129397 3300006880 Bacteria 2208
358 Ga0068865_100000014 3300006881 Bacteria 138727
359 Ga0068865_100073741 3300006881 Bacteria 2428
360 Ga0068865_100830307 3300006881 Bacteria 799
361 Ga0097620_100008247 3300006931 Bacteria 10565
362 Ga0097620_100024043 3300006931 Bacteria 6114
363 Ga0097620_100090076 3300006931 Bacteria 3118
364 Ga0097620_100310844 3300006931 Bacteria 1669
365 Ga0097620_100603134 3300006931 Bacteria 1191
366 Ga0079104_1016890 3300006946 Bacteria 2116
367 Ga0079104_1030833 3300006946 Bacteria 1335
368 Ga0105251_10000232 3300009011 Bacteria 56006
369 Ga0105251_10000554 3300009011 Bacteria 35071
370 Ga0105251_10030739 3300009011 Bacteria 2693
371 Ga0105251_10127682 3300009011 Bacteria 1153
372 Ga0105250_10127622 3300009092 Bacteria 1048
373 Ga0105240_10108042 3300009093 Bacteria 3371
374 Ga0105240_10163937 3300009093 Bacteria 2638
375 Ga0105240_10243049 3300009093 Bacteria 2086
376 Ga0105240_10292795 3300009093 Bacteria 1865
377 Ga0105240_11331320 3300009093 Bacteria 757
378 Ga0105245_10000160 3300009098 Bacteria 63445
379 Ga0105245_10013224 3300009098 Bacteria 7191
380 Ga0105245_10018347 3300009098 Bacteria 6118
381 Ga0105247_10057877 3300009101 Bacteria 2397
382 Ga0114129_10257351 3300009147 Bacteria 2341
383 Ga0105243_10000070 3300009148 Bacteria 120851
384 Ga0105243_10005193 3300009148 Bacteria 10193
385 Ga0105243_10055563 3300009148 Bacteria 3146
386 Ga0105243_10130908 3300009148 Bacteria 2128
387 Ga0105243_10229689 3300009148 Bacteria 1645
388 Ga0105243_10745781 3300009148 Bacteria 959
389 Ga0105241_10030368 3300009174 Bacteria 4037
390 Ga0105241_10077362 3300009174 Bacteria 2597
391 Ga0105241_10158703 3300009174 Bacteria 1857
392 Ga0105241_10266923 3300009174 Bacteria 1456
393 Ga0105241_10762377 3300009174 Bacteria 888
394 Ga0105242_10001604 3300009176 Bacteria 17808
395 Ga0105242_10188683 3300009176 Bacteria 1823
396 Ga0105248_10000083 3300009177 Bacteria 110619
397 Ga0105248_10001385 3300009177 Bacteria 27005
398 Ga0105248_10002034 3300009177 Bacteria 22430
399 Ga0105248_10023944 3300009177 Bacteria 6787
400 Ga0105248_10024368 3300009177 Bacteria 6730
401 Ga0105248_10032701 3300009177 Bacteria 5810
402 Ga0105248_10091313 3300009177 Bacteria 3430
403 Ga0105248_10155436 3300009177 Bacteria 2581
404 Ga0105248_10354956 3300009177 Bacteria 1651
405 Ga0105237_10005695 3300009545 Bacteria 14014
406 Ga0105237_10017062 3300009545 Bacteria 7535
407 Ga0105237_10097580 3300009545 Bacteria 2929
408 Ga0105237_10215362 3300009545 Bacteria 1921
409 Ga0105238_10015678 3300009551 Bacteria 7672
410 Ga0105238_10024071 3300009551 Bacteria 6208
411 Ga0105238_10116826 3300009551 Bacteria 2647
412 Ga0105238_10173208 3300009551 Bacteria 2134
413 Ga0105238_10373185 3300009551 Bacteria 1417
414 Ga0105238_11024103 3300009551 Bacteria 847
415 Ga0105238_11607096 3300009551 Bacteria 680
416 Ga0105249_10000110 3300009553 Bacteria 111292
417 Ga0105249_10015328 3300009553 Bacteria 6783
418 Ga0105249_10096719 3300009553 Bacteria 2771
419 Ga0105249_10201195 3300009553 Bacteria 1949
420 Ga0105249_10433131 3300009553 Bacteria 1351
421 Ga0105249_11029498 3300009553 Bacteria 892
422 Ga0105148_100275 3300009978 Bacteria 6836
423 Ga0105148_117869 3300009978 Bacteria 564
424 Ga0105147_101564 3300009982 Bacteria 1876
425 Ga0105239_10000271 3300010375 Bacteria 76812
426 Ga0105239_10102466 3300010375 Bacteria 3168
427 Ga0105239_10110863 3300010375 Bacteria 3041
428 Ga0105239_10147805 3300010375 Bacteria 2622
429 Ga0105239_11069256 3300010375 Bacteria 928
430 Ga0105239_11248926 3300010375 Bacteria 856
431 Ga0105246_10002314 3300011119 Bacteria 11507
432 Ga0105246_10003501 3300011119 Bacteria 9510
433 Ga0105246_10008646 3300011119 Bacteria 6261
434 Ga0105246_10080366 3300011119 Bacteria 2321
435 Ga0157326_1000005 3300012513 Bacteria 18291
436 Ga0157326_1003871 3300012513 Bacteria 1572
437 Ga0157373_10006989 3300013100 Bacteria 8406
438 Ga0157373_10029859 3300013100 Bacteria 3925
439 Ga0157373_10039126 3300013100 Bacteria 3396
440 Ga0157373_10147818 3300013100 Bacteria 1653
441 Ga0157373_10231884 3300013100 Bacteria 1304
442 Ga0157373_10476278 3300013100 Bacteria 900
443 Ga0157373_10671609 3300013100 Bacteria 758
444 Ga0157371_10000011 3300013102 Bacteria 377608
445 Ga0157371_10001091 3300013102 Bacteria 29403
446 Ga0157371_10007915 3300013102 Bacteria 8529
447 Ga0157371_10077146 3300013102 Bacteria 2359
448 Ga0157371_10167994 3300013102 Bacteria 1567
449 Ga0157371_10203577 3300013102 Bacteria 1419
450 Ga0157371_10235898 3300013102 Bacteria 1315
451 Ga0157371_10606890 3300013102 Bacteria 814
452 Ga0157371_10608377 3300013102 Bacteria 813
453 Ga0157370_10002905 3300013104 Bacteria 20434
454 Ga0157370_11001809 3300013104 Bacteria 756
455 Ga0157369_10021625 3300013105 Bacteria 7194
456 Ga0157369_10157781 3300013105 Bacteria 2396
457 Ga0157369_10780179 3300013105 Bacteria 982
458 Ga0157374_10000542 3300013296 Bacteria 33699
459 Ga0157374_10186177 3300013296 Bacteria 2030
460 Ga0157374_10244501 3300013296 Bacteria 1765
461 Ga0157374_10389936 3300013296 Bacteria 1388
462 Ga0157374_10836077 3300013296 Bacteria 937
463 Ga0157378_10000624 3300013297 Bacteria 33307
464 Ga0157378_10021072 3300013297 Bacteria 5734
465 Ga0157378_10060444 3300013297 Bacteria 3382
466 Ga0157378_11306933 3300013297 Bacteria 766
467 Ga0163162_10009970 3300013306 Bacteria 9240
468 Ga0163162_10015197 3300013306 Bacteria 7520
469 Ga0163162_10305478 3300013306 Bacteria 1723
470 Ga0163162_10335390 3300013306 Bacteria 1645
471 Ga0163162_10363202 3300013306 Bacteria 1581
472 Ga0157372_10008443 3300013307 Bacteria 10936
473 Ga0157372_10093707 3300013307 Bacteria 3418
474 Ga0157372_10293339 3300013307 Bacteria 1891
475 Ga0157372_11391257 3300013307 Bacteria 809
476 Ga0157375_10027717 3300013308 Bacteria 5299
477 Ga0157375_10090533 3300013308 Bacteria 3118
478 Ga0163163_10001064 3300014325 Bacteria 23319
479 Ga0163163_10006906 3300014325 Bacteria 9963
480 Ga0163163_10015984 3300014325 Bacteria 6955
481 Ga0157380_10000315 3300014326 Bacteria 29340
482 Ga0157380_10000763 3300014326 Bacteria 20083
483 Ga0157380_10022724 3300014326 Bacteria 4728
484 Ga0157380_10113655 3300014326 Bacteria 2280
485 Ga0157380_10194137 3300014326 Bacteria 1795
486 Ga0157380_10410985 3300014326 Bacteria 1287
487 Ga0182008_10126272 3300014497 Bacteria 1274
488 Ga0157377_10037303 3300014745 Bacteria 2677
489 Ga0157377_10271498 3300014745 Bacteria 1108
490 Ga0157379_10003811 3300014968 Bacteria 12853
491 Ga0157379_10104620 3300014968 Bacteria 2540
492 Ga0157379_10702359 3300014968 Bacteria 949
493 Ga0157376_10000096 3300014969 Bacteria 65482
494 Ga0183363_1003 3300015690 Bacteria 421263
495 Ga0163161_10044190 3300017792 Bacteria 3209
496 Ga0163161_10046559 3300017792 Bacteria 3129
497 Ga0163161_10106148 3300017792 Bacteria 2096
498 Ga0163161_10107867 3300017792 Bacteria 2079
499 Ga0163161_10295126 3300017792 Bacteria 1275
500 Ga0209147_100298 3300025229 Bacteria 40972
501 Ga0209563_100125 3300025230 Bacteria 113854
502 Ga0209148_1000008 3300025254 Bacteria 1504371
503 Ga0209148_1000147 3300025254 Bacteria 160231
504 Ga0209148_1002428 3300025254 Bacteria 6428
505 Ga0209233_1000140 3300025261 Bacteria 193274
506 Ga0209233_1027364 3300025261 Bacteria 1382
507 Ga0209455_1000002 3300025272 Bacteria 1505459
508 Ga0209455_1000707 3300025272 Bacteria 19438
509 Ga0209455_1009390 3300025272 Bacteria 2573
510 Ga0209675_1000181 3300025291 Bacteria 71490
511 Ga0209676_1000084 3300025292 Bacteria 274330
512 Ga0209676_1000330 3300025292 Bacteria 91216
513 Ga0209676_1000479 3300025292 Bacteria 65868
514 Ga0209676_1032030 3300025292 Bacteria 1587
515 Ga0209025_1022687 3300025294 Bacteria 3316
516 Ga0209758_1000017 3300025297 Bacteria 754393
517 Ga0209050_1000113 3300025298 Bacteria 209222
518 Ga0209050_1000254 3300025298 Bacteria 114395
519 Ga0209050_1001453 3300025298 Bacteria 25414
520 Ga0209050_1048216 3300025298 Bacteria 1102
521 Ga0209257_1000083 3300025304 Bacteria 296207
522 Ga0209257_1000126 3300025304 Bacteria 215705
523 Ga0209257_1000340 3300025304 Bacteria 97492
524 Ga0209257_1001209 3300025304 Bacteria 32418
525 Ga0209257_1053361 3300025304 Bacteria 1131
526 Ga0207697_10035799 3300025315 Bacteria 2033
527 Ga0207697_10047244 3300025315 Bacteria 1774
528 Ga0207697_10077367 3300025315 Bacteria 1399
529 Ga0207697_10084306 3300025315 Bacteria 1341
530 Ga0207697_10211268 3300025315 Bacteria 855
531 Ga0207656_10001253 3300025321 Bacteria 8367
532 Ga0207656_10034991 3300025321 Bacteria 2100
533 Ga0207656_10069520 3300025321 Bacteria 1562
534 Ga0207656_10079265 3300025321 Bacteria 1473
535 Ga0207656_10196397 3300025321 Bacteria 973
536 Ga0207713_1000615 3300025735 Bacteria 35051
537 Ga0207713_1001012 3300025735 Bacteria 24466
538 Ga0207713_1060220 3300025735 Bacteria 1452
539 Ga0207682_10000542 3300025893 Bacteria 17400
540 Ga0207682_10035626 3300025893 Bacteria 2011
541 Ga0207642_10064108 3300025899 Bacteria 1721
542 Ga0207688_10067605 3300025901 Bacteria 2022
543 Ga0207688_10145818 3300025901 Bacteria 1395
544 Ga0207688_10148226 3300025901 Bacteria 1384
545 Ga0207688_10198933 3300025901 Bacteria 1201
546 Ga0207680_10001307 3300025903 Bacteria 11765
547 Ga0207680_10053944 3300025903 Bacteria 2416
548 Ga0207680_10555348 3300025903 Bacteria 820
549 Ga0207647_10000389 3300025904 Bacteria 35906
550 Ga0207647_10000850 3300025904 Bacteria 23703
551 Ga0207647_10019227 3300025904 Bacteria 4597
552 Ga0207647_10041178 3300025904 Bacteria 2906
553 Ga0207647_10084197 3300025904 Bacteria 1903
554 Ga0207647_10085879 3300025904 Bacteria 1881
555 Ga0207645_10000470 3300025907 Bacteria 33310
556 Ga0207645_10008376 3300025907 Bacteria 7213
557 Ga0207645_10030439 3300025907 Bacteria 3477
558 Ga0207645_10044108 3300025907 Bacteria 2854
559 Ga0207645_10208853 3300025907 Bacteria 1286
560 Ga0207643_10033802 3300025908 Bacteria 2861
561 Ga0207705_10000042 3300025909 Bacteria 182120
562 Ga0207705_10000072 3300025909 Bacteria 126043
563 Ga0207705_10000236 3300025909 Bacteria 54788
564 Ga0207705_10007727 3300025909 Bacteria 7904
565 Ga0207705_10009210 3300025909 Bacteria 7190
566 Ga0207705_10018377 3300025909 Bacteria 4999
567 Ga0207705_10028048 3300025909 Bacteria 4014
568 Ga0207705_10093631 3300025909 Bacteria 2203
569 Ga0207705_10151259 3300025909 Bacteria 1739
570 Ga0207705_10318355 3300025909 Bacteria 1195
571 Ga0207705_10479483 3300025909 Bacteria 965
572 Ga0207654_10000246 3300025911 Bacteria 32849
573 Ga0207654_10159335 3300025911 Bacteria 1456
574 Ga0207654_10230549 3300025911 Bacteria 1233
575 Ga0207654_10480107 3300025911 Bacteria 875
576 Ga0207707_10006710 3300025912 Bacteria 10049
577 Ga0207707_10047954 3300025912 Bacteria 3721
578 Ga0207695_10005291 3300025913 Bacteria 17200
579 Ga0207695_10124680 3300025913 Bacteria 2540
580 Ga0207695_11005375 3300025913 Bacteria 714
581 Ga0207671_10000955 3300025914 Bacteria 35890
582 Ga0207671_10044155 3300025914 Bacteria 3296
583 Ga0207693_10014544 3300025915 Bacteria 6324
584 Ga0207693_10053263 3300025915 Bacteria 3175
585 Ga0207660_10001102 3300025917 Bacteria 18028
586 Ga0207657_10000176 3300025919 Bacteria 65856
587 Ga0207657_10000764 3300025919 Bacteria 34123
588 Ga0207657_10000837 3300025919 Bacteria 32516
589 Ga0207657_10000900 3300025919 Bacteria 31430
590 Ga0207657_10003875 3300025919 Bacteria 15879
591 Ga0207657_10005081 3300025919 Bacteria 13794
592 Ga0207657_10008183 3300025919 Bacteria 10654
593 Ga0207657_10009556 3300025919 Bacteria 9733
594 Ga0207657_10024081 3300025919 Bacteria 5651
595 Ga0207657_10027473 3300025919 Bacteria 5211
596 Ga0207657_10164063 3300025919 Bacteria 1803
597 Ga0207657_10434088 3300025919 Bacteria 1031
598 Ga0207649_10000027 3300025920 Bacteria 161926
599 Ga0207649_10000810 3300025920 Bacteria 20093
600 Ga0207649_10002323 3300025920 Bacteria 10680
601 Ga0207649_10005378 3300025920 Bacteria 6931
602 Ga0207649_10086734 3300025920 Bacteria 2040
603 Ga0207649_10199137 3300025920 Bacteria 1414
604 Ga0207649_10388902 3300025920 Bacteria 1041
605 Ga0207652_10000003 3300025921 Bacteria 502441
606 Ga0207652_10000489 3300025921 Bacteria 40293
607 Ga0207652_10027113 3300025921 Bacteria 4774
608 Ga0207652_10035093 3300025921 Bacteria 4232
609 Ga0207652_10068878 3300025921 Bacteria 3071
610 Ga0207652_10181942 3300025921 Bacteria 1889
611 Ga0207652_10378410 3300025921 Bacteria 1278
612 Ga0207681_10000061 3300025923 Bacteria 102257
613 Ga0207681_10002744 3300025923 Bacteria 11146
614 Ga0207681_10005152 3300025923 Bacteria 8028
615 Ga0207681_10090692 3300025923 Bacteria 2182
616 Ga0207681_10131345 3300025923 Bacteria 1852
617 Ga0207681_10254450 3300025923 Bacteria 1372
618 Ga0207694_10005386 3300025924 Bacteria 9850
619 Ga0207694_10036581 3300025924 Bacteria 3768
620 Ga0207694_10098020 3300025924 Bacteria 2320
621 Ga0207694_10443780 3300025924 Bacteria 1083
622 Ga0207694_10822103 3300025924 Bacteria 785
623 Ga0207694_10905958 3300025924 Bacteria 746
624 Ga0207650_10000056 3300025925 Bacteria 157972
625 Ga0207650_10000645 3300025925 Bacteria 27715
626 Ga0207650_10007357 3300025925 Bacteria 7494
627 Ga0207650_10034652 3300025925 Bacteria 3662
628 Ga0207650_10071175 3300025925 Bacteria 2615
629 Ga0207650_10137220 3300025925 Bacteria 1920
630 Ga0207659_10011390 3300025926 Bacteria 5616
631 Ga0207659_10069623 3300025926 Bacteria 2563
632 Ga0207659_10137601 3300025926 Bacteria 1892
633 Ga0207659_10783826 3300025926 Bacteria 819
634 Ga0207687_10000252 3300025927 Bacteria 36302
635 Ga0207687_10000892 3300025927 Bacteria 20277
636 Ga0207687_10059042 3300025927 Bacteria 2701
637 Ga0207700_10032777 3300025928 Bacteria 3710
638 Ga0207700_10255321 3300025928 Bacteria 1499
639 Ga0207664_10149793 3300025929 Bacteria 1981
640 Ga0207664_10509315 3300025929 Bacteria 1078
641 Ga0207644_10018835 3300025931 Bacteria 4677
642 Ga0207644_10026256 3300025931 Bacteria 4011
643 Ga0207644_10059655 3300025931 Bacteria 2759
644 Ga0207644_10063814 3300025931 Bacteria 2675
645 Ga0207644_10190814 3300025931 Bacteria 1611
646 Ga0207644_10200922 3300025931 Bacteria 1572
647 Ga0207690_10000245 3300025932 Bacteria 39464
648 Ga0207690_10000630 3300025932 Bacteria 22732
649 Ga0207690_10001503 3300025932 Bacteria 14574
650 Ga0207690_10022521 3300025932 Bacteria 3921
651 Ga0207690_10071040 3300025932 Bacteria 2400
652 Ga0207690_10083137 3300025932 Bacteria 2241
653 Ga0207690_10171137 3300025932 Bacteria 1627
654 Ga0207690_10198124 3300025932 Bacteria 1523
655 Ga0207690_10227900 3300025932 Bacteria 1429
656 Ga0207690_10229078 3300025932 Bacteria 1425
657 Ga0207690_10244142 3300025932 Bacteria 1384
658 Ga0207690_10259225 3300025932 Bacteria 1346
659 Ga0207690_10390236 3300025932 Bacteria 1108
660 Ga0207690_10645490 3300025932 Bacteria 867
661 Ga0207690_10798539 3300025932 Bacteria 780
662 Ga0207690_10934350 3300025932 Bacteria 720
663 Ga0207706_10000041 3300025933 Bacteria 130090
664 Ga0207706_10001361 3300025933 Bacteria 24433
665 Ga0207706_10009320 3300025933 Bacteria 9013
666 Ga0207706_10021878 3300025933 Bacteria 5739
667 Ga0207706_10028567 3300025933 Bacteria 4981
668 Ga0207706_10032833 3300025933 Bacteria 4619
669 Ga0207706_10327574 3300025933 Bacteria 1333
670 Ga0207706_10401387 3300025933 Bacteria 1188
671 Ga0207686_10002334 3300025934 Bacteria 10371
672 Ga0207686_10048837 3300025934 Bacteria 2624
673 Ga0207709_10000066 3300025935 Bacteria 189194
674 Ga0207709_10000116 3300025935 Bacteria 123061
675 Ga0207709_10018879 3300025935 Bacteria 3867
676 Ga0207709_10033589 3300025935 Bacteria 3014
677 Ga0207709_10183311 3300025935 Bacteria 1480
678 Ga0207669_10000022 3300025937 Bacteria 100002
679 Ga0207669_10015833 3300025937 Bacteria 3814
680 Ga0207669_10062042 3300025937 Bacteria 2300
681 Ga0207669_10101776 3300025937 Bacteria 1901
682 Ga0207669_10113323 3300025937 Bacteria 1823
683 Ga0207704_10000002 3300025938 Bacteria 303025
684 Ga0207704_10000007 3300025938 Bacteria 211230
685 Ga0207704_10054761 3300025938 Bacteria 2434
686 Ga0207704_10164991 3300025938 Bacteria 1581
687 Ga0207704_10183549 3300025938 Bacteria 1514
688 Ga0207665_10013175 3300025939 Bacteria 5437
689 Ga0207691_10010000 3300025940 Bacteria 9107
690 Ga0207691_10017215 3300025940 Bacteria 6857
691 Ga0207691_10513215 3300025940 Bacteria 1017
692 Ga0207691_10519937 3300025940 Bacteria 1010
693 Ga0207711_10000254 3300025941 Bacteria 57648
694 Ga0207711_10002858 3300025941 Bacteria 15138
695 Ga0207711_10019188 3300025941 Bacteria 5693
696 Ga0207711_10033796 3300025941 Bacteria 4329
697 Ga0207711_10043144 3300025941 Bacteria 3846
698 Ga0207711_11183716 3300025941 Bacteria 706
699 Ga0207689_10000060 3300025942 Bacteria 85326
700 Ga0207689_10003854 3300025942 Bacteria 13672
701 Ga0207689_10156309 3300025942 Bacteria 1880
702 Ga0207661_10000953 3300025944 Bacteria 19059
703 Ga0207661_10019161 3300025944 Bacteria 5096
704 Ga0207679_10000243 3300025945 Bacteria 41706
705 Ga0207679_10006441 3300025945 Bacteria 7418
706 Ga0207679_10016805 3300025945 Bacteria 4864
707 Ga0207679_10025671 3300025945 Bacteria 4055
708 Ga0207679_10049249 3300025945 Bacteria 3073
709 Ga0207679_10062972 3300025945 Bacteria 2766
710 Ga0207679_10094259 3300025945 Bacteria 2324
711 Ga0207679_10206807 3300025945 Bacteria 1643
712 Ga0207679_10728949 3300025945 Bacteria 901
713 Ga0207667_10000001 3300025949 Bacteria 1178522
714 Ga0207667_10000017 3300025949 Bacteria 390654
715 Ga0207667_10006092 3300025949 Bacteria 14659
716 Ga0207667_10007578 3300025949 Bacteria 13019
717 Ga0207667_10017260 3300025949 Bacteria 8130
718 Ga0207667_10017604 3300025949 Bacteria 8036
719 Ga0207667_10028549 3300025949 Bacteria 6059
720 Ga0207667_10031849 3300025949 Bacteria 5688
721 Ga0207667_10033839 3300025949 Bacteria 5491
722 Ga0207667_10064139 3300025949 Bacteria 3836
723 Ga0207667_10201249 3300025949 Bacteria 2043
724 Ga0207667_11003548 3300025949 Bacteria 822
725 Ga0207651_10000004 3300025960 Bacteria 290191
726 Ga0207651_10099174 3300025960 Bacteria 2156
727 Ga0207651_10201365 3300025960 Bacteria 1596
