F494194

General Info

Members Datasets Scaffolds Average Seq Length
1469 405 1469 118

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0447138|Ga0501081_0447138_471_950
Length 145
Sequence MFVIIAVATDTRAVGAASSSAVVSNVPSMAVELELAPKVKRAKGERCCEPVVYPDVERAQALRLAEVAKALGDPIRLQLVDVLRKHAGKVCVCELVPLFDISQPTLSHHLKKLRDAGLVDSERQGLWVYYYVKPEALDELAGWLS

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
243 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
370 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
371 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
388 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
389 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
390 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
391 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
392 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
393 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
400 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 8.65
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000745 3300003373 Bacteria 6845
2 JGI25407J50210_10005977 3300003373 Bacteria 3014
3 JGI25407J50210_10011530 3300003373 Bacteria 2260
4 JGI25407J50210_10023709 3300003373 Bacteria 1592
5 JGI25407J50210_10029278 3300003373 Bacteria 1427
6 JGI25407J50210_10058881 3300003373 Bacteria 967
7 Ga0070658_10328024 3300005327 Bacteria 1308
8 Ga0070658_10643591 3300005327 Bacteria 920
9 Ga0070658_11110489 3300005327 Bacteria 688
10 Ga0070676_10972386 3300005328 Bacteria 636
11 Ga0070683_100001942 3300005329 Bacteria 16199
12 Ga0070683_100002447 3300005329 Bacteria 14774
13 Ga0070683_100140102 3300005329 Bacteria 2291
14 Ga0070683_100293530 3300005329 Bacteria 1546
15 Ga0070683_100349299 3300005329 Bacteria 1408
16 Ga0070683_100457389 3300005329 Bacteria 1218
17 Ga0070690_100574311 3300005330 Bacteria 853
18 Ga0070666_10010923 3300005335 Bacteria 5689
19 Ga0070666_10673988 3300005335 Bacteria 757
20 Ga0070666_10921303 3300005335 Bacteria 646
21 Ga0070680_100001579 3300005336 Bacteria 16617
22 Ga0070680_100387960 3300005336 Bacteria 1190
23 Ga0070680_100476387 3300005336 Bacteria 1067
24 Ga0070680_100992676 3300005336 Bacteria 725
25 Ga0070680_101298931 3300005336 Bacteria 630
26 Ga0070682_100637195 3300005337 Bacteria 847
27 Ga0068868_100224561 3300005338 Bacteria 1573
28 Ga0068868_101844707 3300005338 Bacteria 572
29 Ga0070660_100031718 3300005339 Bacteria 3971
30 Ga0070660_100386271 3300005339 Bacteria 1156
31 Ga0070660_100707299 3300005339 Bacteria 845
32 Ga0070660_100753241 3300005339 Bacteria 818
33 Ga0070660_101131527 3300005339 Unclassified 663
34 Ga0070689_100023924 3300005340 Bacteria 4579
35 Ga0070689_101055933 3300005340 Bacteria 725
36 Ga0070691_10332328 3300005341 Bacteria 839
37 Ga0070687_100069860 3300005343 Bacteria 1882
38 Ga0070687_100107833 3300005343 Bacteria 1571
39 Ga0070661_100265499 3300005344 Bacteria 1328
40 Ga0070661_100950724 3300005344 Bacteria 711
41 Ga0070692_10436258 3300005345 Bacteria 835
42 Ga0070692_10760063 3300005345 Bacteria 658
43 Ga0070668_100403035 3300005347 Bacteria 1168
44 Ga0070668_100795731 3300005347 Bacteria 840
45 Ga0070668_101235357 3300005347 Bacteria 678
46 Ga0070668_101273289 3300005347 Bacteria 668
47 Ga0070668_101952215 3300005347 Bacteria 541
48 Ga0070669_100529749 3300005353 Bacteria 980
49 Ga0070669_101079661 3300005353 Bacteria 691
50 Ga0070675_100792599 3300005354 Bacteria 866
51 Ga0070671_100182910 3300005355 Bacteria 1775
52 Ga0070671_100374264 3300005355 Bacteria 1217
53 Ga0070674_100070741 3300005356 Bacteria 2466
54 Ga0070674_100334268 3300005356 Bacteria 1218
55 Ga0070674_100916896 3300005356 Unclassified 764
56 Ga0070688_100043752 3300005365 Bacteria 2761
57 Ga0070688_100105690 3300005365 Bacteria 1864
58 Ga0070659_100010767 3300005366 Bacteria 6742
59 Ga0070659_100114192 3300005366 Bacteria 2182
60 Ga0070659_100287743 3300005366 Bacteria 1368
61 Ga0070659_101168463 3300005366 Bacteria 680
62 Ga0070659_101789306 3300005366 Bacteria 550
63 Ga0070667_100012591 3300005367 Bacteria 6996
64 Ga0070667_100402565 3300005367 Bacteria 1246
65 Ga0070709_11485806 3300005434 Bacteria 550
66 Ga0070714_100044673 3300005435 Bacteria 3751
67 Ga0070714_100106346 3300005435 Bacteria 2479
68 Ga0070714_100123571 3300005435 Bacteria 2305
69 Ga0070714_100199471 3300005435 Bacteria 1830
70 Ga0070714_100504780 3300005435 Bacteria 1154
71 Ga0070714_100805565 3300005435 Bacteria 910
72 Ga0070714_100901041 3300005435 Bacteria 859
73 Ga0070714_101079651 3300005435 Bacteria 782
74 Ga0070714_101740701 3300005435 Bacteria 609
75 Ga0070713_100000005 3300005436 Bacteria 201526
76 Ga0070713_100084534 3300005436 Bacteria 2715
77 Ga0070713_100132384 3300005436 Bacteria 2200
78 Ga0070713_101143145 3300005436 Bacteria 753
79 Ga0070710_10003670 3300005437 Bacteria 7258
80 Ga0070710_10092276 3300005437 Bacteria 1788
81 Ga0070710_10803628 3300005437 Bacteria 672
82 Ga0070710_10958481 3300005437 Bacteria 621
83 Ga0070701_11022204 3300005438 Bacteria 578
84 Ga0070711_100003433 3300005439 Bacteria 9231
85 Ga0070711_100028021 3300005439 Bacteria 3703
86 Ga0070711_100085789 3300005439 Bacteria 2256
87 Ga0070711_100127953 3300005439 Bacteria 1888
88 Ga0070711_100168083 3300005439 Bacteria 1669
89 Ga0070711_100439860 3300005439 Bacteria 1066
90 Ga0070711_101115758 3300005439 Bacteria 680
91 Ga0070705_101759415 3300005440 Bacteria 525
92 Ga0070700_100031582 3300005441 Bacteria 3175
93 Ga0070700_100821631 3300005441 Bacteria 750
94 Ga0070700_101246568 3300005441 Bacteria 623
95 Ga0070700_101555405 3300005441 Bacteria 564
96 Ga0070700_101941589 3300005441 Bacteria 510
97 Ga0070694_100111943 3300005444 Bacteria 1946
98 Ga0070694_100310903 3300005444 Bacteria 1210
99 Ga0070708_100271705 3300005445 Bacteria 1594
100 Ga0070663_100001455 3300005455 Bacteria 13013
101 Ga0070663_100156388 3300005455 Bacteria 1752
102 Ga0070663_100568306 3300005455 Bacteria 950
103 Ga0070663_101237975 3300005455 Bacteria 657
104 Ga0070678_100235280 3300005456 Bacteria 1529
105 Ga0070678_100389328 3300005456 Unclassified 1208
106 Ga0070678_100802517 3300005456 Bacteria 855
107 Ga0070662_100363466 3300005457 Bacteria 1188
108 Ga0070662_100487631 3300005457 Bacteria 1027
109 Ga0070681_10066681 3300005458 Bacteria 3568
110 Ga0070681_10343829 3300005458 Bacteria 1402
111 Ga0070681_10937258 3300005458 Bacteria 785
112 Ga0070681_11650091 3300005458 Bacteria 567
113 Ga0068867_100389237 3300005459 Bacteria 1173
114 Ga0070706_100467373 3300005467 Bacteria 1174
115 Ga0070706_101458385 3300005467 Bacteria 626
116 Ga0070707_100005848 3300005468 Bacteria 11466
117 Ga0070707_100564693 3300005468 Bacteria 1100
118 Ga0070679_100000527 3300005530 Bacteria 32553
119 Ga0070679_100011262 3300005530 Bacteria 8524
120 Ga0070679_100034741 3300005530 Bacteria 4998
121 Ga0070679_100291078 3300005530 Bacteria 1584
122 Ga0070684_100059444 3300005535 Bacteria 3342
123 Ga0070684_100166953 3300005535 Bacteria 1998
124 Ga0070684_100168720 3300005535 Bacteria 1987
125 Ga0070684_100251286 3300005535 Bacteria 1616
126 Ga0070684_100272497 3300005535 Bacteria 1549
127 Ga0070684_100277473 3300005535 Bacteria 1535
128 Ga0070684_100391698 3300005535 Bacteria 1280
129 Ga0070684_100541709 3300005535 Bacteria 1080
130 Ga0068853_101068936 3300005539 Bacteria 778
131 Ga0068853_101452457 3300005539 Bacteria 664
132 Ga0068853_101636016 3300005539 Bacteria 624
133 Ga0068853_101726514 3300005539 Bacteria 607
134 Ga0070672_100341215 3300005543 Bacteria 1276
135 Ga0070672_101095345 3300005543 Bacteria 708
136 Ga0070686_100099972 3300005544 Bacteria 1957
137 Ga0070686_101098500 3300005544 Bacteria 657
138 Ga0070686_101221018 3300005544 Bacteria 625
139 Ga0070686_101425971 3300005544 Bacteria 582
140 Ga0070696_100248980 3300005546 Bacteria 1343
141 Ga0070696_100416203 3300005546 Bacteria 1054
142 Ga0070693_100148097 3300005547 Bacteria 1484
143 Ga0070665_100017416 3300005548 Bacteria 7213
144 Ga0070665_100064533 3300005548 Bacteria 3673
145 Ga0070665_100249228 3300005548 Bacteria 1777
146 Ga0070665_101189944 3300005548 Bacteria 773
147 Ga0070704_100321353 3300005549 Bacteria 1297
148 Ga0070704_100569915 3300005549 Bacteria 991
149 Ga0070704_101003887 3300005549 Unclassified 755
150 Ga0070704_101132033 3300005549 Bacteria 712
151 Ga0070664_100043951 3300005564 Bacteria 3771
152 Ga0070664_100242334 3300005564 Bacteria 1619
153 Ga0070664_100392131 3300005564 Bacteria 1269
154 Ga0070664_100959564 3300005564 Bacteria 803
155 Ga0068857_100476017 3300005577 Bacteria 1170
156 Ga0068857_100598911 3300005577 Bacteria 1042
157 Ga0068854_100410261 3300005578 Bacteria 1123
158 Ga0068854_100771298 3300005578 Bacteria 836
159 Ga0068854_100811724 3300005578 Bacteria 816
160 Ga0068856_100008571 3300005614 Bacteria 9941
161 Ga0068856_100048926 3300005614 Plasmid 4167
162 Ga0068856_100330291 3300005614 Bacteria 1542
163 Ga0068856_100756573 3300005614 Bacteria 992
164 Ga0068856_101273330 3300005614 Bacteria 751
165 Ga0068856_101449916 3300005614 Bacteria 701
166 Ga0068856_101551822 3300005614 Bacteria 676
167 Ga0070702_100008157 3300005615 Bacteria 5061
168 Ga0070702_100163854 3300005615 Bacteria 1440
169 Ga0070702_100248836 3300005615 Bacteria 1204
170 Ga0070702_100310423 3300005615 Bacteria 1095
171 Ga0070702_100653131 3300005615 Bacteria 796
172 Ga0070702_101314675 3300005615 Bacteria 588
173 Ga0068852_100011466 3300005616 Bacteria 6674
174 Ga0068852_100593776 3300005616 Bacteria 1111
175 Ga0068852_100617324 3300005616 Bacteria 1090
176 Ga0068852_101158967 3300005616 Bacteria 794
177 Ga0068852_101991113 3300005616 Bacteria 603
178 Ga0068859_100187234 3300005617 Bacteria 2154
179 Ga0068864_100208535 3300005618 Bacteria 1798
180 Ga0068864_102194659 3300005618 Bacteria 559
181 Ga0068866_10211408 3300005718 Bacteria 1165
182 Ga0068866_10316043 3300005718 Bacteria 981
183 Ga0068861_100818167 3300005719 Bacteria 876
184 Ga0068861_101170905 3300005719 Bacteria 742
185 Ga0068851_10000437 3300005834 Bacteria 18605
186 Ga0068851_10432661 3300005834 Bacteria 779
187 Ga0068851_10983372 3300005834 Bacteria 532
188 Ga0068870_10490522 3300005840 Unclassified 817
189 Ga0068870_10809835 3300005840 Bacteria 655
190 Ga0068863_101322899 3300005841 Bacteria 728
191 Ga0068863_101693727 3300005841 Bacteria 642
192 Ga0068858_100118628 3300005842 Bacteria 2473
193 Ga0068858_100578338 3300005842 Bacteria 1088
194 Ga0068858_101432955 3300005842 Bacteria 681
195 Ga0068858_101784312 3300005842 Bacteria 608
196 Ga0068858_102070750 3300005842 Bacteria 563
197 Ga0068858_102241247 3300005842 Bacteria 540
198 Ga0068862_100340623 3300005844 Bacteria 1389
199 Ga0068862_101324916 3300005844 Bacteria 722
200 Ga0081455_10003758 3300005937 Bacteria 17335
201 Ga0081455_10041583 3300005937 Bacteria 4040
202 Ga0081455_10107170 3300005937 Bacteria 2228
203 Ga0081455_10122556 3300005937 Bacteria 2046
204 Ga0081455_10179218 3300005937 Bacteria 1606
205 Ga0081455_10186868 3300005937 Bacteria 1564
206 Ga0081455_10233677 3300005937 Bacteria 1355
207 Ga0081455_10256525 3300005937 Bacteria 1275
208 Ga0081455_10462765 3300005937 Bacteria 863
209 Ga0081455_10532025 3300005937 Bacteria 782
210 Ga0081455_10868871 3300005937 Bacteria 562
211 Ga0081455_10928170 3300005937 Bacteria 540
212 Ga0081455_10933854 3300005937 Bacteria 538
213 Ga0081455_11060822 3300005937 Bacteria 501
214 Ga0081538_10000267 3300005981 Bacteria 59638
215 Ga0081538_10000287 3300005981 Bacteria 57864
216 Ga0081538_10000673 3300005981 Bacteria 37575
217 Ga0081538_10000700 3300005981 Bacteria 36835
218 Ga0081538_10001042 3300005981 Bacteria 29561
219 Ga0081538_10002352 3300005981 Bacteria 18600
220 Ga0081538_10002361 3300005981 Bacteria 18551
221 Ga0081538_10003365 3300005981 Bacteria 15139
222 Ga0081538_10003816 3300005981 Bacteria 14080
223 Ga0081538_10008580 3300005981 Bacteria 8651
224 Ga0081538_10014118 3300005981 Bacteria 6276
225 Ga0081538_10016300 3300005981 Bacteria 5706
226 Ga0081538_10048700 3300005981 Bacteria 2580
227 Ga0081538_10064310 3300005981 Bacteria 2076
228 Ga0081538_10077703 3300005981 Bacteria 1786
229 Ga0081538_10085102 3300005981 Bacteria 1663
230 Ga0081538_10095507 3300005981 Bacteria 1518
231 Ga0081538_10118141 3300005981 Bacteria 1282
232 Ga0081538_10183034 3300005981 Bacteria 893
233 Ga0081538_10193037 3300005981 Bacteria 850
234 Ga0081538_10256991 3300005981 Bacteria 662
235 Ga0081538_10278224 3300005981 Bacteria 623
236 Ga0081538_10279433 3300005981 Bacteria 621
237 Ga0081540_1112463 3300005983 Bacteria 1147
238 Ga0081539_10008806 3300005985 Bacteria 8644
239 Ga0081539_10013216 3300005985 Bacteria 6245
240 Ga0081539_10138442 3300005985 Bacteria 1186
241 Ga0081539_10296829 3300005985 Bacteria 696
242 Ga0070717_10020393 3300006028 Bacteria 5213
243 Ga0070717_10076451 3300006028 Bacteria 2803
244 Ga0070717_10201302 3300006028 Bacteria 1744
245 Ga0070717_10749482 3300006028 Bacteria 888
246 Ga0075365_10007627 3300006038 Bacteria 6079
247 Ga0075365_10015205 3300006038 Bacteria 4650
248 Ga0075365_10015658 3300006038 Bacteria 4592
249 Ga0075365_10257776 3300006038 Bacteria 1226
250 Ga0075365_10553106 3300006038 Bacteria 814
251 Ga0075365_10770296 3300006038 Bacteria 679
252 Ga0075363_100004752 3300006048 Bacteria 5985
253 Ga0075363_100080586 3300006048 Bacteria 1780
254 Ga0075363_100266633 3300006048 Bacteria 988
255 Ga0075363_100267406 3300006048 Bacteria 987
256 Ga0075363_100380839 3300006048 Bacteria 827
257 Ga0075363_100412916 3300006048 Bacteria 794
258 Ga0075364_10025145 3300006051 Bacteria 3788
259 Ga0075364_10202286 3300006051 Bacteria 1346
260 Ga0075364_10227075 3300006051 Bacteria 1268
261 Ga0075364_10259848 3300006051 Bacteria 1180
262 Ga0075364_10272243 3300006051 Bacteria 1152
263 Ga0075364_10272608 3300006051 Bacteria 1151
264 Ga0075364_10561637 3300006051 Bacteria 780
265 Ga0075364_10695930 3300006051 Bacteria 694
266 Ga0075432_10031466 3300006058 Bacteria 1837
267 Ga0070716_100224617 3300006173 Bacteria 1264
268 Ga0070716_100467522 3300006173 Bacteria 923
269 Ga0070716_100603471 3300006173 Bacteria 826
270 Ga0070716_100771414 3300006173 Bacteria 742
271 Ga0070716_101562916 3300006173 Bacteria 541
272 Ga0070712_100009980 3300006175 Bacteria 5985
273 Ga0070712_100078477 3300006175 Bacteria 2384
274 Ga0070712_100177230 3300006175 Bacteria 1658
275 Ga0070712_100183104 3300006175 Bacteria 1634
276 Ga0070712_100267543 3300006175 Bacteria 1372
277 Ga0070712_100606472 3300006175 Bacteria 927
278 Ga0070712_100675487 3300006175 Bacteria 879
279 Ga0070712_101008311 3300006175 Bacteria 721
280 Ga0070712_101585051 3300006175 Bacteria 573
281 Ga0075367_10076754 3300006178 Bacteria 2016
282 Ga0097621_100411386 3300006237 Bacteria 1212
283 Ga0097621_101359534 3300006237 Bacteria 672
284 Ga0075370_10480190 3300006353 Bacteria 749
285 Ga0075428_100061413 3300006844 Bacteria 4116
286 Ga0075428_100080159 3300006844 Bacteria 3563
287 Ga0075428_100257377 3300006844 Bacteria 1880
288 Ga0075428_100265368 3300006844 Bacteria 1848
289 Ga0075428_100471332 3300006844 Bacteria 1344
290 Ga0075428_100472824 3300006844 Bacteria 1342
291 Ga0075428_100995081 3300006844 Bacteria 888
292 Ga0075430_100008692 3300006846 Bacteria 8569
293 Ga0075430_100012978 3300006846 Bacteria 7101
294 Ga0075430_100388989 3300006846 Bacteria 1151
295 Ga0075430_101398707 3300006846 Bacteria 575
296 Ga0075430_101756551 3300006846 Bacteria 509
297 Ga0075431_100008864 3300006847 Bacteria 10080
298 Ga0075431_100020305 3300006847 Bacteria 6785
299 Ga0075431_100464883 3300006847 Bacteria 1259
300 Ga0075431_100988586 3300006847 Bacteria 809
301 Ga0075431_101294469 3300006847 Bacteria 690
302 Ga0075431_101866276 3300006847 Bacteria 557
303 Ga0075433_10439502 3300006852 Bacteria 1150
304 Ga0075433_10448408 3300006852 Bacteria 1137
305 Ga0075433_10842191 3300006852 Bacteria 801
306 Ga0075434_100123029 3300006871 Bacteria 2610
307 Ga0075434_100454123 3300006871 Bacteria 1303
308 Ga0075434_101404856 3300006871 Bacteria 708
309 Ga0075429_100229040 3300006880 Bacteria 1628
310 Ga0075429_100643639 3300006880 Bacteria 929
311 Ga0068865_100000061 3300006881 Bacteria 57211
312 Ga0068865_100288920 3300006881 Bacteria 1308
313 Ga0068865_100398196 3300006881 Bacteria 1127
314 Ga0068865_100491940 3300006881 Bacteria 1021
315 Ga0075436_100034139 3300006914 Bacteria 3507
316 Ga0075436_100607050 3300006914 Bacteria 806
317 Ga0075436_100680764 3300006914 Bacteria 761
318 Ga0097620_100187250 3300006931 Bacteria 2154
319 Ga0075435_100658168 3300007076 Bacteria 909
320 Ga0075435_100882782 3300007076 Bacteria 779
321 Ga0075435_102058247 3300007076 Bacteria 501
322 Ga0099794_10101351 3300007265 Bacteria 1437
323 Ga0105240_10003780 3300009093 Bacteria 23382
324 Ga0105240_10005426 3300009093 Bacteria 19005
325 Ga0105240_12319946 3300009093 Bacteria 556
326 Ga0111539_10025595 3300009094 Bacteria 7233
327 Ga0111539_10056477 3300009094 Bacteria 4665
328 Ga0111539_10119682 3300009094 Bacteria 3085
329 Ga0111539_10145661 3300009094 Bacteria 2773
330 Ga0111539_10411168 3300009094 Bacteria 1576
331 Ga0111539_10958334 3300009094 Bacteria 995
332 Ga0111539_11366151 3300009094 Bacteria 822
333 Ga0111539_11487619 3300009094 Bacteria 785
334 Ga0111539_11489384 3300009094 Bacteria 785
335 Ga0111539_11578237 3300009094 Unclassified 761
336 Ga0111539_11838461 3300009094 Bacteria 702
337 Ga0105245_10000553 3300009098 Bacteria 33948
338 Ga0105245_10111153 3300009098 Bacteria 2548
339 Ga0105245_10288447 3300009098 Bacteria 1607
340 Ga0105245_10628311 3300009098 Bacteria 1103
341 Ga0105245_11287493 3300009098 Bacteria 780
342 Ga0105245_11488435 3300009098 Bacteria 728
343 Ga0105245_11549657 3300009098 Bacteria 714
344 Ga0105245_11856571 3300009098 Bacteria 656
345 Ga0105245_12104461 3300009098 Bacteria 618
346 Ga0105245_12434931 3300009098 Bacteria 577
347 Ga0105245_12680423 3300009098 Bacteria 551
348 Ga0105247_10658461 3300009101 Bacteria 783
349 Ga0105247_11252560 3300009101 Bacteria 593
350 Ga0114129_10013696 3300009147 Bacteria 11556
351 Ga0114129_10124209 3300009147 Bacteria 3550
352 Ga0114129_10206139 3300009147 Bacteria 2660
353 Ga0114129_10492555 3300009147 Bacteria 1602
354 Ga0114129_10849816 3300009147 Bacteria 1160
355 Ga0114129_10878134 3300009147 Bacteria 1138
356 Ga0114129_10890791 3300009147 Bacteria 1128
357 Ga0114129_11287249 3300009147 Bacteria 907
358 Ga0114129_11581949 3300009147 Bacteria 803
359 Ga0114129_12084980 3300009147 Bacteria 684
360 Ga0114129_12091207 3300009147 Bacteria 683
361 Ga0114129_13037784 3300009147 Bacteria 550
362 Ga0105243_10069009 3300009148 Bacteria 2850
363 Ga0105243_10218086 3300009148 Bacteria 1684
364 Ga0105243_10358550 3300009148 Bacteria 1341
365 Ga0105243_10600092 3300009148 Bacteria 1060
366 Ga0105243_10616461 3300009148 Bacteria 1047
367 Ga0105243_11125139 3300009148 Bacteria 795
368 Ga0105243_11199677 3300009148 Bacteria 772
369 Ga0105243_11242115 3300009148 Bacteria 760
370 Ga0105243_11621533 3300009148 Bacteria 674
371 Ga0105243_11954552 3300009148 Bacteria 620
372 Ga0105241_11374582 3300009174 Bacteria 675
373 Ga0105241_11377121 3300009174 Bacteria 674
374 Ga0105241_11872201 3300009174 Bacteria 587
375 Ga0105242_10910545 3300009176 Bacteria 880
376 Ga0105242_11051024 3300009176 Bacteria 825
377 Ga0105242_11172268 3300009176 Bacteria 786
378 Ga0105242_11673252 3300009176 Bacteria 672
379 Ga0105242_13079531 3300009176 Bacteria 517
380 Ga0105248_11270480 3300009177 Bacteria 833
381 Ga0105248_11501278 3300009177 Bacteria 763
382 Ga0105248_12362935 3300009177 Bacteria 605
383 Ga0105237_10000657 3300009545 Bacteria 47992
384 Ga0105237_10108975 3300009545 Bacteria 2761
385 Ga0105237_10718843 3300009545 Bacteria 1005
386 Ga0105238_10014489 3300009551 Bacteria 7972
387 Ga0105238_11195915 3300009551 Bacteria 784
388 Ga0105238_11359166 3300009551 Bacteria 737
389 Ga0105238_12203906 3300009551 Bacteria 586
390 Ga0105238_12665256 3300009551 Bacteria 536
391 Ga0105249_10035666 3300009553 Bacteria 4510
392 Ga0105249_10156238 3300009553 Bacteria 2200
393 Ga0105249_10487168 3300009553 Bacteria 1277
394 Ga0105249_11015583 3300009553 Bacteria 898
395 Ga0105249_11147719 3300009553 Bacteria 848
396 Ga0105249_11385074 3300009553 Unclassified 775
397 Ga0105249_11878931 3300009553 Bacteria 671
398 Ga0105249_11984619 3300009553 Bacteria 655
399 Ga0105249_12552423 3300009553 Bacteria 583
400 Ga0105239_10012423 3300010375 Bacteria 9484
401 Ga0105239_10776048 3300010375 Bacteria 1098
402 Ga0105239_10912106 3300010375 Bacteria 1008
403 Ga0105239_11624327 3300010375 Bacteria 748
404 Ga0105239_12312476 3300010375 Bacteria 626
405 Ga0105239_13547806 3300010375 Bacteria 507
