metagRoot

F494186

General Info

Members	Datasets	Scaffolds	Average Seq Length
1469	668	1357	266

Family's Representative Sequence

Representative Sequence	3300009148\|Ga0105243_10298403\|Ga0105243_102984031
Length	290
Sequence	VDQEGEVVTVQDAESQERTAAGGAPKSADGRTPVLQGKGMIKTFGRVIGLDGVDIELYPGEVLAVIGDNGAGKSTLIKCLSGAYTLDGGEMLLDGNHVAFKRPQDARDAGIETVYQTLAVIPALDIASNLYLAREERRPGPLGSVLRMLDKKGMRERASDAVQKLGIQTIQNMGQAVETLSGGQRQAVAVARAAAFGSKVVILDEPTAALGVKEGNAVLDMIKQLRENGVPIILISHNMPHVWEVADRIHIQRLARRAGIITPQSHTMQEGVAIMTGAVTLDQGAQKEAT

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
3	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
4	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
5	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
6	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
7	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
8	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
9	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
10	2547132374	Acidovorax radicis N35	Isolate	Unclassified
11	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
12	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
13	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
14	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
15	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
16	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
17	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
18	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
19	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
20	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
21	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
22	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
23	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
24	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
25	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
26	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
27	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
28	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
29	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
30	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
31	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
32	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
33	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
34	2643221658	Variovorax sp. Root411	Isolate	Unclassified
35	2643221664	Massilia sp. Root418	Isolate	Unclassified
36	2643221672	Variovorax sp. Root434	Isolate	Unclassified
37	2643221683	Variovorax sp. Root473	Isolate	Unclassified
38	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
39	2675903059	Asanoa hainanensis CGMCC 4.5593	Isolate	Rhizosphere
40	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
41	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
42	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
43	2738541277	Variovorax sp. GV051	Isolate	Unclassified
44	2738541280	Massilia sp. GV090	Isolate	Unclassified
45	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
46	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
47	2738541300	Massilia sp. GV016	Isolate	Unclassified
48	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
49	2738541307	Variovorax sp. GV008	Isolate	Unclassified
50	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
51	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
52	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
53	2738543013	Variovorax sp. BT01	Isolate	Unclassified
54	2738543018	Massilia sp. GV045	Isolate	Unclassified
55	2738543019	Variovorax sp. GV040	Isolate	Unclassified
56	2738543030	Massilia sp. GV097	Isolate	Unclassified
57	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
58	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
59	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
60	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
61	2811994882	Terrabacter sp. SLBN-196	Isolate	Unclassified
62	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
63	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
64	2818991446	Variovorax sp. 1180	Isolate	Unclassified
65	2818991450	Burkholderia sp. 604	Isolate	Unclassified
66	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
67	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
68	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
69	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
70	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
71	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
72	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
73	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
74	2885198086	Variovorax sp. 679	Isolate	Unclassified
75	2885211737	Variovorax sp. 553	Isolate	Unclassified
76	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
77	2899924645	Variovorax sp. 369	Isolate	Unclassified
78	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
79	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
80	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
81	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
82	2904456579	Variovorax sp. 2002	Isolate	Unclassified
83	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
84	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
85	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
86	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
87	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
88	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
89	2928037797	Variovorax sp. 1126	Isolate	Unclassified
90	2928044640	Variovorax sp. 1128	Isolate	Unclassified
91	2928051484	Variovorax sp. 1133	Isolate	Unclassified
92	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
93	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
94	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
95	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
96	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
97	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
98	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
99	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
100	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
101	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
102	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
103	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
104	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
105	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
106	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
107	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
108	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
109	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
110	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
111	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
112	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
113	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
114	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
115	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
116	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
117	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
118	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
119	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
120	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
121	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
122	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
123	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
124	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
125	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
126	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
127	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
128	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
129	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
130	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
131	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
132	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
133	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
134	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
135	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
136	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
137	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
138	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
139	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
140	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
141	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
142	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
143	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
144	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
145	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
146	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
147	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
148	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
149	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
150	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
151	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
152	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
153	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
154	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
155	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
156	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
157	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
158	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
159	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
160	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
161	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
162	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
163	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
164	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
165	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
166	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
167	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
168	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
169	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
170	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
171	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
172	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
173	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
174	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
175	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
176	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
177	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
178	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
179	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
180	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
181	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
182	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
183	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
184	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
185	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
186	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
187	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
188	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
189	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
190	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
191	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
192	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
193	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
194	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
195	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
196	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
197	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
198	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
199	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
200	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
201	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
202	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
203	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
204	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
205	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
206	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
207	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
208	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
209	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
210	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
211	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
212	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
213	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
214	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
215	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
216	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
217	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
218	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
219	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
220	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
221	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
222	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
223	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
224	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
225	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
226	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
227	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
228	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
229	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
230	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
231	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
232	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
233	3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Metagenome	Rhizosphere
234	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
235	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
236	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
237	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
238	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
239	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
240	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
241	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
242	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