728 Ga0207651_10501208 3300025960 Bacteria 1049
729 Ga0207651_10557147 3300025960 Bacteria 997
730 Ga0207712_10001154 3300025961 Bacteria 18388
731 Ga0207712_10007169 3300025961 Bacteria 7030
732 Ga0207712_10009916 3300025961 Bacteria 6038
733 Ga0207712_10068412 3300025961 Bacteria 2544
734 Ga0207712_10519690 3300025961 Bacteria 1020
735 Ga0207712_10574041 3300025961 Bacteria 972
736 Ga0207668_10000050 3300025972 Bacteria 98767
737 Ga0207668_10008350 3300025972 Bacteria 6167
738 Ga0207668_10024423 3300025972 Bacteria 3900
739 Ga0207668_10025165 3300025972 Bacteria 3849
740 Ga0207668_10036914 3300025972 Bacteria 3266
741 Ga0207668_10060121 3300025972 Bacteria 2666
742 Ga0207668_10096392 3300025972 Bacteria 2186
743 Ga0207668_10100343 3300025972 Bacteria 2149
744 Ga0207668_10136193 3300025972 Bacteria 1882
745 Ga0207668_10196533 3300025972 Bacteria 1603
746 Ga0207640_10000695 3300025981 Bacteria 19606
747 Ga0207640_10003242 3300025981 Bacteria 8767
748 Ga0207640_10009695 3300025981 Bacteria 5401
749 Ga0207640_10010412 3300025981 Bacteria 5240
750 Ga0207640_10022324 3300025981 Bacteria 3786
751 Ga0207640_10022842 3300025981 Bacteria 3750
752 Ga0207640_10050304 3300025981 Bacteria 2703
753 Ga0207640_10057393 3300025981 Bacteria 2560
754 Ga0207640_10254719 3300025981 Bacteria 1364
755 Ga0207640_10848116 3300025981 Bacteria 795
756 Ga0207658_10000109 3300025986 Bacteria 89979
757 Ga0207658_10000243 3300025986 Bacteria 57023
758 Ga0207658_10000831 3300025986 Bacteria 25797
759 Ga0207658_10001229 3300025986 Bacteria 20259
760 Ga0207658_10007072 3300025986 Bacteria 7643
761 Ga0207658_10019968 3300025986 Bacteria 4637
762 Ga0207658_10333312 3300025986 Bacteria 1317
763 Ga0207658_10469643 3300025986 Bacteria 1116
764 Ga0207658_10482858 3300025986 Bacteria 1101
765 Ga0207677_10000231 3300026023 Bacteria 43615
766 Ga0207677_10105098 3300026023 Bacteria 2089
767 Ga0207677_10150276 3300026023 Bacteria 1796
768 Ga0207703_10000167 3300026035 Bacteria 76517
769 Ga0207703_10000302 3300026035 Bacteria 54142
770 Ga0207703_10001218 3300026035 Bacteria 24067
771 Ga0207703_10022812 3300026035 Bacteria 4917
772 Ga0207703_10165021 3300026035 Bacteria 1943
773 Ga0207703_11233867 3300026035 Bacteria 719
774 Ga0207639_10000222 3300026041 Bacteria 42464
775 Ga0207639_10001618 3300026041 Bacteria 15148
776 Ga0207639_10002807 3300026041 Bacteria 11688
777 Ga0207639_10004222 3300026041 Bacteria 9682
778 Ga0207639_10044491 3300026041 Bacteria 3339
779 Ga0207639_10119275 3300026041 Bacteria 2165
780 Ga0207639_10192428 3300026041 Bacteria 1743
781 Ga0207639_10372545 3300026041 Bacteria 1280
782 Ga0207678_10000427 3300026067 Bacteria 38170
783 Ga0207678_10002526 3300026067 Bacteria 16670
784 Ga0207678_10009305 3300026067 Bacteria 8648
785 Ga0207678_10009690 3300026067 Bacteria 8475
786 Ga0207678_10025204 3300026067 Bacteria 5191
787 Ga0207678_10029423 3300026067 Bacteria 4794
788 Ga0207678_10033366 3300026067 Bacteria 4485
789 Ga0207678_10130264 3300026067 Bacteria 2145
790 Ga0207678_10349584 3300026067 Bacteria 1275
791 Ga0207702_10000074 3300026078 Bacteria 113070
792 Ga0207702_10004354 3300026078 Bacteria 12627
793 Ga0207702_10067615 3300026078 Bacteria 3067
794 Ga0207702_10142238 3300026078 Bacteria 2172
795 Ga0207702_10245637 3300026078 Bacteria 1679
796 Ga0207702_10931312 3300026078 Bacteria 861
797 Ga0207702_10954380 3300026078 Bacteria 850
798 Ga0207641_10000018 3300026088 Bacteria 298209
799 Ga0207641_10000241 3300026088 Bacteria 71027
800 Ga0207641_10000755 3300026088 Bacteria 34850
801 Ga0207641_10001790 3300026088 Bacteria 20701
802 Ga0207641_10033823 3300026088 Bacteria 4248
803 Ga0207641_10232662 3300026088 Bacteria 1713
804 Ga0207641_10306438 3300026088 Bacteria 1502
805 Ga0207641_10331658 3300026088 Bacteria 1445
806 Ga0207648_10000003 3300026089 Bacteria 289983
807 Ga0207648_10004533 3300026089 Bacteria 14239
808 Ga0207648_10008748 3300026089 Bacteria 9757
809 Ga0207648_10043805 3300026089 Bacteria 3929
810 Ga0207648_10059901 3300026089 Bacteria 3320
811 Ga0207676_10000021 3300026095 Bacteria 296572
812 Ga0207676_10000027 3300026095 Bacteria 245868
813 Ga0207676_10000344 3300026095 Bacteria 39948
814 Ga0207676_10007462 3300026095 Bacteria 7760
815 Ga0207676_10036224 3300026095 Bacteria 3752
816 Ga0207676_10698306 3300026095 Bacteria 983
817 Ga0207674_10004106 3300026116 Bacteria 17638
818 Ga0207674_10006823 3300026116 Bacteria 13393
819 Ga0207674_10012801 3300026116 Bacteria 9366
820 Ga0207674_10038792 3300026116 Bacteria 4941
821 Ga0207674_10154090 3300026116 Bacteria 2253
822 Ga0207674_10155404 3300026116 Bacteria 2243
823 Ga0207674_10372997 3300026116 Bacteria 1379
824 Ga0207675_100001147 3300026118 Bacteria 26263
825 Ga0207675_100440544 3300026118 Bacteria 1289
826 Ga0207683_10015482 3300026121 Bacteria 6496
827 Ga0207683_10015611 3300026121 Bacteria 6464
828 Ga0207683_10058649 3300026121 Bacteria 3380
829 Ga0207683_10320182 3300026121 Bacteria 1421
830 Ga0207683_10335183 3300026121 Bacteria 1387
831 Ga0207698_10000892 3300026142 Bacteria 17333
832 Ga0207698_10001072 3300026142 Bacteria 15905
833 Ga0207698_10006957 3300026142 Bacteria 7077
834 Ga0207698_10033576 3300026142 Bacteria 3730
835 Ga0207698_10034897 3300026142 Bacteria 3673
836 Ga0207698_10080661 3300026142 Bacteria 2622
837 Ga0207698_10173871 3300026142 Bacteria 1900
838 Ga0207698_10397770 3300026142 Bacteria 1316
839 Ga0207698_11204589 3300026142 Bacteria 771
840 Ga0209973_1085743 3300027252 Bacteria 504
841 Ga0209983_1013449 3300027665 Bacteria 1683
842 Ga0209971_1038769 3300027682 Bacteria 1147
843 Ga0209813_10000007 3300027866 Bacteria 104066
844 Ga0209813_10000279 3300027866 Bacteria 14382
845 Ga0209974_10003536 3300027876 Bacteria 5619
846 Ga0268266_10000002 3300028379 Bacteria 3059047
847 Ga0268266_10000175 3300028379 Bacteria 115897
848 Ga0268266_10001810 3300028379 Bacteria 24195
849 Ga0268266_10005157 3300028379 Bacteria 12305
850 Ga0268266_10013052 3300028379 Bacteria 7163
851 Ga0268266_10025965 3300028379 Bacteria 4983
852 Ga0268266_10258148 3300028379 Bacteria 1614
853 Ga0268266_10502646 3300028379 Bacteria 1158
854 Ga0268266_10623025 3300028379 Bacteria 1037
855 Ga0268265_10000042 3300028380 Bacteria 186086
856 Ga0268265_10000052 3300028380 Bacteria 174254
857 Ga0268265_10003957 3300028380 Bacteria 10437
858 Ga0268265_10014248 3300028380 Bacteria 5416
859 Ga0268265_10080018 3300028380 Bacteria 2575
860 Ga0268265_10122506 3300028380 Bacteria 2145
861 Ga0268265_10167444 3300028380 Bacteria 1874
862 Ga0268265_10320645 3300028380 Bacteria 1403
863 Ga0268265_10651549 3300028380 Bacteria 1012
864 Ga0268264_10000144 3300028381 Bacteria 168841
865 Ga0268264_10000268 3300028381 Bacteria 91477
866 Ga0268264_10001327 3300028381 Bacteria 23270
867 Ga0268264_10013849 3300028381 Bacteria 6632
868 Ga0268264_10016760 3300028381 Bacteria 5996
869 Ga0268264_10045605 3300028381 Bacteria 3640
870 Ga0268264_10065024 3300028381 Bacteria 3071
871 Ga0268264_10095824 3300028381 Bacteria 2569
872 Ga0268264_10565079 3300028381 Bacteria 1117
873 Ga0307517_10020643 3300028786 Bacteria 8380
874 Ga0307517_10295058 3300028786 Bacteria 913
875 Ga0316183_1203243 3300030742 Bacteria 1049
876 Ga0265327_10116288 3300031251 Bacteria 1272
877 Ga0307509_10476517 3300031507 Bacteria 937
878 Ga0307408_100004452 3300031548 Bacteria 9514
879 Ga0307408_100006152 3300031548 Bacteria 7968
880 Ga0307408_100013781 3300031548 Bacteria 5367
881 Ga0307408_100045019 3300031548 Bacteria 3149
882 Ga0307408_100047429 3300031548 Bacteria 3077
883 Ga0307408_100115622 3300031548 Bacteria 2069
884 Ga0307408_100219274 3300031548 Bacteria 1551
885 Ga0307408_100454895 3300031548 Bacteria 1111
886 Ga0307408_100490889 3300031548 Bacteria 1073
887 Ga0307408_100499911 3300031548 Bacteria 1064
888 Ga0307508_10013978 3300031616 Bacteria 7324
889 Ga0307508_10100659 3300031616 Bacteria 2485
890 Ga0307405_10002843 3300031731 Bacteria 7780
891 Ga0307405_10004479 3300031731 Bacteria 6608
892 Ga0307405_10021552 3300031731 Bacteria 3624
893 Ga0307413_10002654 3300031824 Bacteria 7323
894 Ga0307413_10011213 3300031824 Bacteria 4394
895 Ga0307413_10017328 3300031824 Bacteria 3748
896 Ga0307413_10023177 3300031824 Bacteria 3361
897 Ga0307413_10135136 3300031824 Bacteria 1694
898 Ga0307413_10301424 3300031824 Bacteria 1215
899 Ga0307413_10822024 3300031824 Bacteria 783
900 Ga0307410_10012132 3300031852 Bacteria 4965
901 Ga0307410_10045244 3300031852 Bacteria 2929
902 Ga0307410_10074163 3300031852 Bacteria 2369
903 Ga0307410_10075902 3300031852 Bacteria 2344
904 Ga0307410_10118726 3300031852 Bacteria 1925
905 Ga0307410_10243550 3300031852 Bacteria 1394
906 Ga0307410_10303694 3300031852 Bacteria 1260
907 Ga0307410_10425944 3300031852 Bacteria 1077
908 Ga0307410_10746693 3300031852 Bacteria 828
909 Ga0307410_10842397 3300031852 Bacteria 782
910 Ga0307406_10010388 3300031901 Bacteria 5248
911 Ga0307406_10032616 3300031901 Bacteria 3182
912 Ga0307406_10049849 3300031901 Bacteria 2651
913 Ga0307406_10293774 3300031901 Bacteria 1245
914 Ga0307406_10354532 3300031901 Bacteria 1148
915 Ga0307406_10355532 3300031901 Bacteria 1146
916 Ga0307406_10430414 3300031901 Bacteria 1054
917 Ga0307406_10463989 3300031901 Bacteria 1019
918 Ga0307407_10000642 3300031903 Bacteria 11183
919 Ga0307407_10001660 3300031903 Bacteria 8234
920 Ga0307407_10018963 3300031903 Bacteria 3493
921 Ga0307407_10064069 3300031903 Bacteria 2158
922 Ga0307407_10215283 3300031903 Bacteria 1296
923 Ga0307412_10003000 3300031911 Bacteria 9343
924 Ga0307412_10011723 3300031911 Bacteria 5085
925 Ga0307412_10023555 3300031911 Bacteria 3790
926 Ga0307412_10031872 3300031911 Bacteria 3333
927 Ga0307412_10068448 3300031911 Bacteria 2414
928 Ga0307412_10133370 3300031911 Bacteria 1808
929 Ga0307412_10147821 3300031911 Bacteria 1730
930 Ga0307412_10504704 3300031911 Bacteria 1008
931 Ga0307412_10550438 3300031911 Bacteria 969
932 Ga0307412_10673933 3300031911 Bacteria 885
933 Ga0307412_11301028 3300031911 Bacteria 654
934 Ga0307409_100001134 3300031995 Bacteria 12647
935 Ga0307409_100014600 3300031995 Bacteria 5118
936 Ga0307409_100042286 3300031995 Bacteria 3411
937 Ga0307409_100097867 3300031995 Bacteria 2424
938 Ga0307409_100107575 3300031995 Bacteria 2330
939 Ga0307409_100375613 3300031995 Bacteria 1349
940 Ga0307409_100462246 3300031995 Bacteria 1227
941 Ga0307409_100574396 3300031995 Bacteria 1110
942 Ga0307409_100609696 3300031995 Bacteria 1080
943 Ga0307416_100021275 3300032002 Bacteria 4652
944 Ga0307416_100024603 3300032002 Bacteria 4399
945 Ga0307416_100025294 3300032002 Bacteria 4350
946 Ga0307416_100026146 3300032002 Bacteria 4295
947 Ga0307416_100039060 3300032002 Bacteria 3670
948 Ga0307416_100117251 3300032002 Bacteria 2363
949 Ga0307416_100660589 3300032002 Bacteria 1131
950 Ga0307414_10000073 3300032004 Bacteria 94656
951 Ga0307414_10004382 3300032004 Bacteria 7664
952 Ga0307414_10004615 3300032004 Bacteria 7494
953 Ga0307414_10004943 3300032004 Bacteria 7281
954 Ga0307414_10049760 3300032004 Bacteria 2899
955 Ga0307414_10085299 3300032004 Bacteria 2326
956 Ga0307414_10096376 3300032004 Bacteria 2213
957 Ga0307414_10129051 3300032004 Bacteria 1959
958 Ga0307414_10154175 3300032004 Bacteria 1816
959 Ga0307414_10181450 3300032004 Bacteria 1693
960 Ga0307414_10292136 3300032004 Bacteria 1374
961 Ga0307414_10323515 3300032004 Bacteria 1313
962 Ga0307414_10340417 3300032004 Bacteria 1284
963 Ga0307414_10410604 3300032004 Bacteria 1178
964 Ga0307414_10647308 3300032004 Bacteria 952
965 Ga0307414_10764060 3300032004 Bacteria 879
966 Ga0307414_10992884 3300032004 Bacteria 772
967 Ga0307411_10005275 3300032005 Bacteria 6327
968 Ga0307411_10016683 3300032005 Bacteria 4161
969 Ga0307411_10028900 3300032005 Bacteria 3377
970 Ga0307411_10041569 3300032005 Bacteria 2926
971 Ga0307411_10041899 3300032005 Bacteria 2917
972 Ga0307411_10208079 3300032005 Bacteria 1508
973 Ga0307411_10220221 3300032005 Bacteria 1472
974 Ga0307411_10257744 3300032005 Bacteria 1375
975 Ga0307411_10301566 3300032005 Bacteria 1285
976 Ga0307411_10303104 3300032005 Bacteria 1282
977 Ga0307411_10311678 3300032005 Bacteria 1266
978 Ga0307415_100009294 3300032126 Bacteria 5499
979 Ga0307415_100288064 3300032126 Bacteria 1354
980 Ga0307415_100321955 3300032126 Bacteria 1289
981 Ga0307415_100335672 3300032126 Bacteria 1266
982 Ga0307415_100439992 3300032126 Bacteria 1124
983 Ga0307510_10066259 3300033180 Bacteria 3649
984 Ga0373951_0046907 3300035091 Bacteria 1055
985 Ga0373923_0004223 3300035111 Bacteria 4744
986 Ga0373923_0127740 3300035111 Bacteria 1140
987 Ga0373943_0005666 3300035170 Bacteria 5602
988 Ga0373946_0061644 3300035171 Bacteria 1598
989 Ga0373935_0002322 3300035692 Bacteria 10863
990 Ga0373933_0031583 3300035724 Bacteria 3072
991 Ga0373947_0022791 3300035725 Bacteria 3635
992 Ga0373947_0129808 3300035725 Bacteria 1608
993 Ga0373937_0045789 3300036401 Bacteria 3998
994 Ga0373925_0277898 3300037068 Bacteria 1348
995 Ga0395899_0010252 3300037312 Bacteria 7182
996 Ga0395899_0036681 3300037312 Bacteria 3677
997 Ga0395899_0044714 3300037312 Bacteria 3299
998 Ga0395899_0053580 3300037312 Bacteria 2986
999 Ga0395899_0134149 3300037312 Bacteria 1766
1000 Ga0395899_0162236 3300037312 Bacteria 1578
1001 Ga0395900_0027388 3300037418 Bacteria 5837
1002 Ga0395900_0028928 3300037418 Bacteria 5681
1003 Ga0395900_0092721 3300037418 Bacteria 3103
1004 Ga0395900_0120079 3300037418 Bacteria 2697
1005 Ga0395900_0164384 3300037418 Bacteria 2262
1006 Ga0395900_0335785 3300037418 Bacteria 1488
1007 Ga0395898_0054496 3300037466 Bacteria 3902
1008 Ga0395898_0085987 3300037466 Bacteria 3031
1009 Ga0395905_0025080 3300037471 Bacteria 5623
1010 Ga0395905_0030632 3300037471 Bacteria 5067
1011 Ga0395905_0047368 3300037471 Bacteria 4029
1012 Ga0395905_0133408 3300037471 Bacteria 2336
1013 Ga0395905_0160398 3300037471 Bacteria 2114
1014 Ga0395905_0292187 3300037471 Bacteria 1516
1015 Ga0395905_0315237 3300037471 Bacteria 1453
1016 Ga0395905_0370430 3300037471 Bacteria 1326
1017 Ga0395905_0377023 3300037471 Bacteria 1312
1018 Ga0436364_0804686 3300037853 Bacteria 1283
1019 Ga0395901_0041174 3300038443 Bacteria 4786
1020 Ga0395901_0048282 3300038443 Bacteria 4420
1021 Ga0395901_0099018 3300038443 Bacteria 3057
1022 Ga0395901_0647004 3300038443 Bacteria 1061
1023 Ga0237819_02628 3300038705 Bacteria 3517
1024 Ga0237816_03757 3300039145 Bacteria 1089
1025 Ga0436365_1638035 3300039437 Bacteria 1898
1026 Ga0439466_0065068 3300041411 Bacteria 1169
1027 Ga0451791_1549013 3300041451 Bacteria 673
1028 Ga0451853_4106881 3300041512 Bacteria 1545
1029 Ga0439432_002749 3300042006 Bacteria 6573
1030 Ga0439449_0061824 3300042007 Bacteria 1382
1031 Ga0439462_0000274 3300042015 Bacteria 9429
1032 Ga0439458_0000616 3300042157 Bacteria 9192
1033 Ga0439460_0265782 3300042461 Bacteria 595
1034 Ga0451577_0219644 3300042876 Bacteria 1718
1035 Ga0466972_0001135 3300044658 Bacteria 12760
1036 Ga0466972_0040609 3300044658 Bacteria 2266
1037 Ga0466973_0033687 3300044659 Bacteria 4879
1038 Ga0466965_0074211 3300044683 Bacteria 1714
1039 Ga0466966_0001152 3300044684 Bacteria 16994
1040 Ga0466966_0229375 3300044684 Bacteria 1120
1041 Ga0466961_0017645 3300044693 Bacteria 4585
1042 Ga0466961_0039301 3300044693 Bacteria 3033
1043 Ga0466963_0050836 3300044694 Bacteria 2744
1044 Ga0466963_0321751 3300044694 Bacteria 1088
1045 Ga0466964_0023350 3300044706 Bacteria 2405
1046 Ga0466971_0001276 3300044719 Bacteria 10502
1047 Ga0466971_0371524 3300044719 Bacteria 694
1048 Ga0466968_0043206 3300044735 Bacteria 1907
1049 Ga0466968_0054968 3300044735 Bacteria 1707
1050 Ga0466970_0114927 3300044765 Bacteria 1471
1051 Ga0466970_0116316 3300044765 Bacteria 1462
1052 Ga0466970_0161930 3300044765 Bacteria 1238
1053 Ga0466970_0492336 3300044765 Bacteria 705
1054 Ga0466957_0008816 3300044842 Bacteria 5743
1055 Ga0466960_0001716 3300044901 Bacteria 8043
1056 Ga0466959_0084865 3300045049 Bacteria 2279
1057 Ga0466959_0160252 3300045049 Unclassified 1582
1058 Ga0466959_0213418 3300045049 Bacteria 1340
1059 Ga0466958_0010021 3300045836 Bacteria 5294
1060 Ga0466958_0025024 3300045836 Bacteria 3516
1061 Ga0466967_0083449 3300045976 Bacteria 2889
1062 Ga0466967_0373387 3300045976 Bacteria 1383
1063 Ga0466967_0433627 3300045976 Bacteria 1282
1064 Ga0495617_008380 3300046452 Bacteria 3565
1065 Ga0495627_000024 3300046453 Bacteria 250480
1066 Ga0495627_000582 3300046453 Bacteria 29200
1067 Ga0495627_020847 3300046453 Bacteria 2179
1068 Ga0495627_036429 3300046453 Bacteria 1529
1069 Ga0495638_0000051 3300046460 Bacteria 206003
1070 Ga0495638_0015201 3300046460 Bacteria 5175
1071 Ga0495638_0127999 3300046460 Bacteria 1495
1072 Ga0495650_0000967 3300046471 Bacteria 32924
1073 Ga0495650_0001090 3300046471 Bacteria 29761
1074 Ga0495650_0003223 3300046471 Bacteria 12124
1075 Ga0495605_0024857 3300046474 Bacteria 3129
1076 Ga0495584_0483584 3300046491 Bacteria 630
1077 Ga0495585_0040991 3300046492 Bacteria 2598
1078 Ga0495585_0061915 3300046492 Bacteria 2056
1079 Ga0495585_0062413 3300046492 Bacteria 2047
1080 Ga0495585_0081005 3300046492 Bacteria 1759
1081 Ga0495585_0094743 3300046492 Bacteria 1604
1082 Ga0495596_0000008 3300046500 Bacteria 150860
1083 Ga0495596_0002823 3300046500 Bacteria 9077
1084 Ga0495607_0006279 3300046501 Bacteria 8378
1085 Ga0495607_0013977 3300046501 Bacteria 5243
1086 Ga0495607_0037379 3300046501 Bacteria 2917
1087 Ga0495583_0000582 3300046506 Bacteria 50059
1088 Ga0495583_0001392 3300046506 Bacteria 24725
1089 Ga0495583_0005396 3300046506 Bacteria 8696
1090 Ga0495583_0030469 3300046506 Bacteria 2626
1091 Ga0495583_0074163 3300046506 Bacteria 1490
1092 Ga0495583_0077084 3300046506 Bacteria 1455
1093 Ga0495583_0085684 3300046506 Bacteria 1363
1094 Ga0495606_0000178 3300046507 Bacteria 112329
1095 Ga0495606_0010737 3300046507 Bacteria 7554
1096 Ga0495606_0013877 3300046507 Bacteria 6325
1097 Ga0495606_0027882 3300046507 Bacteria 3995