406 Ga0105246_10207328 3300011119 Bacteria 1528
407 Ga0105246_11053331 3300011119 Bacteria 740
408 Ga0105246_11545338 3300011119 Bacteria 625
409 Ga0105246_11614003 3300011119 Bacteria 613
410 Ga0105246_11918344 3300011119 Bacteria 569
411 Ga0105246_11949345 3300011119 Bacteria 565
412 Ga0157373_11209507 3300013100 Unclassified 570
413 Ga0157371_10116532 3300013102 Bacteria 1898
414 Ga0157371_10986171 3300013102 Bacteria 642
415 Ga0157371_11224294 3300013102 Bacteria 579
416 Ga0157370_10062842 3300013104 Bacteria 3520
417 Ga0157370_11120990 3300013104 Bacteria 711
418 Ga0157369_10004916 3300013105 Bacteria 15669
419 Ga0157369_11365561 3300013105 Bacteria 722
420 Ga0157369_11648754 3300013105 Bacteria 652
421 Ga0157369_12098885 3300013105 Bacteria 573
422 Ga0157374_11521324 3300013296 Bacteria 693
423 Ga0157374_11726409 3300013296 Bacteria 651
424 Ga0157378_10299726 3300013297 Bacteria 1555
425 Ga0157378_10694935 3300013297 Bacteria 1036
426 Ga0157378_11861007 3300013297 Bacteria 650
427 Ga0163162_10543595 3300013306 Bacteria 1290
428 Ga0163162_11161386 3300013306 Bacteria 876
429 Ga0163162_11975909 3300013306 Bacteria 668
430 Ga0163162_12103293 3300013306 Bacteria 647
431 Ga0157372_10008003 3300013307 Bacteria 11245
432 Ga0157372_10246843 3300013307 Bacteria 2072
433 Ga0157372_10316746 3300013307 Bacteria 1816
434 Ga0157372_10541446 3300013307 Bacteria 1357
435 Ga0157372_12199866 3300013307 Bacteria 634
436 Ga0157372_12575632 3300013307 Bacteria 584
437 Ga0157372_12668076 3300013307 Bacteria 573
438 Ga0157375_11225367 3300013308 Bacteria 881
439 Ga0157375_12327053 3300013308 Bacteria 639
440 Ga0157375_13737377 3300013308 Bacteria 506
441 Ga0163163_10187373 3300014325 Bacteria 2117
442 Ga0163163_10264691 3300014325 Bacteria 1770
443 Ga0163163_10274109 3300014325 Bacteria 1738
444 Ga0163163_10361707 3300014325 Bacteria 1508
445 Ga0163163_10593585 3300014325 Bacteria 1171
446 Ga0163163_11191372 3300014325 Bacteria 824
447 Ga0163163_11424125 3300014325 Bacteria 755
448 Ga0163163_11743896 3300014325 Bacteria 683
449 Ga0163163_12138444 3300014325 Bacteria 619
450 Ga0157380_10458201 3300014326 Bacteria 1227
451 Ga0157380_11319131 3300014326 Bacteria 770
452 Ga0157380_12276686 3300014326 Unclassified 606
453 Ga0157380_13302867 3300014326 Bacteria 516
454 Ga0157380_13497053 3300014326 Bacteria 503
455 Ga0182008_10483279 3300014497 Bacteria 678
456 Ga0157377_10293775 3300014745 Bacteria 1070
457 Ga0157379_10018278 3300014968 Bacteria 6178
458 Ga0157379_10928923 3300014968 Bacteria 826
459 Ga0157379_11192217 3300014968 Bacteria 732
460 Ga0157376_11061232 3300014969 Bacteria 835
461 Ga0157376_11074037 3300014969 Bacteria 830
462 Ga0157376_11099890 3300014969 Bacteria 820
463 Ga0157376_12501153 3300014969 Bacteria 556
464 Ga0206356_11774943 3300020070 Bacteria 1376
465 Ga0206354_10052142 3300020081 Bacteria 1223
466 Ga0206353_11150984 3300020082 Bacteria 7105
467 Ga0206353_11699445 3300020082 Bacteria 882
468 Ga0206353_11767557 3300020082 Bacteria 589
469 Ga0213874_10006129 3300021377 Bacteria 2834
470 Ga0213874_10007315 3300021377 Bacteria 2646
471 Ga0213876_10024395 3300021384 Bacteria 3193
472 Ga0213876_10121769 3300021384 Bacteria 1385
473 Ga0213876_10165842 3300021384 Bacteria 1175
474 Ga0213875_10000039 3300021388 Bacteria 156845
475 Ga0213875_10411259 3300021388 Bacteria 645
476 Ga0224712_10560137 3300022467 Bacteria 556
477 Ga0207656_10000888 3300025321 Bacteria 9760
478 Ga0207656_10669578 3300025321 Bacteria 531
479 Ga0207692_10115083 3300025898 Bacteria 1498
480 Ga0207692_10253111 3300025898 Bacteria 1056
481 Ga0207692_10519086 3300025898 Bacteria 758
482 Ga0207692_10570636 3300025898 Bacteria 725
483 Ga0207710_10115614 3300025900 Bacteria 1277
484 Ga0207688_10080836 3300025901 Bacteria 1855
485 Ga0207688_10354470 3300025901 Bacteria 904
486 Ga0207680_10026183 3300025903 Bacteria 3230
487 Ga0207680_10034956 3300025903 Bacteria 2880
488 Ga0207680_10938487 3300025903 Bacteria 620
489 Ga0207685_10121154 3300025905 Bacteria 1148
490 Ga0207699_10090676 3300025906 Bacteria 1918
491 Ga0207699_10429188 3300025906 Bacteria 945
492 Ga0207705_10671620 3300025909 Bacteria 806
493 Ga0207705_10762301 3300025909 Bacteria 752
494 Ga0207684_10188573 3300025910 Bacteria 1778
495 Ga0207707_10142134 3300025912 Bacteria 2098
496 Ga0207707_10233014 3300025912 Bacteria 1602
497 Ga0207707_10276327 3300025912 Bacteria 1455
498 Ga0207707_11451386 3300025912 Bacteria 545
499 Ga0207695_10015780 3300025913 Bacteria 8874
500 Ga0207695_10101703 3300025913 Bacteria 2868
501 Ga0207671_10000926 3300025914 Bacteria 36838
502 Ga0207671_10158969 3300025914 Bacteria 1749
503 Ga0207671_10591707 3300025914 Bacteria 884
504 Ga0207693_10002816 3300025915 Bacteria 15068
505 Ga0207693_10276228 3300025915 Bacteria 1316
506 Ga0207693_10322450 3300025915 Bacteria 1209
507 Ga0207693_10645703 3300025915 Bacteria 822
508 Ga0207693_10858619 3300025915 Bacteria 698
509 Ga0207693_11083612 3300025915 Bacteria 609
510 Ga0207663_10000456 3300025916 Bacteria 17782
511 Ga0207663_10007857 3300025916 Bacteria 5559
512 Ga0207663_10096720 3300025916 Bacteria 1973
513 Ga0207663_10288465 3300025916 Bacteria 1222
514 Ga0207663_10971796 3300025916 Bacteria 681
515 Ga0207663_11455491 3300025916 Bacteria 552
516 Ga0207660_10008646 3300025917 Bacteria 6583
517 Ga0207660_10647112 3300025917 Bacteria 862
518 Ga0207662_10038327 3300025918 Bacteria 2808
519 Ga0207662_10397010 3300025918 Bacteria 934
520 Ga0207657_10048398 3300025919 Bacteria 3713
521 Ga0207657_10456583 3300025919 Bacteria 1002
522 Ga0207657_10513081 3300025919 Bacteria 938
523 Ga0207657_10635334 3300025919 Bacteria 832
524 Ga0207649_10188747 3300025920 Bacteria 1448
525 Ga0207649_10205991 3300025920 Bacteria 1392
526 Ga0207649_10336144 3300025920 Bacteria 1114
527 Ga0207652_10000437 3300025921 Bacteria 43281
528 Ga0207652_10041264 3300025921 Bacteria 3922
529 Ga0207652_10116272 3300025921 Bacteria 2376
530 Ga0207652_10198647 3300025921 Bacteria 1805
531 Ga0207652_10245625 3300025921 Bacteria 1614
532 Ga0207652_11863849 3300025921 Bacteria 507
533 Ga0207646_10057897 3300025922 Bacteria 3462
534 Ga0207681_10163206 3300025923 Bacteria 1682
535 Ga0207681_11007631 3300025923 Bacteria 699
536 Ga0207694_11172119 3300025924 Bacteria 650
537 Ga0207659_11469123 3300025926 Bacteria 584
538 Ga0207659_11833984 3300025926 Bacteria 515
539 Ga0207687_10000245 3300025927 Bacteria 36917
540 Ga0207687_10303019 3300025927 Bacteria 1288
541 Ga0207687_10412913 3300025927 Bacteria 1112
542 Ga0207700_10000003 3300025928 Bacteria 500797
543 Ga0207700_10126438 3300025928 Bacteria 2081
544 Ga0207700_10337031 3300025928 Bacteria 1310
545 Ga0207700_10733097 3300025928 Bacteria 883
546 Ga0207664_10007507 3300025929 Bacteria 7564
547 Ga0207664_10047590 3300025929 Bacteria 3370
548 Ga0207664_10064701 3300025929 Bacteria 2926
549 Ga0207664_10077353 3300025929 Bacteria 2696
550 Ga0207664_10163715 3300025929 Bacteria 1899
551 Ga0207664_10383607 3300025929 Unclassified 1248
552 Ga0207664_10388698 3300025929 Bacteria 1239
553 Ga0207664_10719556 3300025929 Bacteria 898
554 Ga0207664_10851614 3300025929 Bacteria 819
555 Ga0207664_11669253 3300025929 Bacteria 559
556 Ga0207644_10995100 3300025931 Bacteria 704
557 Ga0207690_10025608 3300025932 Bacteria 3707
558 Ga0207690_10044723 3300025932 Bacteria 2920
559 Ga0207690_10114323 3300025932 Bacteria 1949
560 Ga0207690_10315653 3300025932 Bacteria 1227
561 Ga0207690_11131912 3300025932 Bacteria 653
562 Ga0207690_11232176 3300025932 Bacteria 625
563 Ga0207706_10159993 3300025933 Bacteria 1980
564 Ga0207686_10151692 3300025934 Bacteria 1614
565 Ga0207709_10054507 3300025935 Bacteria 2466
566 Ga0207709_10203613 3300025935 Unclassified 1415
567 Ga0207709_10649805 3300025935 Bacteria 840
568 Ga0207709_11389727 3300025935 Bacteria 581
569 Ga0207709_11839831 3300025935 Bacteria 504
570 Ga0207670_10015345 3300025936 Bacteria 4576
571 Ga0207670_10182457 3300025936 Bacteria 1582
572 Ga0207669_10155533 3300025937 Bacteria 1608
573 Ga0207669_10280754 3300025937 Bacteria 1256
574 Ga0207669_10321941 3300025937 Bacteria 1184
575 Ga0207669_10337854 3300025937 Bacteria 1159
576 Ga0207704_10326400 3300025938 Bacteria 1186
577 Ga0207704_10412283 3300025938 Bacteria 1069
578 Ga0207704_10856528 3300025938 Bacteria 762
579 Ga0207665_10229605 3300025939 Bacteria 1364
580 Ga0207665_10287311 3300025939 Bacteria 1226
581 Ga0207665_10454119 3300025939 Bacteria 984
582 Ga0207691_10534795 3300025940 Bacteria 994
583 Ga0207711_11879575 3300025941 Bacteria 542
584 Ga0207661_10008946 3300025944 Bacteria 7170
585 Ga0207661_10009920 3300025944 Bacteria 6839
586 Ga0207661_10013529 3300025944 Bacteria 5959
587 Ga0207661_10036293 3300025944 Bacteria 3846
588 Ga0207661_10321330 3300025944 Bacteria 1391
589 Ga0207661_10816516 3300025944 Bacteria 858
590 Ga0207679_10072882 3300025945 Bacteria 2596
591 Ga0207679_10247430 3300025945 Bacteria 1514
592 Ga0207679_10709881 3300025945 Bacteria 913
593 Ga0207679_11138634 3300025945 Bacteria 716
594 Ga0207667_10872939 3300025949 Bacteria 893
595 Ga0207712_10084580 3300025961 Bacteria 2319
596 Ga0207712_10478579 3300025961 Bacteria 1061
597 Ga0207712_10688285 3300025961 Bacteria 891
598 Ga0207668_10251425 3300025972 Bacteria 1436
599 Ga0207668_10381087 3300025972 Bacteria 1187
600 Ga0207668_10926780 3300025972 Bacteria 776
601 Ga0207668_10931655 3300025972 Bacteria 774
602 Ga0207640_10348843 3300025981 Bacteria 1188
603 Ga0207640_10349482 3300025981 Bacteria 1188
604 Ga0207640_10798305 3300025981 Bacteria 817
605 Ga0207640_11591790 3300025981 Bacteria 588
606 Ga0207658_10012425 3300025986 Bacteria 5817
607 Ga0207658_10160578 3300025986 Bacteria 1842
608 Ga0207658_10945156 3300025986 Bacteria 786
609 Ga0207677_11176963 3300026023 Bacteria 701
610 Ga0207703_10885070 3300026035 Bacteria 855
611 Ga0207639_10632471 3300026041 Bacteria 989
612 Ga0207639_11093572 3300026041 Bacteria 748
613 Ga0207639_11719161 3300026041 Bacteria 588
614 Ga0207639_12133750 3300026041 Bacteria 521
615 Ga0207678_10003762 3300026067 Bacteria 13646
616 Ga0207678_10268199 3300026067 Bacteria 1463
617 Ga0207678_10313462 3300026067 Bacteria 1349
618 Ga0207678_11017016 3300026067 Bacteria 733
619 Ga0207708_10035095 3300026075 Bacteria 3816
620 Ga0207708_10230288 3300026075 Bacteria 1488
621 Ga0207708_10809684 3300026075 Bacteria 807
622 Ga0207708_10938787 3300026075 Bacteria 750
623 Ga0207702_10018014 3300026078 Bacteria 5846
624 Ga0207702_10049053 3300026078 Bacteria 3562
625 Ga0207702_10212182 3300026078 Bacteria 1800
626 Ga0207702_10630688 3300026078 Bacteria 1053
627 Ga0207702_10650197 3300026078 Bacteria 1037
628 Ga0207702_10714192 3300026078 Bacteria 988
629 Ga0207702_10925860 3300026078 Bacteria 864
630 Ga0207702_11958148 3300026078 Bacteria 577
631 Ga0207641_10164034 3300026088 Bacteria 2022
632 Ga0207641_10850948 3300026088 Bacteria 904
633 Ga0207641_11479542 3300026088 Bacteria 681
634 Ga0207648_10538285 3300026089 Bacteria 1072
635 Ga0207648_11152739 3300026089 Bacteria 727
636 Ga0207648_11157850 3300026089 Bacteria 726
637 Ga0207648_11514811 3300026089 Bacteria 630
638 Ga0207648_11799245 3300026089 Bacteria 574
639 Ga0207676_10071248 3300026095 Bacteria 2790
640 Ga0207676_11283701 3300026095 Bacteria 727
641 Ga0207674_10207844 3300026116 Bacteria 1907
642 Ga0207674_10223437 3300026116 Bacteria 1831
643 Ga0207674_10818277 3300026116 Bacteria 899
644 Ga0207675_100335310 3300026118 Unclassified 1479
645 Ga0207675_100343657 3300026118 Bacteria 1461
646 Ga0207675_100416208 3300026118 Bacteria 1327
647 Ga0207683_10187507 3300026121 Bacteria 1877
648 Ga0207683_10317640 3300026121 Bacteria 1426
649 Ga0207683_10780196 3300026121 Bacteria 887
650 Ga0207698_10079749 3300026142 Bacteria 2634
651 Ga0207698_10737820 3300026142 Bacteria 983
652 Ga0207698_11162988 3300026142 Bacteria 785
653 Ga0209813_10172896 3300027866 Bacteria 786
654 Ga0207428_10039285 3300027907 Bacteria 3843
655 Ga0207428_10392431 3300027907 Bacteria 1017
656 Ga0207428_11293996 3300027907 Bacteria 505
657 Ga0268266_10000775 3300028379 Bacteria 42696
658 Ga0268266_10027142 3300028379 Bacteria 4871
659 Ga0268266_10040678 3300028379 Bacteria 3963
660 Ga0268266_10048879 3300028379 Bacteria 3626
661 Ga0268265_10843507 3300028380 Bacteria 896
662 Ga0268265_12047104 3300028380 Bacteria 580
663 Ga0265337_1000231 3300028556 Bacteria 30088
664 Ga0265337_1000793 3300028556 Bacteria 16632
665 Ga0265326_10000102 3300028558 Bacteria 43681
666 Ga0265326_10000759 3300028558 Bacteria 11938
667 Ga0265326_10079541 3300028558 Bacteria 927
668 Ga0265319_1000035 3300028563 Bacteria 117269
669 Ga0265319_1000711 3300028563 Bacteria 21750
670 Ga0265319_1009092 3300028563 Bacteria 4273
671 Ga0265318_10001005 3300028577 Bacteria 18023
672 Ga0265318_10006420 3300028577 Bacteria 5416
673 Ga0265322_10000001 3300028654 Bacteria 543854
674 Ga0265322_10016130 3300028654 Bacteria 2157
675 Ga0265336_10000002 3300028666 Bacteria 830172
676 Ga0265336_10121243 3300028666 Bacteria 779
677 Ga0265338_10000001 3300028800 Bacteria 1177449
678 Ga0265338_10000171 3300028800 Bacteria 120054
679 Ga0265338_10044366 3300028800 Bacteria 4107
680 Ga0265338_10588346 3300028800 Bacteria 776
681 Ga0265324_10002017 3300029957 Bacteria 10814
682 Ga0265324_10002801 3300029957 Bacteria 8604
683 Ga0265760_10200503 3300031090 Bacteria 674
684 Ga0265328_10211835 3300031239 Bacteria 737
685 Ga0265320_10000002 3300031240 Bacteria 542875
686 Ga0265320_10036861 3300031240 Bacteria 2468
687 Ga0265325_10005914 3300031241 Bacteria 7497
688 Ga0265329_10003038 3300031242 Bacteria 7447
689 Ga0265340_10000001 3300031247 Bacteria 1647668
690 Ga0265339_10054115 3300031249 Bacteria 2181
691 Ga0265339_10058266 3300031249 Bacteria 2086
692 Ga0265331_10001887 3300031250 Bacteria 14737
693 Ga0265331_10023551 3300031250 Bacteria 3127
694 Ga0265331_10476185 3300031250 Bacteria 561
695 Ga0265327_10000011 3300031251 Bacteria 543807
696 Ga0265316_10010658 3300031344 Bacteria 8357
697 Ga0265316_10106406 3300031344 Bacteria 2127
698 Ga0265316_10119166 3300031344 Bacteria 1994
699 Ga0307408_100764095 3300031548 Bacteria 874
700 Ga0307408_102012362 3300031548 Bacteria 556
701 Ga0265313_10026603 3300031595 Bacteria 3044
702 Ga0265313_10094044 3300031595 Bacteria 1340
703 Ga0265314_10000062 3300031711 Bacteria 159496
704 Ga0265314_10025765 3300031711 Bacteria 4430
705 Ga0265314_10100928 3300031711 Bacteria 1855
706 Ga0265342_10150191 3300031712 Bacteria 1294
707 Ga0307405_10533670 3300031731 Bacteria 946
708 Ga0307413_10056354 3300031824 Bacteria 2397
709 Ga0307413_10150126 3300031824 Bacteria 1622
710 Ga0307413_10302453 3300031824 Bacteria 1214
711 Ga0307410_10223178 3300031852 Bacteria 1451
712 Ga0307410_10377706 3300031852 Bacteria 1139
713 Ga0307410_10528668 3300031852 Bacteria 974
714 Ga0307410_10683473 3300031852 Bacteria 864
715 Ga0307410_10975156 3300031852 Bacteria 730
716 Ga0307410_11045037 3300031852 Bacteria 706
717 Ga0307410_11064229 3300031852 Bacteria 700
718 Ga0307410_11288820 3300031852 Bacteria 639
719 Ga0307410_11322177 3300031852 Bacteria 631
720 Ga0307406_10103563 3300031901 Bacteria 1944
721 Ga0307406_10300310 3300031901 Bacteria 1233
722 Ga0307406_10593959 3300031901 Bacteria 912
723 Ga0307406_10917892 3300031901 Bacteria 746
724 Ga0307406_11358550 3300031901 Bacteria 622
725 Ga0307406_11603338 3300031901 Bacteria 575
726 Ga0307412_10781693 3300031911 Unclassified 827
727 Ga0307409_100212749 3300031995 Bacteria 1739
728 Ga0307409_100258319 3300031995 Bacteria 1597
729 Ga0307409_100403961 3300031995 Bacteria 1306
730 Ga0307409_100466342 3300031995 Bacteria 1222
731 Ga0307409_100694160 3300031995 Bacteria 1016
732 Ga0307409_100942276 3300031995 Bacteria 879
733 Ga0307409_101092857 3300031995 Bacteria 818
734 Ga0307409_101364577 3300031995 Bacteria 735
735 Ga0307409_101565932 3300031995 Bacteria 687
736 Ga0307409_102327763 3300031995 Bacteria 565
737 Ga0307416_100063741 3300032002 Bacteria 3020
738 Ga0307416_100089140 3300032002 Bacteria 2640
739 Ga0307416_100162724 3300032002 Bacteria 2065
740 Ga0307416_100244751 3300032002 Bacteria 1741
741 Ga0307416_100389485 3300032002 Bacteria 1427
742 Ga0307416_100583236 3300032002 Bacteria 1196
743 Ga0307416_100894787 3300032002 Bacteria 987
744 Ga0307416_100982031 3300032002 Bacteria 947
745 Ga0307416_101110859 3300032002 Bacteria 895
746 Ga0307416_101639697 3300032002 Bacteria 748
747 Ga0307416_102517163 3300032002 Bacteria 613
748 Ga0307416_103550613 3300032002 Bacteria 522
749 Ga0307414_10851513 3300032004 Bacteria 834
750 Ga0307414_11992370 3300032004 Bacteria 542
751 Ga0307415_100038241 3300032126 Bacteria 3161
752 Ga0307415_100211331 3300032126 Bacteria 1548
753 Ga0307415_100343821 3300032126 Bacteria 1253
754 Ga0307415_100758566 3300032126 Bacteria 882
755 Ga0307415_100760634 3300032126 Bacteria 880
756 Ga0307415_100936163 3300032126 Bacteria 801
757 Ga0307415_100994897 3300032126 Bacteria 779
758 Ga0307415_102477564 3300032126 Bacteria 511
759 Ga0316583_10033392 3300032133 Bacteria 1828
760 Ga0373949_0043151 3300035090 Bacteria 1115
761 Ga0373923_0263083 3300035111 Bacteria 810
762 Ga0373939_0017447 3300035114 Bacteria 1907
763 Ga0373941_0418611 3300035115 Bacteria 557
764 Ga0373954_0232707 3300035118 Bacteria 907
765 Ga0373957_0042517 3300035120 Bacteria 1715
766 Ga0373946_0777776 3300035171 Bacteria 503
767 Ga0373955_0184009 3300035172 Bacteria 1240
768 Ga0373961_0411432 3300035241 Bacteria 521
769 Ga0373933_0091027 3300035724 Bacteria 1882
770 Ga0373937_0011260 3300036401 Bacteria 7841
771 Ga0373937_0807690 3300036401 Bacteria 886
772 Ga0373925_0086623 3300037068 Bacteria 2390
773 Ga0395899_0020715 3300037312 Bacteria 4986
774 Ga0395899_0366605 3300037312 Bacteria 960
775 Ga0395900_0006588 3300037418 Bacteria 12083
776 Ga0395900_0012281 3300037418 Bacteria 8759
777 Ga0395900_0073191 3300037418 Bacteria 3523
778 Ga0395900_0174493 3300037418 Bacteria 2187
779 Ga0395900_0551524 3300037418 Bacteria 1097
780 Ga0395900_0600118 3300037418 Bacteria 1042
781 Ga0395900_0724908 3300037418 Bacteria 926
782 Ga0395900_0742073 3300037418 Bacteria 913
783 Ga0395900_0792355 3300037418 Bacteria 876
784 Ga0395900_1228567 3300037418 Bacteria 664
785 Ga0395898_0001924 3300037466 Bacteria 26406
786 Ga0395898_0008989 3300037466 Bacteria 10516
787 Ga0395898_0013542 3300037466 Bacteria 8397
788 Ga0395898_0013626 3300037466 Bacteria 8367
789 Ga0395898_0067785 3300037466 Bacteria 3454
790 Ga0395898_0089579 3300037466 Bacteria 2961
791 Ga0395898_0153766 3300037466 Bacteria 2201
792 Ga0395898_0165816 3300037466 Bacteria 2113
793 Ga0395898_0298218 3300037466 Bacteria 1538
794 Ga0395898_0318401 3300037466 Bacteria 1484
795 Ga0395898_0378491 3300037466 Bacteria 1350
796 Ga0395898_1273869 3300037466 Bacteria 665
797 Ga0395898_1407647 3300037466 Bacteria 625
798 Ga0395898_1935065 3300037466 Bacteria 509
799 Ga0395898_1961747 3300037466 Bacteria 505
800 Ga0395905_0002248 3300037471 Bacteria 21708
801 Ga0395905_0003203 3300037471 Bacteria 17629
802 Ga0395905_0787182 3300037471 Bacteria 854
803 Ga0395905_0950940 3300037471 Bacteria 762
804 Ga0395905_1009888 3300037471 Bacteria 735
805 Ga0395905_1017699 3300037471 Bacteria 732
806 Ga0395905_1261236 3300037471 Bacteria 643
807 Ga0395905_1438901 3300037471 Bacteria 593
808 Ga0436364_0170146 3300037853 Bacteria 5611
809 Ga0436364_0440996 3300037853 Bacteria 714
810 Ga0436364_0462369 3300037853 Bacteria 93786
811 Ga0436364_0668395 3300037853 Unclassified 696
812 Ga0436364_0845509 3300037853 Bacteria 1489
813 Ga0436364_1250516 3300037853 Bacteria 1280
814 Ga0395901_0015351 3300038443 Bacteria 7794
815 Ga0395901_0020861 3300038443 Bacteria 6710
816 Ga0395901_0021409 3300038443 Bacteria 6624
817 Ga0395901_0042505 3300038443 Bacteria 4712
818 Ga0395901_0055668 3300038443 Bacteria 4113
819 Ga0395901_0131300 3300038443 Bacteria 2632
820 Ga0395901_0276393 3300038443 Bacteria 1746
821 Ga0395901_0329398 3300038443 Bacteria 1579
822 Ga0395901_0426208 3300038443 Bacteria 1360
823 Ga0395901_0510194 3300038443 Bacteria 1223
824 Ga0395901_0528339 3300038443 Bacteria 1198
825 Ga0395901_0558745 3300038443 Bacteria 1159
826 Ga0395901_0564503 3300038443 Bacteria 1152
827 Ga0395901_0898352 3300038443 Bacteria 868
828 Ga0395901_0968150 3300038443 Bacteria 829
829 Ga0242420_071819 3300038996 Bacteria 705
830 Ga0436365_0284935 3300039437 Bacteria 9236
831 Ga0436365_0681522 3300039437 Bacteria 6889
832 Ga0436365_0875320 3300039437 Bacteria 10156
833 Ga0436365_0893932 3300039437 Bacteria 615
834 Ga0436365_1627672 3300039437 Bacteria 915
835 Ga0436365_1629816 3300039437 Bacteria 4844