243	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
244	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
245	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
246	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
247	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
248	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
249	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
250	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
251	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
252	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
253	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
254	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
255	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
256	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
257	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
258	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
260	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
261	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
262	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
263	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
264	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
265	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
266	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
267	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
268	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
269	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
270	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
271	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
272	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
273	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
274	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
275	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
276	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
277	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
278	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
279	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
280	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
281	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
282	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
283	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
284	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
285	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
286	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
336	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
338	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
340	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
342	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
346	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
347	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
348	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
349	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
350	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
351	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
352	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
353	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
354	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
355	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
356	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
357	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
358	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
359	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
360	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
361	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
362	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
363	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
364	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
365	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
366	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
367	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
368	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
369	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
370	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
371	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
372	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
373	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
374	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
375	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
376	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
377	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
378	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
379	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
380	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
381	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
382	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
383	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
384	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
385	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
386	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
387	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
388	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
389	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
390	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
391	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
392	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
393	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
394	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
395	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
396	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
397	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
398	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
399	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
400	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
401	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
402	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
403	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
404	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
405	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
406	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
407	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
408	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
409	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
410	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
411	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
412	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
413	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
414	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
415	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
416	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
417	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
418	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
419	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
420	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
421	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
422	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
423	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
424	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
425	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
426	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
427	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
428	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
429	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
430	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
431	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
432	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
433	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
434	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
435	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
436	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
437	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
438	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
439	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
440	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
441	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
442	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
443	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
444	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
445	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
446	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
447	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
448	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
449	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
450	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
451	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
452	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
453	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
454	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
455	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
456	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
457	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
458	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
459	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
460	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
461	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
462	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
463	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
464	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
465	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
466	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
467	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
468	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
469	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
470	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
471	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
472	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
473	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
474	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
475	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
476	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
477	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
478	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
479	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
480	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
481	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
482	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
483	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
484	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
485	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
486	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
487	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
488	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
489	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
490	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
491	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
492	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
493	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
494	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
495	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
496	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
497	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
498	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
499	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
500	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
501	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
502	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
503	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
504	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
505	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
506	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
507	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
508	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
509	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
510	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
511	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
512	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
513	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
514	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
515	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
516	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
517	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
518	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
519	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
520	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
521	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
522	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
523	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
524	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
525	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
526	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
527	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
528	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
529	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
530	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
531	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
532	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
533	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
534	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
535	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
536	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
537	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
538	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
539	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
540	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
541	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
542	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
543	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
544	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
545	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
546	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