1098 Ga0495606_0163301 3300046507 Bacteria 1298
1099 Ga0495606_0173376 3300046507 Bacteria 1249
1100 Ga0495610_0000053 3300046512 Bacteria 142545
1101 Ga0495610_0000081 3300046512 Bacteria 113513
1102 Ga0495610_0001175 3300046512 Bacteria 23733
1103 Ga0495610_0004173 3300046512 Bacteria 10803
1104 Ga0495610_0093412 3300046512 Bacteria 1359
1105 Ga0495610_0151897 3300046512 Bacteria 987
1106 Ga0495616_0223663 3300046513 Bacteria 818
1107 Ga0495620_0024916 3300046515 Bacteria 2839
1108 Ga0495631_0026871 3300046518 Bacteria 2638
1109 Ga0495631_0045866 3300046518 Bacteria 1923
1110 Ga0495631_0252731 3300046518 Bacteria 751
1111 Ga0495632_0000006 3300046519 Bacteria 345883
1112 Ga0495632_0000306 3300046519 Bacteria 47401
1113 Ga0495632_0000356 3300046519 Bacteria 43508
1114 Ga0495632_0014842 3300046519 Bacteria 4392
1115 Ga0495632_0185855 3300046519 Bacteria 950
1116 Ga0495637_0000784 3300046520 Bacteria 21358
1117 Ga0495637_0023493 3300046520 Bacteria 2801
1118 Ga0495643_0000021 3300046522 Bacteria 293465
1119 Ga0495643_0000042 3300046522 Bacteria 229665
1120 Ga0495643_0001768 3300046522 Bacteria 18571
1121 Ga0495643_0002744 3300046522 Bacteria 13525
1122 Ga0495643_0002897 3300046522 Bacteria 13016
1123 Ga0495643_0012066 3300046522 Bacteria 5226
1124 Ga0495643_0018146 3300046522 Bacteria 4097
1125 Ga0495643_0018970 3300046522 Bacteria 3984
1126 Ga0495643_0045444 3300046522 Bacteria 2384
1127 Ga0495643_0055387 3300046522 Bacteria 2120
1128 Ga0495643_0064246 3300046522 Bacteria 1939
1129 Ga0495643_0108432 3300046522 Bacteria 1414
1130 Ga0495643_0183112 3300046522 Bacteria 1016
1131 Ga0495643_0232909 3300046522 Bacteria 868
1132 Ga0495643_0406652 3300046522 Bacteria 599
1133 Ga0495648_0000032 3300046524 Bacteria 205970
1134 Ga0495648_0004587 3300046524 Bacteria 11770
1135 Ga0495648_0026511 3300046524 Bacteria 3899
1136 Ga0495648_0038726 3300046524 Bacteria 3044
1137 Ga0495648_0148282 3300046524 Bacteria 1226
1138 Ga0495648_0215116 3300046524 Bacteria 952
1139 Ga0495663_0000008 3300046525 Bacteria 260614
1140 Ga0495663_0000758 3300046525 Bacteria 11077
1141 Ga0495663_0021992 3300046525 Bacteria 1840
1142 Ga0495663_0054540 3300046525 Bacteria 1245
1143 Ga0495663_0128851 3300046525 Bacteria 852
1144 Ga0495652_0539811 3300046529 Bacteria 803
1145 Ga0495609_0003619 3300046538 Bacteria 8776
1146 Ga0495609_0161424 3300046538 Bacteria 950
1147 Ga0495597_0021634 3300046542 Bacteria 2989
1148 Ga0495622_0002170 3300046557 Bacteria 9561
1149 Ga0495633_0000247 3300046558 Bacteria 64533
1150 Ga0495633_0000308 3300046558 Bacteria 55659
1151 Ga0495633_0001265 3300046558 Bacteria 20151
1152 Ga0495633_0009196 3300046558 Bacteria 5479
1153 Ga0495633_0015315 3300046558 Bacteria 3980
1154 Ga0495633_0043814 3300046558 Bacteria 2122
1155 Ga0495633_0100529 3300046558 Bacteria 1342
1156 Ga0495633_0188828 3300046558 Bacteria 947
1157 Ga0495668_0000004 3300046616 Bacteria 574236
1158 Ga0495668_0000013 3300046616 Bacteria 452938
1159 Ga0495668_0015322 3300046616 Bacteria 4481
1160 Ga0495668_0021352 3300046616 Bacteria 3714
1161 Ga0495668_0216745 3300046616 Bacteria 1048
1162 Ga0495668_0434163 3300046616 Bacteria 722
1163 Ga0495611_0014367 3300046648 Bacteria 3381
1164 Ga0495611_0066649 3300046648 Bacteria 1642
1165 Ga0495625_0000321 3300046660 Bacteria 72983
1166 Ga0495625_0000914 3300046660 Bacteria 39744
1167 Ga0495625_0003636 3300046660 Bacteria 15121
1168 Ga0495625_0042735 3300046660 Bacteria 3290
1169 Ga0495625_0043217 3300046660 Bacteria 3269
1170 Ga0495625_0071562 3300046660 Bacteria 2434
1171 Ga0495625_0119010 3300046660 Bacteria 1799
1172 Ga0495625_0226451 3300046660 Bacteria 1223
1173 Ga0495661_0072319 3300046665 Bacteria 2012
1174 Ga0495661_0194740 3300046665 Bacteria 1065
1175 Ga0495623_0070991 3300046679 Bacteria 2168
1176 Ga0495669_0002087 3300046684 Bacteria 8185
1177 Ga0495669_0009712 3300046684 Bacteria 4060
1178 Ga0495669_0014347 3300046684 Bacteria 3387
1179 Ga0495669_0062574 3300046684 Bacteria 1686
1180 Ga0495671_0000017 3300046692 Bacteria 293465
1181 Ga0495671_0000020 3300046692 Bacteria 268306
1182 Ga0495671_0005841 3300046692 Bacteria 7166
1183 Ga0495671_0006324 3300046692 Bacteria 6852
1184 Ga0495671_0022403 3300046692 Bacteria 3312
1185 Ga0495649_0031039 3300046694 Bacteria 2948
1186 Ga0495649_0038474 3300046694 Bacteria 2624
1187 Ga0495600_0001554 3300046809 Bacteria 12763
1188 Ga0495660_0047286 3300046810 Bacteria 2357
1189 Ga0495660_0087149 3300046810 Bacteria 1629
1190 Ga0495672_0117903 3300047320 Bacteria 1416
1191 Ga0495683_0006805 3300047323 Bacteria 6213
1192 Ga0495687_000250 3300047443 Bacteria 72797
1193 Ga0495687_000614 3300047443 Bacteria 41339
1194 Ga0495677_0001865 3300047445 Bacteria 8422
1195 Ga0495673_0000076 3300047469 Bacteria 205985
1196 Ga0495673_0020724 3300047469 Bacteria 3265
1197 Ga0495673_0030495 3300047469 Bacteria 2532
1198 Ga0495673_0034699 3300047469 Bacteria 2331
1199 Ga0495673_0041073 3300047469 Bacteria 2085
1200 Ga0495681_0000099 3300047470 Bacteria 75808
1201 Ga0495681_0000517 3300047470 Bacteria 29470
1202 Ga0495681_0032888 3300047470 Bacteria 2604
1203 Ga0495686_0000262 3300047472 Bacteria 94462
1204 Ga0495686_0000273 3300047472 Bacteria 91936
1205 Ga0495686_0000669 3300047472 Bacteria 46516
1206 Ga0495686_0000680 3300047472 Bacteria 46007
1207 Ga0495686_0103361 3300047472 Bacteria 1716
1208 Ga0495686_0154042 3300047472 Bacteria 1347
1209 Ga0495686_0201852 3300047472 Bacteria 1141
1210 Ga0495602_0046500 3300048088 Bacteria 3920
1211 Ga0495615_0000135 3300048090 Bacteria 18517
1212 Ga0495626_0000139 3300048091 Bacteria 92719
1213 Ga0496100_0427862 3300048903 Bacteria 1012
1214 Ga0496101_0353643 3300048904 Bacteria 1155
1215 Ga0496102_0001391 3300048905 Bacteria 21494
1216 Ga0496102_0009613 3300048905 Bacteria 8316
1217 Ga0496102_0030551 3300048905 Bacteria 4823
1218 Ga0496102_0517366 3300048905 Bacteria 1116
1219 Ga0496102_0557811 3300048905 Bacteria 1068
1220 Ga0496102_0851955 3300048905 Bacteria 834
1221 Ga0496103_0000055 3300048906 Bacteria 143870
1222 Ga0496103_0007593 3300048906 Bacteria 6455
1223 Ga0496103_0041420 3300048906 Bacteria 2831
1224 Ga0496103_0477353 3300048906 Bacteria 799
1225 Ga0496104_0026298 3300048907 Bacteria 5371
1226 Ga0496104_1127604 3300048907 Bacteria 688
1227 Ga0496104_1166181 3300048907 Bacteria 674
1228 Ga0496105_0000358 3300048908 Bacteria 30167
1229 Ga0496105_0740658 3300048908 Bacteria 751
1230 Ga0496106_0019385 3300048909 Bacteria 5045
1231 Ga0496107_0020666 3300048910 Bacteria 4651
1232 Ga0496108_0054733 3300048911 Bacteria 3348
1233 Ga0496108_0296198 3300048911 Bacteria 1409
1234 Ga0496109_0022187 3300048912 Bacteria 5620
1235 Ga0496109_0098706 3300048912 Bacteria 2708
1236 Ga0496109_0215343 3300048912 Bacteria 1806
1237 Ga0496109_0284074 3300048912 Bacteria 1560
1238 Ga0496110_0009627 3300048913 Bacteria 7823
1239 Ga0496110_0026654 3300048913 Bacteria 4948
1240 Ga0496110_0062006 3300048913 Bacteria 3302
1241 Ga0496111_0021635 3300048914 Bacteria 4495
1242 Ga0496111_0103898 3300048914 Bacteria 2090
1243 Ga0496112_0041602 3300048915 Bacteria 4496
1244 Ga0496112_0274805 3300048915 Bacteria 1632
1245 Ga0496113_0009411 3300048916 Bacteria 6407
1246 Ga0496113_0103450 3300048916 Bacteria 2209
1247 Ga0496113_0145461 3300048916 Bacteria 1867
1248 Ga0496113_1273601 3300048916 Bacteria 572
1249 Ga0496114_0000016 3300048917 Bacteria 274656
1250 Ga0496114_0010092 3300048917 Bacteria 7512
1251 Ga0496114_0118522 3300048917 Bacteria 2274
1252 Ga0496115_0000267 3300048918 Bacteria 46248
1253 Ga0496116_0000045 3300048919 Bacteria 324307
1254 Ga0496116_0023536 3300048919 Bacteria 4585
1255 Ga0496116_0028810 3300048919 Bacteria 4016
1256 Ga0496116_0064603 3300048919 Bacteria 2352
1257 Ga0496117_0000549 3300048920 Bacteria 61657
1258 Ga0496117_0002463 3300048920 Bacteria 23295
1259 Ga0496117_0004882 3300048920 Bacteria 14459
1260 Ga0496117_0017345 3300048920 Bacteria 6016
1261 Ga0496117_0070619 3300048920 Bacteria 2344
1262 Ga0496117_0166788 3300048920 Bacteria 1283
1263 Ga0496117_0232443 3300048920 Bacteria 1018
1264 Ga0496118_0000552 3300048921 Bacteria 61677
1265 Ga0496118_0000811 3300048921 Bacteria 49879
1266 Ga0496118_0003823 3300048921 Bacteria 18542
1267 Ga0496118_0007786 3300048921 Bacteria 11249
1268 Ga0496118_0017208 3300048921 Bacteria 6592
1269 Ga0496118_0017950 3300048921 Bacteria 6414
1270 Ga0496118_0034239 3300048921 Bacteria 4149
1271 Ga0496118_0347199 3300048921 Bacteria 792
1272 Ga0496119_0031108 3300048922 Bacteria 3586
1273 Ga0496119_0077162 3300048922 Bacteria 1931
1274 Ga0496119_0089316 3300048922 Bacteria 1755
1275 Ga0496119_0248753 3300048922 Bacteria 897
1276 Ga0496120_0013820 3300048923 Bacteria 5411
1277 Ga0496120_0151706 3300048923 Bacteria 1164
1278 Ga0496121_0000652 3300048924 Bacteria 64960
1279 Ga0496121_0000930 3300048924 Bacteria 52952
1280 Ga0496121_0001191 3300048924 Bacteria 45526
1281 Ga0496121_0003000 3300048924 Bacteria 24522
1282 Ga0496121_0005432 3300048924 Bacteria 16336
1283 Ga0496121_0024091 3300048924 Bacteria 5832
1284 Ga0496121_0031341 3300048924 Bacteria 4859
1285 Ga0496121_0031916 3300048924 Bacteria 4802
1286 Ga0496121_0068404 3300048924 Bacteria 2873
1287 Ga0496121_0078566 3300048924 Bacteria 2623
1288 Ga0496121_0192677 3300048924 Bacteria 1460
1289 Ga0496122_0003938 3300048925 Bacteria 18968
1290 Ga0496122_0005345 3300048925 Bacteria 15345
1291 Ga0496122_0011792 3300048925 Bacteria 8795
1292 Ga0496122_0017572 3300048925 Bacteria 6675
1293 Ga0496122_0036518 3300048925 Bacteria 3971
1294 Ga0496122_0081358 3300048925 Bacteria 2255
1295 Ga0496122_0147769 3300048925 Bacteria 1457
1296 Ga0496123_0001272 3300048926 Bacteria 36131
1297 Ga0496123_0001952 3300048926 Bacteria 26806
1298 Ga0496123_0011382 3300048926 Bacteria 7717
1299 Ga0496123_0011531 3300048926 Bacteria 7650
1300 Ga0496123_0037600 3300048926 Bacteria 3416
1301 Ga0496123_0067977 3300048926 Bacteria 2247
1302 Ga0496123_0079556 3300048926 Bacteria 2002
1303 Ga0496123_0106909 3300048926 Bacteria 1611
1304 Ga0496123_0233381 3300048926 Bacteria 919
1305 Ga0496124_0000585 3300048927 Bacteria 61469
1306 Ga0496124_0003632 3300048927 Bacteria 18723
1307 Ga0496124_0008726 3300048927 Bacteria 10530
1308 Ga0496124_0013710 3300048927 Bacteria 7893
1309 Ga0496124_0019318 3300048927 Bacteria 6345
1310 Ga0496124_0026758 3300048927 Bacteria 5195
1311 Ga0496124_0030502 3300048927 Bacteria 4785
1312 Ga0496124_0099254 3300048927 Bacteria 2362
1313 Ga0496124_0132861 3300048927 Bacteria 1975
1314 Ga0496124_0134357 3300048927 Bacteria 1961
1315 Ga0496124_0166346 3300048927 Bacteria 1713
1316 Ga0496125_0001142 3300048928 Bacteria 40357
1317 Ga0496125_0010180 3300048928 Bacteria 9531
1318 Ga0496125_0010701 3300048928 Bacteria 9252
1319 Ga0496125_0032339 3300048928 Bacteria 4648
1320 Ga0496125_0035059 3300048928 Bacteria 4410
1321 Ga0496125_0036806 3300048928 Bacteria 4265
1322 Ga0496125_0041123 3300048928 Bacteria 3956
1323 Ga0496125_0042756 3300048928 Bacteria 3854
1324 Ga0496125_0059204 3300048928 Bacteria 3088
1325 Ga0496125_0085882 3300048928 Bacteria 2382
1326 Ga0496125_0099292 3300048928 Bacteria 2151
1327 Ga0496125_0107311 3300048928 Bacteria 2035
1328 Ga0496125_0155799 3300048928 Bacteria 1561
1329 Ga0496126_0000519 3300048929 Bacteria 74968
1330 Ga0496126_0001094 3300048929 Bacteria 45520
1331 Ga0496126_0004852 3300048929 Bacteria 15748
1332 Ga0496126_0014259 3300048929 Bacteria 8041
1333 Ga0496126_0064441 3300048929 Bacteria 3283
1334 Ga0496126_0093822 3300048929 Bacteria 2635
1335 Ga0496126_0271213 3300048929 Bacteria 1408
1336 Ga0496126_0501897 3300048929 Bacteria 969
1337 Ga0496126_0536572 3300048929 Bacteria 930
1338 Ga0495678_201105 3300049459 Bacteria 614
1339 Ga0501335_005898 3300049551 Bacteria 1104
1340 Ga0501032_0019920 3300049569 Bacteria 4682
1341 Ga0501032_0022006 3300049569 Bacteria 4426
1342 Ga0501033_0058368 3300049570 Bacteria 2850
1343 Ga0501033_0127471 3300049570 Bacteria 1845
1344 Ga0501034_0108545 3300049571 Bacteria 2766
1345 Ga0501034_0880013 3300049571 Bacteria 785
1346 Ga0501036_0189107 3300049572 Bacteria 1732
1347 Ga0501036_0718870 3300049572 Bacteria 825
1348 Ga0501037_0046165 3300049573 Bacteria 3195
1349 Ga0501038_0253946 3300049574 Bacteria 1392
1350 Ga0501039_0717338 3300049575 Bacteria 781
1351 Ga0501043_0007449 3300049579 Bacteria 8691
1352 Ga0501043_0011321 3300049579 Bacteria 6982
1353 Ga0501043_0059629 3300049579 Bacteria 2995
1354 Ga0501043_0813160 3300049579 Bacteria 675
1355 Ga0501046_0030557 3300049580 Bacteria 4371
1356 Ga0501046_0269958 3300049580 Bacteria 1248
1357 Ga0501047_0000795 3300049581 Bacteria 32971
1358 Ga0501047_0277926 3300049581 Bacteria 1519
1359 Ga0501047_0472231 3300049581 Bacteria 1082
1360 Ga0501047_0701199 3300049581 Bacteria 830
1361 Ga0501048_0086339 3300049582 Bacteria 2213
1362 Ga0501067_0016919 3300049583 Bacteria 4029
1363 Ga0501067_0060171 3300049583 Bacteria 2102
1364 Ga0501070_0297898 3300049586 Bacteria 1314
1365 Ga0501208_042684 3300049655 Bacteria 843
1366 Ga0501223_000092 3300049663 Bacteria 26431
1367 Ga0501224_010003 3300049664 Bacteria 1389
1368 Ga0501235_014004 3300049669 Bacteria 1767
1369 Ga0501235_034142 3300049669 Bacteria 1154
1370 Ga0501249_001325 3300049679 Bacteria 5149
1371 Ga0501257_087543 3300049686 Bacteria 808
1372 Ga0501225_0009956 3300049705 Bacteria 2699
1373 Ga0501225_0118260 3300049705 Bacteria 786
1374 Ga0501245_127857 3300049708 Bacteria 542
1375 Ga0501267_012879 3300049764 Bacteria 866
1376 Ga0501035_0289634 3300049822 Bacteria 1382
1377 Ga0501044_0013098 3300049823 Bacteria 8977
1378 Ga0501044_0035147 3300049823 Bacteria 5250
1379 Ga0501044_0044292 3300049823 Bacteria 4618
1380 Ga0501044_0376795 3300049823 Bacteria 1335
1381 Ga0501044_0401751 3300049823 Bacteria 1283
1382 Ga0501044_0582299 3300049823 Bacteria 1013
1383 nmdc:mga03683_126171_c1 3300050489 Bacteria 1142
1384 nmdc:mga03683_276_c1 3300050489 Bacteria 15419
1385 nmdc:mga03n38_89329_c1 3300050490 Bacteria 1464
1386 nmdc:mga00v17_68256_c1 3300050491 Bacteria 2198
1387 nmdc:mga00v17_81142_c1 3300050491 Bacteria 2025
1388 nmdc:mga0k408_63396_c1 3300050493 Bacteria 2150
1389 nmdc:mga06z11_134_c1 3300050494 Bacteria 29598
1390 nmdc:mga06z11_85_c1 3300050494 Bacteria 39933
1391 nmdc:mga07m45_12_c1 3300050496 Bacteria 158130
1392 nmdc:mga05p37_324492_c1 3300050507 Bacteria 1821
1393 nmdc:mga0n895_1010399_c1 3300050512 Bacteria 812
1394 nmdc:mga0n895_1523631_c1 3300050512 Bacteria 634
1395 nmdc:mga0rr50_135562_c1 3300050513 Bacteria 1975
1396 nmdc:mga0rr50_141418_c1 3300050513 Bacteria 1936
1397 nmdc:mga0sz30_10812_c2 3300050516 Bacteria 1345
1398 nmdc:mga0sz30_11490_c1 3300050516 Bacteria 3420
1399 Ga0500610_0000092 3300053079 Bacteria 27411
1400 Ga0500643_000001 3300053087 Bacteria 1440111
1401 Ga0500643_001742 3300053087 Bacteria 12055
1402 Ga0500643_004433 3300053087 Bacteria 6350
1403 Ga0500643_006129 3300053087 Bacteria 5074
1404 Ga0500647_0042393 3300053091 Bacteria 2185
1405 Ga0500651_0009774 3300053093 Bacteria 5721
1406 Ga0500566_0005455 3300053094 Bacteria 7567
1407 Ga0500562_003322 3300053108 Bacteria 4023
1408 Ga0500592_005424 3300053116 Bacteria 2032
1409 Ga0500592_019794 3300053116 Bacteria 1082
1410 Ga0500594_0009825 3300053118 Bacteria 2210
1411 Ga0500595_007737 3300053119 Bacteria 4442
1412 Ga0500607_001489 3300053121 Bacteria 21049
1413 Ga0500642_0000187 3300053130 Bacteria 25531
1414 Ga0500642_0002784 3300053130 Bacteria 5187
1415 Ga0500655_000107 3300053133 Bacteria 21512
1416 Ga0500658_0034924 3300053134 Bacteria 1988
1417 Ga0500559_0022339 3300053136 Bacteria 2683
1418 Ga0500559_0046716 3300053136 Bacteria 1899
1419 Ga0500564_027808 3300053138 Bacteria 2603
1420 Ga0500568_0003230 3300053139 Bacteria 9223
1421 Ga0500573_0000065 3300053140 Bacteria 64628
1422 Ga0500616_0002096 3300053153 Bacteria 17390
1423 Ga0500616_0051227 3300053153 Bacteria 2176
1424 Ga0500619_024218 3300053154 Bacteria 1783
1425 Ga0500622_0003412 3300053156 Bacteria 10669
1426 Ga0500624_000002 3300053157 Bacteria 257900
1427 Ga0500627_0000089 3300053158 Bacteria 30989
1428 Ga0500636_0005106 3300053177 Bacteria 7457
1429 Ga0500567_002040 3300053723 Bacteria 8449
1430 Ga0500570_000192 3300053724 Bacteria 19388
1431 Ga0500625_000026 3300053729 Bacteria 60801
1432 Ga0500645_000024 3300053730 Bacteria 126024
1433 Ga0500596_000659 3300053735 Bacteria 6672
1434 Ga0466962_0013450 3300061719 Bacteria 3940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027252 Ga0209973_1085743 Ga0209973_10857431 135
2 3300002067 JGI24735J21928_10192644 JGI24735J21928_101926441 136
3 3300048903 Ga0496100_0427862 Ga0496100_0427862_462_977 144
4 3300048907 Ga0496104_1166181 Ga0496104_1166181_51_566 144
5 3300005841 Ga0068863_100193604 Ga0068863_1001936042 145
6 3300009101 Ga0105247_10057877 Ga0105247_100578772 145
7 3300009177 Ga0105248_10024368 Ga0105248_100243687 145
8 3300013297 Ga0157378_11306933 Ga0157378_113069332 145
9 3300026088 Ga0207641_10001790 Ga0207641_1000179015 145
10 3300048922 Ga0496119_0248753 Ga0496119_0248753_152_802 145
11 3300048924 Ga0496121_0031341 Ga0496121_0031341_840_1490 145
12 3300037312 Ga0395899_0053580 Ga0395899_0053580_2455_2970 147
13 3300005616 Ga0068852_100647544 Ga0068852_1006475442 148
14 3300042157 Ga0439458_0000616 Ga0439458_0000616_7250_7882 148
15 3300042461 Ga0439460_0265782 Ga0439460_0265782_51_566 148
16 3300001990 JGI24737J22298_10042356 JGI24737J22298_100423562 149
17 3300005339 Ga0070660_100016075 Ga0070660_1000160754 149
18 3300005345 Ga0070692_10268070 Ga0070692_102680702 149
19 3300005366 Ga0070659_100017756 Ga0070659_1000177565 149
20 3300005444 Ga0070694_100086015 Ga0070694_1000860152 149
21 3300005457 Ga0070662_100001565 Ga0070662_1000015654 149
22 3300005545 Ga0070695_100100790 Ga0070695_1001007902 149
23 3300005563 Ga0068855_100032731 Ga0068855_1000327317 149
24 3300005842 Ga0068858_100665973 Ga0068858_1006659732 149
25 3300005843 Ga0068860_100027199 Ga0068860_1000271995 149