836 Ga0436365_1719312 3300039437 Bacteria 4142
837 Ga0436361_0514212 3300039447 Bacteria 1052
838 Ga0436363_0278742 3300039450 Bacteria 730
839 Ga0436363_0318653 3300039450 Bacteria 8029
840 Ga0436363_0501969 3300039450 Unclassified 731
841 Ga0436363_0701900 3300039450 Bacteria 5611
842 Ga0436363_0831908 3300039450 Bacteria 949
843 Ga0436363_0968274 3300039450 Bacteria 615
844 Ga0436363_0994750 3300039450 Bacteria 1701
845 Ga0436363_1231557 3300039450 Bacteria 2104
846 Ga0436363_1367021 3300039450 Unclassified 587
847 Ga0436363_1413184 3300039450 Bacteria 817
848 Ga0436363_1550007 3300039450 Bacteria 758
849 Ga0436363_1618679 3300039450 Bacteria 1748
850 Ga0436362_0528265 3300039453 Unclassified 581
851 Ga0436362_0528703 3300039453 Bacteria 552
852 Ga0436362_0611588 3300039453 Bacteria 3112
853 Ga0436362_0662125 3300039453 Bacteria 512
854 Ga0451789_0669134 3300041443 Bacteria 603
855 Ga0451789_0978931 3300041443 Unclassified 687
856 Ga0451789_1019140 3300041443 Bacteria 686
857 Ga0451791_0128912 3300041451 Bacteria 1098
858 Ga0451793_0846886 3300041452 Bacteria 523
859 Ga0451795_0490038 3300041456 Bacteria 508
860 Ga0451800_1460710 3300041459 Bacteria 622
861 Ga0451800_1690997 3300041459 Bacteria 837
862 Ga0451807_2375813 3300041486 Bacteria 525
863 Ga0451833_0871389 3300041491 Bacteria 510
864 Ga0451839_0796435 3300041496 Bacteria 531
865 Ga0451845_0312228 3300041501 Bacteria 608
866 Ga0451849_0855266 3300041505 Bacteria 576
867 Ga0451853_0646730 3300041512 Bacteria 511
868 Ga0451853_1040408 3300041512 Bacteria 909
869 Ga0451853_2534263 3300041512 Bacteria 1121
870 Ga0439444_0053368 3300042437 Bacteria 827
871 Ga0439444_0114700 3300042437 Bacteria 623
872 Ga0439459_0016860 3300042438 Bacteria 1354
873 Ga0439459_0175198 3300042438 Bacteria 574
874 Ga0466969_0385278 3300044656 Bacteria 636
875 Ga0466969_0601765 3300044656 Bacteria 505
876 Ga0466972_0595367 3300044658 Bacteria 523
877 Ga0466965_0375049 3300044683 Bacteria 782
878 Ga0466965_0381093 3300044683 Bacteria 777
879 Ga0466965_0387177 3300044683 Bacteria 771
880 Ga0466965_0533062 3300044683 Bacteria 661
881 Ga0466965_0732233 3300044683 Bacteria 569
882 Ga0466966_0045052 3300044684 Bacteria 2821
883 Ga0466966_0054019 3300044684 Bacteria 2547
884 Ga0466966_0080059 3300044684 Bacteria 2036
885 Ga0466966_0118339 3300044684 Bacteria 1629
886 Ga0466966_0131261 3300044684 Bacteria 1534
887 Ga0466966_0640191 3300044684 Unclassified 640
888 Ga0466961_0010068 3300044693 Bacteria 6024
889 Ga0466961_0118636 3300044693 Bacteria 1662
890 Ga0466961_0588541 3300044693 Bacteria 669
891 Ga0466961_0698631 3300044693 Bacteria 608
892 Ga0466963_0005222 3300044694 Bacteria 7582
893 Ga0466963_0006658 3300044694 Bacteria 6861
894 Ga0466963_0016745 3300044694 Bacteria 4562
895 Ga0466963_0031101 3300044694 Bacteria 3449
896 Ga0466963_0067318 3300044694 Bacteria 2403
897 Ga0466963_0069064 3300044694 Bacteria 2374
898 Ga0466963_0076466 3300044694 Bacteria 2261
899 Ga0466963_0104486 3300044694 Bacteria 1941
900 Ga0466963_0117279 3300044694 Bacteria 1830
901 Ga0466963_0162617 3300044694 Bacteria 1554
902 Ga0466963_0239023 3300044694 Bacteria 1273
903 Ga0466963_0243618 3300044694 Bacteria 1261
904 Ga0466963_0507032 3300044694 Bacteria 852
905 Ga0466963_0562429 3300044694 Bacteria 805
906 Ga0466963_0976861 3300044694 Bacteria 596
907 Ga0466963_1221138 3300044694 Bacteria 528
908 Ga0466964_0737301 3300044706 Bacteria 552
909 Ga0466964_0770399 3300044706 Bacteria 541
910 Ga0466971_0088928 3300044719 Bacteria 1413
911 Ga0466971_0166350 3300044719 Bacteria 1034
912 Ga0466971_0316767 3300044719 Bacteria 751
913 Ga0466968_0035395 3300044735 Bacteria 2089
914 Ga0466968_0078514 3300044735 Bacteria 1447
915 Ga0466968_0089172 3300044735 Bacteria 1364
916 Ga0466968_0106517 3300044735 Bacteria 1257
917 Ga0466968_0259560 3300044735 Bacteria 827
918 Ga0466970_0089968 3300044765 Bacteria 1665
919 Ga0466970_0349268 3300044765 Bacteria 839
920 Ga0466970_0356214 3300044765 Bacteria 831
921 Ga0466970_0854758 3300044765 Unclassified 534
922 Ga0466957_0012160 3300044842 Bacteria 4980
923 Ga0466957_0070771 3300044842 Bacteria 2156
924 Ga0466957_0075847 3300044842 Bacteria 2087
925 Ga0466957_0790815 3300044842 Bacteria 674
926 Ga0466960_0087292 3300044901 Bacteria 1583
927 Ga0466960_0233123 3300044901 Bacteria 1017
928 Ga0466959_0063387 3300045049 Bacteria 2684
929 Ga0466959_0072072 3300045049 Bacteria 2501
930 Ga0466959_0123009 3300045049 Unclassified 1843
931 Ga0466959_0181460 3300045049 Bacteria 1472
932 Ga0466959_0304803 3300045049 Bacteria 1090
933 Ga0466959_0354193 3300045049 Bacteria 1000
934 Ga0466959_0514873 3300045049 Bacteria 808
935 Ga0466959_0827024 3300045049 Bacteria 619
936 Ga0466959_0997297 3300045049 Bacteria 558
937 Ga0466959_1131399 3300045049 Bacteria 520
938 Ga0466959_1173568 3300045049 Bacteria 510
939 Ga0466958_0006396 3300045836 Bacteria 6407
940 Ga0466958_0054472 3300045836 Bacteria 2426
941 Ga0466958_0058694 3300045836 Bacteria 2339
942 Ga0466958_0078726 3300045836 Bacteria 2026
943 Ga0466958_0095175 3300045836 Bacteria 1846
944 Ga0466958_0178821 3300045836 Bacteria 1346
945 Ga0466958_0198503 3300045836 Bacteria 1276
946 Ga0466958_0304752 3300045836 Bacteria 1023
947 Ga0466958_0436320 3300045836 Bacteria 847
948 Ga0466958_0517713 3300045836 Bacteria 774
949 Ga0466958_0713536 3300045836 Bacteria 653
950 Ga0466967_0000002 3300045976 Bacteria 219994
951 Ga0466967_0001530 3300045976 Bacteria 13520
952 Ga0466967_0004605 3300045976 Bacteria 9342
953 Ga0466967_0032493 3300045976 Bacteria 4407
954 Ga0466967_0044008 3300045976 Bacteria 3869
955 Ga0466967_0050187 3300045976 Bacteria 3653
956 Ga0466967_0059144 3300045976 Bacteria 3391
957 Ga0466967_0071601 3300045976 Bacteria 3105
958 Ga0466967_0075434 3300045976 Bacteria 3031
959 Ga0466967_0114500 3300045976 Bacteria 2483
960 Ga0466967_0161105 3300045976 Bacteria 2106
961 Ga0466967_0187274 3300045976 Bacteria 1955
962 Ga0466967_0317125 3300045976 Bacteria 1503
963 Ga0466967_0400062 3300045976 Bacteria 1336
964 Ga0466967_0534823 3300045976 Bacteria 1152
965 Ga0466967_0723427 3300045976 Bacteria 986
966 Ga0466967_0726123 3300045976 Bacteria 985
967 Ga0466967_0844297 3300045976 Bacteria 910
968 Ga0466967_0917396 3300045976 Bacteria 871
969 Ga0466967_0968207 3300045976 Bacteria 847
970 Ga0466967_1025282 3300045976 Unclassified 822
971 Ga0466967_1045822 3300045976 Bacteria 813
972 Ga0466967_1053411 3300045976 Bacteria 810
973 Ga0466967_1068664 3300045976 Bacteria 804
974 Ga0466967_1093108 3300045976 Bacteria 794
975 Ga0466967_1936412 3300045976 Bacteria 586
976 Ga0466967_2318504 3300045976 Bacteria 532
977 Ga0495592_0027842 3300046454 Bacteria 4281
978 Ga0495592_0095484 3300046454 Bacteria 2126
979 Ga0495592_0100343 3300046454 Bacteria 2064
980 Ga0495592_0113866 3300046454 Bacteria 1911
981 Ga0495592_0223371 3300046454 Bacteria 1258
982 Ga0495592_0910477 3300046454 Bacteria 516
983 Ga0495603_0300545 3300046455 Bacteria 922
984 Ga0495629_0187612 3300046459 Bacteria 1432
985 Ga0495629_0216188 3300046459 Bacteria 1323
986 Ga0495629_0399477 3300046459 Bacteria 934
987 Ga0495641_0000004 3300046461 Bacteria 210501
988 Ga0495641_0046351 3300046461 Bacteria 1999
989 Ga0495641_0053796 3300046461 Bacteria 1830
990 Ga0495651_0009616 3300046462 Bacteria 7429
991 Ga0495651_0163756 3300046462 Bacteria 1591
992 Ga0495651_0233311 3300046462 Bacteria 1266
993 Ga0495653_0000352 3300046463 Bacteria 37376
994 Ga0495653_0016825 3300046463 Bacteria 5950
995 Ga0495653_0100178 3300046463 Bacteria 2101
996 Ga0495582_0711929 3300046473 Bacteria 581
997 Ga0495662_0193911 3300046476 Bacteria 1001
998 Ga0495596_0034392 3300046500 Bacteria 2013
999 Ga0495596_0257553 3300046500 Bacteria 677
1000 Ga0495596_0303573 3300046500 Bacteria 621
1001 Ga0495607_0310671 3300046501 Bacteria 739
1002 Ga0495608_0000079 3300046511 Bacteria 71469
1003 Ga0495608_0004801 3300046511 Bacteria 9661
1004 Ga0495618_0254003 3300046514 Bacteria 1102
1005 Ga0495618_0356040 3300046514 Bacteria 901
1006 Ga0495618_0881910 3300046514 Bacteria 517
1007 Ga0495620_0145895 3300046515 Bacteria 924
1008 Ga0495628_0007165 3300046516 Bacteria 9657
1009 Ga0495628_0040415 3300046516 Bacteria 3727
1010 Ga0495628_0071004 3300046516 Bacteria 2715
1011 Ga0495628_0089575 3300046516 Bacteria 2382
1012 Ga0495628_0122122 3300046516 Bacteria 1997
1013 Ga0495630_0043596 3300046517 Bacteria 3352
1014 Ga0495630_0068062 3300046517 Bacteria 2677
1015 Ga0495631_0459591 3300046518 Bacteria 542
1016 Ga0495644_0458859 3300046523 Bacteria 508
1017 Ga0495652_0000003 3300046529 Bacteria 597094
1018 Ga0495652_0016179 3300046529 Bacteria 6670
1019 Ga0495652_0099518 3300046529 Bacteria 2361
1020 Ga0495652_0183354 3300046529 Bacteria 1604
1021 Ga0495652_0552523 3300046529 Bacteria 791
1022 Ga0495652_0829440 3300046529 Bacteria 614
1023 Ga0495665_0598665 3300046531 Bacteria 551
1024 Ga0495587_0008422 3300046536 Bacteria 6631
1025 Ga0495587_0323543 3300046536 Bacteria 861
1026 Ga0495645_0013437 3300046543 Bacteria 5788
1027 Ga0495645_0186286 3300046543 Bacteria 1418
1028 Ga0495645_0198310 3300046543 Bacteria 1363
1029 Ga0495667_0000022 3300046559 Bacteria 176919
1030 Ga0495667_0003362 3300046559 Bacteria 10708
1031 Ga0495656_0693206 3300046615 Bacteria 548
1032 Ga0495668_0087208 3300046616 Bacteria 1712
1033 Ga0495634_0013773 3300046642 Bacteria 5840
1034 Ga0495634_0398582 3300046642 Bacteria 818
1035 Ga0495634_0670593 3300046642 Bacteria 598
1036 Ga0495611_0461298 3300046648 Bacteria 579
1037 Ga0495625_0000787 3300046660 Bacteria 43981
1038 Ga0495635_0005866 3300046663 Bacteria 8559
1039 Ga0495657_0000070 3300046675 Bacteria 92382
1040 Ga0495657_0007999 3300046675 Bacteria 8107
1041 Ga0495657_0298071 3300046675 Bacteria 962
1042 Ga0495599_0115289 3300046678 Bacteria 1672
1043 Ga0495599_0118362 3300046678 Bacteria 1647
1044 Ga0495646_0005095 3300046680 Bacteria 8280
1045 Ga0495658_0904770 3300046683 Bacteria 564
1046 Ga0495669_0011199 3300046684 Bacteria 3804
1047 Ga0495669_0517455 3300046684 Bacteria 580
1048 Ga0495624_0703462 3300046690 Bacteria 600
1049 Ga0495670_0607533 3300046691 Bacteria 596
1050 Ga0495671_0325986 3300046692 Bacteria 737
1051 Ga0495649_0400661 3300046694 Bacteria 689
1052 Ga0495589_0499875 3300046794 Bacteria 555
1053 Ga0495600_0019811 3300046809 Bacteria 4299
1054 Ga0495600_0139827 3300046809 Bacteria 1571
1055 Ga0495581_0814785 3300047315 Bacteria 535
1056 Ga0495604_0000293 3300047317 Bacteria 44767
1057 Ga0495604_0006792 3300047317 Bacteria 9076
1058 Ga0495604_0013478 3300047317 Bacteria 6513
1059 Ga0495674_0022940 3300047319 Bacteria 5750
1060 Ga0495672_0008444 3300047320 Bacteria 7601
1061 Ga0495672_0023008 3300047320 Bacteria 4040
1062 Ga0495672_0024786 3300047320 Bacteria 3857
1063 Ga0495672_0028278 3300047320 Bacteria 3549
1064 Ga0495676_0000860 3300047321 Bacteria 25376
1065 Ga0495676_0049452 3300047321 Bacteria 3380
1066 Ga0495676_0059428 3300047321 Bacteria 3002
1067 Ga0495676_0610656 3300047321 Bacteria 710
1068 Ga0495676_0728096 3300047321 Bacteria 641
1069 Ga0495680_0004597 3300047322 Bacteria 13159
1070 Ga0495680_0011964 3300047322 Bacteria 7658
1071 Ga0495680_0027732 3300047322 Bacteria 4647
1072 Ga0495675_0000569 3300047444 Bacteria 23886
1073 Ga0495675_0483522 3300047444 Bacteria 713
1074 Ga0495677_0461763 3300047445 Bacteria 503
1075 Ga0495679_083916 3300047446 Bacteria 901
1076 Ga0495684_0060993 3300047471 Bacteria 2870
1077 Ga0495684_0462525 3300047471 Bacteria 879
1078 Ga0495686_0163611 3300047472 Bacteria 1298
1079 Ga0495593_0009544 3300047673 Bacteria 5631
1080 Ga0495593_0207252 3300047673 Bacteria 985
1081 Ga0495602_0000393 3300048088 Bacteria 40803
1082 Ga0495602_0003654 3300048088 Bacteria 15936
1083 Ga0495602_0063411 3300048088 Bacteria 3202
1084 Ga0495602_0174004 3300048088 Bacteria 1668
1085 Ga0495602_0190657 3300048088 Bacteria 1572
1086 Ga0495602_0226581 3300048088 Bacteria 1407
1087 Ga0495602_1077356 3300048088 Bacteria 528
1088 Ga0496100_0000001 3300048903 Bacteria 530179
1089 Ga0496100_0000004 3300048903 Bacteria 321778
1090 Ga0496100_0021642 3300048903 Bacteria 3877
1091 Ga0496100_0033861 3300048903 Bacteria 3200
1092 Ga0496100_0067643 3300048903 Bacteria 2373
1093 Ga0496100_0263888 3300048903 Bacteria 1278
1094 Ga0496100_0628123 3300048903 Bacteria 835
1095 Ga0496101_0000007 3300048904 Bacteria 321778
1096 Ga0496101_0000028 3300048904 Bacteria 198664
1097 Ga0496101_0002628 3300048904 Bacteria 11037
1098 Ga0496101_0480986 3300048904 Bacteria 980
1099 Ga0496101_1158706 3300048904 Bacteria 606
1100 Ga0496102_0016316 3300048905 Bacteria 6487
1101 Ga0496102_0133289 3300048905 Bacteria 2327
1102 Ga0496102_0552400 3300048905 Bacteria 1074
1103 Ga0496102_1187321 3300048905 Bacteria 683
1104 Ga0496102_1292070 3300048905 Bacteria 649
1105 Ga0496102_1403489 3300048905 Bacteria 617
1106 Ga0496102_1410647 3300048905 Bacteria 615
1107 Ga0496102_1669979 3300048905 Bacteria 555
1108 Ga0496103_0219180 3300048906 Bacteria 1224
1109 Ga0496103_0396176 3300048906 Bacteria 887
1110 Ga0496104_0002173 3300048907 Bacteria 17015
1111 Ga0496104_0008057 3300048907 Bacteria 9347
1112 Ga0496104_0018264 3300048907 Bacteria 6398
1113 Ga0496104_0043790 3300048907 Bacteria 4204
1114 Ga0496104_0064153 3300048907 Bacteria 3485
1115 Ga0496104_0123482 3300048907 Bacteria 2485
1116 Ga0496104_0545396 3300048907 Bacteria 1070
1117 Ga0496105_0001638 3300048908 Bacteria 15935
1118 Ga0496105_0004885 3300048908 Bacteria 10132
1119 Ga0496105_0046864 3300048908 Bacteria 3568
1120 Ga0496105_0075697 3300048908 Bacteria 2780
1121 Ga0496105_0098434 3300048908 Bacteria 2415
1122 Ga0496105_0222250 3300048908 Bacteria 1537
1123 Ga0496105_0442114 3300048908 Bacteria 1027
1124 Ga0496105_0714565 3300048908 Bacteria 768
1125 Ga0496106_0000004 3300048909 Bacteria 279896
1126 Ga0496106_0000013 3300048909 Bacteria 202263
1127 Ga0496106_0000055 3300048909 Bacteria 91570
1128 Ga0496106_0008739 3300048909 Bacteria 7491
1129 Ga0496106_0091830 3300048909 Bacteria 2344
1130 Ga0496106_0318289 3300048909 Bacteria 1249
1131 Ga0496106_0418532 3300048909 Bacteria 1077
1132 Ga0496107_0000001 3300048910 Bacteria 321778
1133 Ga0496107_0000002 3300048910 Bacteria 320871
1134 Ga0496107_0001160 3300048910 Bacteria 15966
1135 Ga0496107_0060036 3300048910 Bacteria 2752
1136 Ga0496107_0158261 3300048910 Bacteria 1678
1137 Ga0496107_0194104 3300048910 Bacteria 1509
1138 Ga0496107_0323566 3300048910 Bacteria 1147
1139 Ga0496107_1064694 3300048910 Bacteria 585
1140 Ga0496108_0000894 3300048911 Bacteria 23226
1141 Ga0496108_0097078 3300048911 Bacteria 2511
1142 Ga0496108_0224659 3300048911 Bacteria 1632
1143 Ga0496108_0454500 3300048911 Bacteria 1119
1144 Ga0496108_0608961 3300048911 Bacteria 951
1145 Ga0496108_0684876 3300048911 Bacteria 890
1146 Ga0496108_0829293 3300048911 Bacteria 797
1147 Ga0496108_0901370 3300048911 Bacteria 759
1148 Ga0496108_1694499 3300048911 Bacteria 520
1149 Ga0496109_0006929 3300048912 Bacteria 9565
1150 Ga0496109_0033238 3300048912 Bacteria 4640
1151 Ga0496109_0053610 3300048912 Bacteria 3679
1152 Ga0496109_0082049 3300048912 Bacteria 2971
1153 Ga0496109_0090546 3300048912 Bacteria 2829
1154 Ga0496109_0149852 3300048912 Bacteria 2184
1155 Ga0496109_0243426 3300048912 Bacteria 1693
1156 Ga0496109_0283772 3300048912 Bacteria 1561
1157 Ga0496109_0313779 3300048912 Bacteria 1479
1158 Ga0496109_0360669 3300048912 Bacteria 1373
1159 Ga0496109_0600892 3300048912 Bacteria 1036
1160 Ga0496109_0804844 3300048912 Bacteria 878
1161 Ga0496109_1144692 3300048912 Bacteria 715
1162 Ga0496110_0000017 3300048913 Bacteria 83678
1163 Ga0496110_0004843 3300048913 Bacteria 10494
1164 Ga0496110_0012777 3300048913 Bacteria 6915
1165 Ga0496110_0074973 3300048913 Bacteria 3006
1166 Ga0496110_0103494 3300048913 Bacteria 2554
1167 Ga0496110_0103749 3300048913 Bacteria 2550
1168 Ga0496110_0201636 3300048913 Bacteria 1808
1169 Ga0496110_0428696 3300048913 Bacteria 1206
1170 Ga0496110_0865243 3300048913 Bacteria 809
1171 Ga0496110_0994844 3300048913 Bacteria 746
1172 Ga0496110_1231925 3300048913 Bacteria 657
1173 Ga0496111_0000003 3300048914 Bacteria 116144
1174 Ga0496111_0002803 3300048914 Bacteria 10617
1175 Ga0496111_0017810 3300048914 Bacteria 4912
1176 Ga0496111_0096669 3300048914 Bacteria 2168
1177 Ga0496111_0192085 3300048914 Bacteria 1518
1178 Ga0496111_0349553 3300048914 Bacteria 1094
1179 Ga0496111_0388634 3300048914 Bacteria 1032
1180 Ga0496111_0984130 3300048914 Bacteria 605
1181 Ga0496112_0003150 3300048915 Bacteria 13548
1182 Ga0496112_0093137 3300048915 Bacteria 2983
1183 Ga0496112_0122395 3300048915 Bacteria 2572
1184 Ga0496112_0133083 3300048915 Bacteria 2457
1185 Ga0496112_0147497 3300048915 Bacteria 2321
1186 Ga0496112_0227559 3300048915 Bacteria 1820
1187 Ga0496112_0406619 3300048915 Bacteria 1301
1188 Ga0496112_0474164 3300048915 Bacteria 1188
1189 Ga0496112_0625134 3300048915 Unclassified 1008
1190 Ga0496113_0014642 3300048916 Bacteria 5360
1191 Ga0496113_0015039 3300048916 Bacteria 5301
1192 Ga0496113_0020998 3300048916 Bacteria 4601
1193 Ga0496113_0061363 3300048916 Bacteria 2837
1194 Ga0496113_0495178 3300048916 Bacteria 981
1195 Ga0496114_0227050 3300048917 Bacteria 1640
1196 Ga0496114_0430786 3300048917 Bacteria 1168
1197 Ga0496114_1072568 3300048917 Bacteria 690
1198 Ga0496115_0000052 3300048918 Bacteria 107262
1199 Ga0496115_0000057 3300048918 Bacteria 103176
1200 Ga0496115_0005376 3300048918 Bacteria 9317
1201 Ga0496115_0005528 3300048918 Bacteria 9201
1202 Ga0496115_0159025 3300048918 Bacteria 1867
1203 Ga0496115_0169250 3300048918 Bacteria 1807
1204 Ga0496115_0508541 3300048918 Bacteria 967
1205 Ga0496115_0585309 3300048918 Bacteria 889
1206 Ga0496118_0211147 3300048921 Bacteria 1139
1207 Ga0496119_0009312 3300048922 Bacteria 8449
1208 Ga0496119_0267571 3300048922 Bacteria 855
1209 Ga0496120_0018982 3300048923 Bacteria 4415
1210 Ga0496120_0135236 3300048923 Bacteria 1258
1211 Ga0496121_0026404 3300048924 Bacteria 5475
1212 Ga0496121_0110305 3300048924 Bacteria 2100
1213 Ga0496122_0609245 3300048925 Bacteria 509
1214 Ga0496124_0050632 3300048927 Bacteria 3538
1215 Ga0496126_0011699 3300048929 Bacteria 9047
1216 Ga0496126_0281488 3300048929 Bacteria 1377
1217 Ga0501305_105707 3300049161 Bacteria 528
1218 Ga0501031_0029469 3300049568 Bacteria 3580
1219 Ga0501031_0355893 3300049568 Bacteria 947
1220 Ga0501031_0374416 3300049568 Bacteria 921
1221 Ga0501031_0485900 3300049568 Bacteria 797
1222 Ga0501032_0000875 3300049569 Bacteria 24430
1223 Ga0501033_0000657 3300049570 Bacteria 31993
1224 Ga0501033_0480143 3300049570 Bacteria 861
1225 Ga0501033_0480167 3300049570 Bacteria 861
1226 Ga0501034_0003696 3300049571 Bacteria 17273
1227 Ga0501034_0015452 3300049571 Bacteria 7844
1228 Ga0501034_0136288 3300049571 Bacteria 2436
1229 Ga0501034_0208966 3300049571 Bacteria 1908
1230 Ga0501034_0249946 3300049571 Bacteria 1718
1231 Ga0501034_0260235 3300049571 Bacteria 1678
1232 Ga0501034_0809400 3300049571 Bacteria 829
1233 Ga0501036_0001123 3300049572 Bacteria 20344
1234 Ga0501036_0051379 3300049572 Bacteria 3490
1235 Ga0501036_0152148 3300049572 Bacteria 1951
1236 Ga0501036_0250964 3300049572 Bacteria 1483
1237 Ga0501036_1703006 3300049572 Bacteria 508
1238 Ga0501036_1719008 3300049572 Bacteria 505
1239 Ga0501037_0000381 3300049573 Bacteria 36906
1240 Ga0501037_0550319 3300049573 Bacteria 779
1241 Ga0501038_0001755 3300049574 Bacteria 20151
1242 Ga0501038_0360661 3300049574 Bacteria 1130
1243 Ga0501038_1171432 3300049574 Bacteria 559
1244 Ga0501038_1178666 3300049574 Bacteria 557
1245 Ga0501039_0008256 3300049575 Bacteria 7935
1246 Ga0501039_0014805 3300049575 Bacteria 5966
1247 Ga0501039_0295526 3300049575 Bacteria 1273
1248 Ga0501039_0340267 3300049575 Bacteria 1179
1249 Ga0501039_0350666 3300049575 Bacteria 1160
1250 Ga0501039_0785889 3300049575 Bacteria 743
1251 Ga0501040_0071691 3300049576 Bacteria 2392
1252 Ga0501040_0071829 3300049576 Bacteria 2390
1253 Ga0501040_0199531 3300049576 Bacteria 1420
1254 Ga0501040_0246382 3300049576 Bacteria 1274
1255 Ga0501040_1037189 3300049576 Bacteria 595
1256 Ga0501041_0076592 3300049577 Bacteria 2058
1257 Ga0501041_0120629 3300049577 Bacteria 1629
1258 Ga0501041_0128655 3300049577 Bacteria 1577
1259 Ga0501041_0633555 3300049577 Bacteria 683
1260 Ga0501041_0814959 3300049577 Bacteria 599
1261 Ga0501042_0014273 3300049578 Bacteria 5420
1262 Ga0501042_0033027 3300049578 Bacteria 3667
1263 Ga0501042_0128104 3300049578 Bacteria 1828
1264 Ga0501042_0218000 3300049578 Bacteria 1376
1265 Ga0501042_0222127 3300049578 Bacteria 1362
1266 Ga0501042_0312346 3300049578 Bacteria 1135