547	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
548	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
549	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
550	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
551	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
552	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
553	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
554	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
555	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
556	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
557	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
558	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
559	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
560	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
561	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
562	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
563	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
564	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
565	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
566	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
567	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
568	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
569	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
570	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
571	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
572	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
573	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
574	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
575	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
576	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
577	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
578	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
579	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
580	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
581	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
582	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
583	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
584	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
585	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
586	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
587	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
588	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
589	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
590	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
591	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
592	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
593	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
594	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
595	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
596	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
597	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
598	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
599	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
600	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
601	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
602	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
603	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
604	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
605	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
606	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
607	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
608	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
609	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
610	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
611	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
612	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
613	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
614	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
615	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
616	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
617	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
618	3300053124	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere	Metagenome	Endosphere
619	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
620	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
621	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
622	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
623	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
624	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
625	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
626	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
627	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
628	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
629	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
630	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
631	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
632	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
633	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
634	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
635	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
636	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
637	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
638	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
639	3300059478	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
640	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
641	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
642	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
643	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
644	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
645	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
646	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
647	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
648	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
649	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
650	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
651	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
652	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
653	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
654	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
655	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
656	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
657	3300059648	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
658	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
659	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
660	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
661	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
662	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
663	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
664	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
665	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
666	8054609563	Nocardioides astragali CGMCC 4.7327	Isolate	Nodule
667	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
668	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.97
Metatranscriptomes	3.4
Isolates	7.62

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.07
Nodule	1.5
Rhizoplane	3.88
Rhizosphere	68.28
Stem	0
Stem Tuber	0
Unclassified	10.28

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000879	3300001979	Bacteria	13281
2	JGI24739J22299_10005422	3300001989	Bacteria	4848
3	JGI24739J22299_10006203	3300001989	Bacteria	4515
4	JGI24739J22299_10013704	3300001989	Bacteria	2955
5	JGI24735J21928_10006447	3300002067	Bacteria	3862
6	JGI24735J21928_10019846	3300002067	Bacteria	2064
7	JGI24738J21930_10003693	3300002075	Bacteria	3830
8	JGI25156J39149_1000664	3300002705	Bacteria	18751
9	JGI25156J39149_1001065	3300002705	Bacteria	12664
10	JGI25156J39149_1001192	3300002705	Bacteria	11578
11	JGI25154J39366_1003188	3300002738	Bacteria	3614
12	JGI25159J45721_1009411	3300002987	Bacteria	2580
13	JGI25159J45721_1009466	3300002987	Bacteria	2568
14	JGI25151J46595_10003822	3300003187	Bacteria	8157
15	JGI25151J46595_10004098	3300003187	Bacteria	7802
16	JGI25406J46586_10021010	3300003203	Bacteria	2627
17	JGI25165J46597_1001095	3300003214	Bacteria	17289
18	rootL2_10047291	3300003322	Bacteria	4980
19	JGI25160J50197_1013586	3300003354	Bacteria	2768
20	JGI25407J50210_10001247	3300003373	Bacteria	5687
21	JGI25161J50226_1003713	3300003374	Bacteria	3406
22	Ga0007417J51691_1058084	3300003544	Bacteria	2034
23	Ga0006562J51391_1206897	3300003578	Bacteria	2510
24	Ga0006562J51391_1206898	3300003578	Bacteria	2380
25	Ga0055533_1000061	3300003756	Bacteria	181542
26	Ga0055533_1000205	3300003756	Bacteria	46507
27	Ga0055533_1004187	3300003756	Bacteria	2669
28	Ga0055532_1000007	3300003758	Bacteria	429810
29	Ga0055525_1000793	3300003759	Bacteria	9998
30	Ga0055527_1000007	3300003760	Bacteria	429810
31	Ga0055535_1000005	3300003761	Bacteria	429810
32	Ga0055542_1000004	3300003762	Bacteria	553532
33	Ga0055542_1000008	3300003762	Bacteria	429810
34	Ga0055529_1000005	3300003763	Bacteria	429810
35	Ga0055526_1021868	3300003771	Bacteria	2203
36	Ga0055526_1023712	3300003771	Bacteria	2038
37	Ga0055537_1000067	3300003773	Bacteria	75689
38	Ga0055524_1000097	3300003775	Bacteria	108145
39	Ga0055524_1021284	3300003775	Bacteria	2155
40	Ga0055524_1022038	3300003775	Bacteria	2093
41	Ga0055536_1002788	3300003781	Bacteria	9662
42	Ga0055534_1000079	3300003784	Bacteria	75689
43	Ga0055534_1000343	3300003784	Bacteria	30091
44	Ga0055528_1003321	3300003790	Bacteria	8152
45	Ga0055530_10001788	3300003791	Bacteria	14935
46	Ga0055540_1000023	3300003792	Bacteria	201131
47	Ga0055540_1001704	3300003792	Bacteria	12646
48	Ga0055540_1004292	3300003792	Bacteria	6506
49	Ga0055540_1021025	3300003792	Bacteria	1708
50	Ga0055531_10002097	3300003794	Bacteria	13692
51	Ga0055543_1009384	3300004625	Bacteria	2105
52	Ga0065165_1051693	3300005262	Bacteria	1163
53	Ga0065714_10028239	3300005288	Bacteria	1389
54	Ga0065704_10086689	3300005289	Bacteria	3094
55	Ga0070658_10005449	3300005327	Bacteria	10316
56	Ga0070658_10007950	3300005327	Bacteria	8535
57	Ga0070658_10062389	3300005327	Bacteria	3037
58	Ga0070658_10075766	3300005327	Bacteria	2760
59	Ga0070658_10149776	3300005327	Bacteria	1953
60	Ga0070676_10001363	3300005328	Bacteria	12301
61	Ga0070676_10033292	3300005328	Bacteria	2956
62	Ga0070683_100169237	3300005329	Bacteria	2074
63	Ga0070683_100262557	3300005329	Bacteria	1643
64	Ga0070677_10115952	3300005333	Bacteria	1203
65	Ga0068869_100105785	3300005334	Bacteria	2135
66	Ga0068869_100320614	3300005334	Bacteria	1257
67	Ga0068869_100478460	3300005334	Bacteria	1036
68	Ga0070666_10088031	3300005335	Bacteria	2130
69	Ga0070682_100005801	3300005337	Bacteria	6896
70	Ga0070682_100406680	3300005337	Bacteria	1031
71	Ga0068868_100049768	3300005338	Bacteria	3289
72	Ga0070660_100016980	3300005339	Bacteria	5299
73	Ga0070660_100021754	3300005339	Bacteria	4733
74	Ga0070660_100305948	3300005339	Bacteria	1304
75	Ga0070660_100525746	3300005339	Bacteria	986
76	Ga0070661_100166362	3300005344	Bacteria	1673
77	Ga0070661_100292950	3300005344	Bacteria	1265
78	Ga0070668_100153050	3300005347	Bacteria	1867
79	Ga0070668_100510368	3300005347	Bacteria	1042
80	Ga0070669_100203236	3300005353	Bacteria	1560
81	Ga0070675_100086136	3300005354	Bacteria	2625
82	Ga0070675_100654737	3300005354	Bacteria	955
83	Ga0070671_100072689	3300005355	Bacteria	2872
84	Ga0070674_100014145	3300005356	Bacteria	4955
85	Ga0070674_100068403	3300005356	Bacteria	2502
86	Ga0070674_100071417	3300005356	Bacteria	2455
87	Ga0070674_100207987	3300005356	Bacteria	1515
88	Ga0070673_100200375	3300005364	Bacteria	1719
89	Ga0070673_100500361	3300005364	Bacteria	1099
90	Ga0070659_100172141	3300005366	Bacteria	1774
91	Ga0070659_100349316	3300005366	Bacteria	1240
92	Ga0070667_100015373	3300005367	Bacteria	6327
93	Ga0070667_100121574	3300005367	Bacteria	2271
94	Ga0070709_10438319	3300005434	Bacteria	982
95	Ga0070714_100300008	3300005435	Bacteria	1497
96	Ga0070705_100049775	3300005440	Bacteria	2434
97	Ga0070700_100029085	3300005441	Bacteria	3292
98	Ga0070663_100036980	3300005455	Bacteria	3395
99	Ga0070663_100048938	3300005455	Bacteria	2999
100	Ga0070663_100224353	3300005455	Bacteria	1477
101	Ga0070663_100291672	3300005455	Bacteria	1303
102	Ga0070678_100053570	3300005456	Bacteria	2934
103	Ga0070678_100077416	3300005456	Bacteria	2509
104	Ga0070678_100306936	3300005456	Bacteria	1350
105	Ga0070662_100006889	3300005457	Bacteria	7354
106	Ga0070662_100008417	3300005457	Bacteria	6722
107	Ga0070662_100080733	3300005457	Bacteria	2422
108	Ga0070662_100171560	3300005457	Bacteria	1704
109	Ga0068867_100000977	3300005459	Bacteria	19533
110	Ga0068867_100005245	3300005459	Bacteria	9150
111	Ga0068867_100034907	3300005459	Bacteria	3646
112	Ga0068867_100431738	3300005459	Bacteria	1118
113	Ga0070706_100000271	3300005467	Bacteria	63046
114	Ga0070707_100127632	3300005468	Bacteria	2471
115	Ga0070707_100134597	3300005468	Bacteria	2404
116	Ga0070707_100369657	3300005468	Bacteria	1393
117	Ga0070698_100026399	3300005471	Bacteria	6045
118	Ga0070698_100158593	3300005471	Bacteria	2207
119	Ga0070684_100087430	3300005535	Bacteria	2768
120	Ga0068853_100006049	3300005539	Bacteria	9574
121	Ga0068853_100068696	3300005539	Bacteria	3081
122	Ga0068853_100192723	3300005539	Bacteria	1852
123	Ga0070672_100045578	3300005543	Bacteria	3393
124	Ga0070693_100080760	3300005547	Bacteria	1938
125	Ga0070693_100155754	3300005547	Bacteria	1451
126	Ga0070665_100104984	3300005548	Bacteria	2827
127	Ga0068855_100004782	3300005563	Bacteria	16532
128	Ga0068855_100094414	3300005563	Bacteria	3449
129	Ga0068855_100094627	3300005563	Bacteria	3444
130	Ga0068855_100253827	3300005563	Bacteria	1961
131	Ga0068855_100403842	3300005563	Bacteria	1497
132	Ga0068855_100667810	3300005563	Bacteria	1115
133	Ga0070664_100099612	3300005564	Bacteria	2526
134	Ga0068857_100099511	3300005577	Bacteria	2608
135	Ga0068857_100138930	3300005577	Bacteria	2195
136	Ga0068857_100303679	3300005577	Bacteria	1472
137	Ga0068854_100132102	3300005578	Bacteria	1907
138	Ga0070702_100364041	3300005615	Bacteria	1023
139	Ga0068852_100157142	3300005616	Bacteria	2119
140	Ga0068852_100269820	3300005616	Bacteria	1637
141	Ga0068852_100863816	3300005616	Bacteria	921
142	Ga0068864_100047704	3300005618	Bacteria	3680
143	Ga0068866_10017942	3300005718	Bacteria	3193
144	Ga0068861_100035272	3300005719	Bacteria	3704
145	Ga0068861_100110521	3300005719	Bacteria	2201