26 3300009093 Ga0105240_10243049 Ga0105240_102430493 149
27 3300009553 Ga0105249_10096719 Ga0105249_100967193 149
28 3300010375 Ga0105239_10102466 Ga0105239_101024662 149
29 3300013306 Ga0163162_10335390 Ga0163162_103353902 149
30 3300025904 Ga0207647_10000850 Ga0207647_100008506 149
31 3300025919 Ga0207657_10003875 Ga0207657_100038752 149
32 3300025932 Ga0207690_10022521 Ga0207690_100225212 149
33 3300025933 Ga0207706_10032833 Ga0207706_100328336 149
34 3300025938 Ga0207704_10164991 Ga0207704_101649912 149
35 3300025961 Ga0207712_10009916 Ga0207712_100099162 149
36 3300026041 Ga0207639_10372545 Ga0207639_103725452 149
37 3300028380 Ga0268265_10167444 Ga0268265_101674443 149
38 3300028381 Ga0268264_10000268 Ga0268264_100002683 149
39 3300035091 Ga0373951_0046907 Ga0373951_0046907_218_850 149
40 3300050513 nmdc:mga0rr50_141418_c1 nmdc:mga0rr50_141418_c1_125_757 149
41 3300009978 Ga0105148_117869 Ga0105148_1178691 150
42 3300037418 Ga0395900_0120079 Ga0395900_0120079_1841_2473 150
43 3300037418 Ga0395900_0335785 Ga0395900_0335785_74_706 150
44 3300037466 Ga0395898_0054496 Ga0395898_0054496_681_1313 150
45 3300037471 Ga0395905_0030632 Ga0395905_0030632_3773_4405 150
46 3300038443 Ga0395901_0041174 Ga0395901_0041174_2216_2848 150
47 3300027665 Ga0209983_1013449 Ga0209983_10134492 151
48 3300027682 Ga0209971_1038769 Ga0209971_10387692 151
49 3300027876 Ga0209974_10003536 Ga0209974_100035367 151
50 3300031548 Ga0307408_100013781 Ga0307408_1000137813 151
51 3300031824 Ga0307413_10017328 Ga0307413_100173284 151
52 3300031852 Ga0307410_10045244 Ga0307410_100452442 151
53 3300031901 Ga0307406_10049849 Ga0307406_100498492 151
54 3300032004 Ga0307414_10049760 Ga0307414_100497604 151
55 3300032005 Ga0307411_10028900 Ga0307411_100289002 151
56 3300032126 Ga0307415_100009294 Ga0307415_1000092948 151
57 3300042007 Ga0439449_0061824 Ga0439449_0061824_460_1092 151
58 3300046522 Ga0495643_0406652 Ga0495643_0406652_29_544 151
59 3300053121 Ga0500607_001489 Ga0500607_001489_10035_10655 151
60 3300005347 Ga0070668_100018871 Ga0070668_1000188712 152
61 3300005843 Ga0068860_100096161 Ga0068860_1000961612 152
62 3300025315 Ga0207697_10047244 Ga0207697_100472442 152
63 3300025972 Ga0207668_10024423 Ga0207668_100244235 152
64 3300028381 Ga0268264_10001327 Ga0268264_100013272 152
65 3300048929 Ga0496126_0501897 Ga0496126_0501897_221_871 152
66 3300049708 Ga0501245_127857 Ga0501245_127857_11_496 152
67 3300032004 Ga0307414_10292136 Ga0307414_102921362 153
68 3300037312 Ga0395899_0134149 Ga0395899_0134149_837_1469 153
69 3300037471 Ga0395905_0292187 Ga0395905_0292187_323_955 153
70 3300031548 Ga0307408_100004452 Ga0307408_1000044528 154
71 3300031731 Ga0307405_10002843 Ga0307405_100028432 154
72 3300031824 Ga0307413_10002654 Ga0307413_100026549 154
73 3300031852 Ga0307410_10243550 Ga0307410_102435501 154
74 3300031903 Ga0307407_10001660 Ga0307407_1000166012 154
75 3300031911 Ga0307412_10003000 Ga0307412_100030006 154
76 3300031995 Ga0307409_100042286 Ga0307409_1000422864 154
77 3300032002 Ga0307416_100024603 Ga0307416_1000246035 154
78 3300032004 Ga0307414_10004382 Ga0307414_100043824 154
79 3300032005 Ga0307411_10311678 Ga0307411_103116781 154
80 3300032126 Ga0307415_100321955 Ga0307415_1003219552 154
81 3300031824 Ga0307413_10023177 Ga0307413_100231773 155
82 3300046507 Ga0495606_0010737 Ga0495606_0010737_4178_4891 155
83 3300047472 Ga0495686_0000680 Ga0495686_0000680_15124_15837 155
84 3300049459 Ga0495678_201105 Ga0495678_201105_15_515 155
85 3300049551 Ga0501335_005898 Ga0501335_005898_37_537 155
86 3300049705 Ga0501225_0118260 Ga0501225_0118260_255_755 155
87 3300005295 Ga0065707_10081811 Ga0065707_1008181138 156
88 3300005455 Ga0070663_100236458 Ga0070663_1002364582 156
89 3300005578 Ga0068854_100252199 Ga0068854_1002521992 156
90 3300014326 Ga0157380_10000315 Ga0157380_1000031534 156
91 3300015690 Ga0183363_1003 Ga0183363_1003220 156
92 3300025901 Ga0207688_10198933 Ga0207688_101989331 156
93 3300025907 Ga0207645_10208853 Ga0207645_102088532 156
94 3300031852 Ga0307410_10746693 Ga0307410_107466931 156
95 3300031995 Ga0307409_100375613 Ga0307409_1003756133 156
96 3300044684 Ga0466966_0229375 Ga0466966_0229375_430_1062 156
97 3300044693 Ga0466961_0017645 Ga0466961_0017645_1304_1936 156
98 3300045049 Ga0466959_0160252 Ga0466959_0160252_472_1104 156
99 3300049574 Ga0501038_0253946 Ga0501038_0253946_16_624 156
100 3300050489 nmdc:mga03683_126171_c1 nmdc:mga03683_126171_c1_22_525 156
101 3300002067 JGI24735J21928_10026692 JGI24735J21928_100266923 157
102 3300005327 Ga0070658_10007308 Ga0070658_100073084 157
103 3300005339 Ga0070660_100347733 Ga0070660_1003477331 157
104 3300005563 Ga0068855_100095837 Ga0068855_1000958372 157
105 3300005616 Ga0068852_100058362 Ga0068852_1000583623 157
106 3300009551 Ga0105238_11607096 Ga0105238_116070962 157
107 3300025904 Ga0207647_10085879 Ga0207647_100858793 157
108 3300025909 Ga0207705_10028048 Ga0207705_100280483 157
109 3300025919 Ga0207657_10027473 Ga0207657_100274732 157
110 3300025949 Ga0207667_10017260 Ga0207667_1001726010 157
111 3300025949 Ga0207667_10028549 Ga0207667_100285493 157
112 3300026142 Ga0207698_10080661 Ga0207698_100806612 157
113 3300037471 Ga0395905_0370430 Ga0395905_0370430_544_1179 157
114 3300046491 Ga0495584_0483584 Ga0495584_0483584_16_525 157
115 3300048904 Ga0496101_0353643 Ga0496101_0353643_76_591 157
116 3300048916 Ga0496113_1273601 Ga0496113_1273601_10_522 157
117 3300048920 Ga0496117_0232443 Ga0496117_0232443_83_721 157
118 3300049583 Ga0501067_0016919 Ga0501067_0016919_3483_3998 157
119 3300053091 Ga0500647_0042393 Ga0500647_0042393_774_1406 157
120 3300053136 Ga0500559_0022339 Ga0500559_0022339_1485_2117 157
121 3300053729 Ga0500625_000026 Ga0500625_000026_2439_3071 157
122 3300032004 Ga0307414_10323515 Ga0307414_103235152 158
123 3300032005 Ga0307411_10220221 Ga0307411_102202211 158
124 3300037312 Ga0395899_0044714 Ga0395899_0044714_555_1187 158
125 3300037418 Ga0395900_0027388 Ga0395900_0027388_2862_3494 158
126 3300037466 Ga0395898_0085987 Ga0395898_0085987_1763_2395 158
127 3300037471 Ga0395905_0047368 Ga0395905_0047368_2960_3592 158
128 3300053134 Ga0500658_0034924 Ga0500658_0034924_242_883 158
129 3300005327 Ga0070658_10003723 Ga0070658_1000372311 159
130 3300005338 Ga0068868_100058542 Ga0068868_1000585422 159
131 3300005347 Ga0070668_100033002 Ga0070668_1000330022 159
132 3300005353 Ga0070669_100133445 Ga0070669_1001334452 159
133 3300005366 Ga0070659_100039493 Ga0070659_1000394932 159
134 3300005366 Ga0070659_100448781 Ga0070659_1004487812 159
135 3300005457 Ga0070662_100165319 Ga0070662_1001653192 159
136 3300005457 Ga0070662_100827040 Ga0070662_1008270401 159
137 3300005543 Ga0070672_100224484 Ga0070672_1002244842 159
138 3300005842 Ga0068858_100043159 Ga0068858_1000431592 159
139 3300005843 Ga0068860_100166266 Ga0068860_1001662662 159
140 3300009098 Ga0105245_10013224 Ga0105245_100132247 159
141 3300009176 Ga0105242_10188683 Ga0105242_101886832 159
142 3300011119 Ga0105246_10080366 Ga0105246_100803663 159
143 3300013102 Ga0157371_10167994 Ga0157371_101679942 159
144 3300013102 Ga0157371_10203577 Ga0157371_102035772 159
145 3300013308 Ga0157375_10027717 Ga0157375_100277177 159
146 3300014745 Ga0157377_10271498 Ga0157377_102714982 159
147 3300025315 Ga0207697_10077367 Ga0207697_100773672 159
148 3300025909 Ga0207705_10000042 Ga0207705_1000004290 159
149 3300025919 Ga0207657_10164063 Ga0207657_101640633 159
150 3300025923 Ga0207681_10254450 Ga0207681_102544502 159
151 3300025927 Ga0207687_10059042 Ga0207687_100590423 159
152 3300025932 Ga0207690_10390236 Ga0207690_103902362 159
153 3300025932 Ga0207690_10645490 Ga0207690_106454902 159
154 3300025934 Ga0207686_10048837 Ga0207686_100488372 159
155 3300025940 Ga0207691_10010000 Ga0207691_100100003 159
156 3300025942 Ga0207689_10003854 Ga0207689_100038549 159
157 3300025972 Ga0207668_10136193 Ga0207668_101361932 159
158 3300026035 Ga0207703_10001218 Ga0207703_1000121822 159
159 3300026088 Ga0207641_10232662 Ga0207641_102326622 159
160 3300026088 Ga0207641_10331658 Ga0207641_103316582 159
161 3300026095 Ga0207676_10698306 Ga0207676_106983062 159
162 3300026116 Ga0207674_10372997 Ga0207674_103729972 159
163 3300028381 Ga0268264_10016760 Ga0268264_100167606 159
164 3300050512 nmdc:mga0n895_1010399_c1 nmdc:mga0n895_1010399_c1_56_688 159
165 3300050513 nmdc:mga0rr50_135562_c1 nmdc:mga0rr50_135562_c1_854_1486 159
166 3300005293 Ga0065715_10007711 Ga0065715_100077115 160
167 3300005336 Ga0070680_100000177 Ga0070680_10000017714 160
168 3300005339 Ga0070660_100024083 Ga0070660_1000240835 160
169 3300005344 Ga0070661_100000156 Ga0070661_10000015636 160
170 3300005345 Ga0070692_10033345 Ga0070692_100333452 160
171 3300005355 Ga0070671_100039002 Ga0070671_1000390022 160
172 3300005458 Ga0070681_10006366 Ga0070681_100063669 160
173 3300005530 Ga0070679_100000001 Ga0070679_100000001508 160
174 3300013306 Ga0163162_10363202 Ga0163162_103632022 160
175 3300025899 Ga0207642_10064108 Ga0207642_100641082 160
176 3300025912 Ga0207707_10047954 Ga0207707_100479544 160
177 3300025917 Ga0207660_10001102 Ga0207660_1000110215 160
178 3300025919 Ga0207657_10009556 Ga0207657_1000955611 160
179 3300025920 Ga0207649_10000027 Ga0207649_1000002712 160
180 3300025921 Ga0207652_10000003 Ga0207652_10000003105 160
181 3300046522 Ga0495643_0018146 Ga0495643_0018146_140_763 160
182 3300048929 Ga0496126_0093822 Ga0496126_0093822_78_713 160
183 3300005353 Ga0070669_100660071 Ga0070669_1006600712 161
184 3300005364 Ga0070673_100226433 Ga0070673_1002264332 161
185 3300005436 Ga0070713_100165627 Ga0070713_1001656272 161
186 3300005459 Ga0068867_100006572 Ga0068867_1000065727 161
187 3300005616 Ga0068852_100137652 Ga0068852_1001376522 161
188 3300005834 Ga0068851_10010180 Ga0068851_100101803 161
189 3300005844 Ga0068862_100749193 Ga0068862_1007491932 161
190 3300006028 Ga0070717_10004794 Ga0070717_100047946 161
191 3300006173 Ga0070716_100017029 Ga0070716_1000170295 161
192 3300009177 Ga0105248_10354956 Ga0105248_103549562 161
193 3300025321 Ga0207656_10001253 Ga0207656_100012533 161
194 3300025928 Ga0207700_10032777 Ga0207700_100327772 161
195 3300025929 Ga0207664_10149793 Ga0207664_101497932 161
196 3300025939 Ga0207665_10013175 Ga0207665_100131752 161
197 3300025949 Ga0207667_10064139 Ga0207667_100641393 161
198 3300025960 Ga0207651_10557147 Ga0207651_105571472 161
199 3300026089 Ga0207648_10008748 Ga0207648_1000874810 161
200 3300026142 Ga0207698_10034897 Ga0207698_100348972 161
201 3300028380 Ga0268265_10651549 Ga0268265_106515492 161
202 3300028381 Ga0268264_10565079 Ga0268264_105650792 161
203 3300031901 Ga0307406_10430414 Ga0307406_104304142 161
204 3300031911 Ga0307412_10504704 Ga0307412_105047042 161
205 3300032004 Ga0307414_10992884 Ga0307414_109928841 161
206 3300037312 Ga0395899_0036681 Ga0395899_0036681_1261_1893 161
207 3300037418 Ga0395900_0028928 Ga0395900_0028928_4936_5568 161
208 3300038443 Ga0395901_0048282 Ga0395901_0048282_538_1170 161
209 3300044706 Ga0466964_0023350 Ga0466964_0023350_700_1332 161
210 3300045976 Ga0466967_0083449 Ga0466967_0083449_1818_2450 161
211 3300046507 Ga0495606_0163301 Ga0495606_0163301_327_965 161
212 3300046512 Ga0495610_0151897 Ga0495610_0151897_80_718 161
213 3300005331 Ga0070670_100302451 Ga0070670_1003024512 162
214 3300005353 Ga0070669_100000470 Ga0070669_1000004708 162
215 3300005355 Ga0070671_100000845 Ga0070671_10000084515 162
216 3300005548 Ga0070665_100000079 Ga0070665_100000079102 162
217 3300005577 Ga0068857_100190219 Ga0068857_1001902192 162
218 3300005842 Ga0068858_100052186 Ga0068858_1000521863 162
219 3300006237 Ga0097621_100244043 Ga0097621_1002440431 162
220 3300006358 Ga0068871_100007505 Ga0068871_10000750510 162
221 3300009011 Ga0105251_10000232 Ga0105251_1000023242 162
222 3300009553 Ga0105249_11029498 Ga0105249_110294982 162
223 3300025254 Ga0209148_1002428 Ga0209148_10024285 162
224 3300025272 Ga0209455_1000707 Ga0209455_10007074 162
225 3300025735 Ga0207713_1001012 Ga0207713_100101215 162
226 3300025903 Ga0207680_10053944 Ga0207680_100539443 162
227 3300025923 Ga0207681_10005152 Ga0207681_100051523 162
228 3300025925 Ga0207650_10071175 Ga0207650_100711753 162
229 3300025931 Ga0207644_10063814 Ga0207644_100638143 162
230 3300025961 Ga0207712_10519690 Ga0207712_105196902 162
231 3300025981 Ga0207640_10848116 Ga0207640_108481161 162
232 3300028379 Ga0268266_10000175 Ga0268266_1000017556 162
233 3300028380 Ga0268265_10014248 Ga0268265_100142484 162
234 3300044693 Ga0466961_0039301 Ga0466961_0039301_1262_1897 162
235 3300044719 Ga0466971_0371524 Ga0466971_0371524_20_655 162
236 3300044765 Ga0466970_0116316 Ga0466970_0116316_23_658 162
237 3300045049 Ga0466959_0084865 Ga0466959_0084865_879_1514 162
238 3300045836 Ga0466958_0025024 Ga0466958_0025024_1398_2033 162
239 3300046525 Ga0495663_0021992 Ga0495663_0021992_412_1044 162
240 3300048906 Ga0496103_0041420 Ga0496103_0041420_1007_1657 162
241 3300048913 Ga0496110_0062006 Ga0496110_0062006_103_735 162
242 3300048919 Ga0496116_0064603 Ga0496116_0064603_1361_2011 162
243 3300048920 Ga0496117_0070619 Ga0496117_0070619_1181_1831 162
244 3300048924 Ga0496121_0031916 Ga0496121_0031916_2284_2904 162
245 3300048927 Ga0496124_0166346 Ga0496124_0166346_947_1597 162
246 3300048929 Ga0496126_0064441 Ga0496126_0064441_2038_2688 162
247 3300005344 Ga0070661_100726035 Ga0070661_1007260351 163
248 3300005548 Ga0070665_100003604 Ga0070665_1000036046 163
249 3300028379 Ga0268266_10001810 Ga0268266_100018108 163
250 3300031824 Ga0307413_10301424 Ga0307413_103014242 163
251 3300037312 Ga0395899_0162236 Ga0395899_0162236_571_1203 163
252 3300037418 Ga0395900_0164384 Ga0395900_0164384_307_939 163
253 3300044694 Ga0466963_0321751 Ga0466963_0321751_148_780 163
254 3300048927 Ga0496124_0132861 Ga0496124_0132861_163_858 163
255 3300005355 Ga0070671_100489394 Ga0070671_1004893941 164
256 3300009177 Ga0105248_10023944 Ga0105248_100239444 164
257 3300025931 Ga0207644_10026256 Ga0207644_100262562 164
258 3300025941 Ga0207711_10033796 Ga0207711_100337965 164
259 3300035170 Ga0373943_0005666 Ga0373943_0005666_4436_5068 164
260 3300035171 Ga0373946_0061644 Ga0373946_0061644_288_920 164
261 3300035725 Ga0373947_0022791 Ga0373947_0022791_360_992 164
262 3300048911 Ga0496108_0296198 Ga0496108_0296198_104_736 164
263 3300048912 Ga0496109_0098706 Ga0496109_0098706_1848_2480 164
264 3300048915 Ga0496112_0041602 Ga0496112_0041602_1591_2223 164
265 3300048917 Ga0496114_0000016 Ga0496114_0000016_194035_194667 164
266 3300048925 Ga0496122_0003938 Ga0496122_0003938_7667_8302 164
267 3300048926 Ga0496123_0001272 Ga0496123_0001272_1632_2267 164
268 3300005548 Ga0070665_100080538 Ga0070665_1000805382 165
269 3300025932 Ga0207690_10229078 Ga0207690_102290782 165
270 3300026116 Ga0207674_10155404 Ga0207674_101554042 165
271 3300026142 Ga0207698_10173871 Ga0207698_101738712 165
272 3300028379 Ga0268266_10258148 Ga0268266_102581482 165
273 3300041411 Ga0439466_0065068 Ga0439466_0065068_445_1008 165
274 3300048921 Ga0496118_0017950 Ga0496118_0017950_1337_1975 165
275 3300005328 Ga0070676_10001215 Ga0070676_1000121514 166
276 3300005339 Ga0070660_100009089 Ga0070660_1000090893 166
277 3300005618 Ga0068864_100034890 Ga0068864_1000348903 166
278 3300005842 Ga0068858_100000673 Ga0068858_10000067325 166
279 3300013306 Ga0163162_10015197 Ga0163162_100151978 166
280 3300017792 Ga0163161_10106148 Ga0163161_101061483 166
281 3300025315 Ga0207697_10035799 Ga0207697_100357992 166
282 3300025901 Ga0207688_10148226 Ga0207688_101482262 166
283 3300025907 Ga0207645_10000470 Ga0207645_1000047017 166
284 3300025923 Ga0207681_10002744 Ga0207681_100027449 166
285 3300025926 Ga0207659_10783826 Ga0207659_107838262 166
286 3300025933 Ga0207706_10327574 Ga0207706_103275742 166
287 3300025937 Ga0207669_10015833 Ga0207669_100158333 166
288 3300025938 Ga0207704_10183549 Ga0207704_101835492 166
289 3300025940 Ga0207691_10017215 Ga0207691_100172153 166
290 3300025942 Ga0207689_10156309 Ga0207689_101563092 166
291 3300025949 Ga0207667_11003548 Ga0207667_110035481 166
292 3300025960 Ga0207651_10099174 Ga0207651_100991742 166
293 3300025972 Ga0207668_10000050 Ga0207668_1000005048 166
294 3300025986 Ga0207658_10007072 Ga0207658_100070725 166
295 3300026035 Ga0207703_10000302 Ga0207703_1000030243 166
296 3300026089 Ga0207648_10059901 Ga0207648_100599012 166
297 3300026095 Ga0207676_10000344 Ga0207676_100003443 166
298 3300026118 Ga0207675_100440544 Ga0207675_1004405441 166
299 3300026121 Ga0207683_10015482 Ga0207683_100154826 166
300 3300028379 Ga0268266_10502646 Ga0268266_105026462 166
301 3300028380 Ga0268265_10080018 Ga0268265_100800183 166
302 3300028381 Ga0268264_10013849 Ga0268264_100138496 166
303 3300031548 Ga0307408_100499911 Ga0307408_1004999112 166
304 3300031911 Ga0307412_10673933 Ga0307412_106739332 166
305 3300032002 Ga0307416_100025294 Ga0307416_1000252942 166
306 3300032004 Ga0307414_10647308 Ga0307414_106473082 166
307 3300032126 Ga0307415_100288064 Ga0307415_1002880642 166
308 3300044765 Ga0466970_0492336 Ga0466970_0492336_32_667 166
309 3300045976 Ga0466967_0433627 Ga0466967_0433627_328_963 166
310 3300048912 Ga0496109_0284074 Ga0496109_0284074_21_653 166
311 3300049583 Ga0501067_0060171 Ga0501067_0060171_1028_1660 166
312 3300005367 Ga0070667_100265935 Ga0070667_1002659352 167
313 3300005548 Ga0070665_100034424 Ga0070665_1000344242 167
314 3300005616 Ga0068852_100001541 Ga0068852_10000154111 167
315 3300005617 Ga0068859_100310836 Ga0068859_1003108362 167
316 3300005618 Ga0068864_100104055 Ga0068864_1001040553 167
317 3300006931 Ga0097620_100310844 Ga0097620_1003108442 167
318 3300009553 Ga0105249_10433131 Ga0105249_104331311 167
319 3300014325 Ga0163163_10015984 Ga0163163_100159848 167
320 3300014326 Ga0157380_10000763 Ga0157380_1000076314 167
321 3300025909 Ga0207705_10000236 Ga0207705_1000023618 167
322 3300025919 Ga0207657_10000837 Ga0207657_1000083732 167
323 3300025932 Ga0207690_10934350 Ga0207690_109343501 167