1267 Ga0501042_0416821 3300049578 Bacteria 973
1268 Ga0501042_0481414 3300049578 Bacteria 901
1269 Ga0501042_0713394 3300049578 Bacteria 729
1270 Ga0501042_0732085 3300049578 Bacteria 719
1271 Ga0501043_0001524 3300049579 Bacteria 20232
1272 Ga0501043_0438049 3300049579 Bacteria 984
1273 Ga0501043_0662961 3300049579 Bacteria 765
1274 Ga0501043_0727939 3300049579 Bacteria 723
1275 Ga0501043_0812041 3300049579 Bacteria 676
1276 Ga0501046_0000876 3300049580 Bacteria 29256
1277 Ga0501046_0452040 3300049580 Bacteria 924
1278 Ga0501046_0556597 3300049580 Bacteria 817
1279 Ga0501047_0000733 3300049581 Bacteria 34156
1280 Ga0501047_0013811 3300049581 Bacteria 7668
1281 Ga0501047_0085582 3300049581 Bacteria 3029
1282 Ga0501047_0091018 3300049581 Bacteria 2928
1283 Ga0501047_0098585 3300049581 Bacteria 2801
1284 Ga0501047_0266083 3300049581 Bacteria 1561
1285 Ga0501048_0000728 3300049582 Bacteria 24116
1286 Ga0501048_0111685 3300049582 Bacteria 1930
1287 Ga0501048_0116542 3300049582 Bacteria 1887
1288 Ga0501048_0204596 3300049582 Bacteria 1400
1289 Ga0501048_0238284 3300049582 Bacteria 1291
1290 Ga0501048_0310361 3300049582 Unclassified 1123
1291 Ga0501067_0085820 3300049583 Bacteria 1747
1292 Ga0501068_0103812 3300049584 Bacteria 1763
1293 Ga0501069_0009335 3300049585 Bacteria 5179
1294 Ga0501070_0000368 3300049586 Bacteria 41043
1295 Ga0501070_0009917 3300049586 Bacteria 8052
1296 Ga0501070_0219141 3300049586 Bacteria 1561
1297 Ga0501070_0502508 3300049586 Bacteria 974
1298 Ga0501070_1066774 3300049586 Bacteria 624
1299 Ga0501070_1447870 3300049586 Bacteria 521
1300 Ga0501071_0061062 3300049587 Bacteria 2730
1301 Ga0501071_0093375 3300049587 Bacteria 2212
1302 Ga0501071_0267170 3300049587 Bacteria 1293
1303 Ga0501071_0304708 3300049587 Bacteria 1208
1304 Ga0501071_0387939 3300049587 Bacteria 1066
1305 Ga0501071_0544866 3300049587 Bacteria 891
1306 Ga0501071_0581288 3300049587 Bacteria 861
1307 Ga0501071_1050022 3300049587 Bacteria 629
1308 Ga0501072_0023777 3300049588 Bacteria 4760
1309 Ga0501072_0047356 3300049588 Bacteria 3386
1310 Ga0501072_0048878 3300049588 Bacteria 3330
1311 Ga0501072_0066621 3300049588 Bacteria 2841
1312 Ga0501072_0095652 3300049588 Bacteria 2361
1313 Ga0501072_0122272 3300049588 Bacteria 2074
1314 Ga0501072_0448254 3300049588 Bacteria 1022
1315 Ga0501072_1484319 3300049588 Bacteria 523
1316 Ga0501073_0003432 3300049589 Bacteria 11904
1317 Ga0501074_0006975 3300049590 Bacteria 8162
1318 Ga0501074_0010425 3300049590 Bacteria 6744
1319 Ga0501074_0015525 3300049590 Bacteria 5536
1320 Ga0501074_0252643 3300049590 Bacteria 1254
1321 Ga0501074_0340294 3300049590 Bacteria 1065
1322 Ga0501075_0023372 3300049591 Bacteria 4526
1323 Ga0501075_0053010 3300049591 Bacteria 3050
1324 Ga0501075_0071301 3300049591 Bacteria 2626
1325 Ga0501075_0108361 3300049591 Bacteria 2112
1326 Ga0501075_0128559 3300049591 Bacteria 1929
1327 Ga0501075_0149227 3300049591 Bacteria 1782
1328 Ga0501075_0529819 3300049591 Bacteria 899
1329 Ga0501076_0028477 3300049592 Bacteria 4338
1330 Ga0501076_0087350 3300049592 Bacteria 2507
1331 Ga0501076_0150232 3300049592 Bacteria 1895
1332 Ga0501076_0179800 3300049592 Bacteria 1724
1333 Ga0501076_1009127 3300049592 Unclassified 686
1334 Ga0501077_0509266 3300049593 Bacteria 772
1335 Ga0501079_0018317 3300049741 Bacteria 5352
1336 Ga0501079_0059346 3300049741 Bacteria 2951
1337 Ga0501079_0086291 3300049741 Bacteria 2429
1338 Ga0501079_0489760 3300049741 Bacteria 966
1339 Ga0501079_0702041 3300049741 Bacteria 796
1340 Ga0501080_0045468 3300049742 Bacteria 4087
1341 Ga0501080_0070883 3300049742 Bacteria 3241
1342 Ga0501081_0041391 3300049743 Bacteria 3155
1343 Ga0501081_0076530 3300049743 Bacteria 2337
1344 Ga0501081_0134366 3300049743 Bacteria 1769
1345 Ga0501081_0447138 3300049743 Bacteria 960
1346 Ga0501081_0511594 3300049743 Bacteria 895
1347 Ga0501081_0836633 3300049743 Bacteria 693
1348 Ga0501081_1212176 3300049743 Bacteria 572
1349 Ga0501083_0000832 3300049744 Bacteria 20278
1350 Ga0501083_0189079 3300049744 Bacteria 1344
1351 Ga0501035_0000224 3300049822 Bacteria 67316
1352 Ga0501035_0182903 3300049822 Bacteria 1805
1353 Ga0501035_0270682 3300049822 Bacteria 1438
1354 Ga0501035_0371373 3300049822 Bacteria 1194
1355 Ga0501035_0624721 3300049822 Bacteria 876
1356 Ga0501035_0960464 3300049822 Bacteria 674
1357 Ga0501035_1334643 3300049822 Bacteria 552
1358 Ga0501044_0000542 3300049823 Bacteria 45924
1359 Ga0501044_0170144 3300049823 Bacteria 2151
1360 Ga0501044_0179929 3300049823 Bacteria 2082
1361 Ga0501044_0261693 3300049823 Bacteria 1668
1362 Ga0501044_0433652 3300049823 Bacteria 1223
1363 Ga0501044_0471876 3300049823 Bacteria 1159
1364 Ga0501045_0126204 3300049824 Bacteria 1901
1365 Ga0501045_0134361 3300049824 Bacteria 1839
1366 Ga0501045_0141992 3300049824 Bacteria 1786
1367 Ga0501045_0147179 3300049824 Bacteria 1752
1368 Ga0501045_0180139 3300049824 Bacteria 1574
1369 Ga0501045_0280460 3300049824 Bacteria 1240
1370 Ga0501045_0530614 3300049824 Bacteria 874
1371 nmdc:mga03n38_132382_c1 3300050490 Bacteria 1237
1372 nmdc:mga03n38_43173_c1 3300050490 Bacteria 1975
1373 nmdc:mga03n38_457123_c1 3300050490 Bacteria 711
1374 nmdc:mga03n38_63547_c1 3300050490 Bacteria 1687
1375 nmdc:mga03n38_8965_c1 3300050490 Bacteria 3614
1376 nmdc:mga00v17_407702_c1 3300050491 Bacteria 883
1377 nmdc:mga00v17_425840_c1 3300050491 Bacteria 862
1378 nmdc:mga00v17_439472_c1 3300050491 Bacteria 847
1379 nmdc:mga00v17_55926_c1 3300050491 Bacteria 2411
1380 nmdc:mga0yw44_1221792_c1 3300050492 Bacteria 507
1381 nmdc:mga0yw44_156272_c1 3300050492 Bacteria 1491
1382 nmdc:mga0yw44_186086_c1 3300050492 Bacteria 1368
1383 nmdc:mga0yw44_222941_c1 3300050492 Bacteria 1250
1384 nmdc:mga0yw44_233938_c1 3300050492 Bacteria 1220
1385 nmdc:mga0yw44_236539_c1 3300050492 Bacteria 1213
1386 nmdc:mga0yw44_27901_c1 3300050492 Bacteria 3240
1387 nmdc:mga06z11_474658_c1 3300050494 Bacteria 757
1388 nmdc:mga04h51_199203_c1 3300050495 Bacteria 786
1389 nmdc:mga07m45_342620_c1 3300050496 Bacteria 868
1390 nmdc:mga05p37_170079_c1 3300050507 Bacteria 2658
1391 nmdc:mga05p37_1780785_c1 3300050507 Bacteria 595
1392 nmdc:mga05p37_2243700_c1 3300050507 Bacteria 505
1393 nmdc:mga05p37_247397_c1 3300050507 Bacteria 2140
1394 nmdc:mga05p37_2914_c1 3300050507 Bacteria 19858
1395 nmdc:mga05p37_441461_c1 3300050507 Bacteria 1509
1396 nmdc:mga05p37_477335_c1 3300050507 Bacteria 1437
1397 nmdc:mga05p37_481609_c1 3300050507 Bacteria 1429
1398 nmdc:mga05p37_794884_c1 3300050507 Bacteria 1036
1399 nmdc:mga05p37_797084_c1 3300050507 Bacteria 1034
1400 nmdc:mga09592_227390_c1 3300050508 Bacteria 1616
1401 nmdc:mga09592_526654_c1 3300050508 Bacteria 1016
1402 nmdc:mga0qj67_2052_c1 3300050509 Bacteria 14373
1403 nmdc:mga0qj67_41025_c1 3300050509 Bacteria 3639
1404 nmdc:mga0qj67_870079_c1 3300050509 Bacteria 711
1405 nmdc:mga06r32_1368421_c1 3300050510 Bacteria 650
1406 nmdc:mga06r32_146032_c1 3300050510 Bacteria 2343
1407 nmdc:mga06r32_4137_c1 3300050510 Bacteria 12990
1408 nmdc:mga06r32_47375_c1 3300050510 Bacteria 4106
1409 nmdc:mga08y16_1133196_c1 3300050511 Bacteria 756
1410 nmdc:mga08y16_117943_c1 3300050511 Bacteria 2762
1411 nmdc:mga08y16_1450933_c1 3300050511 Bacteria 648
1412 nmdc:mga08y16_1785222_c1 3300050511 Bacteria 568
1413 nmdc:mga08y16_181844_c1 3300050511 Bacteria 2183
1414 nmdc:mga08y16_60254_c1 3300050511 Bacteria 3965
1415 nmdc:mga08y16_855844_c1 3300050511 Bacteria 898
1416 nmdc:mga0n895_236574_c1 3300050512 Bacteria 1853
1417 nmdc:mga0n895_402252_c1 3300050512 Bacteria 1385
1418 nmdc:mga0n895_775901_c1 3300050512 Bacteria 950
1419 nmdc:mga0n895_910509_c1 3300050512 Bacteria 864
1420 nmdc:mga0rr50_245943_c1 3300050513 Bacteria 1484
1421 nmdc:mga08x19_40189_c1 3300050514 Bacteria 2976
1422 nmdc:mga08x19_862844_c1 3300050514 Bacteria 643
1423 nmdc:mga0a205_430937_c1 3300050515 Bacteria 1180
1424 Ga0495601_0000017 3300053077 Bacteria 204209
1425 Ga0495601_0000022 3300053077 Bacteria 148418
1426 Ga0495601_0000363 3300053077 Bacteria 23921
1427 Ga0495601_0006808 3300053077 Bacteria 6695
1428 Ga0495601_0047019 3300053077 Bacteria 2716
1429 Ga0495601_0244578 3300053077 Bacteria 1171
1430 Ga0495601_0282407 3300053077 Bacteria 1082
1431 Ga0495612_0013064 3300053078 Bacteria 3344
1432 Ga0495612_0036566 3300053078 Bacteria 1993
1433 Ga0495612_0254121 3300053078 Unclassified 782
1434 Ga0495595_0000004 3300053084 Bacteria 260821
1435 Ga0495595_0001757 3300053084 Bacteria 8468
1436 Ga0495595_0070059 3300053084 Bacteria 1656
1437 Ga0495619_0000194 3300053085 Bacteria 44733
1438 Ga0495619_0049395 3300053085 Bacteria 2774
1439 Ga0495619_0201928 3300053085 Bacteria 1376
1440 Ga0500641_0059286 3300053096 Bacteria 1591
1441 Ga0500614_000149 3300053123 Bacteria 17523
1442 Ga0500568_0107186 3300053139 Bacteria 1046
1443 Ga0501084_0029670 3300054114 Bacteria 4576
1444 Ga0501084_0116232 3300054114 Bacteria 2249
1445 Ga0501084_0132371 3300054114 Bacteria 2099
1446 Ga0501084_0161799 3300054114 Bacteria 1888
1447 Ga0501084_0180299 3300054114 Bacteria 1783
1448 Ga0501084_0319459 3300054114 Bacteria 1311
1449 Ga0501084_0331098 3300054114 Bacteria 1286
1450 Ga0501084_0413724 3300054114 Bacteria 1140
1451 Ga0501084_1131896 3300054114 Bacteria 657
1452 Ga0587073_0293179 3300059492 Bacteria 526
1453 Ga0501082_0004887 3300060353 Bacteria 11690
1454 Ga0501082_0161500 3300060353 Bacteria 1947
1455 Ga0501082_0175385 3300060353 Bacteria 1864
1456 Ga0501082_0178400 3300060353 Bacteria 1847
1457 Ga0501082_0272194 3300060353 Bacteria 1474
1458 Ga0501082_0310873 3300060353 Bacteria 1372
1459 Ga0501082_0389985 3300060353 Bacteria 1215
1460 Ga0501082_0422408 3300060353 Bacteria 1164
1461 Ga0501082_1171300 3300060353 Bacteria 672
1462 Ga0501082_1837755 3300060353 Bacteria 528
1463 Ga0466962_0053934 3300061719 Bacteria 1921
1464 Ga0466962_0110624 3300061719 Bacteria 1322
1465 Ga0466962_0317828 3300061719 Bacteria 772
1466 Ga0530510_0017238 3300061734 Bacteria 5117
1467 Ga0530510_0032494 3300061734 Bacteria 3755
1468 Ga0530510_0098900 3300061734 Bacteria 2133
1469 Ga0530510_0161410 3300061734 Bacteria 1658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0028278 Ga0495672_0028278_1644_2051 111
2 3300005336 Ga0070680_100476387 Ga0070680_1004763872 116
3 3300005339 Ga0070660_100386271 Ga0070660_1003862712 116
4 3300005436 Ga0070713_100000005 Ga0070713_100000005126 116
5 3300005458 Ga0070681_10343829 Ga0070681_103438292 116
6 3300005547 Ga0070693_100148097 Ga0070693_1001480972 116
7 3300005937 Ga0081455_10933854 Ga0081455_109338542 116
8 3300005981 Ga0081538_10016300 Ga0081538_100163006 116
9 3300006048 Ga0075363_100080586 Ga0075363_1000805862 116
10 3300006353 Ga0075370_10480190 Ga0075370_104801901 116
11 3300006846 Ga0075430_101756551 Ga0075430_1017565511 116
12 3300025912 Ga0207707_10276327 Ga0207707_102763272 116
13 3300025920 Ga0207649_10336144 Ga0207649_103361442 116
14 3300025928 Ga0207700_10000003 Ga0207700_10000003315 116
15 3300031852 Ga0307410_11064229 Ga0307410_110642292 116
16 3300032002 Ga0307416_100389485 Ga0307416_1003894852 116
17 3300039450 Ga0436363_0278742 Ga0436363_0278742_24_374 116
18 3300046455 Ga0495603_0300545 Ga0495603_0300545_161_511 116
19 3300047321 Ga0495676_0610656 Ga0495676_0610656_115_465 116
20 3300047446 Ga0495679_083916 Ga0495679_083916_124_474 116
21 3300047673 Ga0495593_0009544 Ga0495593_0009544_2422_2772 116
22 3300048905 Ga0496102_1403489 Ga0496102_1403489_195_545 116
23 3300048906 Ga0496103_0396176 Ga0496103_0396176_494_844 116
24 3300048907 Ga0496104_0043790 Ga0496104_0043790_3736_4086 116
25 3300048908 Ga0496105_0004885 Ga0496105_0004885_4846_5196 116
26 3300048912 Ga0496109_0090546 Ga0496109_0090546_629_979 116
27 3300048915 Ga0496112_0093137 Ga0496112_0093137_648_998 116
28 3300050490 nmdc:mga03n38_132382_c1 nmdc:mga03n38_132382_c1_390_740 116
29 3300050490 nmdc:mga03n38_43173_c1 nmdc:mga03n38_43173_c1_171_521 116
30 3300003373 JGI25407J50210_10000745 JGI25407J50210_100007452 117
31 3300003373 JGI25407J50210_10005977 JGI25407J50210_100059773 117
32 3300003373 JGI25407J50210_10011530 JGI25407J50210_100115302 117
33 3300003373 JGI25407J50210_10023709 JGI25407J50210_100237092 117
34 3300003373 JGI25407J50210_10029278 JGI25407J50210_100292782 117
35 3300003373 JGI25407J50210_10058881 JGI25407J50210_100588811 117
36 3300005327 Ga0070658_10328024 Ga0070658_103280242 117
37 3300005327 Ga0070658_10643591 Ga0070658_106435912 117
38 3300005327 Ga0070658_11110489 Ga0070658_111104892 117
39 3300005328 Ga0070676_10972386 Ga0070676_109723861 117
40 3300005329 Ga0070683_100001942 Ga0070683_10000194220 117
41 3300005329 Ga0070683_100002447 Ga0070683_10000244713 117
42 3300005329 Ga0070683_100140102 Ga0070683_1001401024 117
43 3300005329 Ga0070683_100293530 Ga0070683_1002935302 117
44 3300005329 Ga0070683_100349299 Ga0070683_1003492992 117
45 3300005329 Ga0070683_100457389 Ga0070683_1004573892 117
46 3300005330 Ga0070690_100574311 Ga0070690_1005743112 117
47 3300005335 Ga0070666_10010923 Ga0070666_100109232 117
48 3300005335 Ga0070666_10673988 Ga0070666_106739882 117
49 3300005335 Ga0070666_10921303 Ga0070666_109213031 117
50 3300005336 Ga0070680_100001579 Ga0070680_10000157917 117
51 3300005336 Ga0070680_100387960 Ga0070680_1003879602 117
52 3300005336 Ga0070680_100992676 Ga0070680_1009926762 117
53 3300005336 Ga0070680_101298931 Ga0070680_1012989311 117
54 3300005337 Ga0070682_100637195 Ga0070682_1006371951 117
55 3300005338 Ga0068868_100224561 Ga0068868_1002245612 117
56 3300005338 Ga0068868_101844707 Ga0068868_1018447072 117
57 3300005339 Ga0070660_100031718 Ga0070660_1000317184 117
58 3300005339 Ga0070660_100707299 Ga0070660_1007072992 117
59 3300005339 Ga0070660_100753241 Ga0070660_1007532411 117
60 3300005339 Ga0070660_101131527 Ga0070660_1011315271 117
61 3300005340 Ga0070689_100023924 Ga0070689_1000239242 117
62 3300005340 Ga0070689_101055933 Ga0070689_1010559332 117
63 3300005341 Ga0070691_10332328 Ga0070691_103323282 117
64 3300005343 Ga0070687_100069860 Ga0070687_1000698602 117
65 3300005343 Ga0070687_100107833 Ga0070687_1001078331 117
66 3300005344 Ga0070661_100265499 Ga0070661_1002654991 117
67 3300005344 Ga0070661_100950724 Ga0070661_1009507242 117
68 3300005345 Ga0070692_10436258 Ga0070692_104362582 117
69 3300005345 Ga0070692_10760063 Ga0070692_107600632 117
70 3300005347 Ga0070668_100403035 Ga0070668_1004030352 117
71 3300005347 Ga0070668_100795731 Ga0070668_1007957311 117
72 3300005347 Ga0070668_101235357 Ga0070668_1012353571 117
73 3300005347 Ga0070668_101273289 Ga0070668_1012732891 117
74 3300005347 Ga0070668_101952215 Ga0070668_1019522152 117
75 3300005353 Ga0070669_100529749 Ga0070669_1005297492 117
76 3300005353 Ga0070669_101079661 Ga0070669_1010796612 117
77 3300005354 Ga0070675_100792599 Ga0070675_1007925992 117
78 3300005355 Ga0070671_100182910 Ga0070671_1001829102 117
79 3300005355 Ga0070671_100374264 Ga0070671_1003742641 117
80 3300005356 Ga0070674_100070741 Ga0070674_1000707414 117
81 3300005356 Ga0070674_100334268 Ga0070674_1003342682 117
82 3300005356 Ga0070674_100916896 Ga0070674_1009168962 117
83 3300005365 Ga0070688_100043752 Ga0070688_1000437523 117
84 3300005365 Ga0070688_100105690 Ga0070688_1001056903 117
85 3300005366 Ga0070659_100010767 Ga0070659_1000107679 117
86 3300005366 Ga0070659_100114192 Ga0070659_1001141922 117
87 3300005366 Ga0070659_100287743 Ga0070659_1002877433 117
88 3300005366 Ga0070659_101168463 Ga0070659_1011684631 117
89 3300005366 Ga0070659_101789306 Ga0070659_1017893061 117
90 3300005367 Ga0070667_100012591 Ga0070667_1000125912 117
91 3300005367 Ga0070667_100402565 Ga0070667_1004025652 117
92 3300005434 Ga0070709_11485806 Ga0070709_114858061 117
93 3300005435 Ga0070714_100044673 Ga0070714_1000446732 117
94 3300005435 Ga0070714_100106346 Ga0070714_1001063462 117
95 3300005435 Ga0070714_100123571 Ga0070714_1001235713 117
96 3300005435 Ga0070714_100199471 Ga0070714_1001994712 117
97 3300005435 Ga0070714_100504780 Ga0070714_1005047802 117
98 3300005435 Ga0070714_100805565 Ga0070714_1008055652 117
99 3300005435 Ga0070714_100901041 Ga0070714_1009010412 117
100 3300005435 Ga0070714_101079651 Ga0070714_1010796512 117
101 3300005435 Ga0070714_101740701 Ga0070714_1017407011 117
102 3300005436 Ga0070713_100084534 Ga0070713_1000845343 117
103 3300005436 Ga0070713_100132384 Ga0070713_1001323842 117
104 3300005436 Ga0070713_101143145 Ga0070713_1011431451 117
105 3300005437 Ga0070710_10003670 Ga0070710_100036703 117
106 3300005437 Ga0070710_10092276 Ga0070710_100922763 117
107 3300005437 Ga0070710_10803628 Ga0070710_108036282 117
108 3300005437 Ga0070710_10958481 Ga0070710_109584812 117
109 3300005438 Ga0070701_11022204 Ga0070701_110222041 117
110 3300005439 Ga0070711_100003433 Ga0070711_1000034332 117
111 3300005439 Ga0070711_100028021 Ga0070711_1000280212 117
112 3300005439 Ga0070711_100085789 Ga0070711_1000857891 117
113 3300005439 Ga0070711_100127953 Ga0070711_1001279532 117
114 3300005439 Ga0070711_100168083 Ga0070711_1001680832 117
115 3300005439 Ga0070711_100439860 Ga0070711_1004398602 117
116 3300005439 Ga0070711_101115758 Ga0070711_1011157582 117
117 3300005440 Ga0070705_101759415 Ga0070705_1017594151 117
118 3300005441 Ga0070700_100031582 Ga0070700_1000315826 117
119 3300005441 Ga0070700_100821631 Ga0070700_1008216312 117
120 3300005441 Ga0070700_101246568 Ga0070700_1012465682 117
121 3300005441 Ga0070700_101555405 Ga0070700_1015554051 117
122 3300005441 Ga0070700_101941589 Ga0070700_1019415891 117
123 3300005444 Ga0070694_100111943 Ga0070694_1001119433 117
124 3300005444 Ga0070694_100310903 Ga0070694_1003109032 117
125 3300005445 Ga0070708_100271705 Ga0070708_1002717052 117
126 3300005455 Ga0070663_100001455 Ga0070663_1000014558 117
127 3300005455 Ga0070663_100156388 Ga0070663_1001563882 117
128 3300005455 Ga0070663_100568306 Ga0070663_1005683062 117
129 3300005455 Ga0070663_101237975 Ga0070663_1012379751 117
130 3300005456 Ga0070678_100235280 Ga0070678_1002352802 117
131 3300005456 Ga0070678_100389328 Ga0070678_1003893282 117
132 3300005456 Ga0070678_100802517 Ga0070678_1008025172 117
133 3300005457 Ga0070662_100363466 Ga0070662_1003634662 117
134 3300005457 Ga0070662_100487631 Ga0070662_1004876312 117
135 3300005458 Ga0070681_10066681 Ga0070681_100666814 117
136 3300005458 Ga0070681_10937258 Ga0070681_109372581 117
137 3300005458 Ga0070681_11650091 Ga0070681_116500911 117
138 3300005459 Ga0068867_100389237 Ga0068867_1003892371 117
139 3300005467 Ga0070706_100467373 Ga0070706_1004673732 117
140 3300005467 Ga0070706_101458385 Ga0070706_1014583851 117
141 3300005468 Ga0070707_100005848 Ga0070707_1000058485 117
142 3300005468 Ga0070707_100564693 Ga0070707_1005646932 117
143 3300005530 Ga0070679_100000527 Ga0070679_10000052713 117
144 3300005530 Ga0070679_100011262 Ga0070679_10001126211 117
145 3300005530 Ga0070679_100034741 Ga0070679_1000347413 117
146 3300005530 Ga0070679_100291078 Ga0070679_1002910782 117
147 3300005535 Ga0070684_100059444 Ga0070684_1000594443 117
148 3300005535 Ga0070684_100166953 Ga0070684_1001669532 117
149 3300005535 Ga0070684_100168720 Ga0070684_1001687202 117
150 3300005535 Ga0070684_100251286 Ga0070684_1002512862 117
151 3300005535 Ga0070684_100272497 Ga0070684_1002724972 117
152 3300005535 Ga0070684_100277473 Ga0070684_1002774732 117
153 3300005535 Ga0070684_100391698 Ga0070684_1003916982 117
154 3300005535 Ga0070684_100541709 Ga0070684_1005417092 117
155 3300005539 Ga0068853_101068936 Ga0068853_1010689361 117
156 3300005539 Ga0068853_101452457 Ga0068853_1014524572 117
157 3300005539 Ga0068853_101636016 Ga0068853_1016360161 117
158 3300005539 Ga0068853_101726514 Ga0068853_1017265141 117
159 3300005543 Ga0070672_100341215 Ga0070672_1003412152 117
160 3300005543 Ga0070672_101095345 Ga0070672_1010953452 117
161 3300005544 Ga0070686_100099972 Ga0070686_1000999723 117
162 3300005544 Ga0070686_101098500 Ga0070686_1010985002 117
163 3300005544 Ga0070686_101221018 Ga0070686_1012210182 117
164 3300005544 Ga0070686_101425971 Ga0070686_1014259711 117
165 3300005546 Ga0070696_100248980 Ga0070696_1002489802 117
166 3300005546 Ga0070696_100416203 Ga0070696_1004162032 117
167 3300005548 Ga0070665_100017416 Ga0070665_1000174162 117
168 3300005548 Ga0070665_100064533 Ga0070665_1000645332 117
169 3300005548 Ga0070665_100249228 Ga0070665_1002492283 117
170 3300005548 Ga0070665_101189944 Ga0070665_1011899441 117
171 3300005549 Ga0070704_100321353 Ga0070704_1003213532 117
172 3300005549 Ga0070704_100569915 Ga0070704_1005699152 117
173 3300005549 Ga0070704_101003887 Ga0070704_1010038871 117
174 3300005549 Ga0070704_101132033 Ga0070704_1011320332 117