146	Ga0068861_100206849	3300005719	Bacteria	1651
147	Ga0068861_100491426	3300005719	Bacteria	1108
148	Ga0068851_10061305	3300005834	Bacteria	1928
149	Ga0068863_100342419	3300005841	Bacteria	1455
150	Ga0068858_100146191	3300005842	Bacteria	2220
151	Ga0068860_100116443	3300005843	Bacteria	2557
152	Ga0068860_100489548	3300005843	Bacteria	1227
153	Ga0068860_100554143	3300005843	Bacteria	1152
154	Ga0068862_100016907	3300005844	Bacteria	6072
155	Ga0068862_100072872	3300005844	Bacteria	2967
156	Ga0081455_10003960	3300005937	Bacteria	16815
157	Ga0081455_10027308	3300005937	Bacteria	5232
158	Ga0081455_10033348	3300005937	Bacteria	4628
159	Ga0081455_10088364	3300005937	Bacteria	2518
160	Ga0081538_10000147	3300005981	Bacteria	73397
161	Ga0081540_1037494	3300005983	Bacteria	2568
162	Ga0081539_10001917	3300005985	Bacteria	32201
163	Ga0081539_10015199	3300005985	Bacteria	5617
164	Ga0070717_10072751	3300006028	Bacteria	2871
165	Ga0075365_10004368	3300006038	Bacteria	7476
166	Ga0075365_10009361	3300006038	Bacteria	5625
167	Ga0075365_10074220	3300006038	Bacteria	2294
168	Ga0075368_10000442	3300006042	Bacteria	12227
169	Ga0075363_100035342	3300006048	Bacteria	2614
170	Ga0075363_100069465	3300006048	Bacteria	1911
171	Ga0075363_100069490	3300006048	Bacteria	1911
172	Ga0075363_100097470	3300006048	Bacteria	1624
173	Ga0075363_100236402	3300006048	Bacteria	1050
174	Ga0075364_10102148	3300006051	Bacteria	1909
175	Ga0075364_10103371	3300006051	Bacteria	1897
176	Ga0075364_10268296	3300006051	Bacteria	1161
177	Ga0075432_10000076	3300006058	Bacteria	19908
178	Ga0075432_10012016	3300006058	Bacteria	2941
179	Ga0075362_10001578	3300006177	Bacteria	7377
180	Ga0075362_10003358	3300006177	Bacteria	5578
181	Ga0075362_10005491	3300006177	Bacteria	4645
182	Ga0075362_10193032	3300006177	Bacteria	989
183	Ga0075362_10211126	3300006177	Bacteria	947
184	Ga0075367_10002438	3300006178	Bacteria	8497
185	Ga0075367_10008290	3300006178	Bacteria	5381
186	Ga0075367_10080911	3300006178	Bacteria	1965
187	Ga0075367_10098781	3300006178	Bacteria	1783
188	Ga0075367_10224884	3300006178	Bacteria	1175
189	Ga0075369_10003839	3300006186	Bacteria	5512
190	Ga0075369_10018959	3300006186	Bacteria	2805
191	Ga0075427_10009530	3300006194	Bacteria	1448
192	Ga0075366_10000948	3300006195	Bacteria	14121
193	Ga0075366_10004653	3300006195	Bacteria	7375
194	Ga0075366_10008559	3300006195	Bacteria	5693
195	Ga0075366_10010974	3300006195	Bacteria	5100
196	Ga0075366_10020320	3300006195	Bacteria	3851
197	Ga0075366_10060142	3300006195	Bacteria	2257
198	Ga0075366_10075234	3300006195	Bacteria	2014
199	Ga0097621_100064286	3300006237	Bacteria	3017
200	Ga0075370_10000290	3300006353	Bacteria	18016
201	Ga0075370_10000491	3300006353	Bacteria	14928
202	Ga0075370_10000506	3300006353	Bacteria	14819
203	Ga0075370_10001075	3300006353	Bacteria	11363
204	Ga0075370_10002994	3300006353	Bacteria	7951
205	Ga0075370_10006698	3300006353	Bacteria	5811
206	Ga0075370_10009682	3300006353	Bacteria	5015
207	Ga0075370_10026684	3300006353	Bacteria	3201
208	Ga0075370_10048439	3300006353	Bacteria	2407
209	Ga0075370_10081713	3300006353	Bacteria	1858
210	Ga0075370_10100271	3300006353	Bacteria	1676
211	Ga0075370_10166997	3300006353	Bacteria	1293
212	Ga0075370_10245292	3300006353	Bacteria	1061
213	Ga0068871_100121631	3300006358	Bacteria	2205
214	Ga0068871_100324926	3300006358	Bacteria	1356
215	Ga0075428_100003665	3300006844	Bacteria	16844
216	Ga0075428_100171690	3300006844	Bacteria	2350
217	Ga0075428_100514864	3300006844	Bacteria	1280
218	Ga0075430_100175620	3300006846	Bacteria	1782
219	Ga0075431_100020564	3300006847	Bacteria	6745
220	Ga0075431_100239981	3300006847	Bacteria	1844
221	Ga0075433_10001214	3300006852	Bacteria	18799
222	Ga0075434_100000624	3300006871	Bacteria	27304
223	Ga0075429_100013889	3300006880	Bacteria	6985
224	Ga0068865_100007809	3300006881	Bacteria	6600
225	Ga0079104_1000019	3300006946	Bacteria	269313
226	Ga0079104_1027068	3300006946	Bacteria	1474
227	Ga0099826_10004066	3300006948	Bacteria	10156
228	Ga0075435_100002217	3300007076	Bacteria	12822
229	Ga0105251_10000313	3300009011	Bacteria	48586
230	Ga0105251_10102649	3300009011	Bacteria	1306
231	Ga0105244_10010743	3300009036	Bacteria	5532
232	Ga0105240_10006401	3300009093	Bacteria	17307
233	Ga0105240_10056606	3300009093	Bacteria	4906
234	Ga0105240_10103006	3300009093	Bacteria	3468
235	Ga0105240_10303644	3300009093	Bacteria	1825
236	Ga0105240_10594444	3300009093	Bacteria	1219
237	Ga0111539_10009396	3300009094	Bacteria	12343
238	Ga0105245_10022614	3300009098	Bacteria	5520
239	Ga0105245_10078402	3300009098	Bacteria	3014
240	Ga0105245_10084013	3300009098	Bacteria	2915
241	Ga0105245_10223596	3300009098	Bacteria	1818
242	Ga0105245_10331301	3300009098	Bacteria	1502
243	Ga0105245_10404961	3300009098	Bacteria	1364
244	Ga0114129_10010725	3300009147	Bacteria	13064
245	Ga0105243_10002076	3300009148	Bacteria	16970
246	Ga0105243_10002736	3300009148	Bacteria	14662
247	Ga0105243_10006737	3300009148	Bacteria	8865
248	Ga0105243_10009662	3300009148	Bacteria	7343
249	Ga0105243_10026824	3300009148	Bacteria	4412
250	Ga0105243_10135715	3300009148	Bacteria	2093
251	Ga0105243_10298403	3300009148	Bacteria	1459
252	Ga0105242_10004347	3300009176	Bacteria	11034
253	Ga0105242_10185682	3300009176	Bacteria	1837
254	Ga0105242_10802942	3300009176	Bacteria	932
255	Ga0105237_10005095	3300009545	Bacteria	14917
256	Ga0105237_10013267	3300009545	Bacteria	8643
257	Ga0105237_10023570	3300009545	Bacteria	6304
258	Ga0105237_10046995	3300009545	Bacteria	4340
259	Ga0105237_10137141	3300009545	Bacteria	2441
260	Ga0105237_10256388	3300009545	Bacteria	1751
261	Ga0105238_10006773	3300009551	Bacteria	11447
262	Ga0105238_10014551	3300009551	Bacteria	7957
263	Ga0105238_10357627	3300009551	Bacteria	1449
264	Ga0105238_10457161	3300009551	Bacteria	1274
265	Ga0105238_10672206	3300009551	Bacteria	1047
266	Ga0105249_10011730	3300009553	Bacteria	7704
267	Ga0105249_10129092	3300009553	Bacteria	2411
268	Ga0105249_10142295	3300009553	Bacteria	2301
269	Ga0105249_10150297	3300009553	Bacteria	2242
270	Ga0105249_10164827	3300009553	Bacteria	2144
271	Ga0105249_10951899	3300009553	Bacteria	927
272	Ga0105239_10000486	3300010375	Bacteria	57901
273	Ga0105239_10008053	3300010375	Bacteria	12031
274	Ga0105239_10171693	3300010375	Bacteria	2425
275	Ga0105246_10110698	3300011119	Bacteria	2017
276	Ga0105246_10155428	3300011119	Bacteria	1736
277	Ga0157321_1000281	3300012487	Bacteria	2351
278	Ga0157373_10011998	3300013100	Bacteria	6368
279	Ga0157373_10060247	3300013100	Bacteria	2689
280	Ga0157371_10060094	3300013102	Bacteria	2695
281	Ga0157371_10076413	3300013102	Bacteria	2371
282	Ga0157371_10173501	3300013102	Bacteria	1541
283	Ga0157370_10000978	3300013104	Bacteria	36196
284	Ga0157370_10012136	3300013104	Bacteria	8960
285	Ga0157370_10449763	3300013104	Bacteria	1184
286	Ga0157369_10000084	3300013105	Bacteria	130587
287	Ga0157369_10000178	3300013105	Bacteria	89141
288	Ga0157369_10014451	3300013105	Bacteria	8913
289	Ga0157369_10017323	3300013105	Bacteria	8099
290	Ga0157369_10032829	3300013105	Bacteria	5704
291	Ga0157369_10034289	3300013105	Bacteria	5572
292	Ga0157369_10051469	3300013105	Bacteria	4457
293	Ga0157374_10000034	3300013296	Bacteria	180660
294	Ga0157374_10274549	3300013296	Bacteria	1663
295	Ga0157374_10449498	3300013296	Bacteria	1290
296	Ga0157374_10584958	3300013296	Bacteria	1126
297	Ga0157378_10012748	3300013297	Bacteria	7358
298	Ga0157378_10040785	3300013297	Bacteria	4117
299	Ga0157378_10327503	3300013297	Bacteria	1490
300	Ga0163162_10009563	3300013306	Bacteria	9433
301	Ga0163162_10056229	3300013306	Bacteria	3963
302	Ga0163162_10061387	3300013306	Bacteria	3796
303	Ga0163162_10386582	3300013306	Bacteria	1532
304	Ga0163162_10403452	3300013306	Bacteria	1500
305	Ga0163162_10690579	3300013306	Bacteria	1143
306	Ga0157372_10002485	3300013307	Bacteria	19984
307	Ga0157372_10008088	3300013307	Bacteria	11185
308	Ga0157372_10254182	3300013307	Bacteria	2040
309	Ga0157375_10009170	3300013308	Bacteria	8672
310	Ga0157375_10208032	3300013308	Bacteria	2113
311	Ga0157375_10320844	3300013308	Bacteria	1714
312	Ga0157375_10590936	3300013308	Bacteria	1270
313	Ga0163163_10265341	3300014325	Bacteria	1768
314	Ga0157380_10009130	3300014326	Bacteria	7090
315	Ga0157380_10036997	3300014326	Bacteria	3781
316	Ga0157380_10245554	3300014326	Bacteria	1617
317	Ga0157380_10269450	3300014326	Bacteria	1551
318	Ga0157380_10294785	3300014326	Bacteria	1491
319	Ga0182008_10003892	3300014497	Bacteria	8857
320	Ga0182008_10010702	3300014497	Bacteria	4904
321	Ga0182008_10028545	3300014497	Bacteria	2821
322	Ga0182008_10062063	3300014497	Bacteria	1842
323	Ga0157377_10000098	3300014745	Bacteria	62330
324	Ga0157379_10095344	3300014968	Bacteria	2669
325	Ga0157379_10107820	3300014968	Bacteria	2501
326	Ga0157379_10349758	3300014968	Bacteria	1353
327	Ga0157376_10245887	3300014969	Bacteria	1669
328	Ga0182006_1001700	3300015261	Bacteria	12853
329	Ga0182006_1022637	3300015261	Bacteria	2610
330	Ga0182006_1030628	3300015261	Bacteria	2173
331	Ga0182006_1053986	3300015261	Bacteria	1539
332	Ga0182007_10000614	3300015262	Bacteria	20786
333	Ga0182007_10017719	3300015262	Bacteria	2594
334	Ga0182007_10042761	3300015262	Bacteria	1507
335	Ga0183361_10003	3300016635	Bacteria	577277
336	Ga0163161_10000069	3300017792	Bacteria	103861
337	Ga0163161_10022021	3300017792	Bacteria	4483
338	Ga0163161_10028182	3300017792	Bacteria	3986
339	Ga0163161_10037700	3300017792	Bacteria	3465
340	Ga0163161_10101704	3300017792	Bacteria	2140
341	Ga0163161_10160197	3300017792	Bacteria	1716
342	Ga0206356_10233507	3300020070	Bacteria	2950
343	Ga0206350_10433884	3300020080	Bacteria	3191
344	Ga0213876_10033761	3300021384	Bacteria	2698
345	Ga0224712_10000033	3300022467	Bacteria	20848
346	Ga0209435_101848	3300025206	Bacteria	2548
347	Ga0209436_111831	3300025208	Bacteria	1511
348	Ga0209674_100003	3300025226	Bacteria	2196646
349	Ga0209674_100020	3300025226	Bacteria	672397
350	Ga0209674_100029	3300025226	Bacteria	466683
351	Ga0209672_100013	3300025228	Bacteria	740693
352	Ga0209672_103145	3300025228	Bacteria	3553
353	Ga0209147_100013	3300025229	Bacteria	660057
354	Ga0209147_101692	3300025229	Bacteria	7201
355	Ga0209563_100086	3300025230	Bacteria	182199
356	Ga0207427_100546	3300025231	Bacteria	19253
357	Ga0207427_104197	3300025231	Bacteria	2547
358	Ga0209258_100016	3300025242	Bacteria	668622
359	Ga0209258_100022	3300025242	Bacteria	553584
360	Ga0207425_1001900	3300025245	Bacteria	7948
361	Ga0209646_1000010	3300025246	Bacteria	573803
362	Ga0209677_100133	3300025253	Bacteria	69526
363	Ga0209148_1000020	3300025254	Bacteria	740693
364	Ga0209148_1000034	3300025254	Bacteria	553584
365	Ga0209759_1000008	3300025256	Bacteria	461395
366	Ga0209759_1000022	3300025256	Bacteria	329136
367	Ga0209759_1000052	3300025256	Bacteria	213964
368	Ga0209759_1010820	3300025256	Bacteria	2641
369	Ga0209759_1013544	3300025256	Bacteria	2200
370	Ga0209129_1002491	3300025258	Bacteria	8980
371	Ga0209233_1000055	3300025261	Bacteria	439422
372	Ga0209565_1000146	3300025263	Bacteria	97720
373	Ga0209565_1000294	3300025263	Bacteria	47770
374	Ga0209565_1009636	3300025263	Bacteria	2435
375	Ga0209455_1000017	3300025272	Bacteria	740693
376	Ga0209673_1000701	3300025273	Bacteria	47545
377	Ga0209673_1000860	3300025273	Bacteria	39448
378	Ga0209673_1001758	3300025273	Bacteria	18056
379	Ga0209673_1024823	3300025273	Bacteria	2005
380	Ga0209130_1002114	3300025284	Bacteria	10573
381	Ga0209130_1003858	3300025284	Bacteria	6045
382	Ga0209675_1000024	3300025291	Bacteria	312615
383	Ga0209675_1000765	3300025291	Bacteria	21581
384	Ga0209675_1001125	3300025291	Bacteria	16308
385	Ga0209675_1001622	3300025291	Bacteria	12638
386	Ga0209675_1005663	3300025291	Bacteria	5163
387	Ga0209675_1020213	3300025291	Bacteria	1811
388	Ga0209676_1000005	3300025292	Bacteria	1076001
389	Ga0209676_1000434	3300025292	Bacteria	72286
390	Ga0209676_1001176	3300025292	Bacteria	28320
391	Ga0209676_1003444	3300025292	Bacteria	9733
392	Ga0209676_1036020	3300025292	Bacteria	1445
393	Ga0209025_1000116	3300025294	Bacteria	218293
394	Ga0209025_1000394	3300025294	Bacteria	90347
395	Ga0209025_1001285	3300025294	Bacteria	34421
396	Ga0209564_1000155	3300025295	Bacteria	165859
397	Ga0209564_1000292	3300025295	Bacteria	101735
398	Ga0209758_1000107	3300025297	Bacteria	218293
399	Ga0209758_1000572	3300025297	Bacteria	57723
400	Ga0209758_1023531	3300025297	Bacteria	2783
401	Ga0209050_1000007	3300025298	Bacteria	1187891
402	Ga0209050_1000378	3300025298	Bacteria	83974
403	Ga0209050_1000489	3300025298	Bacteria	68506
404	Ga0209050_1002520	3300025298	Bacteria	15407
405	Ga0209050_1007769	3300025298	Bacteria	5910
406	Ga0209050_1016212	3300025298	Bacteria	3066
407	Ga0209256_1000038	3300025299	Bacteria	375225
408	Ga0209256_1000051	3300025299	Bacteria	307241
409	Ga0209256_1000087	3300025299	Bacteria	218290
410	Ga0207426_1000123	3300025302	Bacteria	218290
411	Ga0207426_1000176	3300025302	Bacteria	159819
412	Ga0209051_1000009	3300025303	Bacteria	706778
413	Ga0209051_1000079	3300025303	Bacteria	201183
414	Ga0209051_1000174	3300025303	Bacteria	116896
415	Ga0209051_1000262	3300025303	Bacteria	87898
416	Ga0209051_1001248	3300025303	Bacteria	22770
417	Ga0209051_1015265	3300025303	Bacteria	3543
418	Ga0209051_1016576	3300025303	Bacteria	3327
419	Ga0209257_1000011	3300025304	Bacteria	1112630
420	Ga0209257_1000139	3300025304	Bacteria	202285
421	Ga0209257_1000183	3300025304	Bacteria	156618
422	Ga0209257_1007030	3300025304	Bacteria	6970
423	Ga0209257_1007189	3300025304	Bacteria	6832
424	Ga0209257_1010519	3300025304	Bacteria	4664
425	Ga0207655_1001900	3300025728	Bacteria	17918
426	Ga0207713_1000401	3300025735	Bacteria	46363
427	Ga0207642_10097923	3300025899	Bacteria	1465
428	Ga0207688_10039253	3300025901	Bacteria	2630
429	Ga0207680_10061354	3300025903	Bacteria	2293
430	Ga0207647_10010669	3300025904	Bacteria	6476
431	Ga0207647_10038302	3300025904	Bacteria	3032
432	Ga0207647_10051497	3300025904	Bacteria	2544
433	Ga0207647_10120599	3300025904	Bacteria	1546
434	Ga0207645_10001218	3300025907	Bacteria	21216
435	Ga0207645_10045017	3300025907	Bacteria	2821
436	Ga0207705_10007480	3300025909	Bacteria	8031
437	Ga0207705_10043255	3300025909	Bacteria	3235
438	Ga0207705_10058871	3300025909	Bacteria	2771
439	Ga0207705_10095883	3300025909	Bacteria	2177
440	Ga0207684_10022867	3300025910	Bacteria	5338
441	Ga0207695_10008242	3300025913	Bacteria	13079
442	Ga0207695_10026334	3300025913	Bacteria	6491
443	Ga0207695_10034076	3300025913	Bacteria	5544
444	Ga0207695_10324379	3300025913	Bacteria	1429