324 3300025961 Ga0207712_10068412 Ga0207712_100684122 167
325 3300025986 Ga0207658_10019968 Ga0207658_100199684 167
326 3300026078 Ga0207702_10142238 Ga0207702_101422383 167
327 3300026088 Ga0207641_10306438 Ga0207641_103064382 167
328 3300026142 Ga0207698_10001072 Ga0207698_1000107211 167
329 3300028379 Ga0268266_10025965 Ga0268266_100259653 167
330 3300037471 Ga0395905_0133408 Ga0395905_0133408_886_1521 167
331 3300044658 Ga0466972_0001135 Ga0466972_0001135_3858_4493 167
332 3300044719 Ga0466971_0001276 Ga0466971_0001276_5699_6334 167
333 3300044735 Ga0466968_0043206 Ga0466968_0043206_891_1526 167
334 3300044842 Ga0466957_0008816 Ga0466957_0008816_196_831 167
335 3300044901 Ga0466960_0001716 Ga0466960_0001716_5244_5879 167
336 3300045836 Ga0466958_0010021 Ga0466958_0010021_302_937 167
337 3300045976 Ga0466967_0373387 Ga0466967_0373387_664_1299 167
338 3300061719 Ga0466962_0013450 Ga0466962_0013450_161_796 167
339 3300001990 JGI24737J22298_10004308 JGI24737J22298_100043085 168
340 3300005329 Ga0070683_100168475 Ga0070683_1001684752 168
341 3300025924 Ga0207694_10443780 Ga0207694_104437802 168
342 3300002067 JGI24735J21928_10002241 JGI24735J21928_100022415 169
343 3300005367 Ga0070667_100038587 Ga0070667_1000385872 169
344 3300005435 Ga0070714_100011330 Ga0070714_1000113306 169
345 3300005436 Ga0070713_100064528 Ga0070713_1000645284 169
346 3300025928 Ga0207700_10255321 Ga0207700_102553212 169
347 3300025929 Ga0207664_10509315 Ga0207664_105093152 169
348 3300048925 Ga0496122_0081358 Ga0496122_0081358_1102_1752 169
349 3300048928 Ga0496125_0010701 Ga0496125_0010701_7400_8050 169
350 3300001979 JGI24740J21852_10082943 JGI24740J21852_100829431 170
351 3300005327 Ga0070658_10003584 Ga0070658_100035846 170
352 3300005329 Ga0070683_100018052 Ga0070683_1000180522 170
353 3300005336 Ga0070680_100003469 Ga0070680_1000034695 170
354 3300005337 Ga0070682_100128504 Ga0070682_1001285043 170
355 3300005337 Ga0070682_101075427 Ga0070682_1010754271 170
356 3300005339 Ga0070660_100002934 Ga0070660_10000293414 170
357 3300005344 Ga0070661_100032184 Ga0070661_1000321843 170
358 3300005366 Ga0070659_100033034 Ga0070659_1000330344 170
359 3300005457 Ga0070662_100001324 Ga0070662_10000132415 170
360 3300005458 Ga0070681_10010175 Ga0070681_100101756 170
361 3300005535 Ga0070684_100559518 Ga0070684_1005595181 170
362 3300005539 Ga0068853_100003550 Ga0068853_1000035502 170
363 3300005547 Ga0070693_100036501 Ga0070693_1000365013 170
364 3300005563 Ga0068855_100007295 Ga0068855_10000729514 170
365 3300005564 Ga0070664_100025790 Ga0070664_1000257902 170
366 3300005578 Ga0068854_100026804 Ga0068854_1000268044 170
367 3300005614 Ga0068856_100005719 Ga0068856_10000571914 170
368 3300005834 Ga0068851_10090672 Ga0068851_100906723 170
369 3300006237 Ga0097621_100397715 Ga0097621_1003977152 170
370 3300009174 Ga0105241_10266923 Ga0105241_102669232 170
371 3300013100 Ga0157373_10006989 Ga0157373_1000698910 170
372 3300013100 Ga0157373_10029859 Ga0157373_100298592 170
373 3300013100 Ga0157373_10476278 Ga0157373_104762782 170
374 3300013102 Ga0157371_10001091 Ga0157371_1000109119 170
375 3300013102 Ga0157371_10235898 Ga0157371_102358982 170
376 3300013105 Ga0157369_10021625 Ga0157369_100216258 170
377 3300025909 Ga0207705_10009210 Ga0207705_1000921010 170
378 3300025909 Ga0207705_10093631 Ga0207705_100936313 170
379 3300025911 Ga0207654_10159335 Ga0207654_101593352 170
380 3300025912 Ga0207707_10006710 Ga0207707_1000671013 170
381 3300025919 Ga0207657_10000764 Ga0207657_1000076427 170
382 3300025919 Ga0207657_10005081 Ga0207657_1000508116 170
383 3300025920 Ga0207649_10005378 Ga0207649_100053788 170
384 3300025921 Ga0207652_10035093 Ga0207652_100350936 170
385 3300025932 Ga0207690_10001503 Ga0207690_100015035 170
386 3300025933 Ga0207706_10001361 Ga0207706_1000136115 170
387 3300025933 Ga0207706_10028567 Ga0207706_100285676 170
388 3300025944 Ga0207661_10019161 Ga0207661_100191616 170
389 3300025945 Ga0207679_10006441 Ga0207679_100064413 170
390 3300025945 Ga0207679_10062972 Ga0207679_100629722 170
391 3300025949 Ga0207667_10007578 Ga0207667_1000757814 170
392 3300025981 Ga0207640_10022324 Ga0207640_100223244 170
393 3300026041 Ga0207639_10001618 Ga0207639_100016183 170
394 3300026067 Ga0207678_10029423 Ga0207678_100294233 170
395 3300026078 Ga0207702_10004354 Ga0207702_1000435413 170
396 3300026116 Ga0207674_10006823 Ga0207674_100068238 170
397 3300048917 Ga0496114_0118522 Ga0496114_0118522_825_1457 170
398 3300050512 nmdc:mga0n895_1523631_c1 nmdc:mga0n895_1523631_c1_12_620 170
399 2162886007 SwRhRL2b_contig_67628 SwRhRL2b_0090.00001060 171
400 3300001976 JGI24752J21851_1001492 JGI24752J21851_10014923 171
401 3300002076 JGI24749J21850_1000069 JGI24749J21850_10000697 171
402 3300002459 JGI24751J29686_10000391 JGI24751J29686_1000039116 171
403 3300005289 Ga0065704_10127076 Ga0065704_101270762 171
404 3300005289 Ga0065704_10173616 Ga0065704_101736162 171
405 3300005295 Ga0065707_10260882 Ga0065707_102608822 171
406 3300005331 Ga0070670_100000027 Ga0070670_10000002796 171
407 3300005331 Ga0070670_100000047 Ga0070670_100000047111 171
408 3300005347 Ga0070668_100089092 Ga0070668_1000890923 171
409 3300005353 Ga0070669_100000072 Ga0070669_10000007279 171
410 3300005367 Ga0070667_100000725 Ga0070667_10000072514 171
411 3300005617 Ga0068859_100008247 Ga0068859_1000082472 171
412 3300005618 Ga0068864_100000051 Ga0068864_100000051111 171
413 3300005618 Ga0068864_100000100 Ga0068864_1000001005 171
414 3300005719 Ga0068861_100038439 Ga0068861_1000384392 171
415 3300005841 Ga0068863_100000025 Ga0068863_100000025115 171
416 3300005844 Ga0068862_100000027 Ga0068862_10000002799 171
417 3300005844 Ga0068862_100000036 Ga0068862_100000036150 171
418 3300006931 Ga0097620_100008247 Ga0097620_10000824710 171
419 3300006931 Ga0097620_100024043 Ga0097620_1000240433 171
420 3300009011 Ga0105251_10000554 Ga0105251_1000055414 171
421 3300009177 Ga0105248_10001385 Ga0105248_1000138514 171
422 3300009553 Ga0105249_10000110 Ga0105249_10000110106 171
423 3300014968 Ga0157379_10702359 Ga0157379_107023592 171
424 3300025735 Ga0207713_1000615 Ga0207713_100061514 171
425 3300025923 Ga0207681_10000061 Ga0207681_1000006115 171
426 3300025925 Ga0207650_10000056 Ga0207650_1000005660 171
427 3300025925 Ga0207650_10000645 Ga0207650_1000064514 171
428 3300025941 Ga0207711_10000254 Ga0207711_1000025454 171
429 3300025961 Ga0207712_10001154 Ga0207712_1000115413 171
430 3300025972 Ga0207668_10036914 Ga0207668_100369143 171
431 3300025972 Ga0207668_10100343 Ga0207668_101003432 171
432 3300025986 Ga0207658_10001229 Ga0207658_100012299 171
433 3300026088 Ga0207641_10000018 Ga0207641_10000018202 171
434 3300026095 Ga0207676_10000021 Ga0207676_1000002116 171
435 3300026095 Ga0207676_10000027 Ga0207676_10000027147 171
436 3300026118 Ga0207675_100001147 Ga0207675_10000114714 171
437 3300028380 Ga0268265_10000042 Ga0268265_1000004289 171
438 3300028380 Ga0268265_10000052 Ga0268265_10000052143 171
439 3300048905 Ga0496102_0517366 Ga0496102_0517366_254_874 171
440 3300048906 Ga0496103_0007593 Ga0496103_0007593_3005_3625 171
441 3300048920 Ga0496117_0002463 Ga0496117_0002463_1241_1861 171
442 3300048920 Ga0496117_0004882 Ga0496117_0004882_5613_6197 171
443 3300048921 Ga0496118_0003823 Ga0496118_0003823_6829_7449 171
444 3300048921 Ga0496118_0034239 Ga0496118_0034239_1600_2184 171
445 3300049579 Ga0501043_0011321 Ga0501043_0011321_2280_2906 171
446 3300049581 Ga0501047_0277926 Ga0501047_0277926_846_1472 171
447 3300049823 Ga0501044_0035147 Ga0501044_0035147_1271_1897 171
448 3300009148 Ga0105243_10745781 Ga0105243_107457812 172
449 3300031903 Ga0307407_10064069 Ga0307407_100640692 172
450 3300044658 Ga0466972_0040609 Ga0466972_0040609_529_1161 172
451 3300046507 Ga0495606_0000178 Ga0495606_0000178_83956_84582 172
452 3300046522 Ga0495643_0045444 Ga0495643_0045444_1133_1759 172
453 3300048922 Ga0496119_0089316 Ga0496119_0089316_920_1555 172
454 3300048928 Ga0496125_0042756 Ga0496125_0042756_1661_2296 172
455 3300053087 Ga0500643_001742 Ga0500643_001742_10422_11042 172
456 3300005347 Ga0070668_100114109 Ga0070668_1001141093 173
457 3300005353 Ga0070669_100147500 Ga0070669_1001475002 173
458 3300005364 Ga0070673_100031597 Ga0070673_1000315975 173
459 3300005543 Ga0070672_100643002 Ga0070672_1006430021 173
460 3300006042 Ga0075368_10000304 Ga0075368_100003042 173
461 3300006048 Ga0075363_100093715 Ga0075363_1000937152 173
462 3300006177 Ga0075362_10001064 Ga0075362_100010646 173
463 3300006178 Ga0075367_10022925 Ga0075367_100229251 173
464 3300006186 Ga0075369_10005423 Ga0075369_100054235 173
465 3300009093 Ga0105240_10163937 Ga0105240_101639372 173
466 3300010375 Ga0105239_10000271 Ga0105239_1000027152 173
467 3300025913 Ga0207695_10005291 Ga0207695_1000529113 173
468 3300025923 Ga0207681_10090692 Ga0207681_100906923 173
469 3300025940 Ga0207691_10519937 Ga0207691_105199371 173
470 3300025972 Ga0207668_10060121 Ga0207668_100601212 173
471 3300027866 Ga0209813_10000279 Ga0209813_1000027921 173
472 3300046684 Ga0495669_0014347 Ga0495669_0014347_2266_2892 173
473 3300048924 Ga0496121_0003000 Ga0496121_0003000_12726_13310 173
474 3300048926 Ga0496123_0037600 Ga0496123_0037600_2584_3207 173
475 3300048929 Ga0496126_0004852 Ga0496126_0004852_8975_9559 173
476 3300049655 Ga0501208_042684 Ga0501208_042684_146_748 173
477 3300049664 Ga0501224_010003 Ga0501224_010003_434_1036 173
478 3300049679 Ga0501249_001325 Ga0501249_001325_1114_1716 173
479 3300050489 nmdc:mga03683_276_c1 nmdc:mga03683_276_c1_3180_3800 173
480 3300050490 nmdc:mga03n38_89329_c1 nmdc:mga03n38_89329_c1_724_1344 173
481 3300050491 nmdc:mga00v17_68256_c1 nmdc:mga00v17_68256_c1_725_1345 173
482 3300050494 nmdc:mga06z11_134_c1 nmdc:mga06z11_134_c1_18487_19107 173
483 3300050496 nmdc:mga07m45_12_c1 nmdc:mga07m45_12_c1_11201_11821 173
484 3300050516 nmdc:mga0sz30_11490_c1 nmdc:mga0sz30_11490_c1_1947_2567 173
485 3300005262 Ga0065165_1053500 Ga0065165_10535002 174
486 3300025304 Ga0209257_1053361 Ga0209257_10533612 174
487 3300042876 Ga0451577_0219644 Ga0451577_0219644_856_1512 174
488 3300048928 Ga0496125_0107311 Ga0496125_0107311_1003_1638 174
489 3300025921 Ga0207652_10378410 Ga0207652_103784102 175
490 3300044684 Ga0466966_0001152 Ga0466966_0001152_6877_7500 175
491 3300044765 Ga0466970_0161930 Ga0466970_0161930_59_679 175
492 3300005343 Ga0070687_100111831 Ga0070687_1001118312 176
493 3300005344 Ga0070661_100284668 Ga0070661_1002846682 176
494 3300005355 Ga0070671_100352852 Ga0070671_1003528522 176
495 3300005366 Ga0070659_100067036 Ga0070659_1000670364 176
496 3300005563 Ga0068855_100034640 Ga0068855_1000346402 176
497 3300005564 Ga0070664_100002928 Ga0070664_1000029289 176
498 3300005614 Ga0068856_100143419 Ga0068856_1001434193 176
499 3300005841 Ga0068863_100058470 Ga0068863_1000584702 176
500 3300005844 Ga0068862_100431342 Ga0068862_1004313422 176
501 3300006051 Ga0075364_10341720 Ga0075364_103417202 176
502 3300006237 Ga0097621_100202373 Ga0097621_1002023733 176
503 3300006358 Ga0068871_100120505 Ga0068871_1001205051 176
504 3300009011 Ga0105251_10127682 Ga0105251_101276822 176
505 3300009148 Ga0105243_10130908 Ga0105243_101309083 176
506 3300009177 Ga0105248_10091313 Ga0105248_100913135 176
507 3300013102 Ga0157371_10077146 Ga0157371_100771462 176
508 3300013296 Ga0157374_10389936 Ga0157374_103899362 176
509 3300014325 Ga0163163_10006906 Ga0163163_100069062 176
510 3300014968 Ga0157379_10003811 Ga0157379_100038116 176
511 3300025229 Ga0209147_100298 Ga0209147_10029836 176
512 3300025920 Ga0207649_10199137 Ga0207649_101991372 176
513 3300025932 Ga0207690_10244142 Ga0207690_102441422 176
514 3300025935 Ga0207709_10033589 Ga0207709_100335892 176
515 3300025941 Ga0207711_11183716 Ga0207711_111837161 176
516 3300025945 Ga0207679_10206807 Ga0207679_102068072 176
517 3300026116 Ga0207674_10004106 Ga0207674_1000410612 176
518 3300028381 Ga0268264_10095824 Ga0268264_100958242 176
519 3300028786 Ga0307517_10295058 Ga0307517_102950582 176
520 3300037471 Ga0395905_0377023 Ga0395905_0377023_95_727 176
521 3300048905 Ga0496102_0009613 Ga0496102_0009613_4387_5019 176
522 3300048907 Ga0496104_1127604 Ga0496104_1127604_21_653 176
523 3300048909 Ga0496106_0019385 Ga0496106_0019385_2073_2705 176
524 3300048910 Ga0496107_0020666 Ga0496107_0020666_1024_1656 176
525 3300048911 Ga0496108_0054733 Ga0496108_0054733_577_1209 176
526 3300048912 Ga0496109_0022187 Ga0496109_0022187_389_1021 176
527 3300048913 Ga0496110_0026654 Ga0496110_0026654_4231_4863 176
528 3300048915 Ga0496112_0274805 Ga0496112_0274805_834_1466 176
529 3300048916 Ga0496113_0009411 Ga0496113_0009411_2964_3596 176
530 3300002067 JGI24735J21928_10004078 JGI24735J21928_100040786 177
531 3300002075 JGI24738J21930_10022102 JGI24738J21930_100221022 177
532 3300005336 Ga0070680_100602927 Ga0070680_1006029272 177
533 3300005456 Ga0070678_100299879 Ga0070678_1002998792 177
534 3300005457 Ga0070662_100002043 Ga0070662_1000020438 177
535 3300005563 Ga0068855_100018573 Ga0068855_1000185737 177
536 3300006946 Ga0079104_1016890 Ga0079104_10168903 177
537 3300011119 Ga0105246_10002314 Ga0105246_100023144 177
538 3300012513 Ga0157326_1000005 Ga0157326_10000058 177
539 3300013100 Ga0157373_10671609 Ga0157373_106716091 177
540 3300013102 Ga0157371_10007915 Ga0157371_100079152 177
541 3300025933 Ga0207706_10009320 Ga0207706_1000932012 177
542 3300026121 Ga0207683_10320182 Ga0207683_103201822 177
543 3300046519 Ga0495632_0000306 Ga0495632_0000306_24750_25385 177
544 3300046684 Ga0495669_0009712 Ga0495669_0009712_1437_2069 177
545 3300048924 Ga0496121_0078566 Ga0496121_0078566_774_1409 177
546 3300049579 Ga0501043_0813160 Ga0501043_0813160_12_647 177
547 3300053136 Ga0500559_0046716 Ga0500559_0046716_438_1022 177
548 3300053140 Ga0500573_0000065 Ga0500573_0000065_52663_53286 177
549 3300053153 Ga0500616_0002096 Ga0500616_0002096_1651_2286 177
550 3300002077 JGI24744J21845_10007524 JGI24744J21845_100075244 178
551 3300005327 Ga0070658_10153726 Ga0070658_101537263 178
552 3300005530 Ga0070679_100006705 Ga0070679_1000067055 178
553 3300005539 Ga0068853_100065019 Ga0068853_1000650195 178
554 3300005577 Ga0068857_100007902 Ga0068857_1000079028 178
555 3300005578 Ga0068854_100007226 Ga0068854_1000072267 178
556 3300005616 Ga0068852_100476231 Ga0068852_1004762312 178
557 3300005842 Ga0068858_100071318 Ga0068858_1000713182 178
558 3300009092 Ga0105250_10127622 Ga0105250_101276221 178
559 3300014326 Ga0157380_10194137 Ga0157380_101941373 178
560 3300025909 Ga0207705_10318355 Ga0207705_103183552 178
561 3300025909 Ga0207705_10479483 Ga0207705_104794832 178
562 3300025921 Ga0207652_10000489 Ga0207652_100004899 178
563 3300025921 Ga0207652_10181942 Ga0207652_101819422 178
564 3300025932 Ga0207690_10083137 Ga0207690_100831373 178
565 3300025981 Ga0207640_10050304 Ga0207640_100503043 178
566 3300026035 Ga0207703_11233867 Ga0207703_112338671 178
567 3300026116 Ga0207674_10012801 Ga0207674_100128012 178
568 3300026116 Ga0207674_10154090 Ga0207674_101540902 178
569 3300026142 Ga0207698_10397770 Ga0207698_103977702 178
570 3300031852 Ga0307410_10075902 Ga0307410_100759022 178
571 3300031903 Ga0307407_10000642 Ga0307407_100006422 178
572 3300031995 Ga0307409_100014600 Ga0307409_1000146003 178
573 3300032004 Ga0307414_10004943 Ga0307414_100049437 178
574 3300032005 Ga0307411_10005275 Ga0307411_100052752 178
575 3300046616 Ga0495668_0021352 Ga0495668_0021352_177_833 178
576 3300047472 Ga0495686_0201852 Ga0495686_0201852_468_1109 178
577 3300048919 Ga0496116_0023536 Ga0496116_0023536_2676_3293 178
578 3300048920 Ga0496117_0166788 Ga0496117_0166788_376_993 178
579 3300048921 Ga0496118_0007786 Ga0496118_0007786_7494_8111 178
580 3300048922 Ga0496119_0077162 Ga0496119_0077162_343_960 178
581 3300048927 Ga0496124_0008726 Ga0496124_0008726_7687_8304 178
582 3300049570 Ga0501033_0127471 Ga0501033_0127471_469_1092 178
583 3300049572 Ga0501036_0718870 Ga0501036_0718870_23_646 178
584 3300049823 Ga0501044_0376795 Ga0501044_0376795_47_670 178
585 3300053087 Ga0500643_000001 Ga0500643_000001_142110_142745 178
586 3300053116 Ga0500592_005424 Ga0500592_005424_1157_1813 178
587 3300005347 Ga0070668_100016101 Ga0070668_1000161012 179
588 3300005353 Ga0070669_100075371 Ga0070669_1000753713 179
589 3300005617 Ga0068859_100603103 Ga0068859_1006031032 179
590 3300005844 Ga0068862_100004531 Ga0068862_10000453110 179
591 3300006931 Ga0097620_100603134 Ga0097620_1006031342 179
592 3300006946 Ga0079104_1030833 Ga0079104_10308332 179
593 3300009177 Ga0105248_10155436 Ga0105248_101554362 179
594 3300009545 Ga0105237_10017062 Ga0105237_100170622 179
595 3300025923 Ga0207681_10131345 Ga0207681_101313452 179
596 3300025931 Ga0207644_10190814 Ga0207644_101908142 179
597 3300031852 Ga0307410_10303694 Ga0307410_103036941 179
598 3300032004 Ga0307414_10764060 Ga0307414_107640601 179
599 3300032005 Ga0307411_10257744 Ga0307411_102577442 179
600 3300037312 Ga0395899_0010252 Ga0395899_0010252_5277_5909 179
601 3300037471 Ga0395905_0025080 Ga0395905_0025080_899_1531 179
602 3300048923 Ga0496120_0151706 Ga0496120_0151706_212_832 179
603 3300048927 Ga0496124_0019318 Ga0496124_0019318_1439_2062 179
604 3300049581 Ga0501047_0472231 Ga0501047_0472231_423_1046 179
605 3300053138 Ga0500564_027808 Ga0500564_027808_298_930 179
606 3300053723 Ga0500567_002040 Ga0500567_002040_6733_7365 179
607 3300002459 JGI24751J29686_10037791 JGI24751J29686_100377911 180
608 3300005563 Ga0068855_100153975 Ga0068855_1001539753 180
609 3300009148 Ga0105243_10229689 Ga0105243_102296892 180
610 3300013307 Ga0157372_10008443 Ga0157372_1000844313 180
611 3300025935 Ga0207709_10183311 Ga0207709_101833112 180
612 3300025949 Ga0207667_10031849 Ga0207667_100318497 180
613 3300044735 Ga0466968_0054968 Ga0466968_0054968_805_1449 180
614 3300046524 Ga0495648_0026511 Ga0495648_0026511_1869_2510 180
615 3300046692 Ga0495671_0005841 Ga0495671_0005841_1286_1927 180
616 3300053094 Ga0500566_0005455 Ga0500566_0005455_3733_4374 180