175 3300005564 Ga0070664_100043951 Ga0070664_1000439515 117
176 3300005564 Ga0070664_100242334 Ga0070664_1002423342 117
177 3300005564 Ga0070664_100392131 Ga0070664_1003921312 117
178 3300005564 Ga0070664_100959564 Ga0070664_1009595642 117
179 3300005577 Ga0068857_100476017 Ga0068857_1004760172 117
180 3300005577 Ga0068857_100598911 Ga0068857_1005989111 117
181 3300005578 Ga0068854_100410261 Ga0068854_1004102612 117
182 3300005578 Ga0068854_100771298 Ga0068854_1007712982 117
183 3300005578 Ga0068854_100811724 Ga0068854_1008117242 117
184 3300005614 Ga0068856_100008571 Ga0068856_1000085719 117
185 3300005614 Ga0068856_100048926 Ga0068856_1000489262 117
186 3300005614 Ga0068856_100330291 Ga0068856_1003302912 117
187 3300005614 Ga0068856_100756573 Ga0068856_1007565731 117
188 3300005614 Ga0068856_101273330 Ga0068856_1012733301 117
189 3300005614 Ga0068856_101449916 Ga0068856_1014499161 117
190 3300005614 Ga0068856_101551822 Ga0068856_1015518222 117
191 3300005615 Ga0070702_100008157 Ga0070702_1000081572 117
192 3300005615 Ga0070702_100163854 Ga0070702_1001638543 117
193 3300005615 Ga0070702_100248836 Ga0070702_1002488362 117
194 3300005615 Ga0070702_100310423 Ga0070702_1003104232 117
195 3300005615 Ga0070702_100653131 Ga0070702_1006531312 117
196 3300005615 Ga0070702_101314675 Ga0070702_1013146751 117
197 3300005616 Ga0068852_100011466 Ga0068852_1000114664 117
198 3300005616 Ga0068852_100593776 Ga0068852_1005937762 117
199 3300005616 Ga0068852_100617324 Ga0068852_1006173242 117
200 3300005616 Ga0068852_101158967 Ga0068852_1011589672 117
201 3300005616 Ga0068852_101991113 Ga0068852_1019911132 117
202 3300005617 Ga0068859_100187234 Ga0068859_1001872343 117
203 3300005618 Ga0068864_100208535 Ga0068864_1002085352 117
204 3300005618 Ga0068864_102194659 Ga0068864_1021946591 117
205 3300005718 Ga0068866_10211408 Ga0068866_102114082 117
206 3300005718 Ga0068866_10316043 Ga0068866_103160432 117
207 3300005719 Ga0068861_100818167 Ga0068861_1008181672 117
208 3300005719 Ga0068861_101170905 Ga0068861_1011709052 117
209 3300005834 Ga0068851_10000437 Ga0068851_100004374 117
210 3300005834 Ga0068851_10432661 Ga0068851_104326612 117
211 3300005834 Ga0068851_10983372 Ga0068851_109833721 117
212 3300005840 Ga0068870_10490522 Ga0068870_104905222 117
213 3300005840 Ga0068870_10809835 Ga0068870_108098352 117
214 3300005841 Ga0068863_101322899 Ga0068863_1013228992 117
215 3300005841 Ga0068863_101693727 Ga0068863_1016937272 117
216 3300005842 Ga0068858_100118628 Ga0068858_1001186282 117
217 3300005842 Ga0068858_100578338 Ga0068858_1005783382 117
218 3300005842 Ga0068858_101432955 Ga0068858_1014329552 117
219 3300005842 Ga0068858_101784312 Ga0068858_1017843122 117
220 3300005842 Ga0068858_102070750 Ga0068858_1020707502 117
221 3300005842 Ga0068858_102241247 Ga0068858_1022412471 117
222 3300005844 Ga0068862_100340623 Ga0068862_1003406232 117
223 3300005844 Ga0068862_101324916 Ga0068862_1013249162 117
224 3300005937 Ga0081455_10003758 Ga0081455_1000375811 117
225 3300005937 Ga0081455_10041583 Ga0081455_100415834 117
226 3300005937 Ga0081455_10107170 Ga0081455_101071703 117
227 3300005937 Ga0081455_10122556 Ga0081455_101225563 117
228 3300005937 Ga0081455_10179218 Ga0081455_101792183 117
229 3300005937 Ga0081455_10186868 Ga0081455_101868681 117
230 3300005937 Ga0081455_10233677 Ga0081455_102336772 117
231 3300005937 Ga0081455_10256525 Ga0081455_102565252 117
232 3300005937 Ga0081455_10462765 Ga0081455_104627652 117
233 3300005937 Ga0081455_10532025 Ga0081455_105320253 117
234 3300005937 Ga0081455_10868871 Ga0081455_108688712 117
235 3300005937 Ga0081455_10928170 Ga0081455_109281702 117
236 3300005937 Ga0081455_11060822 Ga0081455_110608222 117
237 3300005981 Ga0081538_10000267 Ga0081538_1000026710 117
238 3300005981 Ga0081538_10000287 Ga0081538_1000028754 117
239 3300005981 Ga0081538_10000673 Ga0081538_1000067310 117
240 3300005981 Ga0081538_10000700 Ga0081538_1000070030 117
241 3300005981 Ga0081538_10001042 Ga0081538_1000104210 117
242 3300005981 Ga0081538_10002352 Ga0081538_1000235215 117
243 3300005981 Ga0081538_10002361 Ga0081538_1000236115 117
244 3300005981 Ga0081538_10003365 Ga0081538_1000336518 117
245 3300005981 Ga0081538_10003816 Ga0081538_1000381615 117
246 3300005981 Ga0081538_10008580 Ga0081538_100085808 117
247 3300005981 Ga0081538_10014118 Ga0081538_100141183 117
248 3300005981 Ga0081538_10048700 Ga0081538_100487006 117
249 3300005981 Ga0081538_10064310 Ga0081538_100643102 117
250 3300005981 Ga0081538_10077703 Ga0081538_100777032 117
251 3300005981 Ga0081538_10085102 Ga0081538_100851022 117
252 3300005981 Ga0081538_10095507 Ga0081538_100955072 117
253 3300005981 Ga0081538_10118141 Ga0081538_101181412 117
254 3300005981 Ga0081538_10183034 Ga0081538_101830341 117
255 3300005981 Ga0081538_10193037 Ga0081538_101930373 117
256 3300005981 Ga0081538_10256991 Ga0081538_102569912 117
257 3300005981 Ga0081538_10278224 Ga0081538_102782242 117
258 3300005981 Ga0081538_10279433 Ga0081538_102794331 117
259 3300005983 Ga0081540_1112463 Ga0081540_11124632 117
260 3300005985 Ga0081539_10008806 Ga0081539_100088062 117
261 3300005985 Ga0081539_10013216 Ga0081539_100132163 117
262 3300005985 Ga0081539_10138442 Ga0081539_101384423 117
263 3300005985 Ga0081539_10296829 Ga0081539_102968292 117
264 3300006028 Ga0070717_10020393 Ga0070717_100203936 117
265 3300006028 Ga0070717_10076451 Ga0070717_100764514 117
266 3300006028 Ga0070717_10201302 Ga0070717_102013022 117
267 3300006028 Ga0070717_10749482 Ga0070717_107494822 117
268 3300006038 Ga0075365_10007627 Ga0075365_100076272 117
269 3300006038 Ga0075365_10015205 Ga0075365_100152055 117
270 3300006038 Ga0075365_10015658 Ga0075365_100156586 117
271 3300006038 Ga0075365_10257776 Ga0075365_102577762 117
272 3300006038 Ga0075365_10553106 Ga0075365_105531062 117
273 3300006038 Ga0075365_10770296 Ga0075365_107702962 117
274 3300006048 Ga0075363_100004752 Ga0075363_1000047525 117
275 3300006048 Ga0075363_100266633 Ga0075363_1002666331 117
276 3300006048 Ga0075363_100267406 Ga0075363_1002674062 117
277 3300006048 Ga0075363_100380839 Ga0075363_1003808392 117
278 3300006048 Ga0075363_100412916 Ga0075363_1004129162 117
279 3300006051 Ga0075364_10025145 Ga0075364_100251453 117
280 3300006051 Ga0075364_10202286 Ga0075364_102022862 117
281 3300006051 Ga0075364_10227075 Ga0075364_102270751 117
282 3300006051 Ga0075364_10259848 Ga0075364_102598482 117
283 3300006051 Ga0075364_10272243 Ga0075364_102722432 117
284 3300006051 Ga0075364_10272608 Ga0075364_102726082 117
285 3300006051 Ga0075364_10561637 Ga0075364_105616371 117
286 3300006051 Ga0075364_10695930 Ga0075364_106959302 117
287 3300006058 Ga0075432_10031466 Ga0075432_100314662 117
288 3300006173 Ga0070716_100224617 Ga0070716_1002246172 117
289 3300006173 Ga0070716_100467522 Ga0070716_1004675222 117
290 3300006173 Ga0070716_100603471 Ga0070716_1006034712 117
291 3300006173 Ga0070716_100771414 Ga0070716_1007714142 117
292 3300006173 Ga0070716_101562916 Ga0070716_1015629161 117
293 3300006175 Ga0070712_100009980 Ga0070712_1000099804 117
294 3300006175 Ga0070712_100078477 Ga0070712_1000784772 117
295 3300006175 Ga0070712_100177230 Ga0070712_1001772302 117
296 3300006175 Ga0070712_100183104 Ga0070712_1001831043 117
297 3300006175 Ga0070712_100267543 Ga0070712_1002675432 117
298 3300006175 Ga0070712_100606472 Ga0070712_1006064722 117
299 3300006175 Ga0070712_100675487 Ga0070712_1006754872 117
300 3300006175 Ga0070712_101008311 Ga0070712_1010083112 117
301 3300006175 Ga0070712_101585051 Ga0070712_1015850511 117
302 3300006178 Ga0075367_10076754 Ga0075367_100767543 117
303 3300006237 Ga0097621_100411386 Ga0097621_1004113862 117
304 3300006237 Ga0097621_101359534 Ga0097621_1013595342 117
305 3300006844 Ga0075428_100061413 Ga0075428_1000614133 117
306 3300006844 Ga0075428_100080159 Ga0075428_1000801593 117
307 3300006844 Ga0075428_100257377 Ga0075428_1002573772 117
308 3300006844 Ga0075428_100265368 Ga0075428_1002653682 117
309 3300006844 Ga0075428_100471332 Ga0075428_1004713322 117
310 3300006844 Ga0075428_100472824 Ga0075428_1004728242 117
311 3300006844 Ga0075428_100995081 Ga0075428_1009950812 117
312 3300006846 Ga0075430_100008692 Ga0075430_10000869210 117
313 3300006846 Ga0075430_100012978 Ga0075430_1000129785 117
314 3300006846 Ga0075430_100388989 Ga0075430_1003889892 117
315 3300006846 Ga0075430_101398707 Ga0075430_1013987072 117
316 3300006847 Ga0075431_100008864 Ga0075431_1000088648 117
317 3300006847 Ga0075431_100020305 Ga0075431_1000203057 117
318 3300006847 Ga0075431_100464883 Ga0075431_1004648832 117
319 3300006847 Ga0075431_100988586 Ga0075431_1009885862 117
320 3300006847 Ga0075431_101294469 Ga0075431_1012944692 117
321 3300006847 Ga0075431_101866276 Ga0075431_1018662762 117
322 3300006852 Ga0075433_10439502 Ga0075433_104395022 117
323 3300006852 Ga0075433_10448408 Ga0075433_104484082 117
324 3300006852 Ga0075433_10842191 Ga0075433_108421912 117
325 3300006871 Ga0075434_100123029 Ga0075434_1001230294 117
326 3300006871 Ga0075434_100454123 Ga0075434_1004541232 117
327 3300006871 Ga0075434_101404856 Ga0075434_1014048562 117
328 3300006880 Ga0075429_100229040 Ga0075429_1002290403 117
329 3300006880 Ga0075429_100643639 Ga0075429_1006436392 117
330 3300006881 Ga0068865_100000061 Ga0068865_1000000612 117
331 3300006881 Ga0068865_100288920 Ga0068865_1002889202 117
332 3300006881 Ga0068865_100398196 Ga0068865_1003981962 117
333 3300006881 Ga0068865_100491940 Ga0068865_1004919402 117
334 3300006914 Ga0075436_100034139 Ga0075436_1000341394 117
335 3300006914 Ga0075436_100607050 Ga0075436_1006070502 117
336 3300006914 Ga0075436_100680764 Ga0075436_1006807642 117
337 3300006931 Ga0097620_100187250 Ga0097620_1001872503 117
338 3300007076 Ga0075435_100658168 Ga0075435_1006581681 117
339 3300007076 Ga0075435_100882782 Ga0075435_1008827821 117
340 3300007076 Ga0075435_102058247 Ga0075435_1020582471 117
341 3300007265 Ga0099794_10101351 Ga0099794_101013512 117
342 3300009093 Ga0105240_10003780 Ga0105240_100037807 117
343 3300009093 Ga0105240_10005426 Ga0105240_100054263 117
344 3300009093 Ga0105240_12319946 Ga0105240_123199461 117
345 3300009094 Ga0111539_10025595 Ga0111539_100255958 117
346 3300009094 Ga0111539_10056477 Ga0111539_100564774 117
347 3300009094 Ga0111539_10119682 Ga0111539_101196821 117
348 3300009094 Ga0111539_10145661 Ga0111539_101456613 117
349 3300009094 Ga0111539_10411168 Ga0111539_104111681 117
350 3300009094 Ga0111539_10958334 Ga0111539_109583342 117
351 3300009094 Ga0111539_11366151 Ga0111539_113661512 117
352 3300009094 Ga0111539_11487619 Ga0111539_114876192 117
353 3300009094 Ga0111539_11489384 Ga0111539_114893842 117
354 3300009094 Ga0111539_11578237 Ga0111539_115782372 117
355 3300009094 Ga0111539_11838461 Ga0111539_118384611 117
356 3300009098 Ga0105245_10000553 Ga0105245_1000055311 117
357 3300009098 Ga0105245_10111153 Ga0105245_101111534 117
358 3300009098 Ga0105245_10288447 Ga0105245_102884474 117
359 3300009098 Ga0105245_10628311 Ga0105245_106283112 117
360 3300009098 Ga0105245_11287493 Ga0105245_112874931 117
361 3300009098 Ga0105245_11488435 Ga0105245_114884352 117
362 3300009098 Ga0105245_11549657 Ga0105245_115496572 117
363 3300009098 Ga0105245_11856571 Ga0105245_118565711 117
364 3300009098 Ga0105245_12104461 Ga0105245_121044612 117
365 3300009098 Ga0105245_12434931 Ga0105245_124349311 117
366 3300009098 Ga0105245_12680423 Ga0105245_126804232 117
367 3300009101 Ga0105247_10658461 Ga0105247_106584612 117
368 3300009101 Ga0105247_11252560 Ga0105247_112525601 117
369 3300009147 Ga0114129_10013696 Ga0114129_1001369611 117
370 3300009147 Ga0114129_10124209 Ga0114129_101242093 117
371 3300009147 Ga0114129_10206139 Ga0114129_102061393 117
372 3300009147 Ga0114129_10492555 Ga0114129_104925553 117
373 3300009147 Ga0114129_10849816 Ga0114129_108498163 117
374 3300009147 Ga0114129_10878134 Ga0114129_108781342 117
375 3300009147 Ga0114129_10890791 Ga0114129_108907911 117
376 3300009147 Ga0114129_11287249 Ga0114129_112872492 117
377 3300009147 Ga0114129_11581949 Ga0114129_115819492 117
378 3300009147 Ga0114129_12084980 Ga0114129_120849802 117
379 3300009147 Ga0114129_12091207 Ga0114129_120912072 117
380 3300009147 Ga0114129_13037784 Ga0114129_130377842 117
381 3300009148 Ga0105243_10069009 Ga0105243_100690094 117
382 3300009148 Ga0105243_10218086 Ga0105243_102180863 117
383 3300009148 Ga0105243_10358550 Ga0105243_103585502 117
384 3300009148 Ga0105243_10600092 Ga0105243_106000922 117
385 3300009148 Ga0105243_10616461 Ga0105243_106164612 117
386 3300009148 Ga0105243_11125139 Ga0105243_111251392 117
387 3300009148 Ga0105243_11199677 Ga0105243_111996772 117
388 3300009148 Ga0105243_11242115 Ga0105243_112421152 117
389 3300009148 Ga0105243_11621533 Ga0105243_116215332 117
390 3300009148 Ga0105243_11954552 Ga0105243_119545522 117
391 3300009174 Ga0105241_11374582 Ga0105241_113745822 117
392 3300009174 Ga0105241_11377121 Ga0105241_113771211 117
393 3300009174 Ga0105241_11872201 Ga0105241_118722011 117
394 3300009176 Ga0105242_10910545 Ga0105242_109105452 117
395 3300009176 Ga0105242_11051024 Ga0105242_110510241 117
396 3300009176 Ga0105242_11172268 Ga0105242_111722682 117
397 3300009176 Ga0105242_11673252 Ga0105242_116732521 117
398 3300009176 Ga0105242_13079531 Ga0105242_130795311 117
399 3300009177 Ga0105248_11270480 Ga0105248_112704802 117
400 3300009177 Ga0105248_11501278 Ga0105248_115012782 117
401 3300009177 Ga0105248_12362935 Ga0105248_123629352 117
402 3300009545 Ga0105237_10000657 Ga0105237_1000065723 117
403 3300009545 Ga0105237_10108975 Ga0105237_101089753 117
404 3300009545 Ga0105237_10718843 Ga0105237_107188432 117
405 3300009551 Ga0105238_10014489 Ga0105238_100144893 117
406 3300009551 Ga0105238_11195915 Ga0105238_111959152 117
407 3300009551 Ga0105238_11359166 Ga0105238_113591661 117
408 3300009551 Ga0105238_12203906 Ga0105238_122039061 117
409 3300009551 Ga0105238_12665256 Ga0105238_126652561 117
410 3300009553 Ga0105249_10035666 Ga0105249_100356663 117
411 3300009553 Ga0105249_10156238 Ga0105249_101562382 117
412 3300009553 Ga0105249_10487168 Ga0105249_104871682 117
413 3300009553 Ga0105249_11015583 Ga0105249_110155831 117
414 3300009553 Ga0105249_11147719 Ga0105249_111477192 117
415 3300009553 Ga0105249_11385074 Ga0105249_113850741 117
416 3300009553 Ga0105249_11878931 Ga0105249_118789312 117
417 3300009553 Ga0105249_11984619 Ga0105249_119846192 117
418 3300009553 Ga0105249_12552423 Ga0105249_125524232 117
419 3300010375 Ga0105239_10012423 Ga0105239_100124239 117
420 3300010375 Ga0105239_10776048 Ga0105239_107760482 117
421 3300010375 Ga0105239_10912106 Ga0105239_109121062 117
422 3300010375 Ga0105239_11624327 Ga0105239_116243272 117
423 3300010375 Ga0105239_12312476 Ga0105239_123124762 117
424 3300010375 Ga0105239_13547806 Ga0105239_135478061 117
425 3300011119 Ga0105246_10207328 Ga0105246_102073283 117
426 3300011119 Ga0105246_11053331 Ga0105246_110533311 117
427 3300011119 Ga0105246_11545338 Ga0105246_115453382 117
428 3300011119 Ga0105246_11614003 Ga0105246_116140031 117
429 3300011119 Ga0105246_11918344 Ga0105246_119183441 117
430 3300011119 Ga0105246_11949345 Ga0105246_119493452 117
431 3300013100 Ga0157373_11209507 Ga0157373_112095071 117
432 3300013102 Ga0157371_10116532 Ga0157371_101165322 117
433 3300013102 Ga0157371_10986171 Ga0157371_109861712 117
434 3300013102 Ga0157371_11224294 Ga0157371_112242942 117
435 3300013104 Ga0157370_10062842 Ga0157370_100628422 117
436 3300013104 Ga0157370_11120990 Ga0157370_111209901 117
437 3300013105 Ga0157369_10004916 Ga0157369_100049163 117
438 3300013105 Ga0157369_11365561 Ga0157369_113655612 117
439 3300013105 Ga0157369_11648754 Ga0157369_116487542 117
440 3300013105 Ga0157369_12098885 Ga0157369_120988852 117
441 3300013296 Ga0157374_11521324 Ga0157374_115213241 117
442 3300013296 Ga0157374_11726409 Ga0157374_117264091 117
443 3300013297 Ga0157378_10299726 Ga0157378_102997262 117
444 3300013297 Ga0157378_10694935 Ga0157378_106949352 117
445 3300013297 Ga0157378_11861007 Ga0157378_118610071 117
446 3300013306 Ga0163162_10543595 Ga0163162_105435952 117
447 3300013306 Ga0163162_11161386 Ga0163162_111613862 117
448 3300013306 Ga0163162_11975909 Ga0163162_119759092 117
449 3300013306 Ga0163162_12103293 Ga0163162_121032932 117
450 3300013307 Ga0157372_10008003 Ga0157372_1000800315 117
451 3300013307 Ga0157372_10246843 Ga0157372_102468432 117
452 3300013307 Ga0157372_10316746 Ga0157372_103167462 117
453 3300013307 Ga0157372_10541446 Ga0157372_105414462 117
454 3300013307 Ga0157372_12199866 Ga0157372_121998662 117
455 3300013307 Ga0157372_12575632 Ga0157372_125756322 117
456 3300013307 Ga0157372_12668076 Ga0157372_126680761 117
457 3300013308 Ga0157375_11225367 Ga0157375_112253672 117
458 3300013308 Ga0157375_12327053 Ga0157375_123270532 117
459 3300013308 Ga0157375_13737377 Ga0157375_137373772 117
460 3300014325 Ga0163163_10187373 Ga0163163_101873733 117
461 3300014325 Ga0163163_10264691 Ga0163163_102646912 117
462 3300014325 Ga0163163_10274109 Ga0163163_102741093 117
463 3300014325 Ga0163163_10361707 Ga0163163_103617072 117
464 3300014325 Ga0163163_10593585 Ga0163163_105935852 117
465 3300014325 Ga0163163_11191372 Ga0163163_111913722 117
466 3300014325 Ga0163163_11424125 Ga0163163_114241252 117
467 3300014325 Ga0163163_11743896 Ga0163163_117438962 117
468 3300014325 Ga0163163_12138444 Ga0163163_121384441 117
469 3300014326 Ga0157380_10458201 Ga0157380_104582012 117
470 3300014326 Ga0157380_11319131 Ga0157380_113191312 117
471 3300014326 Ga0157380_12276686 Ga0157380_122766861 117
472 3300014326 Ga0157380_13302867 Ga0157380_133028671 117
473 3300014326 Ga0157380_13497053 Ga0157380_134970531 117
474 3300014497 Ga0182008_10483279 Ga0182008_104832792 117
475 3300014745 Ga0157377_10293775 Ga0157377_102937752 117
476 3300014968 Ga0157379_10018278 Ga0157379_100182789 117
477 3300014968 Ga0157379_10928923 Ga0157379_109289232 117
478 3300014968 Ga0157379_11192217 Ga0157379_111922172 117
479 3300014969 Ga0157376_11061232 Ga0157376_110612322 117
480 3300014969 Ga0157376_11074037 Ga0157376_110740372 117
481 3300014969 Ga0157376_11099890 Ga0157376_110998902 117
482 3300014969 Ga0157376_12501153 Ga0157376_125011532 117
483 3300020070 Ga0206356_11774943 Ga0206356_117749431 117
484 3300020081 Ga0206354_10052142 Ga0206354_100521422 117
485 3300020082 Ga0206353_11150984 Ga0206353_1115098410 117
486 3300020082 Ga0206353_11699445 Ga0206353_116994451 117
487 3300020082 Ga0206353_11767557 Ga0206353_117675572 117
488 3300021377 Ga0213874_10006129 Ga0213874_100061292 117
489 3300021377 Ga0213874_10007315 Ga0213874_100073151 117
490 3300021384 Ga0213876_10024395 Ga0213876_100243952 117
491 3300021384 Ga0213876_10121769 Ga0213876_101217692 117
492 3300021384 Ga0213876_10165842 Ga0213876_101658422 117
493 3300021388 Ga0213875_10000039 Ga0213875_10000039129 117
494 3300021388 Ga0213875_10411259 Ga0213875_104112592 117
495 3300022467 Ga0224712_10560137 Ga0224712_105601371 117
496 3300025321 Ga0207656_10000888 Ga0207656_100008886 117
497 3300025321 Ga0207656_10669578 Ga0207656_106695782 117
498 3300025898 Ga0207692_10115083 Ga0207692_101150832 117
499 3300025898 Ga0207692_10253111 Ga0207692_102531112 117
500 3300025898 Ga0207692_10519086 Ga0207692_105190862 117
501 3300025898 Ga0207692_10570636 Ga0207692_105706361 117
502 3300025900 Ga0207710_10115614 Ga0207710_101156142 117
503 3300025901 Ga0207688_10080836 Ga0207688_100808363 117
504 3300025901 Ga0207688_10354470 Ga0207688_103544702 117
505 3300025903 Ga0207680_10026183 Ga0207680_100261832 117
506 3300025903 Ga0207680_10034956 Ga0207680_100349564 117
507 3300025903 Ga0207680_10938487 Ga0207680_109384872 117
508 3300025905 Ga0207685_10121154 Ga0207685_101211541 117
509 3300025906 Ga0207699_10090676 Ga0207699_100906763 117
510 3300025906 Ga0207699_10429188 Ga0207699_104291881 117
511 3300025909 Ga0207705_10671620 Ga0207705_106716202 117
512 3300025909 Ga0207705_10762301 Ga0207705_107623012 117
513 3300025910 Ga0207684_10188573 Ga0207684_101885732 117
514 3300025912 Ga0207707_10142134 Ga0207707_101421342 117
515 3300025912 Ga0207707_10233014 Ga0207707_102330143 117
516 3300025912 Ga0207707_11451386 Ga0207707_114513862 117
517 3300025913 Ga0207695_10015780 Ga0207695_100157807 117
518 3300025913 Ga0207695_10101703 Ga0207695_101017033 117
519 3300025914 Ga0207671_10000926 Ga0207671_1000092617 117
520 3300025914 Ga0207671_10158969 Ga0207671_101589693 117
521 3300025914 Ga0207671_10591707 Ga0207671_105917072 117
522 3300025915 Ga0207693_10002816 Ga0207693_1000281614 117
523 3300025915 Ga0207693_10276228 Ga0207693_102762282 117