445	Ga0207671_10000138	3300025914	Bacteria	112019
446	Ga0207671_10036946	3300025914	Bacteria	3622
447	Ga0207671_10087775	3300025914	Bacteria	2339
448	Ga0207671_10124064	3300025914	Bacteria	1976
449	Ga0207671_10278520	3300025914	Bacteria	1319
450	Ga0207693_10135704	3300025915	Bacteria	1935
451	Ga0207657_10003961	3300025919	Bacteria	15723
452	Ga0207657_10057170	3300025919	Bacteria	3363
453	Ga0207657_10082363	3300025919	Bacteria	2701
454	Ga0207657_10565808	3300025919	Bacteria	888
455	Ga0207649_10110454	3300025920	Bacteria	1836
456	Ga0207646_10081892	3300025922	Bacteria	2886
457	Ga0207646_10121746	3300025922	Bacteria	2344
458	Ga0207681_10433107	3300025923	Bacteria	1067
459	Ga0207694_10002834	3300025924	Bacteria	13983
460	Ga0207694_10114573	3300025924	Bacteria	2147
461	Ga0207694_10264131	3300025924	Bacteria	1410
462	Ga0207687_10019603	3300025927	Bacteria	4483
463	Ga0207687_10089586	3300025927	Bacteria	2240
464	Ga0207687_10181400	3300025927	Bacteria	1631
465	Ga0207687_10495156	3300025927	Bacteria	1019
466	Ga0207664_10029721	3300025929	Bacteria	4165
467	Ga0207644_10033476	3300025931	Bacteria	3591
468	Ga0207644_10219288	3300025931	Bacteria	1507
469	Ga0207690_10029814	3300025932	Bacteria	3473
470	Ga0207690_10137976	3300025932	Bacteria	1793
471	Ga0207690_10207803	3300025932	Bacteria	1491
472	Ga0207690_10231631	3300025932	Bacteria	1418
473	Ga0207706_10004998	3300025933	Bacteria	12388
474	Ga0207706_10005166	3300025933	Bacteria	12180
475	Ga0207706_10020349	3300025933	Bacteria	5964
476	Ga0207706_10021056	3300025933	Bacteria	5857
477	Ga0207706_10046814	3300025933	Bacteria	3828
478	Ga0207706_10219796	3300025933	Bacteria	1663
479	Ga0207686_10078433	3300025934	Bacteria	2148
480	Ga0207686_10123662	3300025934	Bacteria	1765
481	Ga0207686_10332868	3300025934	Bacteria	1138
482	Ga0207709_10000242	3300025935	Bacteria	67423
483	Ga0207709_10003704	3300025935	Bacteria	9000
484	Ga0207709_10015707	3300025935	Bacteria	4202
485	Ga0207709_10066064	3300025935	Bacteria	2277
486	Ga0207669_10010966	3300025937	Bacteria	4388
487	Ga0207669_10106743	3300025937	Bacteria	1866
488	Ga0207669_10201472	3300025937	Bacteria	1445
489	Ga0207704_10068833	3300025938	Bacteria	2233
490	Ga0207691_10210843	3300025940	Bacteria	1687
491	Ga0207711_10048700	3300025941	Bacteria	3626
492	Ga0207689_10008711	3300025942	Bacteria	8830
493	Ga0207689_10157992	3300025942	Bacteria	1869
494	Ga0207689_10322259	3300025942	Bacteria	1283
495	Ga0207661_10158756	3300025944	Bacteria	1961
496	Ga0207679_10015159	3300025945	Bacteria	5084
497	Ga0207679_10043399	3300025945	Bacteria	3237
498	Ga0207667_10001018	3300025949	Bacteria	35714
499	Ga0207667_10016581	3300025949	Bacteria	8317
500	Ga0207651_10257487	3300025960	Bacteria	1431
501	Ga0207651_10369860	3300025960	Bacteria	1212
502	Ga0207712_10171473	3300025961	Bacteria	1696
503	Ga0207668_10006033	3300025972	Bacteria	7145
504	Ga0207668_10100610	3300025972	Bacteria	2147
505	Ga0207640_10115003	3300025981	Bacteria	1915
506	Ga0207640_10402743	3300025981	Bacteria	1115
507	Ga0207658_10010356	3300025986	Bacteria	6333
508	Ga0207658_10045504	3300025986	Bacteria	3199
509	Ga0207658_10060391	3300025986	Bacteria	2829
510	Ga0207677_10064696	3300026023	Bacteria	2548
511	Ga0207703_10054670	3300026035	Bacteria	3248
512	Ga0207639_10009566	3300026041	Bacteria	6691
513	Ga0207639_10242193	3300026041	Bacteria	1569
514	Ga0207678_10070107	3300026067	Bacteria	3005
515	Ga0207678_10183442	3300026067	Bacteria	1787
516	Ga0207678_10197841	3300026067	Bacteria	1718
517	Ga0207678_10288635	3300026067	Bacteria	1409
518	Ga0207678_10393760	3300026067	Bacteria	1199
519	Ga0207708_10045287	3300026075	Bacteria	3353
520	Ga0207708_10402387	3300026075	Bacteria	1132
521	Ga0207708_10478006	3300026075	Bacteria	1041
522	Ga0207641_10659530	3300026088	Bacteria	1028
523	Ga0207648_10000614	3300026089	Bacteria	39971
524	Ga0207648_10001597	3300026089	Bacteria	24813
525	Ga0207648_10005261	3300026089	Bacteria	13061
526	Ga0207648_10019266	3300026089	Bacteria	6159
527	Ga0207648_10019717	3300026089	Bacteria	6085
528	Ga0207676_10101719	3300026095	Bacteria	2383
529	Ga0207676_10797808	3300026095	Bacteria	921
530	Ga0207674_10059264	3300026116	Bacteria	3875
531	Ga0207674_10234577	3300026116	Bacteria	1782
532	Ga0207674_10339859	3300026116	Bacteria	1452
533	Ga0207675_100004236	3300026118	Bacteria	13870
534	Ga0207675_100023749	3300026118	Bacteria	5704
535	Ga0207675_100099043	3300026118	Bacteria	2746
536	Ga0207675_100107582	3300026118	Bacteria	2629
537	Ga0207675_100141004	3300026118	Bacteria	2290
538	Ga0207683_10019535	3300026121	Bacteria	5787
539	Ga0207683_10021280	3300026121	Bacteria	5550
540	Ga0207683_10032411	3300026121	Bacteria	4540
541	Ga0207683_10118428	3300026121	Bacteria	2376
542	Ga0207683_10208057	3300026121	Bacteria	1780
543	Ga0207683_10253361	3300026121	Bacteria	1607
544	Ga0207683_10719162	3300026121	Bacteria	926
545	Ga0207698_10588534	3300026142	Bacteria	1095
546	Ga0209281_1000160	3300027111	Bacteria	161071
547	Ga0209371_1004239	3300027312	Bacteria	6371
548	Ga0209282_1002689	3300027666	Bacteria	10367
549	Ga0209971_1065471	3300027682	Bacteria	880
550	Ga0209813_10011641	3300027866	Bacteria	2304
551	Ga0209813_10014749	3300027866	Bacteria	2109
552	Ga0209974_10000950	3300027876	Bacteria	10142
553	Ga0209974_10046153	3300027876	Bacteria	1456
554	Ga0207428_10000246	3300027907	Bacteria	73697
555	Ga0207428_10245401	3300027907	Bacteria	1337
556	Ga0268266_10008775	3300028379	Bacteria	8960
557	Ga0268266_10059220	3300028379	Bacteria	3299
558	Ga0268266_10175924	3300028379	Bacteria	1946
559	Ga0268265_10031147	3300028380	Bacteria	3850
560	Ga0268264_10013578	3300028381	Bacteria	6705
561	Ga0268264_10080456	3300028381	Bacteria	2782
562	Ga0268264_10321275	3300028381	Bacteria	1464
563	Ga0307517_10000918	3300028786	Bacteria	49925
564	Ga0307517_10003786	3300028786	Bacteria	23507
565	Ga0307517_10042428	3300028786	Bacteria	4879
566	Ga0307515_10000180	3300028794	Bacteria	156173
567	Ga0307515_10001052	3300028794	Bacteria	63228
568	Ga0307515_10001755	3300028794	Bacteria	48316
569	Ga0307515_10019603	3300028794	Bacteria	12153
570	Ga0307515_10047411	3300028794	Bacteria	6532
571	Ga0307515_10115941	3300028794	Bacteria	3080
572	Ga0307515_10117083	3300028794	Bacteria	3053
573	Ga0307515_10127404	3300028794	Bacteria	2832
574	Ga0268256_1003971	3300030500	Bacteria	6371
575	Ga0307511_10101380	3300030521	Bacteria	1888
576	Ga0314311_1070217	3300030733	Bacteria	5297
577	Ga0316178_1038078	3300030735	Bacteria	3324
578	Ga0316183_1076181	3300030742	Bacteria	3879
579	Ga0316181_1040477	3300030744	Bacteria	1159
580	Ga0316182_1383588	3300030745	Bacteria	967
581	Ga0265327_10008779	3300031251	Bacteria	7456
582	Ga0307513_10000004	3300031456	Bacteria	558931
583	Ga0307513_10020823	3300031456	Bacteria	7764
584	Ga0307513_10043585	3300031456	Bacteria	4925
585	Ga0307513_10153793	3300031456	Bacteria	2204
586	Ga0307513_10300039	3300031456	Bacteria	1374
587	Ga0307509_10000509	3300031507	Bacteria	66233
588	Ga0307509_10011291	3300031507	Bacteria	10833
589	Ga0307509_10017545	3300031507	Bacteria	8233
590	Ga0307509_10040571	3300031507	Bacteria	5062
591	Ga0307509_10101898	3300031507	Bacteria	2904
592	Ga0307408_100002069	3300031548	Bacteria	14442
593	Ga0307408_100004560	3300031548	Bacteria	9383
594	Ga0307408_100009082	3300031548	Bacteria	6562
595	Ga0307408_100076701	3300031548	Bacteria	2487
596	Ga0307408_100139523	3300031548	Bacteria	1901
597	Ga0307408_100174744	3300031548	Bacteria	1718
598	Ga0307408_100324150	3300031548	Bacteria	1299
599	Ga0307508_10000099	3300031616	Bacteria	102389
600	Ga0307508_10004974	3300031616	Bacteria	12777
601	Ga0307508_10065901	3300031616	Bacteria	3190
602	Ga0307514_10001936	3300031649	Bacteria	22633
603	Ga0307514_10067037	3300031649	Bacteria	2711
604	Ga0307514_10070423	3300031649	Bacteria	2626
605	Ga0307514_10093417	3300031649	Bacteria	2185
606	Ga0307516_10000488	3300031730	Bacteria	52667
607	Ga0307516_10000973	3300031730	Bacteria	39600
608	Ga0307516_10008370	3300031730	Bacteria	11720
609	Ga0307516_10024759	3300031730	Bacteria	6126
610	Ga0307516_10034231	3300031730	Bacteria	5107
611	Ga0307516_10063771	3300031730	Bacteria	3566
612	Ga0307516_10080742	3300031730	Bacteria	3096
613	Ga0307516_10373747	3300031730	Bacteria	1088
614	Ga0307405_10007092	3300031731	Bacteria	5571
615	Ga0307405_10082128	3300031731	Bacteria	2108
616	Ga0307405_10204400	3300031731	Bacteria	1437
617	Ga0307413_10036519	3300031824	Bacteria	2829
618	Ga0307518_10104727	3300031838	Bacteria	2021
619	Ga0307410_10002643	3300031852	Bacteria	8735
620	Ga0307410_10013076	3300031852	Bacteria	4828
621	Ga0307410_10019209	3300031852	Bacteria	4151
622	Ga0307410_10020811	3300031852	Bacteria	4022
623	Ga0307410_10164949	3300031852	Bacteria	1664
624	Ga0307410_10173901	3300031852	Bacteria	1625
625	Ga0307406_10000033	3300031901	Bacteria	83943
626	Ga0307406_10002798	3300031901	Bacteria	9517
627	Ga0307406_10010897	3300031901	Bacteria	5141
628	Ga0307406_10022465	3300031901	Bacteria	3743
629	Ga0307406_10180947	3300031901	Bacteria	1535
630	Ga0307407_10010285	3300031903	Bacteria	4406
631	Ga0307407_10010702	3300031903	Bacteria	4336
632	Ga0307407_10017100	3300031903	Bacteria	3629
633	Ga0307407_10337008	3300031903	Bacteria	1063
634	Ga0307412_10000082	3300031911	Bacteria	93313
635	Ga0307412_10019946	3300031911	Bacteria	4070
636	Ga0307412_10040320	3300031911	Bacteria	3021
637	Ga0307412_10116855	3300031911	Bacteria	1914
638	Ga0307412_10331746	3300031911	Bacteria	1214
639	Ga0307409_100000041	3300031995	Bacteria	44759
640	Ga0307409_100004833	3300031995	Bacteria	7649
641	Ga0307409_100020526	3300031995	Bacteria	4505
642	Ga0307409_100030253	3300031995	Bacteria	3887
643	Ga0307416_100010402	3300032002	Bacteria	6142
644	Ga0307416_100030465	3300032002	Bacteria	4048
645	Ga0307416_100033456	3300032002	Bacteria	3896
646	Ga0307416_100054803	3300032002	Bacteria	3207
647	Ga0307416_100195739	3300032002	Bacteria	1912
648	Ga0307414_10015378	3300032004	Bacteria	4617
649	Ga0307414_10019902	3300032004	Bacteria	4170
650	Ga0307414_10034677	3300032004	Bacteria	3349
651	Ga0307411_10008910	3300032005	Bacteria	5235
652	Ga0307411_10012072	3300032005	Bacteria	4693
653	Ga0307411_10024459	3300032005	Bacteria	3601
654	Ga0307411_10148719	3300032005	Bacteria	1738
655	Ga0307411_10365617	3300032005	Bacteria	1181
656	Ga0307415_100001840	3300032126	Bacteria	10403
657	Ga0307415_100003857	3300032126	Bacteria	7694
658	Ga0307415_100019247	3300032126	Bacteria	4141
659	Ga0307415_100085161	3300032126	Bacteria	2270
660	Ga0307415_100511769	3300032126	Bacteria	1052
661	Ga0307507_10000005	3300033179	Bacteria	281494
662	Ga0307510_10000794	3300033180	Bacteria	32695
663	Ga0307510_10010876	3300033180	Bacteria	10812
664	Ga0373948_0015061	3300034817	Bacteria	1416
665	Ga0373926_0023606	3300035083	Bacteria	2137
666	Ga0373929_0028438	3300035085	Bacteria	1181
667	Ga0373934_0004886	3300035086	Bacteria	4961
668	Ga0373923_0175769	3300035111	Bacteria	982
669	Ga0373932_0075603	3300035112	Bacteria	1054
670	Ga0373939_0000028	3300035114	Bacteria	53215
671	Ga0373939_0010945	3300035114	Bacteria	2280
672	Ga0373960_0000179	3300035121	Bacteria	11264
673	Ga0373943_0034815	3300035170	Bacteria	2404
674	Ga0373962_0026455	3300035242	Bacteria	1564
675	Ga0373931_0000156	3300035691	Bacteria	29608
676	Ga0373931_0034988	3300035691	Bacteria	2609
677	Ga0373931_0059157	3300035691	Bacteria	2060
678	Ga0373935_0014634	3300035692	Bacteria	4736
679	Ga0373927_0339795	3300035695	Bacteria	989
680	Ga0373937_0024629	3300036401	Bacteria	5430
681	Ga0373925_0004860	3300037068	Bacteria	10116
682	Ga0395899_0000005	3300037312	Bacteria	772966
683	Ga0395899_0011426	3300037312	Bacteria	6797
684	Ga0395900_0000003	3300037418	Bacteria	587648
685	Ga0395900_0002516	3300037418	Bacteria	20125
686	Ga0395900_0028299	3300037418	Bacteria	5740
687	Ga0395900_0034058	3300037418	Bacteria	5243
688	Ga0395900_0040475	3300037418	Bacteria	4803
689	Ga0395900_0075702	3300037418	Bacteria	3460
690	Ga0395900_0338305	3300037418	Bacteria	1481
691	Ga0395898_0000003	3300037466	Bacteria	772986
692	Ga0395898_0001980	3300037466	Bacteria	25743
693	Ga0395898_0006478	3300037466	Bacteria	12503
694	Ga0395898_0028977	3300037466	Bacteria	5549
695	Ga0395898_0031402	3300037466	Bacteria	5307
696	Ga0395898_0092874	3300037466	Bacteria	2902
697	Ga0395898_0258266	3300037466	Bacteria	1661
698	Ga0395905_0024495	3300037471	Bacteria	5695
699	Ga0395905_0081705	3300037471	Bacteria	3028
700	Ga0395905_0087107	3300037471	Bacteria	2928
701	Ga0395905_0118684	3300037471	Bacteria	2486
702	Ga0395905_0311176	3300037471	Bacteria	1463
703	Ga0395905_0338165	3300037471	Bacteria	1396
704	Ga0395901_0000026	3300038443	Bacteria	249248
705	Ga0395901_0000040	3300038443	Bacteria	204677
706	Ga0395901_0000336	3300038443	Bacteria	57518
707	Ga0395901_0008865	3300038443	Bacteria	10184
708	Ga0395901_0020542	3300038443	Bacteria	6759
709	Ga0395901_0129540	3300038443	Bacteria	2651
710	Ga0395901_0147446	3300038443	Bacteria	2473
711	Ga0395901_0306882	3300038443	Bacteria	1644
712	Ga0436365_1786770	3300039437	Bacteria	4101
713	Ga0436361_0673985	3300039447	Bacteria	5453
714	Ga0439439_0025500	3300041406	Bacteria	1488
715	Ga0439453_0016628	3300041408	Bacteria	1285
716	Ga0439461_0009525	3300041410	Bacteria	1764
717	Ga0439461_0015325	3300041410	Bacteria	1468
718	Ga0439465_0058922	3300041413	Bacteria	1270
719	Ga0451794_05375	3300041446	Bacteria	908
720	Ga0451791_0508084	3300041451	Bacteria	2640
721	Ga0451791_1056810	3300041451	Bacteria	1274
722	Ga0451791_1212200	3300041451	Bacteria	3807
723	Ga0451793_0297079	3300041452	Bacteria	2069
724	Ga0451797_0293764	3300041453	Bacteria	1919
725	Ga0451797_0989451	3300041453	Bacteria	1746
726	Ga0451798_0166294	3300041458	Bacteria	1423
727	Ga0451802_0382733	3300041460	Bacteria	1745
728	Ga0451841_0618492	3300041498	Bacteria	1056
729	Ga0451841_1382434	3300041498	Bacteria	1398
730	Ga0451843_1188350	3300041509	Bacteria	1534
731	Ga0451853_1134849	3300041512	Bacteria	4331
732	Ga0451853_2013300	3300041512	Bacteria	1228
733	Ga0439431_0020494	3300041997	Bacteria	1580
734	Ga0439433_0018643	3300041999	Bacteria	1545
735	Ga0439433_0028305	3300041999	Bacteria	1274
736	Ga0439448_0000010	3300042005	Bacteria	33604
737	Ga0439448_0009616	3300042005	Bacteria	2853
738	Ga0439448_0019396	3300042005	Bacteria	2093
739	Ga0439449_0009571	3300042007	Bacteria	3669
740	Ga0439449_0064647	3300042007	Bacteria	1349
741	Ga0439449_0083998	3300042007	Bacteria	1175
742	Ga0439457_009405	3300042014	Bacteria	2276
743	Ga0439463_009820	3300042016	Bacteria	2351
744	Ga0450923_003778	3300042125	Bacteria	2322