617 3300053118 Ga0500594_0009825 Ga0500594_0009825_158_799 180
618 2162886007 SwRhRL2b_contig_1893398 SwRhRL2b_0309.00005740 181
619 3300001989 JGI24739J22299_10008673 JGI24739J22299_100086734 181
620 3300001990 JGI24737J22298_10001243 JGI24737J22298_100012439 181
621 3300001991 JGI24743J22301_10019238 JGI24743J22301_100192382 181
622 3300002067 JGI24735J21928_10043417 JGI24735J21928_100434172 181
623 3300002075 JGI24738J21930_10052632 JGI24738J21930_100526321 181
624 3300005335 Ga0070666_10054458 Ga0070666_100544583 181
625 3300005347 Ga0070668_100078104 Ga0070668_1000781041 181
626 3300005353 Ga0070669_100030653 Ga0070669_1000306534 181
627 3300005353 Ga0070669_100177785 Ga0070669_1001777853 181
628 3300005354 Ga0070675_100014931 Ga0070675_1000149314 181
629 3300005367 Ga0070667_100000286 Ga0070667_10000028642 181
630 3300005456 Ga0070678_100033684 Ga0070678_1000336844 181
631 3300005841 Ga0068863_100000168 Ga0068863_10000016858 181
632 3300006358 Ga0068871_100224978 Ga0068871_1002249783 181
633 3300006881 Ga0068865_100073741 Ga0068865_1000737413 181
634 3300025315 Ga0207697_10211268 Ga0207697_102112682 181
635 3300025901 Ga0207688_10067605 Ga0207688_100676052 181
636 3300025903 Ga0207680_10001307 Ga0207680_100013073 181
637 3300025904 Ga0207647_10000389 Ga0207647_1000038917 181
638 3300025904 Ga0207647_10041178 Ga0207647_100411782 181
639 3300025926 Ga0207659_10011390 Ga0207659_100113901 181
640 3300025932 Ga0207690_10259225 Ga0207690_102592252 181
641 3300025937 Ga0207669_10113323 Ga0207669_101133232 181
642 3300025938 Ga0207704_10054761 Ga0207704_100547613 181
643 3300025972 Ga0207668_10008350 Ga0207668_100083506 181
644 3300025986 Ga0207658_10000243 Ga0207658_1000024328 181
645 3300026088 Ga0207641_10000241 Ga0207641_1000024119 181
646 3300026121 Ga0207683_10015611 Ga0207683_100156117 181
647 3300028379 Ga0268266_10013052 Ga0268266_1001305210 181
648 3300028381 Ga0268264_10065024 Ga0268264_100650243 181
649 3300039437 Ga0436365_1638035 Ga0436365_1638035_443_1069 181
650 3300042015 Ga0439462_0000274 Ga0439462_0000274_7915_8538 181
651 3300044694 Ga0466963_0050836 Ga0466963_0050836_1326_1958 181
652 3300046471 Ga0495650_0003223 Ga0495650_0003223_1412_2029 181
653 3300046524 Ga0495648_0148282 Ga0495648_0148282_40_666 181
654 3300048919 Ga0496116_0028810 Ga0496116_0028810_676_1293 181
655 3300048924 Ga0496121_0000930 Ga0496121_0000930_38324_38941 181
656 3300048928 Ga0496125_0059204 Ga0496125_0059204_189_806 181
657 3300048929 Ga0496126_0014259 Ga0496126_0014259_2022_2639 181
658 3300053087 Ga0500643_006129 Ga0500643_006129_99_743 181
659 3300001915 JGI24741J21665_1039325 JGI24741J21665_10393251 182
660 3300001979 JGI24740J21852_10025066 JGI24740J21852_100250662 182
661 3300001989 JGI24739J22299_10002839 JGI24739J22299_100028392 182
662 3300001989 JGI24739J22299_10020971 JGI24739J22299_100209712 182
663 3300002075 JGI24738J21930_10000436 JGI24738J21930_100004363 182
664 3300005327 Ga0070658_10000377 Ga0070658_1000037733 182
665 3300005329 Ga0070683_100001819 Ga0070683_10000181912 182
666 3300005330 Ga0070690_100128620 Ga0070690_1001286202 182
667 3300005331 Ga0070670_100042597 Ga0070670_1000425972 182
668 3300005333 Ga0070677_10034331 Ga0070677_100343312 182
669 3300005335 Ga0070666_10000779 Ga0070666_1000077917 182
670 3300005337 Ga0070682_100058066 Ga0070682_1000580662 182
671 3300005338 Ga0068868_100192305 Ga0068868_1001923052 182
672 3300005339 Ga0070660_100000986 Ga0070660_1000009866 182
673 3300005343 Ga0070687_100150704 Ga0070687_1001507041 182
674 3300005344 Ga0070661_100000187 Ga0070661_10000018733 182
675 3300005344 Ga0070661_100036795 Ga0070661_1000367952 182
676 3300005344 Ga0070661_100069996 Ga0070661_1000699964 182
677 3300005347 Ga0070668_100125621 Ga0070668_1001256212 182
678 3300005355 Ga0070671_100054381 Ga0070671_1000543814 182
679 3300005356 Ga0070674_100027045 Ga0070674_1000270453 182
680 3300005366 Ga0070659_100000191 Ga0070659_10000019117 182
681 3300005366 Ga0070659_100066651 Ga0070659_1000666515 182
682 3300005367 Ga0070667_100034211 Ga0070667_1000342112 182
683 3300005455 Ga0070663_100008779 Ga0070663_1000087796 182
684 3300005457 Ga0070662_100000012 Ga0070662_10000001236 182
685 3300005459 Ga0068867_100133018 Ga0068867_1001330183 182
686 3300005530 Ga0070679_100100254 Ga0070679_1001002542 182
687 3300005530 Ga0070679_100589659 Ga0070679_1005896592 182
688 3300005535 Ga0070684_100009174 Ga0070684_1000091744 182
689 3300005539 Ga0068853_100000032 Ga0068853_10000003289 182
690 3300005539 Ga0068853_100174373 Ga0068853_1001743733 182
691 3300005547 Ga0070693_100000332 Ga0070693_10000033212 182
692 3300005548 Ga0070665_100012237 Ga0070665_1000122372 182
693 3300005563 Ga0068855_100000591 Ga0068855_1000005919 182
694 3300005563 Ga0068855_100449134 Ga0068855_1004491342 182
695 3300005564 Ga0070664_100000187 Ga0070664_10000018724 182
696 3300005564 Ga0070664_100073402 Ga0070664_1000734025 182
697 3300005577 Ga0068857_100436038 Ga0068857_1004360382 182
698 3300005578 Ga0068854_100111295 Ga0068854_1001112953 182
699 3300005614 Ga0068856_100000291 Ga0068856_10000029133 182
700 3300005616 Ga0068852_100000906 Ga0068852_1000009069 182
701 3300005616 Ga0068852_101080088 Ga0068852_1010800882 182
702 3300005834 Ga0068851_10019263 Ga0068851_100192632 182
703 3300005840 Ga0068870_10039947 Ga0068870_100399472 182
704 3300006237 Ga0097621_100104675 Ga0097621_1001046752 182
705 3300006358 Ga0068871_100672249 Ga0068871_1006722492 182
706 3300009093 Ga0105240_11331320 Ga0105240_113313202 182
707 3300009147 Ga0114129_10257351 Ga0114129_102573513 182
708 3300009174 Ga0105241_10762377 Ga0105241_107623771 182
709 3300009177 Ga0105248_10000083 Ga0105248_1000008384 182
710 3300009551 Ga0105238_10024071 Ga0105238_100240712 182
711 3300009551 Ga0105238_11024103 Ga0105238_110241031 182
712 3300010375 Ga0105239_11248926 Ga0105239_112489261 182
713 3300013104 Ga0157370_11001809 Ga0157370_110018091 182
714 3300013105 Ga0157369_10157781 Ga0157369_101577812 182
715 3300013105 Ga0157369_10780179 Ga0157369_107801792 182
716 3300013297 Ga0157378_10021072 Ga0157378_100210723 182
717 3300013308 Ga0157375_10090533 Ga0157375_100905331 182
718 3300014325 Ga0163163_10001064 Ga0163163_100010646 182
719 3300014497 Ga0182008_10126272 Ga0182008_101262722 182
720 3300014968 Ga0157379_10104620 Ga0157379_101046202 182
721 3300025321 Ga0207656_10196397 Ga0207656_101963972 182
722 3300025893 Ga0207682_10035626 Ga0207682_100356262 182
723 3300025904 Ga0207647_10084197 Ga0207647_100841972 182
724 3300025908 Ga0207643_10033802 Ga0207643_100338022 182
725 3300025909 Ga0207705_10000072 Ga0207705_1000007289 182
726 3300025913 Ga0207695_11005375 Ga0207695_110053751 182
727 3300025919 Ga0207657_10000176 Ga0207657_1000017636 182
728 3300025919 Ga0207657_10024081 Ga0207657_100240816 182
729 3300025920 Ga0207649_10000810 Ga0207649_1000081015 182
730 3300025924 Ga0207694_10822103 Ga0207694_108221031 182
731 3300025924 Ga0207694_10905958 Ga0207694_109059581 182
732 3300025925 Ga0207650_10034652 Ga0207650_100346522 182
733 3300025931 Ga0207644_10018835 Ga0207644_100188356 182
734 3300025932 Ga0207690_10000245 Ga0207690_1000024517 182
735 3300025932 Ga0207690_10198124 Ga0207690_101981242 182
736 3300025933 Ga0207706_10000041 Ga0207706_1000004190 182
737 3300025937 Ga0207669_10062042 Ga0207669_100620422 182
738 3300025941 Ga0207711_10002858 Ga0207711_100028585 182
739 3300025944 Ga0207661_10000953 Ga0207661_1000095312 182
740 3300025945 Ga0207679_10000243 Ga0207679_1000024332 182
741 3300025945 Ga0207679_10025671 Ga0207679_100256716 182
742 3300025949 Ga0207667_10006092 Ga0207667_100060929 182
743 3300025960 Ga0207651_10501208 Ga0207651_105012082 182
744 3300025972 Ga0207668_10196533 Ga0207668_101965333 182
745 3300025981 Ga0207640_10057393 Ga0207640_100573933 182
746 3300025986 Ga0207658_10333312 Ga0207658_103333121 182
747 3300025986 Ga0207658_10482858 Ga0207658_104828582 182
748 3300026023 Ga0207677_10105098 Ga0207677_101050982 182
749 3300026035 Ga0207703_10165021 Ga0207703_101650213 182
750 3300026041 Ga0207639_10000222 Ga0207639_1000022210 182
751 3300026041 Ga0207639_10119275 Ga0207639_101192752 182
752 3300026041 Ga0207639_10192428 Ga0207639_101924283 182
753 3300026067 Ga0207678_10009305 Ga0207678_100093058 182
754 3300026067 Ga0207678_10009690 Ga0207678_100096906 182
755 3300026067 Ga0207678_10130264 Ga0207678_101302642 182
756 3300026078 Ga0207702_10000074 Ga0207702_1000007426 182
757 3300026078 Ga0207702_10931312 Ga0207702_109313121 182
758 3300026089 Ga0207648_10004533 Ga0207648_1000453313 182
759 3300026095 Ga0207676_10007462 Ga0207676_100074626 182
760 3300026142 Ga0207698_10000892 Ga0207698_1000089215 182
761 3300026142 Ga0207698_10006957 Ga0207698_1000695710 182
762 3300028379 Ga0268266_10005157 Ga0268266_100051572 182
763 3300028786 Ga0307517_10020643 Ga0307517_100206433 182
764 3300031548 Ga0307408_100047429 Ga0307408_1000474292 182
765 3300031901 Ga0307406_10293774 Ga0307406_102937742 182
766 3300032005 Ga0307411_10208079 Ga0307411_102080793 182
767 3300037418 Ga0395900_0092721 Ga0395900_0092721_2036_2668 182
768 3300049571 Ga0501034_0880013 Ga0501034_0880013_128_760 182
769 3300050507 nmdc:mga05p37_324492_c1 nmdc:mga05p37_324492_c1_222_839 182
770 3300005563 Ga0068855_100245833 Ga0068855_1002458332 183
771 3300009093 Ga0105240_10108042 Ga0105240_101080424 183
772 3300009545 Ga0105237_10005695 Ga0105237_1000569511 183
773 3300009551 Ga0105238_10116826 Ga0105238_101168262 183
774 3300010375 Ga0105239_10147805 Ga0105239_101478054 183
775 3300025292 Ga0209676_1032030 Ga0209676_10320302 183
776 3300025304 Ga0209257_1001209 Ga0209257_100120913 183
777 3300025907 Ga0207645_10044108 Ga0207645_100441082 183
778 3300025914 Ga0207671_10000955 Ga0207671_1000095528 183
779 3300025924 Ga0207694_10098020 Ga0207694_100980202 183
780 3300025949 Ga0207667_10201249 Ga0207667_102012492 183
781 3300025981 Ga0207640_10009695 Ga0207640_100096953 183
782 3300026078 Ga0207702_10245637 Ga0207702_102456373 183
783 3300031911 Ga0307412_10023555 Ga0307412_100235552 183
784 3300032004 Ga0307414_10004615 Ga0307414_100046155 183
785 3300046525 Ga0495663_0128851 Ga0495663_0128851_189_815 183
786 3300047443 Ga0495687_000250 Ga0495687_000250_47120_47746 183
787 3300048924 Ga0496121_0024091 Ga0496121_0024091_3147_3731 183
788 3300049581 Ga0501047_0701199 Ga0501047_0701199_43_678 183
789 3300053116 Ga0500592_019794 Ga0500592_019794_158_784 183
790 3300053158 Ga0500627_0000089 Ga0500627_0000089_14360_14986 183
791 3300001978 JGI24747J21853_1004386 JGI24747J21853_10043862 184
792 3300002077 JGI24744J21845_10038565 JGI24744J21845_100385652 184
793 3300002244 JGI24742J22300_10039055 JGI24742J22300_100390551 184
794 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007311 184
795 3300005338 Ga0068868_100202519 Ga0068868_1002025192 184
796 3300005354 Ga0070675_100246966 Ga0070675_1002469662 184
797 3300005356 Ga0070674_100000209 Ga0070674_10000020917 184
798 3300005364 Ga0070673_100658848 Ga0070673_1006588482 184
799 3300005456 Ga0070678_100001063 Ga0070678_1000010632 184
800 3300005459 Ga0068867_100071011 Ga0068867_1000710112 184
801 3300005718 Ga0068866_10096709 Ga0068866_100967092 184
802 3300006237 Ga0097621_100081758 Ga0097621_1000817585 184
803 3300006881 Ga0068865_100830307 Ga0068865_1008303072 184
804 3300009148 Ga0105243_10005193 Ga0105243_100051938 184
805 3300011119 Ga0105246_10008646 Ga0105246_100086465 184
806 3300013102 Ga0157371_10000011 Ga0157371_1000001182 184
807 3300025297 Ga0209758_1000017 Ga0209758_1000017307 184
808 3300025907 Ga0207645_10030439 Ga0207645_100304393 184
809 3300025926 Ga0207659_10069623 Ga0207659_100696233 184
810 3300025933 Ga0207706_10401387 Ga0207706_104013872 184
811 3300025935 Ga0207709_10000116 Ga0207709_1000011636 184
812 3300025937 Ga0207669_10000022 Ga0207669_1000002218 184
813 3300025960 Ga0207651_10201365 Ga0207651_102013652 184
814 3300026023 Ga0207677_10150276 Ga0207677_101502762 184
815 3300026089 Ga0207648_10043805 Ga0207648_100438053 184
816 3300026121 Ga0207683_10058649 Ga0207683_100586495 184
817 3300028379 Ga0268266_10623025 Ga0268266_106230251 184
818 3300031548 Ga0307408_100115622 Ga0307408_1001156223 184
819 3300031824 Ga0307413_10011213 Ga0307413_100112132 184
820 3300031852 Ga0307410_10118726 Ga0307410_101187262 184
821 3300031901 Ga0307406_10032616 Ga0307406_100326165 184
822 3300031903 Ga0307407_10215283 Ga0307407_102152832 184
823 3300031995 Ga0307409_100107575 Ga0307409_1001075752 184
824 3300032002 Ga0307416_100026146 Ga0307416_1000261462 184
825 3300032004 Ga0307414_10154175 Ga0307414_101541752 184
826 3300032005 Ga0307411_10041569 Ga0307411_100415692 184
827 3300032126 Ga0307415_100335672 Ga0307415_1003356722 184
828 3300041451 Ga0451791_1549013 Ga0451791_1549013_23_652 184
829 3300041512 Ga0451853_4106881 Ga0451853_4106881_835_1458 184
830 3300046522 Ga0495643_0012066 Ga0495643_0012066_1961_2587 184
831 3300048928 Ga0496125_0155799 Ga0496125_0155799_774_1403 184
832 3300050494 nmdc:mga06z11_85_c1 nmdc:mga06z11_85_c1_35574_36188 184
833 3300001904 JGI24736J21556_1005378 JGI24736J21556_10053782 185
834 3300001989 JGI24739J22299_10003277 JGI24739J22299_100032775 185
835 3300001989 JGI24739J22299_10010024 JGI24739J22299_100100242 185
836 3300003759 Ga0055525_1000127 Ga0055525_100012775 185
837 3300003762 Ga0055542_1000038 Ga0055542_100003837 185
838 3300003763 Ga0055529_1000002 Ga0055529_1000002313 185
839 3300003763 Ga0055529_1000021 Ga0055529_1000021167 185
840 3300005327 Ga0070658_10004008 Ga0070658_100040083 185
841 3300005328 Ga0070676_10652559 Ga0070676_106525591 185
842 3300005339 Ga0070660_100005512 Ga0070660_1000055127 185
843 3300005344 Ga0070661_100006527 Ga0070661_1000065279 185
844 3300005347 Ga0070668_100167545 Ga0070668_1001675451 185
845 3300005455 Ga0070663_100046160 Ga0070663_1000461602 185
846 3300005457 Ga0070662_100026436 Ga0070662_1000264365 185
847 3300005564 Ga0070664_100016865 Ga0070664_1000168655 185
848 3300005834 Ga0068851_10335431 Ga0068851_103354311 185
849 3300006042 Ga0075368_10000450 Ga0075368_1000045010 185
850 3300006178 Ga0075367_10007487 Ga0075367_100074873 185
851 3300009174 Ga0105241_10077362 Ga0105241_100773622 185
852 3300009551 Ga0105238_10173208 Ga0105238_101732082 185
853 3300010375 Ga0105239_11069256 Ga0105239_110692561 185
854 3300012513 Ga0157326_1003871 Ga0157326_10038712 185
855 3300013100 Ga0157373_10147818 Ga0157373_101478182 185
856 3300013296 Ga0157374_10244501 Ga0157374_102445012 185
857 3300017792 Ga0163161_10044190 Ga0163161_100441904 185
858 3300025230 Ga0209563_100125 Ga0209563_10012540 185
859 3300025254 Ga0209148_1000008 Ga0209148_10000081030 185
860 3300025272 Ga0209455_1000002 Ga0209455_1000002395 185
861 3300025321 Ga0207656_10079265 Ga0207656_100792653 185
862 3300025901 Ga0207688_10145818 Ga0207688_101458182 185
863 3300025904 Ga0207647_10019227 Ga0207647_100192275 185
864 3300025909 Ga0207705_10007727 Ga0207705_100077272 185
865 3300025911 Ga0207654_10000246 Ga0207654_1000024615 185
866 3300025913 Ga0207695_10124680 Ga0207695_101246802 185
867 3300025914 Ga0207671_10044155 Ga0207671_100441551 185
868 3300025919 Ga0207657_10008183 Ga0207657_1000818311 185
869 3300025920 Ga0207649_10002323 Ga0207649_100023238 185
870 3300025924 Ga0207694_10005386 Ga0207694_100053863 185
871 3300025932 Ga0207690_10000630 Ga0207690_1000063011 185
872 3300025945 Ga0207679_10094259 Ga0207679_100942592 185
873 3300025949 Ga0207667_10000001 Ga0207667_10000001559 185
874 3300025949 Ga0207667_10017604 Ga0207667_100176041 185
875 3300025972 Ga0207668_10025165 Ga0207668_100251654 185
876 3300025981 Ga0207640_10003242 Ga0207640_100032425 185
877 3300025981 Ga0207640_10022842 Ga0207640_100228425 185
878 3300026041 Ga0207639_10044491 Ga0207639_100444912 185
879 3300026067 Ga0207678_10002526 Ga0207678_1000252615 185
880 3300026078 Ga0207702_10954380 Ga0207702_109543801 185
881 3300026116 Ga0207674_10038792 Ga0207674_100387925 185
882 3300026142 Ga0207698_11204589 Ga0207698_112045891 185
883 3300027866 Ga0209813_10000007 Ga0209813_1000000777 185
884 3300030742 Ga0316183_1203243 Ga0316183_12032432 185
885 3300033180 Ga0307510_10066259 Ga0307510_100662593 185
886 3300035692 Ga0373935_0002322 Ga0373935_0002322_6255_6887 185
887 3300046452 Ga0495617_008380 Ga0495617_008380_434_1060 185
888 3300046471 Ga0495650_0000967 Ga0495650_0000967_17768_18394 185
889 3300046492 Ga0495585_0040991 Ga0495585_0040991_119_745 185
890 3300046492 Ga0495585_0094743 Ga0495585_0094743_649_1275 185
891 3300046506 Ga0495583_0001392 Ga0495583_0001392_14109_14735 185
892 3300046506 Ga0495583_0030469 Ga0495583_0030469_1433_2059 185
893 3300046507 Ga0495606_0173376 Ga0495606_0173376_610_1236 185
894 3300046518 Ga0495631_0026871 Ga0495631_0026871_1877_2503 185
895 3300046522 Ga0495643_0064246 Ga0495643_0064246_1231_1857 185
896 3300046524 Ga0495648_0215116 Ga0495648_0215116_136_756 185
897 3300046525 Ga0495663_0000758 Ga0495663_0000758_3372_3998 185
898 3300046529 Ga0495652_0539811 Ga0495652_0539811_77_703 185
899 3300046557 Ga0495622_0002170 Ga0495622_0002170_3515_4141 185
900 3300046558 Ga0495633_0009196 Ga0495633_0009196_3038_3664 185
901 3300046616 Ga0495668_0434163 Ga0495668_0434163_34_660 185
902 3300046648 Ga0495611_0066649 Ga0495611_0066649_660_1286 185
903 3300046660 Ga0495625_0043217 Ga0495625_0043217_86_712 185
904 3300046660 Ga0495625_0071562 Ga0495625_0071562_1521_2147 185
905 3300046694 Ga0495649_0031039 Ga0495649_0031039_216_842 185
906 3300046809 Ga0495600_0001554 Ga0495600_0001554_11031_11657 185
907 3300047445 Ga0495677_0001865 Ga0495677_0001865_6112_6738 185
908 3300047469 Ga0495673_0041073 Ga0495673_0041073_630_1256 185
909 3300048905 Ga0496102_0001391 Ga0496102_0001391_3199_3825 185
910 3300048906 Ga0496103_0000055 Ga0496103_0000055_110035_110661 185
911 3300048907 Ga0496104_0026298 Ga0496104_0026298_1647_2273 185
912 3300048908 Ga0496105_0000358 Ga0496105_0000358_12484_13110 185