524 3300025915 Ga0207693_10322450 Ga0207693_103224502 117
525 3300025915 Ga0207693_10645703 Ga0207693_106457032 117
526 3300025915 Ga0207693_10858619 Ga0207693_108586192 117
527 3300025915 Ga0207693_11083612 Ga0207693_110836122 117
528 3300025916 Ga0207663_10000456 Ga0207663_1000045620 117
529 3300025916 Ga0207663_10007857 Ga0207663_100078572 117
530 3300025916 Ga0207663_10096720 Ga0207663_100967202 117
531 3300025916 Ga0207663_10288465 Ga0207663_102884652 117
532 3300025916 Ga0207663_10971796 Ga0207663_109717961 117
533 3300025916 Ga0207663_11455491 Ga0207663_114554912 117
534 3300025917 Ga0207660_10008646 Ga0207660_100086463 117
535 3300025917 Ga0207660_10647112 Ga0207660_106471122 117
536 3300025918 Ga0207662_10038327 Ga0207662_100383275 117
537 3300025918 Ga0207662_10397010 Ga0207662_103970101 117
538 3300025919 Ga0207657_10048398 Ga0207657_100483983 117
539 3300025919 Ga0207657_10456583 Ga0207657_104565831 117
540 3300025919 Ga0207657_10513081 Ga0207657_105130812 117
541 3300025919 Ga0207657_10635334 Ga0207657_106353342 117
542 3300025920 Ga0207649_10188747 Ga0207649_101887472 117
543 3300025920 Ga0207649_10205991 Ga0207649_102059912 117
544 3300025921 Ga0207652_10000437 Ga0207652_1000043734 117
545 3300025921 Ga0207652_10041264 Ga0207652_100412643 117
546 3300025921 Ga0207652_10116272 Ga0207652_101162722 117
547 3300025921 Ga0207652_10198647 Ga0207652_101986474 117
548 3300025921 Ga0207652_10245625 Ga0207652_102456252 117
549 3300025921 Ga0207652_11863849 Ga0207652_118638492 117
550 3300025922 Ga0207646_10057897 Ga0207646_100578972 117
551 3300025923 Ga0207681_10163206 Ga0207681_101632063 117
552 3300025923 Ga0207681_11007631 Ga0207681_110076312 117
553 3300025924 Ga0207694_11172119 Ga0207694_111721191 117
554 3300025926 Ga0207659_11469123 Ga0207659_114691231 117
555 3300025926 Ga0207659_11833984 Ga0207659_118339841 117
556 3300025927 Ga0207687_10000245 Ga0207687_1000024510 117
557 3300025927 Ga0207687_10303019 Ga0207687_103030193 117
558 3300025927 Ga0207687_10412913 Ga0207687_104129132 117
559 3300025928 Ga0207700_10126438 Ga0207700_101264383 117
560 3300025928 Ga0207700_10337031 Ga0207700_103370313 117
561 3300025928 Ga0207700_10733097 Ga0207700_107330972 117
562 3300025929 Ga0207664_10007507 Ga0207664_100075074 117
563 3300025929 Ga0207664_10047590 Ga0207664_100475903 117
564 3300025929 Ga0207664_10064701 Ga0207664_100647012 117
565 3300025929 Ga0207664_10077353 Ga0207664_100773533 117
566 3300025929 Ga0207664_10163715 Ga0207664_101637151 117
567 3300025929 Ga0207664_10383607 Ga0207664_103836072 117
568 3300025929 Ga0207664_10388698 Ga0207664_103886982 117
569 3300025929 Ga0207664_10719556 Ga0207664_107195561 117
570 3300025929 Ga0207664_10851614 Ga0207664_108516142 117
571 3300025929 Ga0207664_11669253 Ga0207664_116692531 117
572 3300025931 Ga0207644_10995100 Ga0207644_109951002 117
573 3300025932 Ga0207690_10025608 Ga0207690_100256085 117
574 3300025932 Ga0207690_10044723 Ga0207690_100447232 117
575 3300025932 Ga0207690_10114323 Ga0207690_101143233 117
576 3300025932 Ga0207690_10315653 Ga0207690_103156532 117
577 3300025932 Ga0207690_11131912 Ga0207690_111319122 117
578 3300025932 Ga0207690_11232176 Ga0207690_112321761 117
579 3300025933 Ga0207706_10159993 Ga0207706_101599932 117
580 3300025934 Ga0207686_10151692 Ga0207686_101516923 117
581 3300025935 Ga0207709_10054507 Ga0207709_100545072 117
582 3300025935 Ga0207709_10203613 Ga0207709_102036132 117
583 3300025935 Ga0207709_10649805 Ga0207709_106498052 117
584 3300025935 Ga0207709_11389727 Ga0207709_113897272 117
585 3300025935 Ga0207709_11839831 Ga0207709_118398312 117
586 3300025936 Ga0207670_10015345 Ga0207670_100153455 117
587 3300025936 Ga0207670_10182457 Ga0207670_101824572 117
588 3300025937 Ga0207669_10155533 Ga0207669_101555333 117
589 3300025937 Ga0207669_10280754 Ga0207669_102807542 117
590 3300025937 Ga0207669_10321941 Ga0207669_103219412 117
591 3300025937 Ga0207669_10337854 Ga0207669_103378543 117
592 3300025938 Ga0207704_10326400 Ga0207704_103264002 117
593 3300025938 Ga0207704_10412283 Ga0207704_104122832 117
594 3300025938 Ga0207704_10856528 Ga0207704_108565281 117
595 3300025939 Ga0207665_10229605 Ga0207665_102296053 117
596 3300025939 Ga0207665_10287311 Ga0207665_102873112 117
597 3300025939 Ga0207665_10454119 Ga0207665_104541191 117
598 3300025940 Ga0207691_10534795 Ga0207691_105347952 117
599 3300025941 Ga0207711_11879575 Ga0207711_118795751 117
600 3300025944 Ga0207661_10008946 Ga0207661_100089463 117
601 3300025944 Ga0207661_10009920 Ga0207661_100099204 117
602 3300025944 Ga0207661_10013529 Ga0207661_100135292 117
603 3300025944 Ga0207661_10036293 Ga0207661_100362935 117
604 3300025944 Ga0207661_10321330 Ga0207661_103213302 117
605 3300025944 Ga0207661_10816516 Ga0207661_108165162 117
606 3300025945 Ga0207679_10072882 Ga0207679_100728825 117
607 3300025945 Ga0207679_10247430 Ga0207679_102474302 117
608 3300025945 Ga0207679_10709881 Ga0207679_107098812 117
609 3300025945 Ga0207679_11138634 Ga0207679_111386341 117
610 3300025949 Ga0207667_10872939 Ga0207667_108729392 117
611 3300025961 Ga0207712_10084580 Ga0207712_100845803 117
612 3300025961 Ga0207712_10478579 Ga0207712_104785792 117
613 3300025961 Ga0207712_10688285 Ga0207712_106882852 117
614 3300025972 Ga0207668_10251425 Ga0207668_102514252 117
615 3300025972 Ga0207668_10381087 Ga0207668_103810873 117
616 3300025972 Ga0207668_10926780 Ga0207668_109267801 117
617 3300025972 Ga0207668_10931655 Ga0207668_109316552 117
618 3300025981 Ga0207640_10348843 Ga0207640_103488432 117
619 3300025981 Ga0207640_10349482 Ga0207640_103494822 117
620 3300025981 Ga0207640_10798305 Ga0207640_107983051 117
621 3300025981 Ga0207640_11591790 Ga0207640_115917901 117
622 3300025986 Ga0207658_10012425 Ga0207658_100124255 117
623 3300025986 Ga0207658_10160578 Ga0207658_101605783 117
624 3300025986 Ga0207658_10945156 Ga0207658_109451562 117
625 3300026023 Ga0207677_11176963 Ga0207677_111769632 117
626 3300026035 Ga0207703_10885070 Ga0207703_108850702 117
627 3300026041 Ga0207639_10632471 Ga0207639_106324711 117
628 3300026041 Ga0207639_11093572 Ga0207639_110935722 117
629 3300026041 Ga0207639_11719161 Ga0207639_117191611 117
630 3300026041 Ga0207639_12133750 Ga0207639_121337502 117
631 3300026067 Ga0207678_10003762 Ga0207678_100037627 117
632 3300026067 Ga0207678_10268199 Ga0207678_102681992 117
633 3300026067 Ga0207678_10313462 Ga0207678_103134622 117
634 3300026067 Ga0207678_11017016 Ga0207678_110170162 117
635 3300026075 Ga0207708_10035095 Ga0207708_100350956 117
636 3300026075 Ga0207708_10230288 Ga0207708_102302881 117
637 3300026075 Ga0207708_10809684 Ga0207708_108096841 117
638 3300026075 Ga0207708_10938787 Ga0207708_109387872 117
639 3300026078 Ga0207702_10018014 Ga0207702_100180141 117
640 3300026078 Ga0207702_10049053 Ga0207702_100490533 117
641 3300026078 Ga0207702_10212182 Ga0207702_102121822 117
642 3300026078 Ga0207702_10630688 Ga0207702_106306882 117
643 3300026078 Ga0207702_10650197 Ga0207702_106501972 117
644 3300026078 Ga0207702_10714192 Ga0207702_107141922 117
645 3300026078 Ga0207702_10925860 Ga0207702_109258602 117
646 3300026078 Ga0207702_11958148 Ga0207702_119581481 117
647 3300026088 Ga0207641_10164034 Ga0207641_101640342 117
648 3300026088 Ga0207641_10850948 Ga0207641_108509482 117
649 3300026088 Ga0207641_11479542 Ga0207641_114795422 117
650 3300026089 Ga0207648_10538285 Ga0207648_105382852 117
651 3300026089 Ga0207648_11152739 Ga0207648_111527392 117
652 3300026089 Ga0207648_11157850 Ga0207648_111578501 117
653 3300026089 Ga0207648_11514811 Ga0207648_115148112 117
654 3300026089 Ga0207648_11799245 Ga0207648_117992451 117
655 3300026095 Ga0207676_10071248 Ga0207676_100712482 117
656 3300026095 Ga0207676_11283701 Ga0207676_112837012 117
657 3300026116 Ga0207674_10207844 Ga0207674_102078442 117
658 3300026116 Ga0207674_10223437 Ga0207674_102234373 117
659 3300026116 Ga0207674_10818277 Ga0207674_108182771 117
660 3300026118 Ga0207675_100335310 Ga0207675_1003353102 117
661 3300026118 Ga0207675_100343657 Ga0207675_1003436573 117
662 3300026118 Ga0207675_100416208 Ga0207675_1004162082 117
663 3300026121 Ga0207683_10187507 Ga0207683_101875072 117
664 3300026121 Ga0207683_10317640 Ga0207683_103176403 117
665 3300026121 Ga0207683_10780196 Ga0207683_107801962 117
666 3300026142 Ga0207698_10079749 Ga0207698_100797494 117
667 3300026142 Ga0207698_10737820 Ga0207698_107378202 117
668 3300026142 Ga0207698_11162988 Ga0207698_111629881 117
669 3300027866 Ga0209813_10172896 Ga0209813_101728962 117
670 3300027907 Ga0207428_10039285 Ga0207428_100392853 117
671 3300027907 Ga0207428_10392431 Ga0207428_103924312 117
672 3300027907 Ga0207428_11293996 Ga0207428_112939961 117
673 3300028379 Ga0268266_10000775 Ga0268266_100007759 117
674 3300028379 Ga0268266_10027142 Ga0268266_100271425 117
675 3300028379 Ga0268266_10040678 Ga0268266_100406782 117
676 3300028379 Ga0268266_10048879 Ga0268266_100488795 117
677 3300028380 Ga0268265_10843507 Ga0268265_108435072 117
678 3300028380 Ga0268265_12047104 Ga0268265_120471041 117
679 3300028556 Ga0265337_1000231 Ga0265337_100023128 117
680 3300028556 Ga0265337_1000793 Ga0265337_10007937 117
681 3300028558 Ga0265326_10000102 Ga0265326_1000010234 117
682 3300028558 Ga0265326_10000759 Ga0265326_100007599 117
683 3300028558 Ga0265326_10079541 Ga0265326_100795412 117
684 3300028563 Ga0265319_1000035 Ga0265319_100003579 117
685 3300028563 Ga0265319_1000711 Ga0265319_10007119 117
686 3300028563 Ga0265319_1009092 Ga0265319_10090923 117
687 3300028577 Ga0265318_10001005 Ga0265318_100010057 117
688 3300028577 Ga0265318_10006420 Ga0265318_100064203 117
689 3300028654 Ga0265322_10000001 Ga0265322_10000001311 117
690 3300028654 Ga0265322_10016130 Ga0265322_100161302 117
691 3300028666 Ga0265336_10000002 Ga0265336_10000002793 117
692 3300028666 Ga0265336_10121243 Ga0265336_101212432 117
693 3300028800 Ga0265338_10000001 Ga0265338_1000000119 117
694 3300028800 Ga0265338_10000171 Ga0265338_1000017182 117
695 3300028800 Ga0265338_10044366 Ga0265338_100443664 117
696 3300028800 Ga0265338_10588346 Ga0265338_105883462 117
697 3300029957 Ga0265324_10002017 Ga0265324_100020178 117
698 3300029957 Ga0265324_10002801 Ga0265324_100028018 117
699 3300031090 Ga0265760_10200503 Ga0265760_102005032 117
700 3300031239 Ga0265328_10211835 Ga0265328_102118352 117
701 3300031240 Ga0265320_10000002 Ga0265320_10000002310 117
702 3300031240 Ga0265320_10036861 Ga0265320_100368614 117
703 3300031241 Ga0265325_10005914 Ga0265325_100059144 117
704 3300031242 Ga0265329_10003038 Ga0265329_100030385 117
705 3300031247 Ga0265340_10000001 Ga0265340_1000000119 117
706 3300031249 Ga0265339_10054115 Ga0265339_100541153 117
707 3300031249 Ga0265339_10058266 Ga0265339_100582663 117
708 3300031250 Ga0265331_10001887 Ga0265331_1000188714 117
709 3300031250 Ga0265331_10023551 Ga0265331_100235513 117
710 3300031250 Ga0265331_10476185 Ga0265331_104761851 117
711 3300031251 Ga0265327_10000011 Ga0265327_10000011310 117
712 3300031344 Ga0265316_10010658 Ga0265316_1001065812 117
713 3300031344 Ga0265316_10106406 Ga0265316_101064062 117
714 3300031344 Ga0265316_10119166 Ga0265316_101191663 117
715 3300031548 Ga0307408_100764095 Ga0307408_1007640952 117
716 3300031548 Ga0307408_102012362 Ga0307408_1020123622 117
717 3300031595 Ga0265313_10026603 Ga0265313_100266034 117
718 3300031595 Ga0265313_10094044 Ga0265313_100940442 117
719 3300031711 Ga0265314_10000062 Ga0265314_1000006244 117
720 3300031711 Ga0265314_10025765 Ga0265314_100257652 117
721 3300031711 Ga0265314_10100928 Ga0265314_101009282 117
722 3300031712 Ga0265342_10150191 Ga0265342_101501912 117
723 3300031731 Ga0307405_10533670 Ga0307405_105336702 117
724 3300031824 Ga0307413_10056354 Ga0307413_100563543 117
725 3300031824 Ga0307413_10150126 Ga0307413_101501262 117
726 3300031824 Ga0307413_10302453 Ga0307413_103024532 117
727 3300031852 Ga0307410_10223178 Ga0307410_102231782 117
728 3300031852 Ga0307410_10377706 Ga0307410_103777061 117
729 3300031852 Ga0307410_10528668 Ga0307410_105286682 117
730 3300031852 Ga0307410_10683473 Ga0307410_106834732 117
731 3300031852 Ga0307410_10975156 Ga0307410_109751561 117
732 3300031852 Ga0307410_11045037 Ga0307410_110450371 117
733 3300031852 Ga0307410_11288820 Ga0307410_112888201 117
734 3300031852 Ga0307410_11322177 Ga0307410_113221772 117
735 3300031901 Ga0307406_10103563 Ga0307406_101035634 117
736 3300031901 Ga0307406_10300310 Ga0307406_103003103 117
737 3300031901 Ga0307406_10593959 Ga0307406_105939592 117
738 3300031901 Ga0307406_10917892 Ga0307406_109178922 117
739 3300031901 Ga0307406_11358550 Ga0307406_113585502 117
740 3300031901 Ga0307406_11603338 Ga0307406_116033381 117
741 3300031911 Ga0307412_10781693 Ga0307412_107816931 117
742 3300031995 Ga0307409_100212749 Ga0307409_1002127492 117
743 3300031995 Ga0307409_100258319 Ga0307409_1002583193 117
744 3300031995 Ga0307409_100403961 Ga0307409_1004039612 117
745 3300031995 Ga0307409_100466342 Ga0307409_1004663422 117
746 3300031995 Ga0307409_100694160 Ga0307409_1006941601 117
747 3300031995 Ga0307409_100942276 Ga0307409_1009422762 117
748 3300031995 Ga0307409_101092857 Ga0307409_1010928572 117
749 3300031995 Ga0307409_101364577 Ga0307409_1013645771 117
750 3300031995 Ga0307409_101565932 Ga0307409_1015659322 117
751 3300031995 Ga0307409_102327763 Ga0307409_1023277632 117
752 3300032002 Ga0307416_100063741 Ga0307416_1000637412 117
753 3300032002 Ga0307416_100089140 Ga0307416_1000891403 117
754 3300032002 Ga0307416_100162724 Ga0307416_1001627244 117
755 3300032002 Ga0307416_100244751 Ga0307416_1002447512 117
756 3300032002 Ga0307416_100583236 Ga0307416_1005832361 117
757 3300032002 Ga0307416_100894787 Ga0307416_1008947872 117
758 3300032002 Ga0307416_100982031 Ga0307416_1009820312 117
759 3300032002 Ga0307416_101110859 Ga0307416_1011108592 117
760 3300032002 Ga0307416_101639697 Ga0307416_1016396971 117
761 3300032002 Ga0307416_102517163 Ga0307416_1025171632 117
762 3300032002 Ga0307416_103550613 Ga0307416_1035506131 117
763 3300032004 Ga0307414_10851513 Ga0307414_108515131 117
764 3300032004 Ga0307414_11992370 Ga0307414_119923701 117
765 3300032126 Ga0307415_100038241 Ga0307415_1000382412 117
766 3300032126 Ga0307415_100211331 Ga0307415_1002113312 117
767 3300032126 Ga0307415_100343821 Ga0307415_1003438211 117
768 3300032126 Ga0307415_100758566 Ga0307415_1007585662 117
769 3300032126 Ga0307415_100760634 Ga0307415_1007606342 117
770 3300032126 Ga0307415_100936163 Ga0307415_1009361631 117
771 3300032126 Ga0307415_100994897 Ga0307415_1009948972 117
772 3300032126 Ga0307415_102477564 Ga0307415_1024775641 117
773 3300032133 Ga0316583_10033392 Ga0316583_100333922 117
774 3300035090 Ga0373949_0043151 Ga0373949_0043151_362_715 117
775 3300035111 Ga0373923_0263083 Ga0373923_0263083_79_432 117
776 3300035114 Ga0373939_0017447 Ga0373939_0017447_869_1222 117
777 3300035115 Ga0373941_0418611 Ga0373941_0418611_21_374 117
778 3300035118 Ga0373954_0232707 Ga0373954_0232707_333_686 117
779 3300035120 Ga0373957_0042517 Ga0373957_0042517_549_902 117
780 3300035171 Ga0373946_0777776 Ga0373946_0777776_48_401 117
781 3300035172 Ga0373955_0184009 Ga0373955_0184009_63_416 117
782 3300035241 Ga0373961_0411432 Ga0373961_0411432_116_469 117
783 3300035724 Ga0373933_0091027 Ga0373933_0091027_1207_1560 117
784 3300036401 Ga0373937_0011260 Ga0373937_0011260_649_1002 117
785 3300036401 Ga0373937_0807690 Ga0373937_0807690_359_712 117
786 3300037068 Ga0373925_0086623 Ga0373925_0086623_977_1330 117
787 3300037312 Ga0395899_0020715 Ga0395899_0020715_4514_4867 117
788 3300037312 Ga0395899_0366605 Ga0395899_0366605_351_704 117
789 3300037418 Ga0395900_0006588 Ga0395900_0006588_5684_6037 117
790 3300037418 Ga0395900_0012281 Ga0395900_0012281_4497_4850 117
791 3300037418 Ga0395900_0073191 Ga0395900_0073191_918_1271 117
792 3300037418 Ga0395900_0174493 Ga0395900_0174493_1403_1756 117
793 3300037418 Ga0395900_0551524 Ga0395900_0551524_496_849 117
794 3300037418 Ga0395900_0600118 Ga0395900_0600118_475_828 117
795 3300037418 Ga0395900_0724908 Ga0395900_0724908_276_629 117
796 3300037418 Ga0395900_0742073 Ga0395900_0742073_97_450 117
797 3300037418 Ga0395900_0792355 Ga0395900_0792355_114_467 117
798 3300037418 Ga0395900_1228567 Ga0395900_1228567_117_473 117
799 3300037466 Ga0395898_0001924 Ga0395898_0001924_24486_24839 117
800 3300037466 Ga0395898_0008989 Ga0395898_0008989_5687_6040 117
801 3300037466 Ga0395898_0013542 Ga0395898_0013542_3909_4262 117
802 3300037466 Ga0395898_0013626 Ga0395898_0013626_965_1318 117
803 3300037466 Ga0395898_0067785 Ga0395898_0067785_2056_2409 117
804 3300037466 Ga0395898_0089579 Ga0395898_0089579_1197_1550 117
805 3300037466 Ga0395898_0153766 Ga0395898_0153766_732_1085 117
806 3300037466 Ga0395898_0165816 Ga0395898_0165816_1085_1441 117
807 3300037466 Ga0395898_0298218 Ga0395898_0298218_1092_1448 117
808 3300037466 Ga0395898_0318401 Ga0395898_0318401_737_1090 117
809 3300037466 Ga0395898_0378491 Ga0395898_0378491_405_758 117
810 3300037466 Ga0395898_1273869 Ga0395898_1273869_267_623 117
811 3300037466 Ga0395898_1407647 Ga0395898_1407647_20_373 117
812 3300037466 Ga0395898_1935065 Ga0395898_1935065_64_420 117
813 3300037466 Ga0395898_1961747 Ga0395898_1961747_137_490 117
814 3300037471 Ga0395905_0002248 Ga0395905_0002248_20523_20876 117
815 3300037471 Ga0395905_0003203 Ga0395905_0003203_12567_12920 117
816 3300037471 Ga0395905_0787182 Ga0395905_0787182_303_659 117
817 3300037471 Ga0395905_0950940 Ga0395905_0950940_223_576 117
818 3300037471 Ga0395905_1009888 Ga0395905_1009888_11_364 117
819 3300037471 Ga0395905_1017699 Ga0395905_1017699_203_556 117
820 3300037471 Ga0395905_1261236 Ga0395905_1261236_66_422 117
821 3300037471 Ga0395905_1438901 Ga0395905_1438901_100_453 117
822 3300037853 Ga0436364_0170146 Ga0436364_0170146_2740_3093 117
823 3300037853 Ga0436364_0440996 Ga0436364_0440996_171_524 117
824 3300037853 Ga0436364_0462369 Ga0436364_0462369_19743_20096 117
825 3300037853 Ga0436364_0668395 Ga0436364_0668395_266_619 117
826 3300037853 Ga0436364_0845509 Ga0436364_0845509_1027_1380 117
827 3300037853 Ga0436364_1250516 Ga0436364_1250516_876_1229 117
828 3300038443 Ga0395901_0015351 Ga0395901_0015351_3136_3489 117
829 3300038443 Ga0395901_0020861 Ga0395901_0020861_3644_3997 117
830 3300038443 Ga0395901_0021409 Ga0395901_0021409_1295_1648 117
831 3300038443 Ga0395901_0042505 Ga0395901_0042505_2545_2901 117
832 3300038443 Ga0395901_0055668 Ga0395901_0055668_1639_1992 117
833 3300038443 Ga0395901_0131300 Ga0395901_0131300_69_425 117
834 3300038443 Ga0395901_0276393 Ga0395901_0276393_472_825 117
835 3300038443 Ga0395901_0329398 Ga0395901_0329398_894_1247 117
836 3300038443 Ga0395901_0426208 Ga0395901_0426208_547_900 117
837 3300038443 Ga0395901_0510194 Ga0395901_0510194_54_410 117
838 3300038443 Ga0395901_0528339 Ga0395901_0528339_656_1009 117
839 3300038443 Ga0395901_0558745 Ga0395901_0558745_577_930 117
840 3300038443 Ga0395901_0564503 Ga0395901_0564503_733_1086 117
841 3300038443 Ga0395901_0898352 Ga0395901_0898352_231_584 117
842 3300038443 Ga0395901_0968150 Ga0395901_0968150_225_578 117
843 3300038996 Ga0242420_071819 Ga0242420_071819_201_554 117
844 3300039437 Ga0436365_0284935 Ga0436365_0284935_2244_2597 117
845 3300039437 Ga0436365_0681522 Ga0436365_0681522_712_1065 117
846 3300039437 Ga0436365_0875320 Ga0436365_0875320_9348_9701 117
847 3300039437 Ga0436365_0893932 Ga0436365_0893932_192_551 117
848 3300039437 Ga0436365_1627672 Ga0436365_1627672_387_740 117
849 3300039437 Ga0436365_1629816 Ga0436365_1629816_1067_1420 117
850 3300039437 Ga0436365_1719312 Ga0436365_1719312_665_1018 117
851 3300039447 Ga0436361_0514212 Ga0436361_0514212_91_444 117
852 3300039450 Ga0436363_0318653 Ga0436363_0318653_4397_4750 117
853 3300039450 Ga0436363_0501969 Ga0436363_0501969_288_641 117
854 3300039450 Ga0436363_0701900 Ga0436363_0701900_3089_3442 117
855 3300039450 Ga0436363_0831908 Ga0436363_0831908_299_652 117
856 3300039450 Ga0436363_0968274 Ga0436363_0968274_110_463 117
857 3300039450 Ga0436363_0994750 Ga0436363_0994750_1338_1691 117
858 3300039450 Ga0436363_1231557 Ga0436363_1231557_381_734 117
859 3300039450 Ga0436363_1367021 Ga0436363_1367021_84_437 117
860 3300039450 Ga0436363_1413184 Ga0436363_1413184_238_591 117
861 3300039450 Ga0436363_1550007 Ga0436363_1550007_42_395 117
862 3300039450 Ga0436363_1618679 Ga0436363_1618679_17_370 117
863 3300039453 Ga0436362_0528265 Ga0436362_0528265_81_440 117
864 3300039453 Ga0436362_0528703 Ga0436362_0528703_105_458 117
865 3300039453 Ga0436362_0611588 Ga0436362_0611588_652_1005 117