745	Ga0450889_003410	3300042144	Bacteria	1568
746	Ga0439446_0005479	3300042156	Bacteria	3267
747	Ga0439446_0012573	3300042156	Bacteria	2312
748	Ga0439434_0016350	3300042435	Bacteria	2216
749	Ga0439434_0049834	3300042435	Bacteria	1297
750	Ga0439435_0010559	3300042436	Bacteria	2195
751	Ga0439464_0000820	3300042439	Bacteria	6854
752	Ga0439464_0013935	3300042439	Bacteria	2158
753	Ga0439460_0009146	3300042461	Bacteria	2512
754	Ga0439460_0024543	3300042461	Bacteria	1671
755	Ga0450918_000247	3300042531	Bacteria	12331
756	Ga0450918_003064	3300042531	Bacteria	3125
757	Ga0451577_0004101	3300042876	Bacteria	15626
758	Ga0451577_0008497	3300042876	Bacteria	9995
759	Ga0439440_0050815	3300042993	Bacteria	1035
760	Ga0466969_0006244	3300044656	Bacteria	6342
761	Ga0466969_0009071	3300044656	Bacteria	5272
762	Ga0466969_0020264	3300044656	Bacteria	3446
763	Ga0466972_0032869	3300044658	Bacteria	2546
764	Ga0466972_0034704	3300044658	Bacteria	2470
765	Ga0466972_0053332	3300044658	Bacteria	1947
766	Ga0466972_0079847	3300044658	Bacteria	1558
767	Ga0466972_0161396	3300044658	Bacteria	1053
768	Ga0453683_0006829	3300044673	Bacteria	7794
769	Ga0466965_0025044	3300044683	Bacteria	2887
770	Ga0466965_0039324	3300044683	Bacteria	2325
771	Ga0466965_0134393	3300044683	Bacteria	1284
772	Ga0466965_0255852	3300044683	Bacteria	940
773	Ga0466966_0042121	3300044684	Bacteria	2932
774	Ga0466966_0054535	3300044684	Bacteria	2533
775	Ga0466966_0105105	3300044684	Bacteria	1743
776	Ga0466961_0006616	3300044693	Bacteria	7369
777	Ga0466961_0010176	3300044693	Bacteria	5992
778	Ga0466961_0039542	3300044693	Bacteria	3024
779	Ga0466963_0093770	3300044694	Bacteria	2047
780	Ga0453684_0000121	3300044712	Bacteria	341067
781	Ga0453684_0006064	3300044712	Bacteria	23358
782	Ga0453684_0034636	3300044712	Bacteria	7003
783	Ga0453684_0078506	3300044712	Bacteria	4131
784	Ga0466971_0000346	3300044719	Bacteria	17781
785	Ga0466971_0007704	3300044719	Bacteria	4696
786	Ga0466971_0085763	3300044719	Bacteria	1439
787	Ga0466971_0148013	3300044719	Bacteria	1095
788	Ga0466970_0110100	3300044765	Bacteria	1504
789	Ga0466970_0122764	3300044765	Bacteria	1423
790	Ga0466957_0065491	3300044842	Bacteria	2238
791	Ga0466957_0135501	3300044842	Bacteria	1582
792	Ga0466960_0034165	3300044901	Bacteria	2368
793	Ga0466960_0068430	3300044901	Bacteria	1761
794	Ga0466960_0068582	3300044901	Bacteria	1760
795	Ga0466960_0212505	3300044901	Bacteria	1061
796	Ga0466959_0003033	3300045049	Bacteria	10859
797	Ga0466959_0012085	3300045049	Bacteria	6229
798	Ga0466959_0077185	3300045049	Bacteria	2404
799	Ga0466959_0154470	3300045049	Bacteria	1616
800	Ga0451576_0014933	3300045051	Bacteria	8626
801	Ga0466958_0008025	3300045836	Bacteria	5838
802	Ga0466958_0075646	3300045836	Bacteria	2066
803	Ga0466958_0263564	3300045836	Bacteria	1103
804	Ga0466967_0011773	3300045976	Bacteria	6651
805	Ga0466967_0162297	3300045976	Bacteria	2098
806	Ga0466967_0399246	3300045976	Bacteria	1337
807	Ga0495617_002533	3300046452	Bacteria	7221
808	Ga0495627_015598	3300046453	Bacteria	2619
809	Ga0495592_0000140	3300046454	Bacteria	63848
810	Ga0495592_0000783	3300046454	Bacteria	22037
811	Ga0495592_0001857	3300046454	Bacteria	14863
812	Ga0495592_0004900	3300046454	Bacteria	9854
813	Ga0495592_0024693	3300046454	Bacteria	4569
814	Ga0495603_0012253	3300046455	Bacteria	5192
815	Ga0495603_0196837	3300046455	Bacteria	1165
816	Ga0495590_0007624	3300046457	Bacteria	4158
817	Ga0495590_0010622	3300046457	Bacteria	3453
818	Ga0495590_0017553	3300046457	Bacteria	2574
819	Ga0495590_0038270	3300046457	Bacteria	1672
820	Ga0495591_002071	3300046458	Bacteria	11577
821	Ga0495629_0000058	3300046459	Bacteria	103431
822	Ga0495629_0005681	3300046459	Bacteria	9315
823	Ga0495629_0075981	3300046459	Bacteria	2346
824	Ga0495629_0167511	3300046459	Bacteria	1525
825	Ga0495629_0259972	3300046459	Bacteria	1193
826	Ga0495638_0023970	3300046460	Bacteria	3984
827	Ga0495638_0031429	3300046460	Bacteria	3413
828	Ga0495641_0044386	3300046461	Bacteria	2051
829	Ga0495641_0100519	3300046461	Bacteria	1290
830	Ga0495651_0010993	3300046462	Bacteria	6964
831	Ga0495651_0014624	3300046462	Bacteria	6067
832	Ga0495653_0000360	3300046463	Bacteria	36850
833	Ga0495653_0004293	3300046463	Bacteria	11546
834	Ga0495653_0019693	3300046463	Bacteria	5473
835	Ga0495653_0042784	3300046463	Bacteria	3524
836	Ga0495653_0061926	3300046463	Bacteria	2828
837	Ga0495653_0088994	3300046463	Bacteria	2263
838	Ga0495653_0232313	3300046463	Bacteria	1234
839	Ga0495650_0003649	3300046471	Bacteria	11050
840	Ga0495650_0035343	3300046471	Bacteria	2200
841	Ga0495580_0000476	3300046472	Bacteria	33380
842	Ga0495580_0001762	3300046472	Bacteria	19005
843	Ga0495580_0002280	3300046472	Bacteria	16750
844	Ga0495580_0003418	3300046472	Bacteria	13534
845	Ga0495580_0006355	3300046472	Bacteria	9640
846	Ga0495580_0401159	3300046472	Bacteria	924
847	Ga0495582_0010660	3300046473	Bacteria	5054
848	Ga0495582_0129989	3300046473	Bacteria	1422
849	Ga0495605_0010958	3300046474	Bacteria	5063
850	Ga0495605_0024442	3300046474	Bacteria	3161
851	Ga0495639_0001849	3300046475	Bacteria	9363
852	Ga0495662_0000845	3300046476	Bacteria	14890
853	Ga0495662_0014551	3300046476	Bacteria	3825
854	Ga0495662_0047606	3300046476	Bacteria	2070
855	Ga0495664_0000639	3300046477	Bacteria	17814
856	Ga0495664_0002563	3300046477	Bacteria	9769
857	Ga0495664_0029650	3300046477	Bacteria	3201
858	Ga0495584_0002297	3300046491	Bacteria	10905
859	Ga0495584_0038277	3300046491	Bacteria	2424
860	Ga0495584_0156087	3300046491	Bacteria	1160
861	Ga0495584_0156252	3300046491	Bacteria	1159
862	Ga0495585_0003905	3300046492	Bacteria	9889
863	Ga0495585_0010619	3300046492	Bacteria	5473
864	Ga0495585_0080518	3300046492	Bacteria	1765
865	Ga0495594_0119044	3300046499	Bacteria	1492
866	Ga0495594_0427179	3300046499	Bacteria	753
867	Ga0495596_0005084	3300046500	Bacteria	6272
868	Ga0495596_0013745	3300046500	Bacteria	3424
869	Ga0495607_0014431	3300046501	Bacteria	5141
870	Ga0495607_0018499	3300046501	Bacteria	4442
871	Ga0495583_0000008	3300046506	Bacteria	411092
872	Ga0495583_0000159	3300046506	Bacteria	113627
873	Ga0495583_0000185	3300046506	Bacteria	105958
874	Ga0495583_0002666	3300046506	Bacteria	14856
875	Ga0495606_0000297	3300046507	Bacteria	85779
876	Ga0495606_0023737	3300046507	Bacteria	4436
877	Ga0495606_0026344	3300046507	Bacteria	4145
878	Ga0495606_0090024	3300046507	Bacteria	1889
879	Ga0495606_0129628	3300046507	Bacteria	1500
880	Ga0495608_0001236	3300046511	Bacteria	18137
881	Ga0495608_0002116	3300046511	Bacteria	14306
882	Ga0495610_0000281	3300046512	Bacteria	53046
883	Ga0495616_0001038	3300046513	Bacteria	19867
884	Ga0495618_0005681	3300046514	Bacteria	7579
885	Ga0495618_0008585	3300046514	Bacteria	6171
886	Ga0495618_0017955	3300046514	Bacteria	4340
887	Ga0495618_0158472	3300046514	Bacteria	1444
888	Ga0495620_0012100	3300046515	Bacteria	4476
889	Ga0495620_0014853	3300046515	Bacteria	3947
890	Ga0495628_0002179	3300046516	Bacteria	17713
891	Ga0495628_0007390	3300046516	Bacteria	9511
892	Ga0495628_0018684	3300046516	Bacteria	5736
893	Ga0495628_0042864	3300046516	Bacteria	3607
894	Ga0495628_0081904	3300046516	Bacteria	2506
895	Ga0495628_0180176	3300046516	Bacteria	1598
896	Ga0495630_0010652	3300046517	Bacteria	6636
897	Ga0495630_0011063	3300046517	Bacteria	6527
898	Ga0495630_0014955	3300046517	Bacteria	5659
899	Ga0495630_0021432	3300046517	Bacteria	4771
900	Ga0495630_0062843	3300046517	Bacteria	2789
901	Ga0495631_0002040	3300046518	Bacteria	11762
902	Ga0495632_0005702	3300046519	Bacteria	8175
903	Ga0495632_0130831	3300046519	Bacteria	1168
904	Ga0495637_0096456	3300046520	Bacteria	1160
905	Ga0495643_0006396	3300046522	Bacteria	7773
906	Ga0495644_0000163	3300046523	Bacteria	31558
907	Ga0495644_0000657	3300046523	Bacteria	14478
908	Ga0495644_0002234	3300046523	Bacteria	7743
909	Ga0495644_0030361	3300046523	Bacteria	2041
910	Ga0495648_0005067	3300046524	Bacteria	11059
911	Ga0495648_0042271	3300046524	Bacteria	2869
912	Ga0495648_0110454	3300046524	Bacteria	1497
913	Ga0495648_0156063	3300046524	Bacteria	1185
914	Ga0495666_0001339	3300046526	Bacteria	11935
915	Ga0495666_0002336	3300046526	Bacteria	9463
916	Ga0495666_0003519	3300046526	Bacteria	7903
917	Ga0495666_0003612	3300046526	Bacteria	7814
918	Ga0495666_0093368	3300046526	Bacteria	1419
919	Ga0495642_0006334	3300046528	Bacteria	4537
920	Ga0495642_0007489	3300046528	Bacteria	4182
921	Ga0495642_0200864	3300046528	Bacteria	869
922	Ga0495652_0023197	3300046529	Bacteria	5501
923	Ga0495652_0043504	3300046529	Bacteria	3867
924	Ga0495652_0065868	3300046529	Bacteria	3043
925	Ga0495652_0096084	3300046529	Bacteria	2413
926	Ga0495652_0149517	3300046529	Bacteria	1826
927	Ga0495654_0035827	3300046530	Bacteria	2496
928	Ga0495654_0182106	3300046530	Bacteria	909
929	Ga0495665_0003179	3300046531	Bacteria	8896
930	Ga0495665_0006306	3300046531	Bacteria	6399
931	Ga0495665_0013591	3300046531	Bacteria	4400
932	Ga0495665_0021088	3300046531	Bacteria	3500
933	Ga0495665_0022250	3300046531	Bacteria	3408
934	Ga0495665_0097262	3300046531	Bacteria	1545
935	Ga0495640_0008119	3300046533	Bacteria	8243
936	Ga0495640_0022329	3300046533	Bacteria	4626
937	Ga0495640_0026439	3300046533	Bacteria	4194
938	Ga0495586_0006695	3300046535	Bacteria	6156
939	Ga0495586_0025575	3300046535	Bacteria	3159
940	Ga0495586_0047487	3300046535	Bacteria	2318
941	Ga0495586_0061860	3300046535	Bacteria	2037
942	Ga0495587_0000694	3300046536	Bacteria	22576
943	Ga0495587_0008334	3300046536	Bacteria	6673
944	Ga0495587_0288050	3300046536	Bacteria	920
945	Ga0495609_0001121	3300046538	Bacteria	18556
946	Ga0495609_0042730	3300046538	Bacteria	2036
947	Ga0495609_0076602	3300046538	Bacteria	1466
948	Ga0495645_0003861	3300046543	Bacteria	10200
949	Ga0495645_0108866	3300046543	Bacteria	1962
950	Ga0495645_0115954	3300046543	Bacteria	1891
951	Ga0495645_0125466	3300046543	Bacteria	1803
952	Ga0495622_0000005	3300046557	Bacteria	254434
953	Ga0495622_0069093	3300046557	Bacteria	1631
954	Ga0495622_0072660	3300046557	Bacteria	1587
955	Ga0495622_0133353	3300046557	Bacteria	1130
956	Ga0495633_0012733	3300046558	Bacteria	4460
957	Ga0495633_0195765	3300046558	Bacteria	928
958	Ga0495667_0004100	3300046559	Bacteria	9789
959	Ga0495667_0022746	3300046559	Bacteria	4223
960	Ga0495667_0063582	3300046559	Bacteria	2415
961	Ga0495656_0012876	3300046615	Bacteria	3099
962	Ga0495656_0034603	3300046615	Bacteria	2070
963	Ga0495656_0039784	3300046615	Bacteria	1956
964	Ga0495656_0178128	3300046615	Bacteria	1043
965	Ga0495668_0213923	3300046616	Bacteria	1055
966	Ga0495634_0012084	3300046642	Bacteria	6258
967	Ga0495634_0042216	3300046642	Bacteria	3094
968	Ga0495634_0100105	3300046642	Bacteria	1873
969	Ga0495611_0018132	3300046648	Bacteria	3016
970	Ga0495611_0019535	3300046648	Bacteria	2910
971	Ga0495611_0022203	3300046648	Bacteria	2745
972	Ga0495611_0034854	3300046648	Bacteria	2227
973	Ga0495625_0000311	3300046660	Bacteria	74209
974	Ga0495625_0003763	3300046660	Bacteria	14734
975	Ga0495625_0004856	3300046660	Bacteria	12537
976	Ga0495625_0007125	3300046660	Bacteria	9822
977	Ga0495625_0011468	3300046660	Bacteria	7226
978	Ga0495625_0025185	3300046660	Bacteria	4515
979	Ga0495625_0057926	3300046660	Bacteria	2753
980	Ga0495625_0115590	3300046660	Bacteria	1831
981	Ga0495635_0001935	3300046663	Bacteria	14070
982	Ga0495635_0009483	3300046663	Bacteria	6801
983	Ga0495635_0034268	3300046663	Bacteria	3522
984	Ga0495659_0000004	3300046664	Bacteria	143914
985	Ga0495659_0002446	3300046664	Bacteria	5990
986	Ga0495659_0010315	3300046664	Bacteria	2994
987	Ga0495661_0016411	3300046665	Bacteria	4908
988	Ga0495661_0030390	3300046665	Bacteria	3440
989	Ga0495661_0043439	3300046665	Bacteria	2762
990	Ga0495657_0032773	3300046675	Bacteria	3623
991	Ga0495657_0100853	3300046675	Bacteria	1840
992	Ga0495599_0034813	3300046678	Bacteria	3162
993	Ga0495599_0050057	3300046678	Bacteria	2618
994	Ga0495599_0156007	3300046678	Bacteria	1412
995	Ga0495623_0002243	3300046679	Bacteria	12871
996	Ga0495623_0002671	3300046679	Bacteria	11773
997	Ga0495623_0011801	3300046679	Bacteria	5659
998	Ga0495623_0049305	3300046679	Bacteria	2668
999	Ga0495623_0163277	3300046679	Bacteria	1307
1000	Ga0495646_0000444	3300046680	Bacteria	21897
1001	Ga0495646_0007933	3300046680	Bacteria	6744
1002	Ga0495646_0014284	3300046680	Bacteria	5051
1003	Ga0495646_0020329	3300046680	Bacteria	4200
1004	Ga0495646_0058726	3300046680	Bacteria	2299
1005	Ga0495646_0127848	3300046680	Bacteria	1433
1006	Ga0495646_0209218	3300046680	Bacteria	1059
1007	Ga0495647_0017099	3300046681	Bacteria	2562
1008	Ga0495658_0013346	3300046683	Bacteria	4180
1009	Ga0495658_0133474	3300046683	Bacteria	1513
1010	Ga0495669_0036061	3300046684	Bacteria	2185
1011	Ga0495613_0004462	3300046689	Bacteria	10485
1012	Ga0495613_0016684	3300046689	Bacteria	5467
1013	Ga0495613_0089462	3300046689	Bacteria	2230
1014	Ga0495624_0000673	3300046690	Bacteria	26743
1015	Ga0495624_0019701	3300046690	Bacteria	4497
1016	Ga0495624_0037050	3300046690	Bacteria	3140
1017	Ga0495624_0060403	3300046690	Bacteria	2376
1018	Ga0495670_0004151	3300046691	Bacteria	7100
1019	Ga0495670_0008283	3300046691	Bacteria	5112
1020	Ga0495670_0042781	3300046691	Bacteria	2260
1021	Ga0495671_0000548	3300046692	Bacteria	28176
1022	Ga0495671_0011372	3300046692	Bacteria	4900
1023	Ga0495671_0030601	3300046692	Bacteria	2755
1024	Ga0495671_0043887	3300046692	Bacteria	2243
1025	Ga0495649_0001187	3300046694	Bacteria	20128
1026	Ga0495649_0018907	3300046694	Bacteria	3870
1027	Ga0495649_0027296	3300046694	Bacteria	3168
1028	Ga0495589_0004649	3300046794	Bacteria	7294
1029	Ga0495600_0002476	3300046809	Bacteria	10604
1030	Ga0495600_0025388	3300046809	Bacteria	3819
1031	Ga0495660_0005128	3300046810	Bacteria	7872
1032	Ga0495660_0007860	3300046810	Bacteria	6263
1033	Ga0495660_0058044	3300046810	Bacteria	2086
1034	Ga0495581_0002671	3300047315	Bacteria	10147
1035	Ga0495581_0003725	3300047315	Bacteria	8780
1036	Ga0495581_0003895	3300047315	Bacteria	8586
1037	Ga0495581_0006187	3300047315	Bacteria	6942
1038	Ga0495581_0081845	3300047315	Bacteria	1870
1039	Ga0495604_0004557	3300047317	Bacteria	10979
1040	Ga0495604_0007246	3300047317	Bacteria	8778
1041	Ga0495604_0007750	3300047317	Bacteria	8502
1042	Ga0495604_0030537	3300047317	Bacteria	4279
1043	Ga0495604_0053846	3300047317	Bacteria	3107
1044	Ga0495604_0081842	3300047317	Bacteria	2416
1045	Ga0495636_0000383	3300047318	Bacteria	16670
1046	Ga0495636_0008721	3300047318	Bacteria	3998
1047	Ga0495674_0005761	3300047319	Bacteria	11878
1048	Ga0495674_0029100	3300047319	Bacteria	5032
1049	Ga0495674_0077585	3300047319	Bacteria	2855