913 3300048913 Ga0496110_0009627 Ga0496110_0009627_3206_3832 185
914 3300048914 Ga0496111_0021635 Ga0496111_0021635_1395_2021 185
915 3300048916 Ga0496113_0145461 Ga0496113_0145461_666_1292 185
916 3300048917 Ga0496114_0010092 Ga0496114_0010092_3168_3794 185
917 3300048918 Ga0496115_0000267 Ga0496115_0000267_27845_28471 185
918 3300048920 Ga0496117_0000549 Ga0496117_0000549_33382_34008 185
919 3300048921 Ga0496118_0000552 Ga0496118_0000552_33264_33890 185
920 3300048922 Ga0496119_0031108 Ga0496119_0031108_1711_2337 185
921 3300048923 Ga0496120_0013820 Ga0496120_0013820_1464_2090 185
922 3300048924 Ga0496121_0001191 Ga0496121_0001191_17058_17684 185
923 3300048925 Ga0496122_0011792 Ga0496122_0011792_4989_5615 185
924 3300048926 Ga0496123_0011531 Ga0496123_0011531_3214_3840 185
925 3300048927 Ga0496124_0000585 Ga0496124_0000585_33135_33761 185
926 3300048928 Ga0496125_0001142 Ga0496125_0001142_22136_22762 185
927 3300048929 Ga0496126_0001094 Ga0496126_0001094_17066_17692 185
928 3300053119 Ga0500595_007737 Ga0500595_007737_659_1285 185
929 3300053130 Ga0500642_0000187 Ga0500642_0000187_23522_24148 185
930 3300053154 Ga0500619_024218 Ga0500619_024218_1026_1652 185
931 3300053177 Ga0500636_0005106 Ga0500636_0005106_3027_3653 185
932 3300005434 Ga0070709_10016498 Ga0070709_100164984 186
933 3300005435 Ga0070714_100156723 Ga0070714_1001567232 186
934 3300005436 Ga0070713_100087188 Ga0070713_1000871882 186
935 3300005985 Ga0081539_10008794 Ga0081539_100087944 186
936 3300006028 Ga0070717_10109103 Ga0070717_101091032 186
937 3300006173 Ga0070716_100129508 Ga0070716_1001295082 186
938 3300006175 Ga0070712_100043513 Ga0070712_1000435135 186
939 3300009551 Ga0105238_10015678 Ga0105238_100156788 186
940 3300025298 Ga0209050_1000254 Ga0209050_100025428 186
941 3300025915 Ga0207693_10014544 Ga0207693_100145445 186
942 3300032004 Ga0307414_10000073 Ga0307414_1000007348 186
943 3300046460 Ga0495638_0015201 Ga0495638_0015201_1582_2217 186
944 3300048919 Ga0496116_0000045 Ga0496116_0000045_294607_295242 186
945 3300048920 Ga0496117_0017345 Ga0496117_0017345_2451_3068 186
946 3300048921 Ga0496118_0000811 Ga0496118_0000811_44464_45081 186
947 3300048921 Ga0496118_0017208 Ga0496118_0017208_1492_2127 186
948 3300048924 Ga0496121_0005432 Ga0496121_0005432_2426_3061 186
949 3300048925 Ga0496122_0005345 Ga0496122_0005345_7340_7975 186
950 3300048925 Ga0496122_0147769 Ga0496122_0147769_56_691 186
951 3300048926 Ga0496123_0001952 Ga0496123_0001952_21590_22225 186
952 3300048927 Ga0496124_0003632 Ga0496124_0003632_8958_9593 186
953 3300048927 Ga0496124_0013710 Ga0496124_0013710_3734_4369 186
954 3300048928 Ga0496125_0010180 Ga0496125_0010180_6456_7091 186
955 3300048928 Ga0496125_0085882 Ga0496125_0085882_70_705 186
956 3300048929 Ga0496126_0000519 Ga0496126_0000519_48324_48959 186
957 3300005331 Ga0070670_100775340 Ga0070670_1007753401 187
958 3300005530 Ga0070679_100005339 Ga0070679_1000053396 187
959 3300005617 Ga0068859_100090073 Ga0068859_1000900732 187
960 3300005618 Ga0068864_100113092 Ga0068864_1001130922 187
961 3300006195 Ga0075366_10087603 Ga0075366_100876033 187
962 3300006880 Ga0075429_100129397 Ga0075429_1001293972 187
963 3300006931 Ga0097620_100090076 Ga0097620_1000900762 187
964 3300009093 Ga0105240_10292795 Ga0105240_102927952 187
965 3300009177 Ga0105248_10002034 Ga0105248_100020346 187
966 3300009177 Ga0105248_10032701 Ga0105248_100327016 187
967 3300009553 Ga0105249_10201195 Ga0105249_102011952 187
968 3300013104 Ga0157370_10002905 Ga0157370_1000290514 187
969 3300025941 Ga0207711_10019188 Ga0207711_100191886 187
970 3300025941 Ga0207711_10043144 Ga0207711_100431444 187
971 3300025961 Ga0207712_10574041 Ga0207712_105740412 187
972 3300026095 Ga0207676_10036224 Ga0207676_100362242 187
973 3300050491 nmdc:mga00v17_81142_c1 nmdc:mga00v17_81142_c1_429_1070 187
974 3300050493 nmdc:mga0k408_63396_c1 nmdc:mga0k408_63396_c1_83_724 187
975 3300053087 Ga0500643_004433 Ga0500643_004433_4208_4828 187
976 3300005262 Ga0065165_1004328 Ga0065165_10043284 188
977 3300046460 Ga0495638_0000051 Ga0495638_0000051_174058_174675 188
978 3300046506 Ga0495583_0000582 Ga0495583_0000582_31229_31846 188
979 3300046519 Ga0495632_0000356 Ga0495632_0000356_17940_18557 188
980 3300046524 Ga0495648_0000032 Ga0495648_0000032_31309_31926 188
981 3300046558 Ga0495633_0015315 Ga0495633_0015315_1975_2592 188
982 3300046692 Ga0495671_0000020 Ga0495671_0000020_173446_174063 188
983 3300047469 Ga0495673_0000076 Ga0495673_0000076_31410_32027 188
984 3300048928 Ga0496125_0099292 Ga0496125_0099292_1201_1845 188
985 3300048929 Ga0496126_0536572 Ga0496126_0536572_122_748 188
986 3300013102 Ga0157371_10606890 Ga0157371_106068902 189
987 3300025940 Ga0207691_10513215 Ga0207691_105132151 189
988 3300044659 Ga0466973_0033687 Ga0466973_0033687_3370_4011 189
989 3300049569 Ga0501032_0019920 Ga0501032_0019920_2148_2777 189
990 3300049569 Ga0501032_0022006 Ga0501032_0022006_3023_3664 189
991 3300049570 Ga0501033_0058368 Ga0501033_0058368_1536_2165 189
992 3300049571 Ga0501034_0108545 Ga0501034_0108545_1040_1669 189
993 3300049572 Ga0501036_0189107 Ga0501036_0189107_784_1425 189
994 3300049573 Ga0501037_0046165 Ga0501037_0046165_862_1491 189
995 3300049575 Ga0501039_0717338 Ga0501039_0717338_58_687 189
996 3300049579 Ga0501043_0007449 Ga0501043_0007449_3013_3654 189
997 3300049579 Ga0501043_0059629 Ga0501043_0059629_1835_2464 189
998 3300049580 Ga0501046_0030557 Ga0501046_0030557_1154_1795 189
999 3300049580 Ga0501046_0269958 Ga0501046_0269958_575_1204 189
1000 3300049581 Ga0501047_0000795 Ga0501047_0000795_16766_17407 189
1001 3300049582 Ga0501048_0086339 Ga0501048_0086339_777_1418 189
1002 3300049586 Ga0501070_0297898 Ga0501070_0297898_341_982 189
1003 3300049822 Ga0501035_0289634 Ga0501035_0289634_59_700 189
1004 3300049823 Ga0501044_0013098 Ga0501044_0013098_7477_8106 189
1005 3300049823 Ga0501044_0044292 Ga0501044_0044292_1474_2115 189
1006 3300049823 Ga0501044_0582299 Ga0501044_0582299_16_645 189
1007 iso_pu_bacteria 8057101203 8057101585 189
1008 3300025932 Ga0207690_10227900 Ga0207690_102279001 190
1009 3300037853 Ga0436364_0804686 Ga0436364_0804686_616_1251 190
1010 3300046453 Ga0495627_036429 Ga0495627_036429_104_745 190
1011 3300049823 Ga0501044_0401751 Ga0501044_0401751_81_704 190
1012 iso_pu_bacteria 2512564014 2512644588 190
1013 iso_pu_bacteria 2775507255 2778126675 190
1014 iso_pu_bacteria 2885429604 2885432554 190
1015 3300005844 Ga0068862_100024495 Ga0068862_1000244956 191
1016 3300013307 Ga0157372_10293339 Ga0157372_102933392 191
1017 3300028380 Ga0268265_10003957 Ga0268265_100039577 191
1018 3300031911 Ga0307412_10011723 Ga0307412_100117233 191
1019 3300032002 Ga0307416_100660589 Ga0307416_1006605892 191
1020 3300042006 Ga0439432_002749 Ga0439432_002749_5880_6512 191
1021 3300048921 Ga0496118_0347199 Ga0496118_0347199_75_725 191
1022 iso_pu_bacteria 2643221560 2643819380 191
1023 iso_pu_bacteria 2739367664 2739651109 191
1024 iso_pu_bacteria 2739367865 2740029582 191
1025 iso_pu_bacteria 2808606401 2809062608 191
1026 iso_pu_bacteria 2808606404 2809078708 191
1027 iso_pu_bacteria 2808606405 2809082997 191
1028 iso_pu_bacteria 2848297114 2848298713 191
1029 iso_pu_bacteria 2880518877 2880521586 191
1030 iso_pu_bacteria 2896253425 2896253805 191
1031 iso_pu_bacteria 2919709256 2919709521 191
1032 iso_pu_bacteria 2928027323 2928029412 191
1033 iso_pu_bacteria 2946787523 2946790184 191
1034 iso_pu_bacteria 2984555340 2984556609 191
1035 iso_pu_bacteria 2984564862 2984565218 191
1036 iso_pu_bacteria 2993356040 2993356294 191
1037 3300003323 rootH1_10162866 rootH1_101628661 192
1038 3300046525 Ga0495663_0054540 Ga0495663_0054540_47_658 192
1039 3300049669 Ga0501235_034142 Ga0501235_034142_259_870 192
1040 iso_pu_bacteria 2510917021 2511130872 192
1041 iso_pu_bacteria 2582581305 2585261427 192
1042 iso_pu_bacteria 2643221541 2643730797 192
1043 iso_pu_bacteria 2643221563 2643836094 192
1044 iso_pu_bacteria 2643221588 2643951674 192
1045 iso_pu_bacteria 2643221605 2644040797 192
1046 iso_pu_bacteria 2643221606 2644044550 192
1047 iso_pu_bacteria 2643221608 2644052571 192
1048 iso_pu_bacteria 2643221671 2644391525 192
1049 iso_pu_bacteria 2852653556 2852656068 192
1050 iso_pu_bacteria 2852680915 2852683203 192
1051 iso_pu_bacteria 2895880812 2895881321 192
1052 iso_pu_bacteria 2990265787 2990265954 192
1053 iso_pu_bacteria 2993693658 2993696255 192
1054 iso_pu_bacteria 3000865235 3000867203 192
1055 iso_pu_bacteria 8054302542 8054305113 192
1056 3300005367 Ga0070667_100533049 Ga0070667_1005330491 193
1057 3300025986 Ga0207658_10469643 Ga0207658_104696432 193
1058 3300001904 JGI24736J21556_1001983 JGI24736J21556_10019832 194
1059 3300001915 JGI24741J21665_1000122 JGI24741J21665_10001222 194
1060 3300001979 JGI24740J21852_10010138 JGI24740J21852_100101382 194
1061 3300001979 JGI24740J21852_10046169 JGI24740J21852_100461692 194
1062 3300001979 JGI24740J21852_10074931 JGI24740J21852_100749312 194
1063 3300001989 JGI24739J22299_10000391 JGI24739J22299_1000039115 194
1064 3300001990 JGI24737J22298_10050139 JGI24737J22298_100501392 194
1065 3300002067 JGI24735J21928_10007186 JGI24735J21928_100071862 194
1066 3300002075 JGI24738J21930_10011972 JGI24738J21930_100119722 194
1067 3300003214 JGI25165J46597_1000071 JGI25165J46597_1000071177 194
1068 3300003320 rootH2_10174559 rootH2_101745593 194
1069 3300003323 rootH1_10040862 rootH1_100408622 194
1070 3300003762 Ga0055542_1001654 Ga0055542_10016544 194
1071 3300005289 Ga0065704_10094687 Ga0065704_100946873 194
1072 3300005295 Ga0065707_10105390 Ga0065707_101053904 194
1073 3300005327 Ga0070658_10075150 Ga0070658_100751503 194
1074 3300005328 Ga0070676_10005501 Ga0070676_100055015 194
1075 3300005334 Ga0068869_100000031 Ga0068869_1000000314 194
1076 3300005338 Ga0068868_100000060 Ga0068868_10000006059 194
1077 3300005339 Ga0070660_100000751 Ga0070660_10000075118 194
1078 3300005339 Ga0070660_100111630 Ga0070660_1001116303 194
1079 3300005355 Ga0070671_100080339 Ga0070671_1000803392 194
1080 3300005364 Ga0070673_100000009 Ga0070673_10000000959 194
1081 3300005366 Ga0070659_100043632 Ga0070659_1000436324 194
1082 3300005455 Ga0070663_100004783 Ga0070663_1000047837 194
1083 3300005455 Ga0070663_100377050 Ga0070663_1003770501 194
1084 3300005459 Ga0068867_100000002 Ga0068867_100000002230 194
1085 3300005466 Ga0070685_10077284 Ga0070685_100772842 194
1086 3300005539 Ga0068853_100014991 Ga0068853_1000149914 194
1087 3300005563 Ga0068855_100001164 Ga0068855_10000116427 194
1088 3300005564 Ga0070664_100177595 Ga0070664_1001775953 194
1089 3300005577 Ga0068857_100542997 Ga0068857_1005429972 194
1090 3300005578 Ga0068854_100003204 Ga0068854_1000032047 194
1091 3300005578 Ga0068854_100090117 Ga0068854_1000901172 194
1092 3300005834 Ga0068851_10019743 Ga0068851_100197433 194
1093 3300005834 Ga0068851_10096921 Ga0068851_100969212 194
1094 3300006237 Ga0097621_100001876 Ga0097621_10000187615 194
1095 3300006358 Ga0068871_100062791 Ga0068871_1000627912 194
1096 3300006881 Ga0068865_100000014 Ga0068865_10000001484 194
1097 3300009011 Ga0105251_10030739 Ga0105251_100307393 194
1098 3300009098 Ga0105245_10000160 Ga0105245_100001607 194
1099 3300009148 Ga0105243_10000070 Ga0105243_1000007063 194
1100 3300009174 Ga0105241_10030368 Ga0105241_100303685 194
1101 3300009174 Ga0105241_10158703 Ga0105241_101587032 194
1102 3300009176 Ga0105242_10001604 Ga0105242_1000160412 194
1103 3300009545 Ga0105237_10097580 Ga0105237_100975802 194
1104 3300009545 Ga0105237_10215362 Ga0105237_102153622 194
1105 3300009551 Ga0105238_10373185 Ga0105238_103731852 194
1106 3300009553 Ga0105249_10015328 Ga0105249_100153282 194
1107 3300009978 Ga0105148_100275 Ga0105148_1002755 194
1108 3300009982 Ga0105147_101564 Ga0105147_1015642 194
1109 3300010375 Ga0105239_10110863 Ga0105239_101108634 194
1110 3300011119 Ga0105246_10003501 Ga0105246_100035014 194
1111 3300013100 Ga0157373_10039126 Ga0157373_100391262 194
1112 3300013100 Ga0157373_10231884 Ga0157373_102318842 194
1113 3300013102 Ga0157371_10608377 Ga0157371_106083772 194
1114 3300013296 Ga0157374_10000542 Ga0157374_1000054238 194
1115 3300013296 Ga0157374_10186177 Ga0157374_101861772 194
1116 3300013297 Ga0157378_10000624 Ga0157378_1000062438 194
1117 3300013306 Ga0163162_10305478 Ga0163162_103054782 194
1118 3300013307 Ga0157372_10093707 Ga0157372_100937073 194
1119 3300013307 Ga0157372_11391257 Ga0157372_113912571 194
1120 3300014326 Ga0157380_10113655 Ga0157380_101136553 194
1121 3300014745 Ga0157377_10037303 Ga0157377_100373032 194
1122 3300014969 Ga0157376_10000096 Ga0157376_1000009659 194
1123 3300017792 Ga0163161_10046559 Ga0163161_100465592 194
1124 3300017792 Ga0163161_10107867 Ga0163161_101078672 194
1125 3300017792 Ga0163161_10295126 Ga0163161_102951261 194
1126 3300025254 Ga0209148_1000147 Ga0209148_1000147107 194
1127 3300025261 Ga0209233_1000140 Ga0209233_100014010 194
1128 3300025321 Ga0207656_10034991 Ga0207656_100349912 194
1129 3300025321 Ga0207656_10069520 Ga0207656_100695202 194
1130 3300025735 Ga0207713_1060220 Ga0207713_10602202 194
1131 3300025907 Ga0207645_10008376 Ga0207645_100083764 194
1132 3300025911 Ga0207654_10230549 Ga0207654_102305491 194
1133 3300025911 Ga0207654_10480107 Ga0207654_104801071 194
1134 3300025919 Ga0207657_10000900 Ga0207657_1000090024 194
1135 3300025920 Ga0207649_10388902 Ga0207649_103889022 194
1136 3300025924 Ga0207694_10036581 Ga0207694_100365814 194
1137 3300025925 Ga0207650_10137220 Ga0207650_101372201 194
1138 3300025927 Ga0207687_10000252 Ga0207687_1000025229 194
1139 3300025931 Ga0207644_10059655 Ga0207644_100596553 194
1140 3300025932 Ga0207690_10171137 Ga0207690_101711372 194
1141 3300025932 Ga0207690_10798539 Ga0207690_107985391 194
1142 3300025934 Ga0207686_10002334 Ga0207686_100023344 194
1143 3300025935 Ga0207709_10000066 Ga0207709_1000006637 194
1144 3300025938 Ga0207704_10000002 Ga0207704_10000002161 194
1145 3300025938 Ga0207704_10000007 Ga0207704_10000007161 194
1146 3300025942 Ga0207689_10000060 Ga0207689_1000006028 194
1147 3300025949 Ga0207667_10000017 Ga0207667_10000017287 194
1148 3300025949 Ga0207667_10033839 Ga0207667_100338393 194
1149 3300025960 Ga0207651_10000004 Ga0207651_10000004230 194
1150 3300025961 Ga0207712_10007169 Ga0207712_100071697 194
1151 3300025981 Ga0207640_10000695 Ga0207640_1000069517 194
1152 3300025981 Ga0207640_10010412 Ga0207640_100104121 194
1153 3300026023 Ga0207677_10000231 Ga0207677_1000023111 194
1154 3300026041 Ga0207639_10002807 Ga0207639_1000280711 194
1155 3300026041 Ga0207639_10004222 Ga0207639_100042228 194
1156 3300026067 Ga0207678_10000427 Ga0207678_1000042740 194
1157 3300026067 Ga0207678_10033366 Ga0207678_100333662 194
1158 3300026078 Ga0207702_10067615 Ga0207702_100676152 194
1159 3300026089 Ga0207648_10000003 Ga0207648_1000000359 194
1160 3300026142 Ga0207698_10033576 Ga0207698_100335766 194
1161 3300031251 Ga0265327_10116288 Ga0265327_101162881 194
1162 3300031548 Ga0307408_100006152 Ga0307408_1000061527 194
1163 3300031731 Ga0307405_10021552 Ga0307405_100215524 194
1164 3300031824 Ga0307413_10135136 Ga0307413_101351362 194
1165 3300031852 Ga0307410_10425944 Ga0307410_104259442 194
1166 3300031901 Ga0307406_10010388 Ga0307406_100103885 194
1167 3300031901 Ga0307406_10354532 Ga0307406_103545322 194
1168 3300031995 Ga0307409_100097867 Ga0307409_1000978673 194
1169 3300032004 Ga0307414_10410604 Ga0307414_104106042 194
1170 3300032005 Ga0307411_10016683 Ga0307411_100166832 194
1171 3300032126 Ga0307415_100439992 Ga0307415_1004399922 194
1172 3300037471 Ga0395905_0315237 Ga0395905_0315237_657_1292 194
1173 3300038443 Ga0395901_0647004 Ga0395901_0647004_18_653 194
1174 3300038705 Ga0237819_02628 Ga0237819_02628_1545_2162 194
1175 3300039145 Ga0237816_03757 Ga0237816_03757_183_800 194
1176 3300046453 Ga0495627_000024 Ga0495627_000024_96476_97093 194
1177 3300046453 Ga0495627_020847 Ga0495627_020847_1313_1930 194
1178 3300046512 Ga0495610_0000053 Ga0495610_0000053_99191_99808 194
1179 3300046518 Ga0495631_0252731 Ga0495631_0252731_42_659 194
1180 3300046558 Ga0495633_0043814 Ga0495633_0043814_691_1308 194
1181 3300046558 Ga0495633_0188828 Ga0495633_0188828_131_748 194
1182 3300046665 Ga0495661_0072319 Ga0495661_0072319_940_1557 194
1183 3300047320 Ga0495672_0117903 Ga0495672_0117903_179_796 194
1184 3300047469 Ga0495673_0020724 Ga0495673_0020724_967_1602 194
1185 3300047469 Ga0495673_0034699 Ga0495673_0034699_1318_1935 194
1186 3300047470 Ga0495681_0000099 Ga0495681_0000099_66085_66702 194
1187 3300047472 Ga0495686_0000669 Ga0495686_0000669_31551_32186 194
1188 3300047472 Ga0495686_0154042 Ga0495686_0154042_156_773 194
1189 3300048905 Ga0496102_0557811 Ga0496102_0557811_343_960 194
1190 3300048905 Ga0496102_0851955 Ga0496102_0851955_149_784 194
1191 3300048906 Ga0496103_0477353 Ga0496103_0477353_62_679 194
1192 3300048908 Ga0496105_0740658 Ga0496105_0740658_21_638 194
1193 3300048914 Ga0496111_0103898 Ga0496111_0103898_647_1264 194
1194 3300048916 Ga0496113_0103450 Ga0496113_0103450_705_1322 194
1195 3300048924 Ga0496121_0068404 Ga0496121_0068404_2241_2858 194
1196 3300048925 Ga0496122_0017572 Ga0496122_0017572_5541_6158 194
1197 3300048926 Ga0496123_0067977 Ga0496123_0067977_257_895 194
1198 3300048926 Ga0496123_0079556 Ga0496123_0079556_1268_1885 194
1199 3300048926 Ga0496123_0106909 Ga0496123_0106909_430_1047 194
1200 3300048926 Ga0496123_0233381 Ga0496123_0233381_114_731 194
1201 3300048927 Ga0496124_0026758 Ga0496124_0026758_106_723 194
1202 3300048927 Ga0496124_0099254 Ga0496124_0099254_1320_1937 194
1203 3300048928 Ga0496125_0035059 Ga0496125_0035059_2371_2988 194
1204 3300048928 Ga0496125_0036806 Ga0496125_0036806_1273_1890 194
1205 3300048929 Ga0496126_0271213 Ga0496126_0271213_392_1009 194
1206 3300049663 Ga0501223_000092 Ga0501223_000092_8592_9209 194
1207 3300049669 Ga0501235_014004 Ga0501235_014004_805_1422 194
1208 3300049705 Ga0501225_0009956 Ga0501225_0009956_1952_2569 194