866 3300039453 Ga0436362_0662125 Ga0436362_0662125_52_405 117
867 3300041443 Ga0451789_0669134 Ga0451789_0669134_106_459 117
868 3300041443 Ga0451789_0978931 Ga0451789_0978931_57_413 117
869 3300041443 Ga0451789_1019140 Ga0451789_1019140_96_449 117
870 3300041451 Ga0451791_0128912 Ga0451791_0128912_380_733 117
871 3300041452 Ga0451793_0846886 Ga0451793_0846886_25_378 117
872 3300041456 Ga0451795_0490038 Ga0451795_0490038_53_406 117
873 3300041459 Ga0451800_1460710 Ga0451800_1460710_84_440 117
874 3300041459 Ga0451800_1690997 Ga0451800_1690997_448_804 117
875 3300041486 Ga0451807_2375813 Ga0451807_2375813_119_472 117
876 3300041491 Ga0451833_0871389 Ga0451833_0871389_126_479 117
877 3300041496 Ga0451839_0796435 Ga0451839_0796435_33_386 117
878 3300041501 Ga0451845_0312228 Ga0451845_0312228_168_521 117
879 3300041505 Ga0451849_0855266 Ga0451849_0855266_72_437 117
880 3300041512 Ga0451853_0646730 Ga0451853_0646730_21_374 117
881 3300041512 Ga0451853_1040408 Ga0451853_1040408_151_504 117
882 3300041512 Ga0451853_2534263 Ga0451853_2534263_138_494 117
883 3300042437 Ga0439444_0053368 Ga0439444_0053368_448_801 117
884 3300042437 Ga0439444_0114700 Ga0439444_0114700_259_612 117
885 3300042438 Ga0439459_0016860 Ga0439459_0016860_886_1275 117
886 3300042438 Ga0439459_0175198 Ga0439459_0175198_86_439 117
887 3300044656 Ga0466969_0385278 Ga0466969_0385278_135_488 117
888 3300044656 Ga0466969_0601765 Ga0466969_0601765_49_402 117
889 3300044658 Ga0466972_0595367 Ga0466972_0595367_86_439 117
890 3300044683 Ga0466965_0375049 Ga0466965_0375049_415_768 117
891 3300044683 Ga0466965_0381093 Ga0466965_0381093_309_662 117
892 3300044683 Ga0466965_0387177 Ga0466965_0387177_335_688 117
893 3300044683 Ga0466965_0533062 Ga0466965_0533062_112_465 117
894 3300044683 Ga0466965_0732233 Ga0466965_0732233_45_398 117
895 3300044684 Ga0466966_0045052 Ga0466966_0045052_826_1179 117
896 3300044684 Ga0466966_0054019 Ga0466966_0054019_439_792 117
897 3300044684 Ga0466966_0080059 Ga0466966_0080059_920_1273 117
898 3300044684 Ga0466966_0118339 Ga0466966_0118339_482_835 117
899 3300044684 Ga0466966_0131261 Ga0466966_0131261_915_1268 117
900 3300044684 Ga0466966_0640191 Ga0466966_0640191_60_425 117
901 3300044693 Ga0466961_0010068 Ga0466961_0010068_3509_3862 117
902 3300044693 Ga0466961_0118636 Ga0466961_0118636_1156_1509 117
903 3300044693 Ga0466961_0588541 Ga0466961_0588541_29_382 117
904 3300044693 Ga0466961_0698631 Ga0466961_0698631_158_511 117
905 3300044694 Ga0466963_0005222 Ga0466963_0005222_4693_5046 117
906 3300044694 Ga0466963_0006658 Ga0466963_0006658_5351_5704 117
907 3300044694 Ga0466963_0016745 Ga0466963_0016745_2728_3081 117
908 3300044694 Ga0466963_0031101 Ga0466963_0031101_2949_3302 117
909 3300044694 Ga0466963_0067318 Ga0466963_0067318_1767_2120 117
910 3300044694 Ga0466963_0069064 Ga0466963_0069064_814_1167 117
911 3300044694 Ga0466963_0076466 Ga0466963_0076466_1751_2107 117
912 3300044694 Ga0466963_0104486 Ga0466963_0104486_931_1284 117
913 3300044694 Ga0466963_0117279 Ga0466963_0117279_997_1350 117
914 3300044694 Ga0466963_0162617 Ga0466963_0162617_19_375 117
915 3300044694 Ga0466963_0239023 Ga0466963_0239023_743_1096 117
916 3300044694 Ga0466963_0243618 Ga0466963_0243618_656_1024 117
917 3300044694 Ga0466963_0507032 Ga0466963_0507032_340_693 117
918 3300044694 Ga0466963_0562429 Ga0466963_0562429_94_447 117
919 3300044694 Ga0466963_0976861 Ga0466963_0976861_111_464 117
920 3300044694 Ga0466963_1221138 Ga0466963_1221138_84_437 117
921 3300044706 Ga0466964_0737301 Ga0466964_0737301_26_379 117
922 3300044706 Ga0466964_0770399 Ga0466964_0770399_132_485 117
923 3300044719 Ga0466971_0088928 Ga0466971_0088928_661_1014 117
924 3300044719 Ga0466971_0166350 Ga0466971_0166350_668_1021 117
925 3300044719 Ga0466971_0316767 Ga0466971_0316767_178_531 117
926 3300044735 Ga0466968_0035395 Ga0466968_0035395_616_969 117
927 3300044735 Ga0466968_0078514 Ga0466968_0078514_767_1120 117
928 3300044735 Ga0466968_0089172 Ga0466968_0089172_802_1155 117
929 3300044735 Ga0466968_0106517 Ga0466968_0106517_115_468 117
930 3300044735 Ga0466968_0259560 Ga0466968_0259560_447_800 117
931 3300044765 Ga0466970_0089968 Ga0466970_0089968_506_859 117
932 3300044765 Ga0466970_0349268 Ga0466970_0349268_406_759 117
933 3300044765 Ga0466970_0356214 Ga0466970_0356214_44_397 117
934 3300044765 Ga0466970_0854758 Ga0466970_0854758_86_439 117
935 3300044842 Ga0466957_0012160 Ga0466957_0012160_3475_3828 117
936 3300044842 Ga0466957_0070771 Ga0466957_0070771_1424_1780 117
937 3300044842 Ga0466957_0075847 Ga0466957_0075847_401_754 117
938 3300044842 Ga0466957_0790815 Ga0466957_0790815_225_578 117
939 3300044901 Ga0466960_0087292 Ga0466960_0087292_526_879 117
940 3300044901 Ga0466960_0233123 Ga0466960_0233123_608_961 117
941 3300045049 Ga0466959_0063387 Ga0466959_0063387_1635_1988 117
942 3300045049 Ga0466959_0072072 Ga0466959_0072072_888_1241 117
943 3300045049 Ga0466959_0123009 Ga0466959_0123009_164_517 117
944 3300045049 Ga0466959_0181460 Ga0466959_0181460_676_1029 117
945 3300045049 Ga0466959_0304803 Ga0466959_0304803_460_813 117
946 3300045049 Ga0466959_0354193 Ga0466959_0354193_26_379 117
947 3300045049 Ga0466959_0514873 Ga0466959_0514873_343_696 117
948 3300045049 Ga0466959_0827024 Ga0466959_0827024_29_382 117
949 3300045049 Ga0466959_0997297 Ga0466959_0997297_178_531 117
950 3300045049 Ga0466959_1131399 Ga0466959_1131399_59_412 117
951 3300045049 Ga0466959_1173568 Ga0466959_1173568_11_364 117
952 3300045836 Ga0466958_0006396 Ga0466958_0006396_5036_5389 117
953 3300045836 Ga0466958_0054472 Ga0466958_0054472_399_752 117
954 3300045836 Ga0466958_0058694 Ga0466958_0058694_1674_2027 117
955 3300045836 Ga0466958_0078726 Ga0466958_0078726_607_960 117
956 3300045836 Ga0466958_0095175 Ga0466958_0095175_239_592 117
957 3300045836 Ga0466958_0178821 Ga0466958_0178821_447_800 117
958 3300045836 Ga0466958_0198503 Ga0466958_0198503_335_688 117
959 3300045836 Ga0466958_0304752 Ga0466958_0304752_74_427 117
960 3300045836 Ga0466958_0436320 Ga0466958_0436320_37_390 117
961 3300045836 Ga0466958_0517713 Ga0466958_0517713_20_376 117
962 3300045836 Ga0466958_0713536 Ga0466958_0713536_36_389 117
963 3300045976 Ga0466967_0000002 Ga0466967_0000002_197986_198339 117
964 3300045976 Ga0466967_0001530 Ga0466967_0001530_1472_1825 117
965 3300045976 Ga0466967_0004605 Ga0466967_0004605_149_502 117
966 3300045976 Ga0466967_0032493 Ga0466967_0032493_2175_2528 117
967 3300045976 Ga0466967_0044008 Ga0466967_0044008_1569_1922 117
968 3300045976 Ga0466967_0050187 Ga0466967_0050187_2888_3241 117
969 3300045976 Ga0466967_0059144 Ga0466967_0059144_1634_1987 117
970 3300045976 Ga0466967_0071601 Ga0466967_0071601_84_437 117
971 3300045976 Ga0466967_0075434 Ga0466967_0075434_2094_2447 117
972 3300045976 Ga0466967_0114500 Ga0466967_0114500_869_1225 117
973 3300045976 Ga0466967_0161105 Ga0466967_0161105_569_922 117
974 3300045976 Ga0466967_0187274 Ga0466967_0187274_1044_1397 117
975 3300045976 Ga0466967_0317125 Ga0466967_0317125_174_527 117
976 3300045976 Ga0466967_0400062 Ga0466967_0400062_829_1185 117
977 3300045976 Ga0466967_0534823 Ga0466967_0534823_449_802 117
978 3300045976 Ga0466967_0723427 Ga0466967_0723427_574_927 117
979 3300045976 Ga0466967_0726123 Ga0466967_0726123_359_724 117
980 3300045976 Ga0466967_0844297 Ga0466967_0844297_278_631 117
981 3300045976 Ga0466967_0917396 Ga0466967_0917396_259_612 117
982 3300045976 Ga0466967_0968207 Ga0466967_0968207_260_613 117
983 3300045976 Ga0466967_1025282 Ga0466967_1025282_100_453 117
984 3300045976 Ga0466967_1045822 Ga0466967_1045822_50_403 117
985 3300045976 Ga0466967_1053411 Ga0466967_1053411_438_791 117
986 3300045976 Ga0466967_1068664 Ga0466967_1068664_333_686 117
987 3300045976 Ga0466967_1093108 Ga0466967_1093108_328_681 117
988 3300045976 Ga0466967_1936412 Ga0466967_1936412_156_509 117
989 3300045976 Ga0466967_2318504 Ga0466967_2318504_51_407 117
990 3300046454 Ga0495592_0027842 Ga0495592_0027842_1901_2254 117
991 3300046454 Ga0495592_0095484 Ga0495592_0095484_754_1107 117
992 3300046454 Ga0495592_0100343 Ga0495592_0100343_1474_1827 117
993 3300046454 Ga0495592_0113866 Ga0495592_0113866_612_965 117
994 3300046454 Ga0495592_0223371 Ga0495592_0223371_109_468 117
995 3300046454 Ga0495592_0910477 Ga0495592_0910477_36_389 117
996 3300046459 Ga0495629_0187612 Ga0495629_0187612_993_1346 117
997 3300046459 Ga0495629_0216188 Ga0495629_0216188_774_1130 117
998 3300046459 Ga0495629_0399477 Ga0495629_0399477_346_699 117
999 3300046461 Ga0495641_0000004 Ga0495641_0000004_29071_29424 117
1000 3300046461 Ga0495641_0046351 Ga0495641_0046351_722_1114 117
1001 3300046461 Ga0495641_0053796 Ga0495641_0053796_546_899 117
1002 3300046462 Ga0495651_0009616 Ga0495651_0009616_5488_5841 117
1003 3300046462 Ga0495651_0163756 Ga0495651_0163756_905_1258 117
1004 3300046462 Ga0495651_0233311 Ga0495651_0233311_479_835 117
1005 3300046463 Ga0495653_0000352 Ga0495653_0000352_3363_3716 117
1006 3300046463 Ga0495653_0016825 Ga0495653_0016825_4304_4657 117
1007 3300046463 Ga0495653_0100178 Ga0495653_0100178_1200_1553 117
1008 3300046473 Ga0495582_0711929 Ga0495582_0711929_184_537 117
1009 3300046476 Ga0495662_0193911 Ga0495662_0193911_122_475 117
1010 3300046500 Ga0495596_0034392 Ga0495596_0034392_1338_1691 117
1011 3300046500 Ga0495596_0257553 Ga0495596_0257553_276_629 117
1012 3300046500 Ga0495596_0303573 Ga0495596_0303573_226_579 117
1013 3300046501 Ga0495607_0310671 Ga0495607_0310671_184_537 117
1014 3300046511 Ga0495608_0000079 Ga0495608_0000079_49886_50239 117
1015 3300046511 Ga0495608_0004801 Ga0495608_0004801_6666_7019 117
1016 3300046514 Ga0495618_0254003 Ga0495618_0254003_639_992 117
1017 3300046514 Ga0495618_0356040 Ga0495618_0356040_46_399 117
1018 3300046514 Ga0495618_0881910 Ga0495618_0881910_126_479 117
1019 3300046515 Ga0495620_0145895 Ga0495620_0145895_533_886 117
1020 3300046516 Ga0495628_0007165 Ga0495628_0007165_4828_5181 117
1021 3300046516 Ga0495628_0040415 Ga0495628_0040415_3318_3671 117
1022 3300046516 Ga0495628_0071004 Ga0495628_0071004_1321_1674 117
1023 3300046516 Ga0495628_0089575 Ga0495628_0089575_274_627 117
1024 3300046516 Ga0495628_0122122 Ga0495628_0122122_1204_1560 117
1025 3300046517 Ga0495630_0043596 Ga0495630_0043596_1233_1586 117
1026 3300046517 Ga0495630_0068062 Ga0495630_0068062_1327_1680 117
1027 3300046518 Ga0495631_0459591 Ga0495631_0459591_45_398 117
1028 3300046523 Ga0495644_0458859 Ga0495644_0458859_120_473 117
1029 3300046529 Ga0495652_0000003 Ga0495652_0000003_236419_236772 117
1030 3300046529 Ga0495652_0016179 Ga0495652_0016179_6276_6629 117
1031 3300046529 Ga0495652_0099518 Ga0495652_0099518_884_1240 117
1032 3300046529 Ga0495652_0183354 Ga0495652_0183354_967_1320 117
1033 3300046529 Ga0495652_0552523 Ga0495652_0552523_350_703 117
1034 3300046529 Ga0495652_0829440 Ga0495652_0829440_205_558 117
1035 3300046531 Ga0495665_0598665 Ga0495665_0598665_37_390 117
1036 3300046536 Ga0495587_0008422 Ga0495587_0008422_273_626 117
1037 3300046536 Ga0495587_0323543 Ga0495587_0323543_63_416 117
1038 3300046543 Ga0495645_0013437 Ga0495645_0013437_1572_1925 117
1039 3300046543 Ga0495645_0186286 Ga0495645_0186286_1037_1390 117
1040 3300046543 Ga0495645_0198310 Ga0495645_0198310_944_1297 117
1041 3300046559 Ga0495667_0000022 Ga0495667_0000022_29843_30196 117
1042 3300046559 Ga0495667_0003362 Ga0495667_0003362_2671_3024 117
1043 3300046615 Ga0495656_0693206 Ga0495656_0693206_137_490 117
1044 3300046616 Ga0495668_0087208 Ga0495668_0087208_132_485 117
1045 3300046642 Ga0495634_0013773 Ga0495634_0013773_5117_5470 117
1046 3300046642 Ga0495634_0398582 Ga0495634_0398582_46_399 117
1047 3300046642 Ga0495634_0670593 Ga0495634_0670593_164_517 117
1048 3300046648 Ga0495611_0461298 Ga0495611_0461298_78_431 117
1049 3300046660 Ga0495625_0000787 Ga0495625_0000787_28676_29029 117
1050 3300046663 Ga0495635_0005866 Ga0495635_0005866_1126_1479 117
1051 3300046675 Ga0495657_0000070 Ga0495657_0000070_49875_50228 117
1052 3300046675 Ga0495657_0007999 Ga0495657_0007999_1326_1679 117
1053 3300046675 Ga0495657_0298071 Ga0495657_0298071_224_577 117
1054 3300046678 Ga0495599_0115289 Ga0495599_0115289_104_457 117
1055 3300046678 Ga0495599_0118362 Ga0495599_0118362_91_444 117
1056 3300046680 Ga0495646_0005095 Ga0495646_0005095_1782_2135 117
1057 3300046683 Ga0495658_0904770 Ga0495658_0904770_177_530 117
1058 3300046684 Ga0495669_0011199 Ga0495669_0011199_1144_1497 117
1059 3300046684 Ga0495669_0517455 Ga0495669_0517455_55_408 117
1060 3300046690 Ga0495624_0703462 Ga0495624_0703462_16_372 117
1061 3300046691 Ga0495670_0607533 Ga0495670_0607533_172_525 117
1062 3300046692 Ga0495671_0325986 Ga0495671_0325986_270_623 117
1063 3300046694 Ga0495649_0400661 Ga0495649_0400661_180_533 117
1064 3300046794 Ga0495589_0499875 Ga0495589_0499875_189_542 117
1065 3300046809 Ga0495600_0019811 Ga0495600_0019811_1117_1470 117
1066 3300046809 Ga0495600_0139827 Ga0495600_0139827_1046_1438 117
1067 3300047315 Ga0495581_0814785 Ga0495581_0814785_142_495 117
1068 3300047317 Ga0495604_0000293 Ga0495604_0000293_1020_1412 117
1069 3300047317 Ga0495604_0006792 Ga0495604_0006792_1300_1653 117
1070 3300047317 Ga0495604_0013478 Ga0495604_0013478_5102_5494 117
1071 3300047319 Ga0495674_0022940 Ga0495674_0022940_1586_1939 117
1072 3300047320 Ga0495672_0008444 Ga0495672_0008444_2693_3046 117
1073 3300047320 Ga0495672_0023008 Ga0495672_0023008_3128_3484 117
1074 3300047320 Ga0495672_0024786 Ga0495672_0024786_117_476 117
1075 3300047321 Ga0495676_0000860 Ga0495676_0000860_18947_19300 117
1076 3300047321 Ga0495676_0049452 Ga0495676_0049452_665_1018 117
1077 3300047321 Ga0495676_0059428 Ga0495676_0059428_421_774 117
1078 3300047321 Ga0495676_0728096 Ga0495676_0728096_239_592 117
1079 3300047322 Ga0495680_0004597 Ga0495680_0004597_94_447 117
1080 3300047322 Ga0495680_0011964 Ga0495680_0011964_4524_4877 117
1081 3300047322 Ga0495680_0027732 Ga0495680_0027732_103_456 117
1082 3300047444 Ga0495675_0000569 Ga0495675_0000569_2378_2731 117
1083 3300047444 Ga0495675_0483522 Ga0495675_0483522_107_460 117
1084 3300047445 Ga0495677_0461763 Ga0495677_0461763_36_389 117
1085 3300047471 Ga0495684_0060993 Ga0495684_0060993_832_1185 117
1086 3300047471 Ga0495684_0462525 Ga0495684_0462525_422_775 117
1087 3300047472 Ga0495686_0163611 Ga0495686_0163611_432_785 117
1088 3300047673 Ga0495593_0207252 Ga0495593_0207252_583_936 117
1089 3300048088 Ga0495602_0000393 Ga0495602_0000393_33551_33943 117
1090 3300048088 Ga0495602_0003654 Ga0495602_0003654_11106_11459 117
1091 3300048088 Ga0495602_0063411 Ga0495602_0063411_211_564 117
1092 3300048088 Ga0495602_0174004 Ga0495602_0174004_874_1227 117
1093 3300048088 Ga0495602_0190657 Ga0495602_0190657_246_602 117
1094 3300048088 Ga0495602_0226581 Ga0495602_0226581_596_949 117
1095 3300048088 Ga0495602_1077356 Ga0495602_1077356_142_495 117
1096 3300048903 Ga0496100_0000001 Ga0496100_0000001_122463_122816 117
1097 3300048903 Ga0496100_0000004 Ga0496100_0000004_143270_143623 117
1098 3300048903 Ga0496100_0021642 Ga0496100_0021642_3335_3688 117
1099 3300048903 Ga0496100_0033861 Ga0496100_0033861_706_1059 117
1100 3300048903 Ga0496100_0067643 Ga0496100_0067643_509_862 117
1101 3300048903 Ga0496100_0263888 Ga0496100_0263888_725_1078 117
1102 3300048903 Ga0496100_0628123 Ga0496100_0628123_241_594 117
1103 3300048904 Ga0496101_0000007 Ga0496101_0000007_143270_143623 117
1104 3300048904 Ga0496101_0000028 Ga0496101_0000028_122452_122805 117
1105 3300048904 Ga0496101_0002628 Ga0496101_0002628_5624_5977 117
1106 3300048904 Ga0496101_0480986 Ga0496101_0480986_155_508 117
1107 3300048904 Ga0496101_1158706 Ga0496101_1158706_123_476 117
1108 3300048905 Ga0496102_0016316 Ga0496102_0016316_5716_6069 117
1109 3300048905 Ga0496102_0133289 Ga0496102_0133289_614_967 117
1110 3300048905 Ga0496102_0552400 Ga0496102_0552400_89_445 117
1111 3300048905 Ga0496102_1187321 Ga0496102_1187321_232_585 117
1112 3300048905 Ga0496102_1292070 Ga0496102_1292070_168_521 117
1113 3300048905 Ga0496102_1410647 Ga0496102_1410647_122_475 117
1114 3300048905 Ga0496102_1669979 Ga0496102_1669979_10_366 117
1115 3300048906 Ga0496103_0219180 Ga0496103_0219180_542_895 117
1116 3300048907 Ga0496104_0002173 Ga0496104_0002173_800_1156 117
1117 3300048907 Ga0496104_0008057 Ga0496104_0008057_107_460 117
1118 3300048907 Ga0496104_0018264 Ga0496104_0018264_1493_1885 117
1119 3300048907 Ga0496104_0064153 Ga0496104_0064153_118_471 117
1120 3300048907 Ga0496104_0123482 Ga0496104_0123482_1983_2336 117
1121 3300048907 Ga0496104_0545396 Ga0496104_0545396_135_488 117
1122 3300048908 Ga0496105_0001638 Ga0496105_0001638_8291_8647 117
1123 3300048908 Ga0496105_0046864 Ga0496105_0046864_2931_3284 117
1124 3300048908 Ga0496105_0075697 Ga0496105_0075697_1021_1374 117
1125 3300048908 Ga0496105_0098434 Ga0496105_0098434_233_586 117
1126 3300048908 Ga0496105_0222250 Ga0496105_0222250_425_778 117
1127 3300048908 Ga0496105_0442114 Ga0496105_0442114_551_904 117
1128 3300048908 Ga0496105_0714565 Ga0496105_0714565_125_481 117
1129 3300048909 Ga0496106_0000004 Ga0496106_0000004_104684_105037 117
1130 3300048909 Ga0496106_0000013 Ga0496106_0000013_137493_137846 117
1131 3300048909 Ga0496106_0000055 Ga0496106_0000055_15382_15735 117
1132 3300048909 Ga0496106_0008739 Ga0496106_0008739_691_1044 117
1133 3300048909 Ga0496106_0091830 Ga0496106_0091830_36_389 117
1134 3300048909 Ga0496106_0318289 Ga0496106_0318289_361_714 117
1135 3300048909 Ga0496106_0418532 Ga0496106_0418532_530_883 117
1136 3300048910 Ga0496107_0000001 Ga0496107_0000001_143270_143623 117
1137 3300048910 Ga0496107_0000002 Ga0496107_0000002_125672_126025 117
1138 3300048910 Ga0496107_0001160 Ga0496107_0001160_6467_6820 117
1139 3300048910 Ga0496107_0060036 Ga0496107_0060036_808_1161 117
1140 3300048910 Ga0496107_0158261 Ga0496107_0158261_455_808 117
1141 3300048910 Ga0496107_0194104 Ga0496107_0194104_991_1344 117
1142 3300048910 Ga0496107_0323566 Ga0496107_0323566_134_487 117
1143 3300048910 Ga0496107_1064694 Ga0496107_1064694_130_483 117
1144 3300048911 Ga0496108_0000894 Ga0496108_0000894_9171_9524 117
1145 3300048911 Ga0496108_0097078 Ga0496108_0097078_1660_2013 117
1146 3300048911 Ga0496108_0224659 Ga0496108_0224659_288_641 117
1147 3300048911 Ga0496108_0454500 Ga0496108_0454500_130_483 117
1148 3300048911 Ga0496108_0608961 Ga0496108_0608961_519_872 117
1149 3300048911 Ga0496108_0684876 Ga0496108_0684876_165_518 117
1150 3300048911 Ga0496108_0829293 Ga0496108_0829293_167_520 117
1151 3300048911 Ga0496108_0901370 Ga0496108_0901370_129_482 117
1152 3300048911 Ga0496108_1694499 Ga0496108_1694499_123_476 117
1153 3300048912 Ga0496109_0006929 Ga0496109_0006929_4060_4413 117
1154 3300048912 Ga0496109_0033238 Ga0496109_0033238_2020_2373 117
1155 3300048912 Ga0496109_0053610 Ga0496109_0053610_2977_3330 117
1156 3300048912 Ga0496109_0082049 Ga0496109_0082049_1013_1366 117
1157 3300048912 Ga0496109_0149852 Ga0496109_0149852_1572_1925 117
1158 3300048912 Ga0496109_0243426 Ga0496109_0243426_870_1223 117
1159 3300048912 Ga0496109_0283772 Ga0496109_0283772_1096_1449 117
1160 3300048912 Ga0496109_0313779 Ga0496109_0313779_680_1033 117
1161 3300048912 Ga0496109_0360669 Ga0496109_0360669_827_1180 117
1162 3300048912 Ga0496109_0600892 Ga0496109_0600892_33_386 117
1163 3300048912 Ga0496109_0804844 Ga0496109_0804844_247_600 117
1164 3300048912 Ga0496109_1144692 Ga0496109_1144692_171_524 117
1165 3300048913 Ga0496110_0000017 Ga0496110_0000017_50730_51083 117
1166 3300048913 Ga0496110_0004843 Ga0496110_0004843_6147_6500 117
1167 3300048913 Ga0496110_0012777 Ga0496110_0012777_1674_2027 117
1168 3300048913 Ga0496110_0074973 Ga0496110_0074973_372_725 117
1169 3300048913 Ga0496110_0103494 Ga0496110_0103494_1103_1456 117
1170 3300048913 Ga0496110_0103749 Ga0496110_0103749_1308_1661 117
1171 3300048913 Ga0496110_0201636 Ga0496110_0201636_866_1219 117
1172 3300048913 Ga0496110_0428696 Ga0496110_0428696_593_946 117
1173 3300048913 Ga0496110_0865243 Ga0496110_0865243_409_762 117
1174 3300048913 Ga0496110_0994844 Ga0496110_0994844_350_703 117
1175 3300048913 Ga0496110_1231925 Ga0496110_1231925_36_389 117
1176 3300048914 Ga0496111_0000003 Ga0496111_0000003_41701_42054 117
1177 3300048914 Ga0496111_0002803 Ga0496111_0002803_6094_6447 117
1178 3300048914 Ga0496111_0017810 Ga0496111_0017810_304_657 117
1179 3300048914 Ga0496111_0096669 Ga0496111_0096669_576_929 117
1180 3300048914 Ga0496111_0192085 Ga0496111_0192085_302_655 117
1181 3300048914 Ga0496111_0349553 Ga0496111_0349553_490_843 117
1182 3300048914 Ga0496111_0388634 Ga0496111_0388634_367_720 117
1183 3300048914 Ga0496111_0984130 Ga0496111_0984130_90_443 117