1050	Ga0495674_0090441	3300047319	Bacteria	2615
1051	Ga0495674_0095821	3300047319	Bacteria	2530
1052	Ga0495674_0192478	3300047319	Bacteria	1694
1053	Ga0495674_0497499	3300047319	Bacteria	975
1054	Ga0495672_0000045	3300047320	Bacteria	255145
1055	Ga0495672_0000835	3300047320	Bacteria	32845
1056	Ga0495672_0013305	3300047320	Bacteria	5683
1057	Ga0495672_0013478	3300047320	Bacteria	5639
1058	Ga0495676_0002760	3300047321	Bacteria	15769
1059	Ga0495676_0012050	3300047321	Bacteria	7798
1060	Ga0495676_0027272	3300047321	Bacteria	4900
1061	Ga0495676_0045103	3300047321	Bacteria	3592
1062	Ga0495680_0010660	3300047322	Bacteria	8196
1063	Ga0495680_0030264	3300047322	Bacteria	4422
1064	Ga0495680_0399244	3300047322	Bacteria	949
1065	Ga0495683_0014935	3300047323	Bacteria	4044
1066	Ga0495683_0016313	3300047323	Bacteria	3858
1067	Ga0495683_0026971	3300047323	Bacteria	2939
1068	Ga0495683_0029725	3300047323	Bacteria	2791
1069	Ga0495683_0127558	3300047323	Bacteria	1202
1070	Ga0495687_000863	3300047443	Bacteria	32127
1071	Ga0495687_001223	3300047443	Bacteria	24535
1072	Ga0495687_003425	3300047443	Bacteria	11511
1073	Ga0495687_003938	3300047443	Bacteria	10394
1074	Ga0495687_005728	3300047443	Bacteria	7824
1075	Ga0495675_0003747	3300047444	Bacteria	9191
1076	Ga0495675_0004373	3300047444	Bacteria	8553
1077	Ga0495675_0039701	3300047444	Bacteria	2998
1078	Ga0495677_0001387	3300047445	Bacteria	9691
1079	Ga0495677_0024225	3300047445	Bacteria	2201
1080	Ga0495679_000009	3300047446	Bacteria	343637
1081	Ga0495679_000441	3300047446	Bacteria	30679
1082	Ga0495679_004662	3300047446	Bacteria	6247
1083	Ga0495685_000161	3300047447	Bacteria	22547
1084	Ga0495685_000794	3300047447	Bacteria	9682
1085	Ga0495673_0038168	3300047469	Bacteria	2187
1086	Ga0495673_0155653	3300047469	Bacteria	880
1087	Ga0495681_0062393	3300047470	Bacteria	1714
1088	Ga0495681_0156814	3300047470	Bacteria	951
1089	Ga0495684_0025678	3300047471	Bacteria	4527
1090	Ga0495684_0107577	3300047471	Bacteria	2106
1091	Ga0495684_0213262	3300047471	Bacteria	1418
1092	Ga0495684_0307516	3300047471	Bacteria	1137
1093	Ga0495686_0001957	3300047472	Bacteria	20470
1094	Ga0495686_0037205	3300047472	Bacteria	3119
1095	Ga0495686_0063442	3300047472	Bacteria	2289
1096	Ga0495686_0081582	3300047472	Bacteria	1974
1097	Ga0495686_0093636	3300047472	Bacteria	1821
1098	Ga0495686_0117636	3300047472	Bacteria	1587
1099	Ga0495686_0166036	3300047472	Bacteria	1287
1100	Ga0495593_0007350	3300047673	Bacteria	6449
1101	Ga0495593_0009592	3300047673	Bacteria	5621
1102	Ga0495593_0017392	3300047673	Bacteria	4047
1103	Ga0495593_0086379	3300047673	Bacteria	1618
1104	Ga0495602_0039918	3300048088	Bacteria	4314
1105	Ga0495602_0042914	3300048088	Bacteria	4116
1106	Ga0495602_0100407	3300048088	Bacteria	2376
1107	Ga0495602_0206259	3300048088	Bacteria	1496
1108	Ga0495614_0003846	3300048089	Bacteria	6750
1109	Ga0495614_0008069	3300048089	Bacteria	4679
1110	Ga0495614_0092873	3300048089	Bacteria	1314
1111	Ga0495614_0163484	3300048089	Bacteria	997
1112	Ga0495615_0046314	3300048090	Bacteria	1105
1113	Ga0495626_0027005	3300048091	Bacteria	2793
1114	Ga0495626_0052987	3300048091	Bacteria	1869
1115	Ga0495626_0074386	3300048091	Bacteria	1520
1116	Ga0496100_0012954	3300048903	Bacteria	4796
1117	Ga0496101_0012659	3300048904	Bacteria	5637
1118	Ga0496101_0031505	3300048904	Bacteria	3728
1119	Ga0496102_0002634	3300048905	Bacteria	15247
1120	Ga0496102_0055796	3300048905	Bacteria	3602
1121	Ga0496102_0058121	3300048905	Bacteria	3533
1122	Ga0496102_0151281	3300048905	Bacteria	2181
1123	Ga0496102_0271645	3300048905	Bacteria	1598
1124	Ga0496102_0382634	3300048905	Bacteria	1324
1125	Ga0496103_0002745	3300048906	Bacteria	10983
1126	Ga0496103_0004898	3300048906	Bacteria	8082
1127	Ga0496103_0011346	3300048906	Bacteria	5278
1128	Ga0496104_0004737	3300048907	Bacteria	11840
1129	Ga0496104_0024837	3300048907	Bacteria	5517
1130	Ga0496104_0125490	3300048907	Bacteria	2465
1131	Ga0496105_0002430	3300048908	Bacteria	13500
1132	Ga0496105_0019902	3300048908	Bacteria	5416
1133	Ga0496105_0188107	3300048908	Bacteria	1689
1134	Ga0496108_0002610	3300048911	Bacteria	14435
1135	Ga0496108_0018614	3300048911	Bacteria	5690
1136	Ga0496108_0121156	3300048911	Bacteria	2244
1137	Ga0496108_0145019	3300048911	Bacteria	2046
1138	Ga0496109_0004160	3300048912	Bacteria	12082
1139	Ga0496109_0113871	3300048912	Bacteria	2516
1140	Ga0496109_0116118	3300048912	Bacteria	2490
1141	Ga0496110_0001347	3300048913	Bacteria	17693
1142	Ga0496110_0004179	3300048913	Bacteria	11152
1143	Ga0496110_0018524	3300048913	Bacteria	5837
1144	Ga0496110_0910211	3300048913	Bacteria	786
1145	Ga0496111_0000440	3300048914	Bacteria	21060
1146	Ga0496111_0030896	3300048914	Bacteria	3811
1147	Ga0496111_0053960	3300048914	Bacteria	2904
1148	Ga0496113_0021420	3300048916	Bacteria	4560
1149	Ga0496114_0034444	3300048917	Bacteria	4178
1150	Ga0496114_0048117	3300048917	Bacteria	3547
1151	Ga0496114_0064732	3300048917	Bacteria	3062
1152	Ga0496114_0073909	3300048917	Bacteria	2870
1153	Ga0496114_0087100	3300048917	Bacteria	2647
1154	Ga0496114_0174461	3300048917	Bacteria	1875
1155	Ga0496114_0190124	3300048917	Bacteria	1796
1156	Ga0496114_0194976	3300048917	Bacteria	1773
1157	Ga0496114_0327276	3300048917	Bacteria	1354
1158	Ga0496114_0517327	3300048917	Bacteria	1055
1159	Ga0496115_0349709	3300048918	Bacteria	1206
1160	Ga0496116_0038974	3300048919	Bacteria	3291
1161	Ga0496116_0126852	3300048919	Bacteria	1464
1162	Ga0496117_0001308	3300048920	Bacteria	36661
1163	Ga0496117_0019630	3300048920	Bacteria	5543
1164	Ga0496117_0050422	3300048920	Bacteria	2951
1165	Ga0496117_0079019	3300048920	Bacteria	2169
1166	Ga0496117_0082613	3300048920	Bacteria	2104
1167	Ga0496118_0000234	3300048921	Bacteria	97673
1168	Ga0496118_0001165	3300048921	Bacteria	40521
1169	Ga0496118_0005315	3300048921	Bacteria	14678
1170	Ga0496118_0016947	3300048921	Bacteria	6653
1171	Ga0496118_0024099	3300048921	Bacteria	5263
1172	Ga0496121_0000896	3300048924	Bacteria	53796
1173	Ga0496121_0007376	3300048924	Bacteria	13291
1174	Ga0496121_0016264	3300048924	Bacteria	7693
1175	Ga0496121_0165210	3300048924	Bacteria	1614
1176	Ga0496121_0173480	3300048924	Bacteria	1563
1177	Ga0496121_0175089	3300048924	Bacteria	1554
1178	Ga0496123_0053308	3300048926	Bacteria	2674
1179	Ga0496123_0110166	3300048926	Bacteria	1576
1180	Ga0496124_0008990	3300048927	Bacteria	10338
1181	Ga0496125_0071362	3300048928	Bacteria	2713
1182	Ga0496126_0000319	3300048929	Bacteria	102596
1183	Ga0496126_0004229	3300048929	Bacteria	17292
1184	Ga0495678_002384	3300049459	Bacteria	12869
1185	Ga0495678_019873	3300049459	Bacteria	2986
1186	Ga0495682_0000206	3300049460	Bacteria	47410
1187	Ga0495682_0000261	3300049460	Bacteria	41788
1188	Ga0495682_0012369	3300049460	Bacteria	3272
1189	Ga0495682_0020172	3300049460	Bacteria	2502
1190	Ga0501316_000316	3300049532	Bacteria	3112
1191	Ga0501318_009628	3300049534	Bacteria	1057
1192	Ga0501031_0003149	3300049568	Bacteria	10581
1193	Ga0501033_0095289	3300049570	Bacteria	2175
1194	Ga0501034_0153351	3300049571	Bacteria	2279
1195	Ga0501037_0115604	3300049573	Bacteria	1931
1196	Ga0501038_0005725	3300049574	Bacteria	11524
1197	Ga0501039_0024042	3300049575	Bacteria	4679
1198	Ga0501040_0006222	3300049576	Bacteria	7747
1199	Ga0501042_0087935	3300049578	Bacteria	2229
1200	Ga0501043_0028821	3300049579	Bacteria	4359
1201	Ga0501046_0013645	3300049580	Bacteria	6872
1202	Ga0501046_0205335	3300049580	Bacteria	1465
1203	Ga0501048_0004930	3300049582	Bacteria	10182
1204	Ga0501048_0294297	3300049582	Bacteria	1155
1205	Ga0501070_0222642	3300049586	Bacteria	1547
1206	Ga0501071_0021994	3300049587	Bacteria	4444
1207	Ga0501072_0051261	3300049588	Bacteria	3250
1208	Ga0501073_0106192	3300049589	Bacteria	1949
1209	Ga0501075_0060240	3300049591	Bacteria	2860
1210	Ga0501076_0003690	3300049592	Bacteria	10769
1211	Ga0501077_0014989	3300049593	Bacteria	4873
1212	Ga0501217_013429	3300049661	Bacteria	1839
1213	Ga0501225_0003407	3300049705	Bacteria	4824
1214	Ga0501079_0020845	3300049741	Bacteria	5012
1215	Ga0501080_0146023	3300049742	Bacteria	2186
1216	Ga0501262_000459	3300049759	Bacteria	4848
1217	Ga0501044_0009388	3300049823	Bacteria	10659
1218	Ga0501045_0002017	3300049824	Bacteria	13731
1219	nmdc:mga03683_2086_c1	3300050489	Bacteria	6141
1220	nmdc:mga03683_2284_c1	3300050489	Bacteria	5922
1221	nmdc:mga03683_61583_c1	3300050489	Bacteria	1587
1222	nmdc:mga03683_63200_c1	3300050489	Bacteria	1569
1223	nmdc:mga03683_986_c1	3300050489	Bacteria	8300
1224	nmdc:mga03n38_128748_c1	3300050490	Bacteria	1252
1225	nmdc:mga03n38_213179_c1	3300050490	Bacteria	1005
1226	nmdc:mga03n38_32485_c1	3300050490	Bacteria	2212
1227	nmdc:mga03n38_5724_c1	3300050490	Bacteria	4259
1228	nmdc:mga00v17_115324_c1	3300050491	Bacteria	1707
1229	nmdc:mga00v17_2326_c1	3300050491	Bacteria	9735
1230	nmdc:mga00v17_5314_c1	3300050491	Bacteria	6783
1231	nmdc:mga0k408_10561_c1	3300050493	Bacteria	4999
1232	nmdc:mga0k408_107565_c1	3300050493	Bacteria	1647
1233	nmdc:mga0k408_12401_c1	3300050493	Bacteria	4658
1234	nmdc:mga0k408_16255_c1	3300050493	Bacteria	4126
1235	nmdc:mga0k408_16868_c1	3300050493	Bacteria	4060
1236	nmdc:mga0k408_249069_c1	3300050493	Bacteria	1061
1237	nmdc:mga0k408_25466_c1	3300050493	Bacteria	3351
1238	nmdc:mga0k408_2622_c1	3300050493	Bacteria	9558
1239	nmdc:mga0k408_4590_c1	3300050493	Bacteria	7327
1240	nmdc:mga0k408_838_c1	3300050493	Bacteria	10969
1241	nmdc:mga06z11_153444_c1	3300050494	Bacteria	1311
1242	nmdc:mga06z11_18075_c1	3300050494	Bacteria	3213
1243	nmdc:mga06z11_1988_c1	3300050494	Bacteria	7733
1244	nmdc:mga06z11_21345_c1	3300050494	Bacteria	3008
1245	nmdc:mga06z11_63742_c1	3300050494	Bacteria	1929
1246	nmdc:mga06z11_6819_c1	3300050494	Bacteria	4669
1247	nmdc:mga04h51_3929_c1	3300050495	Bacteria	3657
1248	nmdc:mga07m45_1016_c1	3300050496	Bacteria	12398
1249	nmdc:mga07m45_103_c1	3300050496	Bacteria	33229
1250	nmdc:mga07m45_131_c1	3300050496	Bacteria	29571
1251	nmdc:mga07m45_16917_c1	3300050496	Bacteria	3909
1252	nmdc:mga07m45_308_c1	3300050496	Bacteria	19736
1253	nmdc:mga07m45_34042_c1	3300050496	Bacteria	2831
1254	nmdc:mga07m45_46102_c1	3300050496	Bacteria	2448
1255	nmdc:mga07m45_7090_c1	3300050496	Bacteria	5707
1256	nmdc:mga05p37_13917_c1	3300050507	Bacteria	9642
1257	nmdc:mga09592_12256_c1	3300050508	Bacteria	6325
1258	nmdc:mga0qj67_173811_c1	3300050509	Bacteria	1749
1259	nmdc:mga06r32_107170_c1	3300050510	Bacteria	2746
1260	nmdc:mga06r32_128917_c1	3300050510	Bacteria	2499
1261	nmdc:mga08y16_22407_c1	3300050511	Bacteria	6668
1262	nmdc:mga0n895_2134_c1	3300050512	Bacteria	15278
1263	nmdc:mga0rr50_5124_c1	3300050513	Bacteria	7780
1264	nmdc:mga0a205_11905_c1	3300050515	Bacteria	8030
1265	nmdc:mga0sz30_107646_c1	3300050516	Bacteria	1220
1266	Ga0495601_0008331	3300053077	Bacteria	6121
1267	Ga0500610_0001519	3300053079	Bacteria	7965
1268	Ga0500610_0002412	3300053079	Bacteria	6875
1269	Ga0500610_0045703	3300053079	Bacteria	2272
1270	Ga0500635_0000035	3300053080	Bacteria	94938
1271	Ga0495619_0078959	3300053085	Bacteria	2213
1272	Ga0495619_0143497	3300053085	Bacteria	1645
1273	Ga0495619_0176921	3300053085	Bacteria	1476
1274	Ga0500578_0000057	3300053086	Bacteria	120178
1275	Ga0500646_0000677	3300053090	Bacteria	9751
1276	Ga0500647_0110655	3300053091	Bacteria	1306
1277	Ga0500651_0000133	3300053093	Bacteria	46244
1278	Ga0500651_0040039	3300053093	Bacteria	2951
1279	Ga0500651_0212236	3300053093	Bacteria	1138
1280	Ga0500569_001196	3300053109	Bacteria	4817
1281	Ga0500571_000153	3300053110	Bacteria	23909
1282	Ga0500593_000449	3300053117	Bacteria	16281
1283	Ga0500593_004327	3300053117	Bacteria	5490
1284	Ga0500594_0000823	3300053118	Bacteria	6610
1285	Ga0500607_094451	3300053121	Bacteria	1498
1286	Ga0500608_016018	3300053122	Bacteria	3379
1287	Ga0500617_141822	3300053124	Bacteria	963
1288	Ga0500621_132426	3300053126	Bacteria	954
1289	Ga0500626_008205	3300053128	Bacteria	4287
1290	Ga0500642_0012877	3300053130	Bacteria	3051
1291	Ga0500652_000112	3300053131	Bacteria	31738
1292	Ga0500652_095153	3300053131	Bacteria	1244
1293	Ga0500655_002556	3300053133	Bacteria	3304
1294	Ga0500658_0000124	3300053134	Bacteria	36729
1295	Ga0500658_0000342	3300053134	Bacteria	20710
1296	Ga0500658_0001793	3300053134	Bacteria	8476
1297	Ga0500658_0002441	3300053134	Bacteria	7191
1298	Ga0500559_0000027	3300053136	Bacteria	118758
1299	Ga0500561_0000758	3300053137	Bacteria	5100
1300	Ga0500568_0001367	3300053139	Bacteria	15853
1301	Ga0500573_0141595	3300053140	Bacteria	1324
1302	Ga0500574_044027	3300053141	Bacteria	1255
1303	Ga0500588_0002567	3300053146	Bacteria	3722
1304	Ga0500600_0009202	3300053149	Bacteria	5958
1305	Ga0500616_0006426	3300053153	Bacteria	7697
1306	Ga0500616_0101260	3300053153	Bacteria	1407
1307	Ga0500622_0000187	3300053156	Bacteria	65366
1308	Ga0500622_0018677	3300053156	Bacteria	3684
1309	Ga0500627_0000606	3300053158	Bacteria	9577
1310	Ga0500633_0098163	3300053160	Bacteria	1076
1311	Ga0500634_0001113	3300053161	Bacteria	9973
1312	Ga0500634_0025886	3300053161	Bacteria	3193
1313	Ga0500636_0010811	3300053177	Bacteria	5334
1314	Ga0587084_000297	3300059477	Bacteria	3611
1315	Ga0587093_013104	3300059478	Bacteria	1016
1316	Ga0587070_000447	3300059491	Bacteria	3401
1317	Ga0587077_000158	3300059493	Bacteria	4484
1318	Ga0587077_003034	3300059493	Bacteria	2072
1319	Ga0587083_0000234	3300059505	Bacteria	4227
1320	Ga0587083_0000943	3300059505	Bacteria	2998
1321	Ga0587083_0011458	3300059505	Bacteria	1464
1322	Ga0587085_000466	3300059506	Bacteria	3004
1323	Ga0587088_018093	3300059508	Bacteria	1143
1324	Ga0587090_000183	3300059510	Bacteria	4415
1325	Ga0587091_000456	3300059511	Bacteria	3506
1326	Ga0587091_016961	3300059511	Bacteria	1220
1327	Ga0587092_000527	3300059512	Bacteria	3123
1328	Ga0587092_009834	3300059512	Bacteria	1293
1329	Ga0587092_011086	3300059512	Bacteria	1246
1330	Ga0587106_003751	3300059605	Bacteria	1621
1331	Ga0587101_000394	3300059623	Bacteria	3008
1332	Ga0587101_001108	3300059623	Bacteria	2210
1333	Ga0587101_008156	3300059623	Bacteria	1257
1334	Ga0587128_012470	3300059630	Bacteria	1181
1335	Ga0587128_020880	3300059630	Bacteria	1005
1336	Ga0587062_000340	3300059639	Bacteria	3104
1337	Ga0587068_000926	3300059641	Bacteria	3045
1338	Ga0587068_002162	3300059641	Bacteria	2350
1339	Ga0587069_000750	3300059642	Bacteria	2657
1340	Ga0587069_001296	3300059642	Bacteria	2251
1341	Ga0587076_000484	3300059645	Bacteria	3271
1342	Ga0587076_001845	3300059645	Bacteria	2257
1343	Ga0587076_026177	3300059645	Bacteria	1003
1344	Ga0587076_032277	3300059645	Bacteria	935