1209 3300053108 Ga0500562_003322 Ga0500562_003322_125_742 194
1210 3300053157 Ga0500624_000002 Ga0500624_000002_120274_120891 194
1211 3300005333 Ga0070677_10000079 Ga0070677_1000007930 195
1212 3300005335 Ga0070666_10581678 Ga0070666_105816781 195
1213 3300005530 Ga0070679_100080732 Ga0070679_1000807326 195
1214 3300005563 Ga0068855_100789685 Ga0068855_1007896852 195
1215 3300005578 Ga0068854_100112344 Ga0068854_1001123442 195
1216 3300005842 Ga0068858_100000848 Ga0068858_10000084816 195
1217 3300005842 Ga0068858_100023512 Ga0068858_1000235124 195
1218 3300005985 Ga0081539_10019519 Ga0081539_100195195 195
1219 3300006177 Ga0075362_10034007 Ga0075362_100340072 195
1220 3300006186 Ga0075369_10096406 Ga0075369_100964062 195
1221 3300009098 Ga0105245_10018347 Ga0105245_100183476 195
1222 3300009148 Ga0105243_10055563 Ga0105243_100555632 195
1223 3300013297 Ga0157378_10060444 Ga0157378_100604444 195
1224 3300013306 Ga0163162_10009970 Ga0163162_100099708 195
1225 3300025272 Ga0209455_1009390 Ga0209455_10093903 195
1226 3300025315 Ga0207697_10084306 Ga0207697_100843062 195
1227 3300025903 Ga0207680_10555348 Ga0207680_105553482 195
1228 3300025921 Ga0207652_10027113 Ga0207652_100271131 195
1229 3300025927 Ga0207687_10000892 Ga0207687_100008925 195
1230 3300025935 Ga0207709_10018879 Ga0207709_100188792 195
1231 3300026035 Ga0207703_10000167 Ga0207703_1000016745 195
1232 3300026035 Ga0207703_10022812 Ga0207703_100228123 195
1233 3300028380 Ga0268265_10122506 Ga0268265_101225062 195
1234 3300031507 Ga0307509_10476517 Ga0307509_104765172 195
1235 3300031616 Ga0307508_10013978 Ga0307508_100139785 195
1236 3300031616 Ga0307508_10100659 Ga0307508_101006593 195
1237 3300031911 Ga0307412_10068448 Ga0307412_100684483 195
1238 3300031911 Ga0307412_10133370 Ga0307412_101333702 195
1239 3300032004 Ga0307414_10085299 Ga0307414_100852992 195
1240 3300035111 Ga0373923_0127740 Ga0373923_0127740_315_935 195
1241 3300046474 Ga0495605_0024857 Ga0495605_0024857_431_1069 195
1242 3300046492 Ga0495585_0081005 Ga0495585_0081005_64_684 195
1243 3300046501 Ga0495607_0037379 Ga0495607_0037379_720_1340 195
1244 3300046512 Ga0495610_0093412 Ga0495610_0093412_691_1311 195
1245 3300046519 Ga0495632_0000006 Ga0495632_0000006_328087_328707 195
1246 3300046520 Ga0495637_0000784 Ga0495637_0000784_2896_3516 195
1247 3300046522 Ga0495643_0000021 Ga0495643_0000021_59775_60395 195
1248 3300046524 Ga0495648_0038726 Ga0495648_0038726_2127_2747 195
1249 3300046525 Ga0495663_0000008 Ga0495663_0000008_17177_17797 195
1250 3300046558 Ga0495633_0000247 Ga0495633_0000247_3088_3708 195
1251 3300046558 Ga0495633_0001265 Ga0495633_0001265_4447_5067 195
1252 3300046692 Ga0495671_0000017 Ga0495671_0000017_233071_233691 195
1253 3300046692 Ga0495671_0006324 Ga0495671_0006324_5122_5742 195
1254 3300047470 Ga0495681_0032888 Ga0495681_0032888_1464_2084 195
1255 3300047472 Ga0495686_0103361 Ga0495686_0103361_366_986 195
1256 3300048905 Ga0496102_0030551 Ga0496102_0030551_2351_2977 195
1257 3300048924 Ga0496121_0000652 Ga0496121_0000652_49135_49755 195
1258 3300048927 Ga0496124_0134357 Ga0496124_0134357_87_710 195
1259 3300048928 Ga0496125_0032339 Ga0496125_0032339_76_696 195
1260 3300050516 nmdc:mga0sz30_10812_c2 nmdc:mga0sz30_10812_c2_103_723 195
1261 3300053153 Ga0500616_0051227 Ga0500616_0051227_795_1433 195
1262 3300003781 Ga0055536_1003088 Ga0055536_10030886 196
1263 3300003781 Ga0055536_1006967 Ga0055536_10069675 196
1264 3300003784 Ga0055534_1008222 Ga0055534_10082223 196
1265 3300003791 Ga0055530_10000048 Ga0055530_10000048113 196
1266 3300003791 Ga0055530_10011789 Ga0055530_100117892 196
1267 3300003794 Ga0055531_10000929 Ga0055531_100009295 196
1268 3300003794 Ga0055531_10004331 Ga0055531_100043319 196
1269 3300005327 Ga0070658_10000716 Ga0070658_1000071617 196
1270 3300005327 Ga0070658_10021861 Ga0070658_100218612 196
1271 3300005328 Ga0070676_10176436 Ga0070676_101764362 196
1272 3300005331 Ga0070670_100012449 Ga0070670_1000124495 196
1273 3300005333 Ga0070677_10011544 Ga0070677_100115443 196
1274 3300005335 Ga0070666_10093259 Ga0070666_100932591 196
1275 3300005336 Ga0070680_100245996 Ga0070680_1002459962 196
1276 3300005339 Ga0070660_100273648 Ga0070660_1002736482 196
1277 3300005344 Ga0070661_100021041 Ga0070661_1000210416 196
1278 3300005347 Ga0070668_100100733 Ga0070668_1001007333 196
1279 3300005354 Ga0070675_100005311 Ga0070675_1000053119 196
1280 3300005356 Ga0070674_100127342 Ga0070674_1001273423 196
1281 3300005366 Ga0070659_100423186 Ga0070659_1004231862 196
1282 3300005367 Ga0070667_100000143 Ga0070667_10000014311 196
1283 3300005455 Ga0070663_100083683 Ga0070663_1000836832 196
1284 3300005456 Ga0070678_100334470 Ga0070678_1003344702 196
1285 3300005457 Ga0070662_100049752 Ga0070662_1000497525 196
1286 3300005548 Ga0070665_100000084 Ga0070665_10000008476 196
1287 3300005564 Ga0070664_100767854 Ga0070664_1007678542 196
1288 3300005578 Ga0068854_100336372 Ga0068854_1003363722 196
1289 3300005578 Ga0068854_100552291 Ga0068854_1005522911 196
1290 3300005840 Ga0068870_10262608 Ga0068870_102626082 196
1291 3300005841 Ga0068863_100001489 Ga0068863_10000148920 196
1292 3300005843 Ga0068860_100000181 Ga0068860_10000018122 196
1293 3300005844 Ga0068862_100386147 Ga0068862_1003861472 196
1294 3300005983 Ga0081540_1099998 Ga0081540_10999982 196
1295 3300006175 Ga0070712_100203183 Ga0070712_1002031832 196
1296 3300013296 Ga0157374_10836077 Ga0157374_108360771 196
1297 3300014326 Ga0157380_10022724 Ga0157380_100227247 196
1298 3300014326 Ga0157380_10410985 Ga0157380_104109852 196
1299 3300025261 Ga0209233_1027364 Ga0209233_10273642 196
1300 3300025291 Ga0209675_1000181 Ga0209675_100018167 196
1301 3300025292 Ga0209676_1000084 Ga0209676_100008415 196
1302 3300025292 Ga0209676_1000330 Ga0209676_100033063 196
1303 3300025292 Ga0209676_1000479 Ga0209676_100047914 196
1304 3300025294 Ga0209025_1022687 Ga0209025_10226873 196
1305 3300025298 Ga0209050_1000113 Ga0209050_1000113180 196
1306 3300025298 Ga0209050_1001453 Ga0209050_100145321 196
1307 3300025298 Ga0209050_1048216 Ga0209050_10482161 196
1308 3300025304 Ga0209257_1000083 Ga0209257_1000083189 196
1309 3300025304 Ga0209257_1000126 Ga0209257_1000126163 196
1310 3300025304 Ga0209257_1000340 Ga0209257_100034052 196
1311 3300025893 Ga0207682_10000542 Ga0207682_1000054211 196
1312 3300025909 Ga0207705_10018377 Ga0207705_100183774 196
1313 3300025909 Ga0207705_10151259 Ga0207705_101512591 196
1314 3300025915 Ga0207693_10053263 Ga0207693_100532633 196
1315 3300025919 Ga0207657_10434088 Ga0207657_104340882 196
1316 3300025920 Ga0207649_10086734 Ga0207649_100867342 196
1317 3300025921 Ga0207652_10068878 Ga0207652_100688783 196
1318 3300025925 Ga0207650_10007357 Ga0207650_100073575 196
1319 3300025926 Ga0207659_10137601 Ga0207659_101376012 196
1320 3300025932 Ga0207690_10071040 Ga0207690_100710403 196
1321 3300025933 Ga0207706_10021878 Ga0207706_100218785 196
1322 3300025937 Ga0207669_10101776 Ga0207669_101017762 196
1323 3300025945 Ga0207679_10016805 Ga0207679_100168057 196
1324 3300025945 Ga0207679_10049249 Ga0207679_100492492 196
1325 3300025945 Ga0207679_10728949 Ga0207679_107289491 196
1326 3300025972 Ga0207668_10096392 Ga0207668_100963923 196
1327 3300025981 Ga0207640_10254719 Ga0207640_102547192 196
1328 3300025986 Ga0207658_10000109 Ga0207658_1000010977 196
1329 3300026067 Ga0207678_10025204 Ga0207678_100252048 196
1330 3300026067 Ga0207678_10349584 Ga0207678_103495842 196
1331 3300026088 Ga0207641_10000755 Ga0207641_1000075529 196
1332 3300026121 Ga0207683_10335183 Ga0207683_103351832 196
1333 3300028379 Ga0268266_10000002 Ga0268266_10000002802 196
1334 3300028380 Ga0268265_10320645 Ga0268265_103206452 196
1335 3300028381 Ga0268264_10000144 Ga0268264_1000014487 196
1336 3300031548 Ga0307408_100045019 Ga0307408_1000450195 196
1337 3300031548 Ga0307408_100219274 Ga0307408_1002192742 196
1338 3300031548 Ga0307408_100454895 Ga0307408_1004548951 196
1339 3300031548 Ga0307408_100490889 Ga0307408_1004908892 196
1340 3300031824 Ga0307413_10822024 Ga0307413_108220241 196
1341 3300031852 Ga0307410_10012132 Ga0307410_100121325 196
1342 3300031852 Ga0307410_10074163 Ga0307410_100741632 196
1343 3300031852 Ga0307410_10842397 Ga0307410_108423971 196
1344 3300031901 Ga0307406_10355532 Ga0307406_103555322 196
1345 3300031901 Ga0307406_10463989 Ga0307406_104639892 196
1346 3300031903 Ga0307407_10018963 Ga0307407_100189633 196
1347 3300031911 Ga0307412_10147821 Ga0307412_101478212 196
1348 3300031911 Ga0307412_10550438 Ga0307412_105504382 196
1349 3300031911 Ga0307412_11301028 Ga0307412_113010281 196
1350 3300031995 Ga0307409_100001134 Ga0307409_1000011346 196
1351 3300031995 Ga0307409_100462246 Ga0307409_1004622462 196
1352 3300031995 Ga0307409_100574396 Ga0307409_1005743962 196
1353 3300031995 Ga0307409_100609696 Ga0307409_1006096961 196
1354 3300032002 Ga0307416_100021275 Ga0307416_1000212754 196
1355 3300032002 Ga0307416_100039060 Ga0307416_1000390604 196
1356 3300032002 Ga0307416_100117251 Ga0307416_1001172515 196
1357 3300032004 Ga0307414_10096376 Ga0307414_100963762 196
1358 3300032004 Ga0307414_10129051 Ga0307414_101290512 196
1359 3300032004 Ga0307414_10181450 Ga0307414_101814503 196
1360 3300032004 Ga0307414_10340417 Ga0307414_103404172 196
1361 3300032005 Ga0307411_10041899 Ga0307411_100418994 196
1362 3300032005 Ga0307411_10301566 Ga0307411_103015662 196
1363 3300032005 Ga0307411_10303104 Ga0307411_103031042 196
1364 3300035111 Ga0373923_0004223 Ga0373923_0004223_189_821 196
1365 3300035724 Ga0373933_0031583 Ga0373933_0031583_87_719 196
1366 3300035725 Ga0373947_0129808 Ga0373947_0129808_660_1313 196
1367 3300036401 Ga0373937_0045789 Ga0373937_0045789_3244_3876 196
1368 3300037068 Ga0373925_0277898 Ga0373925_0277898_412_1065 196
1369 3300037471 Ga0395905_0160398 Ga0395905_0160398_1005_1631 196
1370 3300038443 Ga0395901_0099018 Ga0395901_0099018_2062_2688 196
1371 3300044683 Ga0466965_0074211 Ga0466965_0074211_356_988 196
1372 3300044765 Ga0466970_0114927 Ga0466970_0114927_135_767 196
1373 3300045049 Ga0466959_0213418 Ga0466959_0213418_392_1024 196
1374 3300046453 Ga0495627_000582 Ga0495627_000582_17340_17963 196
1375 3300046460 Ga0495638_0127999 Ga0495638_0127999_335_958 196
1376 3300046471 Ga0495650_0001090 Ga0495650_0001090_18540_19163 196
1377 3300046492 Ga0495585_0061915 Ga0495585_0061915_1289_1912 196
1378 3300046492 Ga0495585_0062413 Ga0495585_0062413_809_1435 196
1379 3300046500 Ga0495596_0000008 Ga0495596_0000008_133611_134234 196
1380 3300046501 Ga0495607_0006279 Ga0495607_0006279_2540_3163 196
1381 3300046501 Ga0495607_0013977 Ga0495607_0013977_62_685 196
1382 3300046506 Ga0495583_0005396 Ga0495583_0005396_2931_3557 196
1383 3300046506 Ga0495583_0074163 Ga0495583_0074163_103_729 196
1384 3300046506 Ga0495583_0077084 Ga0495583_0077084_722_1375 196
1385 3300046506 Ga0495583_0085684 Ga0495583_0085684_602_1225 196
1386 3300046507 Ga0495606_0013877 Ga0495606_0013877_4153_4776 196
1387 3300046512 Ga0495610_0000081 Ga0495610_0000081_93378_94004 196
1388 3300046512 Ga0495610_0001175 Ga0495610_0001175_9565_10188 196
1389 3300046513 Ga0495616_0223663 Ga0495616_0223663_57_683 196
1390 3300046515 Ga0495620_0024916 Ga0495620_0024916_738_1361 196
1391 3300046518 Ga0495631_0045866 Ga0495631_0045866_1175_1801 196
1392 3300046519 Ga0495632_0014842 Ga0495632_0014842_2177_2800 196
1393 3300046519 Ga0495632_0185855 Ga0495632_0185855_306_929 196
1394 3300046520 Ga0495637_0023493 Ga0495637_0023493_1318_1944 196
1395 3300046522 Ga0495643_0000042 Ga0495643_0000042_19912_20538 196
1396 3300046522 Ga0495643_0001768 Ga0495643_0001768_12939_13562 196
1397 3300046522 Ga0495643_0002744 Ga0495643_0002744_11316_11942 196
1398 3300046522 Ga0495643_0002897 Ga0495643_0002897_8462_9085 196
1399 3300046522 Ga0495643_0018970 Ga0495643_0018970_794_1447 196
1400 3300046522 Ga0495643_0055387 Ga0495643_0055387_890_1543 196
1401 3300046522 Ga0495643_0108432 Ga0495643_0108432_474_1103 196
1402 3300046522 Ga0495643_0232909 Ga0495643_0232909_90_716 196
1403 3300046524 Ga0495648_0004587 Ga0495648_0004587_6608_7234 196
1404 3300046538 Ga0495609_0003619 Ga0495609_0003619_1322_1945 196
1405 3300046538 Ga0495609_0161424 Ga0495609_0161424_255_881 196
1406 3300046542 Ga0495597_0021634 Ga0495597_0021634_1067_1720 196
1407 3300046558 Ga0495633_0000308 Ga0495633_0000308_37628_38254 196
1408 3300046558 Ga0495633_0100529 Ga0495633_0100529_77_730 196
1409 3300046616 Ga0495668_0000004 Ga0495668_0000004_163667_164296 196
1410 3300046616 Ga0495668_0000013 Ga0495668_0000013_260697_261323 196
1411 3300046616 Ga0495668_0015322 Ga0495668_0015322_682_1335 196
1412 3300046616 Ga0495668_0216745 Ga0495668_0216745_244_873 196
1413 3300046648 Ga0495611_0014367 Ga0495611_0014367_1497_2123 196
1414 3300046660 Ga0495625_0000321 Ga0495625_0000321_2256_2882 196
1415 3300046660 Ga0495625_0000914 Ga0495625_0000914_33291_33920 196
1416 3300046660 Ga0495625_0003636 Ga0495625_0003636_13357_13980 196
1417 3300046660 Ga0495625_0042735 Ga0495625_0042735_2045_2671 196
1418 3300046660 Ga0495625_0119010 Ga0495625_0119010_556_1182 196
1419 3300046660 Ga0495625_0226451 Ga0495625_0226451_185_814 196
1420 3300046665 Ga0495661_0194740 Ga0495661_0194740_17_643 196
1421 3300046679 Ga0495623_0070991 Ga0495623_0070991_1019_1651 196
1422 3300046684 Ga0495669_0002087 Ga0495669_0002087_3459_4085 196
1423 3300046684 Ga0495669_0062574 Ga0495669_0062574_620_1273 196
1424 3300046692 Ga0495671_0022403 Ga0495671_0022403_556_1179 196
1425 3300046694 Ga0495649_0038474 Ga0495649_0038474_1913_2539 196
1426 3300046810 Ga0495660_0047286 Ga0495660_0047286_406_1032 196
1427 3300046810 Ga0495660_0087149 Ga0495660_0087149_36_662 196
1428 3300047323 Ga0495683_0006805 Ga0495683_0006805_3471_4097 196
1429 3300047443 Ga0495687_000614 Ga0495687_000614_17053_17679 196
1430 3300047469 Ga0495673_0030495 Ga0495673_0030495_1826_2449 196
1431 3300047470 Ga0495681_0000517 Ga0495681_0000517_10519_11142 196
1432 3300047472 Ga0495686_0000262 Ga0495686_0000262_18747_19370 196
1433 3300047472 Ga0495686_0000273 Ga0495686_0000273_70687_71310 196
1434 3300048088 Ga0495602_0046500 Ga0495602_0046500_2928_3560 196
1435 3300048912 Ga0496109_0215343 Ga0496109_0215343_706_1335 196
1436 3300048924 Ga0496121_0192677 Ga0496121_0192677_713_1336 196
1437 3300049686 Ga0501257_087543 Ga0501257_087543_121_753 196
1438 3300049764 Ga0501267_012879 Ga0501267_012879_128_760 196
1439 3300053079 Ga0500610_0000092 Ga0500610_0000092_15461_16087 196
1440 3300053093 Ga0500651_0009774 Ga0500651_0009774_2916_3569 196
1441 3300053130 Ga0500642_0002784 Ga0500642_0002784_1408_2061 196
1442 3300053133 Ga0500655_000107 Ga0500655_000107_15194_15847 196
1443 3300053139 Ga0500568_0003230 Ga0500568_0003230_8406_9035 196
1444 3300053156 Ga0500622_0003412 Ga0500622_0003412_9205_9858 196
1445 3300053724 Ga0500570_000192 Ga0500570_000192_6142_6795 196
1446 3300053730 Ga0500645_000024 Ga0500645_000024_26388_27014 196
1447 3300053735 Ga0500596_000659 Ga0500596_000659_3270_3896 196
1448 iso_pu_bacteria 2818991438 2819551416 196
1449 3300031731 Ga0307405_10004479 Ga0307405_100044793 199
1450 3300031911 Ga0307412_10031872 Ga0307412_100318724 199
1451 2162886007 SwRhRL2b_contig_1673102 SwRhRL2b_0191.00004620 200
1452 3300005289 Ga0065704_10070193 Ga0065704_1007019319 200
1453 3300005355 Ga0070671_100241581 Ga0070671_1002415812 200
1454 3300005367 Ga0070667_100000367 Ga0070667_10000036736 200
1455 3300005841 Ga0068863_100081951 Ga0068863_1000819513 200
1456 3300005843 Ga0068860_100067993 Ga0068860_1000679933 200
1457 3300025931 Ga0207644_10200922 Ga0207644_102009223 200
1458 3300025986 Ga0207658_10000831 Ga0207658_1000083124 200
1459 3300026088 Ga0207641_10033823 Ga0207641_100338234 200
1460 3300028381 Ga0268264_10045605 Ga0268264_100456054 200
1461 3300046500 Ga0495596_0002823 Ga0495596_0002823_2353_2988 200
1462 3300046507 Ga0495606_0027882 Ga0495606_0027882_2025_2660 200
1463 3300046512 Ga0495610_0004173 Ga0495610_0004173_1355_1990 200
1464 3300046522 Ga0495643_0183112 Ga0495643_0183112_208_843 200
1465 3300048090 Ga0495615_0000135 Ga0495615_0000135_12571_13209 200
1466 3300048091 Ga0495626_0000139 Ga0495626_0000139_52332_52967 200
1467 3300048925 Ga0496122_0036518 Ga0496122_0036518_1015_1653 200
1468 3300048926 Ga0496123_0011382 Ga0496123_0011382_4763_5401 200
1469 3300048927 Ga0496124_0030502 Ga0496124_0030502_1244_1879 200
1470 3300048928 Ga0496125_0041123 Ga0496125_0041123_2144_2782 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01914

MarC

MarC family integral membrane protein

6

216

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc2-assembly1.cif.gz_A human oct1 bound to diltiazem in inward-open conformation 0.5222 5 187
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.5049 1 193
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.4982 3 189
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.4807 5 187
6vs2-assembly1.cif.gz_A protein d 0.4667 4 198
ID Description Score Start End Superfamily
af_Q9XUL2_18_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5236 3 197 1.20.1250.20
af_A0A4V0IJT1_312_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.52 4 189 1.20.1250.20
af_A0A0P0X7B4_1_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5177 4 191 1.20.1250.20
af_E7FF19_1_301_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5115 2 187 1.20.1250.20
af_P9WGE5_1_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5097 4 194 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D3LTE6-F1-model_v4 UPF0056 membrane protein 0.7734 2 197 GO:0005886
AF-A0A839J1R9-F1-model_v4 UPF0056 membrane protein 0.7669 41 198 GO:0005886
AF-A0A7Y2G823-F1-model_v4 UPF0056 membrane protein 0.7645 4 198 GO:0005886
AF-A0A3D3Q9Z2-F1-model_v4 UPF0056 membrane protein 0.7594 13 197 GO:0005886
AF-A0A1C3DT85-F1-model_v4 UPF0056 membrane protein 0.7593 5 197 GO:0005886

Feature Viewer

pLDDT pTM Quality
63.73 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map