1184 3300048915 Ga0496112_0003150 Ga0496112_0003150_11646_11999 117
1185 3300048915 Ga0496112_0122395 Ga0496112_0122395_274_627 117
1186 3300048915 Ga0496112_0133083 Ga0496112_0133083_635_988 117
1187 3300048915 Ga0496112_0147497 Ga0496112_0147497_177_530 117
1188 3300048915 Ga0496112_0227559 Ga0496112_0227559_1189_1542 117
1189 3300048915 Ga0496112_0406619 Ga0496112_0406619_266_619 117
1190 3300048915 Ga0496112_0474164 Ga0496112_0474164_525_878 117
1191 3300048915 Ga0496112_0625134 Ga0496112_0625134_300_653 117
1192 3300048916 Ga0496113_0014642 Ga0496113_0014642_2859_3212 117
1193 3300048916 Ga0496113_0015039 Ga0496113_0015039_228_581 117
1194 3300048916 Ga0496113_0020998 Ga0496113_0020998_3084_3437 117
1195 3300048916 Ga0496113_0061363 Ga0496113_0061363_453_845 117
1196 3300048916 Ga0496113_0495178 Ga0496113_0495178_317_670 117
1197 3300048917 Ga0496114_0227050 Ga0496114_0227050_1025_1378 117
1198 3300048917 Ga0496114_0430786 Ga0496114_0430786_572_925 117
1199 3300048917 Ga0496114_1072568 Ga0496114_1072568_120_473 117
1200 3300048918 Ga0496115_0000052 Ga0496115_0000052_74381_74734 117
1201 3300048918 Ga0496115_0000057 Ga0496115_0000057_24158_24511 117
1202 3300048918 Ga0496115_0005376 Ga0496115_0005376_5431_5784 117
1203 3300048918 Ga0496115_0005528 Ga0496115_0005528_7222_7575 117
1204 3300048918 Ga0496115_0159025 Ga0496115_0159025_255_608 117
1205 3300048918 Ga0496115_0169250 Ga0496115_0169250_1390_1743 117
1206 3300048918 Ga0496115_0508541 Ga0496115_0508541_527_880 117
1207 3300048918 Ga0496115_0585309 Ga0496115_0585309_70_423 117
1208 3300048921 Ga0496118_0211147 Ga0496118_0211147_366_719 117
1209 3300048922 Ga0496119_0009312 Ga0496119_0009312_2737_3090 117
1210 3300048922 Ga0496119_0267571 Ga0496119_0267571_492_845 117
1211 3300048923 Ga0496120_0018982 Ga0496120_0018982_703_1056 117
1212 3300048923 Ga0496120_0135236 Ga0496120_0135236_660_1016 117
1213 3300048924 Ga0496121_0026404 Ga0496121_0026404_2431_2784 117
1214 3300048924 Ga0496121_0110305 Ga0496121_0110305_1664_2017 117
1215 3300048925 Ga0496122_0609245 Ga0496122_0609245_144_497 117
1216 3300048927 Ga0496124_0050632 Ga0496124_0050632_1486_1839 117
1217 3300048929 Ga0496126_0011699 Ga0496126_0011699_3358_3711 117
1218 3300048929 Ga0496126_0281488 Ga0496126_0281488_355_708 117
1219 3300049161 Ga0501305_105707 Ga0501305_105707_116_469 117
1220 3300049568 Ga0501031_0029469 Ga0501031_0029469_1500_1853 117
1221 3300049568 Ga0501031_0355893 Ga0501031_0355893_439_792 117
1222 3300049568 Ga0501031_0374416 Ga0501031_0374416_539_892 117
1223 3300049568 Ga0501031_0485900 Ga0501031_0485900_397_750 117
1224 3300049569 Ga0501032_0000875 Ga0501032_0000875_10594_10977 117
1225 3300049570 Ga0501033_0000657 Ga0501033_0000657_21043_21426 117
1226 3300049570 Ga0501033_0480143 Ga0501033_0480143_349_702 117
1227 3300049570 Ga0501033_0480167 Ga0501033_0480167_23_376 117
1228 3300049571 Ga0501034_0003696 Ga0501034_0003696_11513_11896 117
1229 3300049571 Ga0501034_0015452 Ga0501034_0015452_5360_5743 117
1230 3300049571 Ga0501034_0136288 Ga0501034_0136288_154_519 117
1231 3300049571 Ga0501034_0208966 Ga0501034_0208966_1103_1456 117
1232 3300049571 Ga0501034_0249946 Ga0501034_0249946_687_1043 117
1233 3300049571 Ga0501034_0260235 Ga0501034_0260235_679_1053 117
1234 3300049571 Ga0501034_0809400 Ga0501034_0809400_77_430 117
1235 3300049572 Ga0501036_0001123 Ga0501036_0001123_9324_9707 117
1236 3300049572 Ga0501036_0051379 Ga0501036_0051379_2654_3007 117
1237 3300049572 Ga0501036_0152148 Ga0501036_0152148_752_1105 117
1238 3300049572 Ga0501036_0250964 Ga0501036_0250964_34_387 117
1239 3300049572 Ga0501036_1703006 Ga0501036_1703006_107_481 117
1240 3300049572 Ga0501036_1719008 Ga0501036_1719008_103_456 117
1241 3300049573 Ga0501037_0000381 Ga0501037_0000381_17073_17456 117
1242 3300049573 Ga0501037_0550319 Ga0501037_0550319_316_669 117
1243 3300049574 Ga0501038_0001755 Ga0501038_0001755_9320_9703 117
1244 3300049574 Ga0501038_0360661 Ga0501038_0360661_689_1042 117
1245 3300049574 Ga0501038_1171432 Ga0501038_1171432_160_516 117
1246 3300049574 Ga0501038_1178666 Ga0501038_1178666_190_543 117
1247 3300049575 Ga0501039_0008256 Ga0501039_0008256_2613_2996 117
1248 3300049575 Ga0501039_0014805 Ga0501039_0014805_2634_2987 117
1249 3300049575 Ga0501039_0295526 Ga0501039_0295526_192_545 117
1250 3300049575 Ga0501039_0340267 Ga0501039_0340267_549_902 117
1251 3300049575 Ga0501039_0350666 Ga0501039_0350666_200_553 117
1252 3300049575 Ga0501039_0785889 Ga0501039_0785889_256_609 117
1253 3300049576 Ga0501040_0071691 Ga0501040_0071691_1147_1500 117
1254 3300049576 Ga0501040_0071829 Ga0501040_0071829_720_1073 117
1255 3300049576 Ga0501040_0199531 Ga0501040_0199531_1024_1410 117
1256 3300049576 Ga0501040_0246382 Ga0501040_0246382_876_1229 117
1257 3300049576 Ga0501040_1037189 Ga0501040_1037189_123_476 117
1258 3300049577 Ga0501041_0076592 Ga0501041_0076592_1038_1391 117
1259 3300049577 Ga0501041_0120629 Ga0501041_0120629_316_669 117
1260 3300049577 Ga0501041_0128655 Ga0501041_0128655_173_559 117
1261 3300049577 Ga0501041_0633555 Ga0501041_0633555_237_590 117
1262 3300049577 Ga0501041_0814959 Ga0501041_0814959_99_473 117
1263 3300049578 Ga0501042_0014273 Ga0501042_0014273_2386_2739 117
1264 3300049578 Ga0501042_0033027 Ga0501042_0033027_2726_3109 117
1265 3300049578 Ga0501042_0128104 Ga0501042_0128104_886_1239 117
1266 3300049578 Ga0501042_0218000 Ga0501042_0218000_631_1005 117
1267 3300049578 Ga0501042_0222127 Ga0501042_0222127_333_686 117
1268 3300049578 Ga0501042_0312346 Ga0501042_0312346_661_1014 117
1269 3300049578 Ga0501042_0416821 Ga0501042_0416821_138_491 117
1270 3300049578 Ga0501042_0481414 Ga0501042_0481414_493_846 117
1271 3300049578 Ga0501042_0713394 Ga0501042_0713394_220_573 117
1272 3300049578 Ga0501042_0732085 Ga0501042_0732085_273_626 117
1273 3300049579 Ga0501043_0001524 Ga0501043_0001524_9221_9604 117
1274 3300049579 Ga0501043_0438049 Ga0501043_0438049_246_602 117
1275 3300049579 Ga0501043_0662961 Ga0501043_0662961_335_688 117
1276 3300049579 Ga0501043_0727939 Ga0501043_0727939_302_676 117
1277 3300049579 Ga0501043_0812041 Ga0501043_0812041_87_461 117
1278 3300049580 Ga0501046_0000876 Ga0501046_0000876_9323_9706 117
1279 3300049580 Ga0501046_0452040 Ga0501046_0452040_423_776 117
1280 3300049580 Ga0501046_0556597 Ga0501046_0556597_167_520 117
1281 3300049581 Ga0501047_0000733 Ga0501047_0000733_21111_21494 117
1282 3300049581 Ga0501047_0013811 Ga0501047_0013811_5689_6063 117
1283 3300049581 Ga0501047_0085582 Ga0501047_0085582_837_1193 117
1284 3300049581 Ga0501047_0091018 Ga0501047_0091018_426_782 117
1285 3300049581 Ga0501047_0098585 Ga0501047_0098585_2344_2697 117
1286 3300049581 Ga0501047_0266083 Ga0501047_0266083_18_401 117
1287 3300049582 Ga0501048_0000728 Ga0501048_0000728_6612_6995 117
1288 3300049582 Ga0501048_0111685 Ga0501048_0111685_883_1269 117
1289 3300049582 Ga0501048_0116542 Ga0501048_0116542_267_620 117
1290 3300049582 Ga0501048_0204596 Ga0501048_0204596_554_907 117
1291 3300049582 Ga0501048_0238284 Ga0501048_0238284_484_837 117
1292 3300049582 Ga0501048_0310361 Ga0501048_0310361_715_1068 117
1293 3300049583 Ga0501067_0085820 Ga0501067_0085820_199_582 117
1294 3300049584 Ga0501068_0103812 Ga0501068_0103812_1030_1383 117
1295 3300049585 Ga0501069_0009335 Ga0501069_0009335_2820_3203 117
1296 3300049586 Ga0501070_0000368 Ga0501070_0000368_19538_19921 117
1297 3300049586 Ga0501070_0009917 Ga0501070_0009917_7659_8012 117
1298 3300049586 Ga0501070_0219141 Ga0501070_0219141_184_540 117
1299 3300049586 Ga0501070_0502508 Ga0501070_0502508_166_519 117
1300 3300049586 Ga0501070_1066774 Ga0501070_1066774_121_474 117
1301 3300049586 Ga0501070_1447870 Ga0501070_1447870_110_463 117
1302 3300049587 Ga0501071_0061062 Ga0501071_0061062_1872_2255 117
1303 3300049587 Ga0501071_0093375 Ga0501071_0093375_543_896 117
1304 3300049587 Ga0501071_0267170 Ga0501071_0267170_194_547 117
1305 3300049587 Ga0501071_0304708 Ga0501071_0304708_504_857 117
1306 3300049587 Ga0501071_0387939 Ga0501071_0387939_467_820 117
1307 3300049587 Ga0501071_0544866 Ga0501071_0544866_129_506 117
1308 3300049587 Ga0501071_0581288 Ga0501071_0581288_280_633 117
1309 3300049587 Ga0501071_1050022 Ga0501071_1050022_155_508 117
1310 3300049588 Ga0501072_0023777 Ga0501072_0023777_3890_4243 117
1311 3300049588 Ga0501072_0047356 Ga0501072_0047356_1649_2002 117
1312 3300049588 Ga0501072_0048878 Ga0501072_0048878_2876_3259 117
1313 3300049588 Ga0501072_0066621 Ga0501072_0066621_2406_2792 117
1314 3300049588 Ga0501072_0095652 Ga0501072_0095652_790_1143 117
1315 3300049588 Ga0501072_0122272 Ga0501072_0122272_1672_2025 117
1316 3300049588 Ga0501072_0448254 Ga0501072_0448254_212_565 117
1317 3300049588 Ga0501072_1484319 Ga0501072_1484319_56_433 117
1318 3300049589 Ga0501073_0003432 Ga0501073_0003432_5256_5639 117
1319 3300049590 Ga0501074_0006975 Ga0501074_0006975_2170_2553 117
1320 3300049590 Ga0501074_0010425 Ga0501074_0010425_1483_1836 117
1321 3300049590 Ga0501074_0015525 Ga0501074_0015525_230_583 117
1322 3300049590 Ga0501074_0252643 Ga0501074_0252643_357_710 117
1323 3300049590 Ga0501074_0340294 Ga0501074_0340294_323_676 117
1324 3300049591 Ga0501075_0023372 Ga0501075_0023372_2797_3150 117
1325 3300049591 Ga0501075_0053010 Ga0501075_0053010_355_708 117
1326 3300049591 Ga0501075_0071301 Ga0501075_0071301_645_998 117
1327 3300049591 Ga0501075_0108361 Ga0501075_0108361_1128_1514 117
1328 3300049591 Ga0501075_0128559 Ga0501075_0128559_173_526 117
1329 3300049591 Ga0501075_0149227 Ga0501075_0149227_969_1322 117
1330 3300049591 Ga0501075_0529819 Ga0501075_0529819_65_418 117
1331 3300049592 Ga0501076_0028477 Ga0501076_0028477_1949_2305 117
1332 3300049592 Ga0501076_0087350 Ga0501076_0087350_1375_1728 117
1333 3300049592 Ga0501076_0150232 Ga0501076_0150232_654_1040 117
1334 3300049592 Ga0501076_0179800 Ga0501076_0179800_1044_1397 117
1335 3300049592 Ga0501076_1009127 Ga0501076_1009127_104_457 117
1336 3300049593 Ga0501077_0509266 Ga0501077_0509266_205_558 117
1337 3300049741 Ga0501079_0018317 Ga0501079_0018317_1974_2357 117
1338 3300049741 Ga0501079_0059346 Ga0501079_0059346_2393_2746 117
1339 3300049741 Ga0501079_0086291 Ga0501079_0086291_1989_2342 117
1340 3300049741 Ga0501079_0489760 Ga0501079_0489760_65_439 117
1341 3300049741 Ga0501079_0702041 Ga0501079_0702041_378_731 117
1342 3300049742 Ga0501080_0045468 Ga0501080_0045468_2409_2762 117
1343 3300049742 Ga0501080_0070883 Ga0501080_0070883_885_1268 117
1344 3300049743 Ga0501081_0041391 Ga0501081_0041391_2347_2700 117
1345 3300049743 Ga0501081_0076530 Ga0501081_0076530_1809_2162 117
1346 3300049743 Ga0501081_0134366 Ga0501081_0134366_1197_1550 117
1347 3300049743 Ga0501081_0447138 Ga0501081_0447138_471_950 117
1348 3300049743 Ga0501081_0511594 Ga0501081_0511594_223_576 117
1349 3300049743 Ga0501081_0836633 Ga0501081_0836633_133_486 117
1350 3300049743 Ga0501081_1212176 Ga0501081_1212176_99_452 117
1351 3300049744 Ga0501083_0000832 Ga0501083_0000832_10575_10958 117
1352 3300049744 Ga0501083_0189079 Ga0501083_0189079_949_1302 117
1353 3300049822 Ga0501035_0000224 Ga0501035_0000224_21461_21844 117
1354 3300049822 Ga0501035_0182903 Ga0501035_0182903_152_505 117
1355 3300049822 Ga0501035_0270682 Ga0501035_0270682_376_729 117
1356 3300049822 Ga0501035_0371373 Ga0501035_0371373_328_681 117
1357 3300049822 Ga0501035_0624721 Ga0501035_0624721_106_492 117
1358 3300049822 Ga0501035_0960464 Ga0501035_0960464_282_638 117
1359 3300049822 Ga0501035_1334643 Ga0501035_1334643_55_408 117
1360 3300049823 Ga0501044_0000542 Ga0501044_0000542_12326_12709 117
1361 3300049823 Ga0501044_0170144 Ga0501044_0170144_1314_1667 117
1362 3300049823 Ga0501044_0179929 Ga0501044_0179929_179_532 117
1363 3300049823 Ga0501044_0261693 Ga0501044_0261693_766_1122 117
1364 3300049823 Ga0501044_0433652 Ga0501044_0433652_840_1193 117
1365 3300049823 Ga0501044_0471876 Ga0501044_0471876_207_581 117
1366 3300049824 Ga0501045_0126204 Ga0501045_0126204_572_925 117
1367 3300049824 Ga0501045_0134361 Ga0501045_0134361_435_818 117
1368 3300049824 Ga0501045_0141992 Ga0501045_0141992_1412_1765 117
1369 3300049824 Ga0501045_0147179 Ga0501045_0147179_22_396 117
1370 3300049824 Ga0501045_0180139 Ga0501045_0180139_442_795 117
1371 3300049824 Ga0501045_0280460 Ga0501045_0280460_845_1198 117
1372 3300049824 Ga0501045_0530614 Ga0501045_0530614_39_425 117
1373 3300050490 nmdc:mga03n38_457123_c1 nmdc:mga03n38_457123_c1_118_486 117
1374 3300050490 nmdc:mga03n38_63547_c1 nmdc:mga03n38_63547_c1_1186_1539 117
1375 3300050490 nmdc:mga03n38_8965_c1 nmdc:mga03n38_8965_c1_3100_3453 117
1376 3300050491 nmdc:mga00v17_407702_c1 nmdc:mga00v17_407702_c1_477_830 117
1377 3300050491 nmdc:mga00v17_425840_c1 nmdc:mga00v17_425840_c1_254_607 117
1378 3300050491 nmdc:mga00v17_439472_c1 nmdc:mga00v17_439472_c1_247_600 117
1379 3300050491 nmdc:mga00v17_55926_c1 nmdc:mga00v17_55926_c1_404_757 117
1380 3300050492 nmdc:mga0yw44_1221792_c1 nmdc:mga0yw44_1221792_c1_144_497 117
1381 3300050492 nmdc:mga0yw44_156272_c1 nmdc:mga0yw44_156272_c1_266_619 117
1382 3300050492 nmdc:mga0yw44_186086_c1 nmdc:mga0yw44_186086_c1_280_633 117
1383 3300050492 nmdc:mga0yw44_222941_c1 nmdc:mga0yw44_222941_c1_730_1083 117
1384 3300050492 nmdc:mga0yw44_233938_c1 nmdc:mga0yw44_233938_c1_131_484 117
1385 3300050492 nmdc:mga0yw44_236539_c1 nmdc:mga0yw44_236539_c1_711_1064 117
1386 3300050492 nmdc:mga0yw44_27901_c1 nmdc:mga0yw44_27901_c1_1167_1520 117
1387 3300050494 nmdc:mga06z11_474658_c1 nmdc:mga06z11_474658_c1_209_562 117
1388 3300050495 nmdc:mga04h51_199203_c1 nmdc:mga04h51_199203_c1_282_635 117
1389 3300050496 nmdc:mga07m45_342620_c1 nmdc:mga07m45_342620_c1_358_711 117
1390 3300050507 nmdc:mga05p37_170079_c1 nmdc:mga05p37_170079_c1_244_597 117
1391 3300050507 nmdc:mga05p37_1780785_c1 nmdc:mga05p37_1780785_c1_74_427 117
1392 3300050507 nmdc:mga05p37_2243700_c1 nmdc:mga05p37_2243700_c1_24_380 117
1393 3300050507 nmdc:mga05p37_247397_c1 nmdc:mga05p37_247397_c1_861_1214 117
1394 3300050507 nmdc:mga05p37_2914_c1 nmdc:mga05p37_2914_c1_15685_16038 117
1395 3300050507 nmdc:mga05p37_441461_c1 nmdc:mga05p37_441461_c1_401_754 117
1396 3300050507 nmdc:mga05p37_477335_c1 nmdc:mga05p37_477335_c1_738_1091 117
1397 3300050507 nmdc:mga05p37_481609_c1 nmdc:mga05p37_481609_c1_273_626 117
1398 3300050507 nmdc:mga05p37_794884_c1 nmdc:mga05p37_794884_c1_318_671 117
1399 3300050507 nmdc:mga05p37_797084_c1 nmdc:mga05p37_797084_c1_671_1024 117
1400 3300050508 nmdc:mga09592_227390_c1 nmdc:mga09592_227390_c1_630_983 117
1401 3300050508 nmdc:mga09592_526654_c1 nmdc:mga09592_526654_c1_169_522 117
1402 3300050509 nmdc:mga0qj67_2052_c1 nmdc:mga0qj67_2052_c1_2284_2637 117
1403 3300050509 nmdc:mga0qj67_41025_c1 nmdc:mga0qj67_41025_c1_2115_2468 117
1404 3300050509 nmdc:mga0qj67_870079_c1 nmdc:mga0qj67_870079_c1_265_618 117
1405 3300050510 nmdc:mga06r32_1368421_c1 nmdc:mga06r32_1368421_c1_170_523 117
1406 3300050510 nmdc:mga06r32_146032_c1 nmdc:mga06r32_146032_c1_1799_2152 117
1407 3300050510 nmdc:mga06r32_4137_c1 nmdc:mga06r32_4137_c1_8666_9019 117
1408 3300050510 nmdc:mga06r32_47375_c1 nmdc:mga06r32_47375_c1_1124_1477 117
1409 3300050511 nmdc:mga08y16_1133196_c1 nmdc:mga08y16_1133196_c1_327_680 117
1410 3300050511 nmdc:mga08y16_117943_c1 nmdc:mga08y16_117943_c1_1624_1977 117
1411 3300050511 nmdc:mga08y16_1450933_c1 nmdc:mga08y16_1450933_c1_282_635 117
1412 3300050511 nmdc:mga08y16_1785222_c1 nmdc:mga08y16_1785222_c1_105_458 117
1413 3300050511 nmdc:mga08y16_181844_c1 nmdc:mga08y16_181844_c1_187_540 117
1414 3300050511 nmdc:mga08y16_60254_c1 nmdc:mga08y16_60254_c1_1495_1848 117
1415 3300050511 nmdc:mga08y16_855844_c1 nmdc:mga08y16_855844_c1_488_841 117
1416 3300050512 nmdc:mga0n895_236574_c1 nmdc:mga0n895_236574_c1_631_984 117
1417 3300050512 nmdc:mga0n895_402252_c1 nmdc:mga0n895_402252_c1_137_490 117
1418 3300050512 nmdc:mga0n895_775901_c1 nmdc:mga0n895_775901_c1_75_428 117
1419 3300050512 nmdc:mga0n895_910509_c1 nmdc:mga0n895_910509_c1_305_658 117
1420 3300050513 nmdc:mga0rr50_245943_c1 nmdc:mga0rr50_245943_c1_247_600 117
1421 3300050514 nmdc:mga08x19_40189_c1 nmdc:mga08x19_40189_c1_2351_2704 117
1422 3300050514 nmdc:mga08x19_862844_c1 nmdc:mga08x19_862844_c1_247_600 117
1423 3300050515 nmdc:mga0a205_430937_c1 nmdc:mga0a205_430937_c1_128_481 117
1424 3300053077 Ga0495601_0000017 Ga0495601_0000017_129181_129573 117
1425 3300053077 Ga0495601_0000022 Ga0495601_0000022_119035_119388 117
1426 3300053077 Ga0495601_0000363 Ga0495601_0000363_21551_21904 117
1427 3300053077 Ga0495601_0006808 Ga0495601_0006808_2474_2830 117
1428 3300053077 Ga0495601_0047019 Ga0495601_0047019_225_581 117
1429 3300053077 Ga0495601_0244578 Ga0495601_0244578_622_975 117
1430 3300053077 Ga0495601_0282407 Ga0495601_0282407_658_1011 117
1431 3300053078 Ga0495612_0013064 Ga0495612_0013064_1400_1753 117
1432 3300053078 Ga0495612_0036566 Ga0495612_0036566_493_846 117
1433 3300053078 Ga0495612_0254121 Ga0495612_0254121_166_519 117
1434 3300053084 Ga0495595_0000004 Ga0495595_0000004_218314_218667 117
1435 3300053084 Ga0495595_0001757 Ga0495595_0001757_8017_8409 117
1436 3300053084 Ga0495595_0070059 Ga0495595_0070059_440_793 117
1437 3300053085 Ga0495619_0000194 Ga0495619_0000194_42000_42353 117
1438 3300053085 Ga0495619_0049395 Ga0495619_0049395_1523_1876 117
1439 3300053085 Ga0495619_0201928 Ga0495619_0201928_946_1299 117
1440 3300053096 Ga0500641_0059286 Ga0500641_0059286_398_751 117
1441 3300053123 Ga0500614_000149 Ga0500614_000149_8054_8407 117
1442 3300053139 Ga0500568_0107186 Ga0500568_0107186_148_501 117
1443 3300054114 Ga0501084_0029670 Ga0501084_0029670_2092_2475 117
1444 3300054114 Ga0501084_0116232 Ga0501084_0116232_293_646 117
1445 3300054114 Ga0501084_0132371 Ga0501084_0132371_898_1251 117
1446 3300054114 Ga0501084_0161799 Ga0501084_0161799_62_436 117
1447 3300054114 Ga0501084_0180299 Ga0501084_0180299_429_815 117
1448 3300054114 Ga0501084_0319459 Ga0501084_0319459_486_839 117
1449 3300054114 Ga0501084_0331098 Ga0501084_0331098_888_1241 117
1450 3300054114 Ga0501084_0413724 Ga0501084_0413724_51_404 117
1451 3300054114 Ga0501084_1131896 Ga0501084_1131896_171_548 117
1452 3300059492 Ga0587073_0293179 Ga0587073_0293179_104_457 117
1453 3300060353 Ga0501082_0004887 Ga0501082_0004887_2119_2502 117
1454 3300060353 Ga0501082_0161500 Ga0501082_0161500_1533_1886 117
1455 3300060353 Ga0501082_0175385 Ga0501082_0175385_36_413 117
1456 3300060353 Ga0501082_0178400 Ga0501082_0178400_328_681 117
1457 3300060353 Ga0501082_0272194 Ga0501082_0272194_569_922 117
1458 3300060353 Ga0501082_0310873 Ga0501082_0310873_750_1124 117
1459 3300060353 Ga0501082_0389985 Ga0501082_0389985_504_857 117
1460 3300060353 Ga0501082_0422408 Ga0501082_0422408_19_390 117
1461 3300060353 Ga0501082_1171300 Ga0501082_1171300_42_416 117
1462 3300060353 Ga0501082_1837755 Ga0501082_1837755_119_475 117
1463 3300061719 Ga0466962_0053934 Ga0466962_0053934_130_483 117
1464 3300061719 Ga0466962_0110624 Ga0466962_0110624_867_1220 117
1465 3300061719 Ga0466962_0317828 Ga0466962_0317828_404_757 117
1466 3300061734 Ga0530510_0017238 Ga0530510_0017238_3779_4132 117
1467 3300061734 Ga0530510_0032494 Ga0530510_0032494_799_1152 117
1468 3300061734 Ga0530510_0098900 Ga0530510_0098900_326_679 117
1469 3300061734 Ga0530510_0161410 Ga0530510_0161410_606_959 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

73

121

0.98

PF12840

HTH_20

Helix-turn-helix domain

71

122

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9281 35 116
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9208 45 104
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9167 38 116
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9129 33 116
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9118 47 105
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9355 36 116 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 34 116 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 35 116 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9251 41 116 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 29 117 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538A5F9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9763 24 116 GO:0003700
AF-A0A1F5YY93-F1-model_v4 HTH arsR-type domain-containing protein 0.9735 35 104 GO:0003700
AF-A0A1F6AQU8-F1-model_v4 HTH arsR-type domain-containing protein 0.9693 35 106 GO:0003700
AF-A0A4P6JZE4-F1-model_v4 ArsR family transcriptional regulator 0.9656 33 116 GO:0003700
AF-A0A7V9Q2C4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9642 35 117 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.49 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map