1345	Ga0587078_000307	3300059646	Bacteria	3448
1346	Ga0587079_002858	3300059647	Bacteria	2183
1347	Ga0587100_002107	3300059648	Bacteria	1245
1348	Ga0587102_000521	3300059649	Bacteria	2240
1349	Ga0587124_000224	3300059660	Bacteria	2755
1350	Ga0587071_000866	3300060344	Bacteria	3443
1351	Ga0587071_018214	3300060344	Bacteria	1260
1352	Ga0587111_0000401	3300060346	Bacteria	4017
1353	Ga0587111_0000679	3300060346	Bacteria	3504
1354	Ga0587111_0008702	3300060346	Bacteria	1691
1355	Ga0466962_0000165	3300061719	Bacteria	28145
1356	Ga0466962_0000695	3300061719	Bacteria	14986
1357	Ga0530510_0004113	3300061734	Bacteria	10043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046499	Ga0495594_0427179	Ga0495594_0427179_13_702	229
2	3300048913	Ga0496110_0910211	Ga0496110_0910211_11_700	229
3	3300037466	Ga0395898_0258266	Ga0395898_0258266_922_1644	240
4	3300045836	Ga0466958_0008025	Ga0466958_0008025_4690_5430	246
5	3300046514	Ga0495618_0158472	Ga0495618_0158472_685_1434	246
6	3300046519	Ga0495632_0130831	Ga0495632_0130831_18_767	246
7	3300047319	Ga0495674_0497499	Ga0495674_0497499_208_963	247
8	iso_pu_bacteria	2837268691	2837272626	247
9	3300041410	Ga0439461_0015325	Ga0439461_0015325_133_903	248
10	3300042156	Ga0439446_0005479	Ga0439446_0005479_230_1000	248
11	3300042435	Ga0439434_0016350	Ga0439434_0016350_974_1744	248
12	iso_pu_bacteria	2588253510	2588290155	248
13	3300005327	Ga0070658_10149776	Ga0070658_101497762	249
14	3300005339	Ga0070660_100305948	Ga0070660_1003059481	249
15	3300005455	Ga0070663_100036980	Ga0070663_1000369803	249
16	3300005564	Ga0070664_100099612	Ga0070664_1000996124	249
17	3300005985	Ga0081539_10015199	Ga0081539_100151996	249
18	3300025919	Ga0207657_10082363	Ga0207657_100823632	249
19	3300025932	Ga0207690_10231631	Ga0207690_102316312	249
20	3300025945	Ga0207679_10043399	Ga0207679_100433993	249
21	3300042439	Ga0439464_0013935	Ga0439464_0013935_522_1295	249
22	3300059645	Ga0587076_026177	Ga0587076_026177_110_880	249
23	3300005434	Ga0070709_10438319	Ga0070709_104383191	250
24	3300033179	Ga0307507_10000005	Ga0307507_10000005167	250
25	3300041413	Ga0439465_0058922	Ga0439465_0058922_211_987	250
26	3300046516	Ga0495628_0042864	Ga0495628_0042864_1327_2148	250
27	3300049582	Ga0501048_0294297	Ga0501048_0294297_13_777	250
28	iso_pu_bacteria	2818991318	2819425720	250
29	iso_pu_bacteria	8054609563	8054614103	250
30	3300005435	Ga0070714_100300008	Ga0070714_1003000082	251
31	3300009545	Ga0105237_10046995	Ga0105237_100469954	251
32	3300025914	Ga0207671_10124064	Ga0207671_101240642	251
33	3300025929	Ga0207664_10029721	Ga0207664_100297214	251
34	3300044658	Ga0466972_0032869	Ga0466972_0032869_600_1394	251
35	3300005327	Ga0070658_10062389	Ga0070658_100623892	252
36	3300006353	Ga0075370_10166997	Ga0075370_101669971	252
37	3300009093	Ga0105240_10006401	Ga0105240_100064017	252
38	3300009545	Ga0105237_10005095	Ga0105237_100050958	252
39	3300009545	Ga0105237_10013267	Ga0105237_100132673	252
40	3300009551	Ga0105238_10006773	Ga0105238_100067737	252
41	3300009551	Ga0105238_10014551	Ga0105238_100145517	252
42	3300010375	Ga0105239_10000486	Ga0105239_1000048642	252
43	3300010375	Ga0105239_10008053	Ga0105239_100080537	252
44	3300014968	Ga0157379_10349758	Ga0157379_103497581	252
45	3300025256	Ga0209759_1013544	Ga0209759_10135442	252
46	3300025904	Ga0207647_10120599	Ga0207647_101205992	252
47	3300025913	Ga0207695_10008242	Ga0207695_100082427	252
48	3300025913	Ga0207695_10026334	Ga0207695_100263342	252
49	3300025914	Ga0207671_10000138	Ga0207671_1000013830	252
50	3300025924	Ga0207694_10002834	Ga0207694_1000283411	252
51	3300031616	Ga0307508_10004974	Ga0307508_1000497412	252
52	3300034817	Ga0373948_0015061	Ga0373948_0015061_314_1084	252
53	3300035083	Ga0373926_0023606	Ga0373926_0023606_668_1438	252
54	3300035086	Ga0373934_0004886	Ga0373934_0004886_2646_3416	252
55	3300035112	Ga0373932_0075603	Ga0373932_0075603_270_1037	252
56	3300035114	Ga0373939_0000028	Ga0373939_0000028_2602_3372	252
57	3300035121	Ga0373960_0000179	Ga0373960_0000179_10307_11077	252
58	3300035242	Ga0373962_0026455	Ga0373962_0026455_446_1216	252
59	3300035691	Ga0373931_0000156	Ga0373931_0000156_3712_4482	252
60	3300037068	Ga0373925_0004860	Ga0373925_0004860_5762_6532	252
61	3300041458	Ga0451798_0166294	Ga0451798_0166294_165_932	252
62	3300042125	Ga0450923_003778	Ga0450923_003778_1283_2050	252
63	3300042531	Ga0450918_000247	Ga0450918_000247_4040_4807	252
64	3300046454	Ga0495592_0000140	Ga0495592_0000140_49563_50330	252
65	3300046507	Ga0495606_0129628	Ga0495606_0129628_13_783	252
66	3300046530	Ga0495654_0182106	Ga0495654_0182106_100_867	252
67	3300046536	Ga0495587_0288050	Ga0495587_0288050_142_909	252
68	3300046660	Ga0495625_0025185	Ga0495625_0025185_634_1401	252
69	3300046680	Ga0495646_0058726	Ga0495646_0058726_1272_2039	252
70	3300046692	Ga0495671_0011372	Ga0495671_0011372_894_1661	252
71	3300047317	Ga0495604_0081842	Ga0495604_0081842_986_1774	252
72	3300047470	Ga0495681_0062393	Ga0495681_0062393_99_866	252
73	3300048090	Ga0495615_0046314	Ga0495615_0046314_313_1080	252
74	3300050490	nmdc:mga03n38_128748_c1	nmdc:mga03n38_128748_c1_14_781	252
75	3300050493	nmdc:mga0k408_16868_c1	nmdc:mga0k408_16868_c1_2013_2783	252
76	3300050493	nmdc:mga0k408_25466_c1	nmdc:mga0k408_25466_c1_1907_2674	252
77	3300050496	nmdc:mga07m45_46102_c1	nmdc:mga07m45_46102_c1_826_1593	252
78	3300053079	Ga0500610_0001519	Ga0500610_0001519_4269_5036	252
79	3300053080	Ga0500635_0000035	Ga0500635_0000035_61475_62245	252
80	3300053117	Ga0500593_004327	Ga0500593_004327_3252_4019	252
81	3300053130	Ga0500642_0012877	Ga0500642_0012877_10_777	252
82	3300053133	Ga0500655_002556	Ga0500655_002556_2450_3217	252
83	3300053158	Ga0500627_0000606	Ga0500627_0000606_5600_6367	252
84	3300053161	Ga0500634_0025886	Ga0500634_0025886_15_782	252
85	iso_pu_bacteria	2877676314	2877682886	252
86	3300003322	rootL2_10047291	rootL2_100472915	253
87	3300025915	Ga0207693_10135704	Ga0207693_101357042	253
88	3300028786	Ga0307517_10003786	Ga0307517_1000378614	253
89	3300030521	Ga0307511_10101380	Ga0307511_101013802	253
90	3300031507	Ga0307509_10040571	Ga0307509_100405714	253
91	3300031649	Ga0307514_10093417	Ga0307514_100934172	253
92	3300031730	Ga0307516_10063771	Ga0307516_100637713	253
93	3300032126	Ga0307415_100511769	Ga0307415_1005117691	253
94	3300037312	Ga0395899_0000005	Ga0395899_0000005_565020_565781	253
95	3300037418	Ga0395900_0000003	Ga0395900_0000003_207186_207947	253
96	3300037418	Ga0395900_0028299	Ga0395900_0028299_1402_2163	253
97	3300037418	Ga0395900_0034058	Ga0395900_0034058_3318_4079	253
98	3300037466	Ga0395898_0000003	Ga0395898_0000003_565040_565801	253
99	3300037466	Ga0395898_0028977	Ga0395898_0028977_1318_2079	253
100	3300038443	Ga0395901_0000026	Ga0395901_0000026_39180_39941	253
101	3300038443	Ga0395901_0000040	Ga0395901_0000040_171283_172044	253
102	3300038443	Ga0395901_0008865	Ga0395901_0008865_8670_9431	253
103	3300042007	Ga0439449_0064647	Ga0439449_0064647_112_894	253
104	3300044694	Ga0466963_0093770	Ga0466963_0093770_1100_1903	253
105	3300045836	Ga0466958_0263564	Ga0466958_0263564_18_779	253
106	3300046522	Ga0495643_0006396	Ga0495643_0006396_3830_4624	253
107	3300046543	Ga0495645_0108866	Ga0495645_0108866_1069_1902	253
108	3300046557	Ga0495622_0069093	Ga0495622_0069093_734_1528	253
109	3300046680	Ga0495646_0127848	Ga0495646_0127848_47_853	253
110	3300046691	Ga0495670_0008283	Ga0495670_0008283_3171_3944	253
111	3300046810	Ga0495660_0005128	Ga0495660_0005128_3856_4629	253
112	3300047315	Ga0495581_0081845	Ga0495581_0081845_193_987	253
113	3300047319	Ga0495674_0095821	Ga0495674_0095821_1110_1943	253
114	3300047443	Ga0495687_005728	Ga0495687_005728_4058_4852	253
115	3300047447	Ga0495685_000794	Ga0495685_000794_4709_5503	253
116	3300053085	Ga0495619_0078959	Ga0495619_0078959_364_1137	253
117	3300053085	Ga0495619_0176921	Ga0495619_0176921_83_877	253
118	3300053134	Ga0500658_0002441	Ga0500658_0002441_4505_5299	253
119	3300053137	Ga0500561_0000758	Ga0500561_0000758_641_1414	253
120	3300053149	Ga0500600_0009202	Ga0500600_0009202_4534_5328	253
121	3300053153	Ga0500616_0006426	Ga0500616_0006426_2270_3043	253
122	3300009098	Ga0105245_10404961	Ga0105245_104049612	254
123	3300013296	Ga0157374_10274549	Ga0157374_102745492	254
124	3300013306	Ga0163162_10690579	Ga0163162_106905792	254
125	3300014326	Ga0157380_10269450	Ga0157380_102694501	254
126	3300025927	Ga0207687_10181400	Ga0207687_101814002	254
127	3300025934	Ga0207686_10332868	Ga0207686_103328682	254
128	3300026095	Ga0207676_10797808	Ga0207676_107978081	254
129	3300026121	Ga0207683_10021280	Ga0207683_100212802	254
130	3300028379	Ga0268266_10175924	Ga0268266_101759242	254
131	3300031730	Ga0307516_10373747	Ga0307516_103737472	254
132	3300037418	Ga0395900_0040475	Ga0395900_0040475_3751_4578	254
133	3300037466	Ga0395898_0031402	Ga0395898_0031402_2571_3398	254
134	3300037471	Ga0395905_0024495	Ga0395905_0024495_1675_2502	254
135	3300038443	Ga0395901_0020542	Ga0395901_0020542_4657_5484	254
136	3300041451	Ga0451791_0508084	Ga0451791_0508084_113_922	254
137	3300041452	Ga0451793_0297079	Ga0451793_0297079_860_1669	254
138	3300041453	Ga0451797_0989451	Ga0451797_0989451_537_1346	254
139	3300041512	Ga0451853_1134849	Ga0451853_1134849_425_1234	254
140	3300046531	Ga0495665_0022250	Ga0495665_0022250_2305_3141	254
141	3300048905	Ga0496102_0271645	Ga0496102_0271645_229_1038	254
142	3300048907	Ga0496104_0004737	Ga0496104_0004737_8647_9456	254
143	3300048908	Ga0496105_0002430	Ga0496105_0002430_8774_9583	254
144	3300048911	Ga0496108_0002610	Ga0496108_0002610_4930_5739	254
145	3300048911	Ga0496108_0121156	Ga0496108_0121156_256_1065	254
146	3300048912	Ga0496109_0004160	Ga0496109_0004160_7174_7983	254
147	3300048913	Ga0496110_0001347	Ga0496110_0001347_12564_13373	254
148	3300048914	Ga0496111_0000440	Ga0496111_0000440_3989_4798	254
149	3300048916	Ga0496113_0021420	Ga0496113_0021420_1506_2315	254
150	3300048917	Ga0496114_0174461	Ga0496114_0174461_61_870	254
151	3300048917	Ga0496114_0194976	Ga0496114_0194976_180_989	254
152	3300048917	Ga0496114_0517327	Ga0496114_0517327_230_1039	254
153	3300009011	Ga0105251_10000313	Ga0105251_1000031325	255
154	3300013105	Ga0157369_10051469	Ga0157369_100514693	255
155	3300015262	Ga0182007_10000614	Ga0182007_100006144	255
156	3300026075	Ga0207708_10045287	Ga0207708_100452873	255
157	3300031730	Ga0307516_10024759	Ga0307516_100247595	255
158	3300046454	Ga0495592_0001857	Ga0495592_0001857_2603_3370	255
159	3300046454	Ga0495592_0024693	Ga0495592_0024693_28_795	255
160	3300046455	Ga0495603_0012253	Ga0495603_0012253_3965_4732	255
161	3300046458	Ga0495591_002071	Ga0495591_002071_3705_4472	255
162	3300046459	Ga0495629_0000058	Ga0495629_0000058_34744_35511	255
163	3300046462	Ga0495651_0010993	Ga0495651_0010993_2769_3536	255
164	3300046463	Ga0495653_0000360	Ga0495653_0000360_6128_6895	255
165	3300046463	Ga0495653_0019693	Ga0495653_0019693_3865_4632	255
166	3300046463	Ga0495653_0042784	Ga0495653_0042784_1630_2397	255
167	3300046472	Ga0495580_0000476	Ga0495580_0000476_1909_2676	255
168	3300046472	Ga0495580_0001762	Ga0495580_0001762_9090_9857	255
169	3300046472	Ga0495580_0002280	Ga0495580_0002280_7324_8091	255
170	3300046472	Ga0495580_0003418	Ga0495580_0003418_4838_5605	255
171	3300046472	Ga0495580_0401159	Ga0495580_0401159_141_908	255
172	3300046473	Ga0495582_0010660	Ga0495582_0010660_2208_2975	255
173	3300046473	Ga0495582_0129989	Ga0495582_0129989_136_903	255
174	3300046476	Ga0495662_0014551	Ga0495662_0014551_1174_1941	255
175	3300046476	Ga0495662_0047606	Ga0495662_0047606_1225_1992	255
176	3300046477	Ga0495664_0002563	Ga0495664_0002563_1248_2015	255
177	3300046499	Ga0495594_0119044	Ga0495594_0119044_46_813	255
178	3300046500	Ga0495596_0013745	Ga0495596_0013745_1292_2059	255
179	3300046507	Ga0495606_0090024	Ga0495606_0090024_621_1388	255
180	3300046511	Ga0495608_0001236	Ga0495608_0001236_2663_3430	255
181	3300046514	Ga0495618_0005681	Ga0495618_0005681_4105_4872	255
182	3300046514	Ga0495618_0008585	Ga0495618_0008585_2623_3390	255
183	3300046516	Ga0495628_0007390	Ga0495628_0007390_2196_2963	255
184	3300046516	Ga0495628_0081904	Ga0495628_0081904_898_1665	255
185	3300046516	Ga0495628_0180176	Ga0495628_0180176_443_1210	255
186	3300046517	Ga0495630_0010652	Ga0495630_0010652_3837_4604	255
187	3300046517	Ga0495630_0011063	Ga0495630_0011063_1834_2601	255
188	3300046517	Ga0495630_0062843	Ga0495630_0062843_53_820	255
189	3300046524	Ga0495648_0042271	Ga0495648_0042271_613_1380	255
190	3300046524	Ga0495648_0110454	Ga0495648_0110454_181_948	255
191	3300046526	Ga0495666_0001339	Ga0495666_0001339_5714_6481	255
192	3300046526	Ga0495666_0003612	Ga0495666_0003612_1414_2181	255
193	3300046529	Ga0495652_0023197	Ga0495652_0023197_898_1665	255
194	3300046529	Ga0495652_0065868	Ga0495652_0065868_1960_2727	255
195	3300046529	Ga0495652_0096084	Ga0495652_0096084_842_1609	255
196	3300046531	Ga0495665_0003179	Ga0495665_0003179_6415_7182	255
197	3300046531	Ga0495665_0006306	Ga0495665_0006306_778_1545	255
198	3300046531	Ga0495665_0097262	Ga0495665_0097262_220_987	255
199	3300046533	Ga0495640_0022329	Ga0495640_0022329_2826_3593	255
200	3300046533	Ga0495640_0026439	Ga0495640_0026439_1322_2089	255
201	3300046535	Ga0495586_0025575	Ga0495586_0025575_1535_2302	255
202	3300046535	Ga0495586_0061860	Ga0495586_0061860_310_1077	255
203	3300046536	Ga0495587_0000694	Ga0495587_0000694_7530_8297	255
204	3300046536	Ga0495587_0008334	Ga0495587_0008334_2483_3250	255
205	3300046543	Ga0495645_0003861	Ga0495645_0003861_6549_7316	255
206	3300046543	Ga0495645_0115954	Ga0495645_0115954_955_1722	255
207	3300046559	Ga0495667_0063582	Ga0495667_0063582_1018_1785	255
208	3300046642	Ga0495634_0012084	Ga0495634_0012084_2679_3446	255
209	3300046642	Ga0495634_0042216	Ga0495634_0042216_2284_3051	255
210	3300046648	Ga0495611_0034854	Ga0495611_0034854_1169_1936	255
211	3300046663	Ga0495635_0009483	Ga0495635_0009483_5582_6349	255
212	3300046663	Ga0495635_0034268	Ga0495635_0034268_875_1642	255
213	3300046665	Ga0495661_0016411	Ga0495661_0016411_2809_3576	255
214	3300046665	Ga0495661_0043439	Ga0495661_0043439_970_1737	255
215	3300046675	Ga0495657_0100853	Ga0495657_0100853_1016_1783	255
216	3300046678	Ga0495599_0034813	Ga0495599_0034813_1427_2194	255
217	3300046678	Ga0495599_0050057	Ga0495599_0050057_1436_2203	255
218	3300046678	Ga0495599_0156007	Ga0495599_0156007_336_1103	255
219	3300046679	Ga0495623_0002243	Ga0495623_0002243_4281_5048	255
220	3300046679	Ga0495623_0002671	Ga0495623_0002671_5630_6397	255
221	3300046679	Ga0495623_0163277	Ga0495623_0163277_504_1271	255
222	3300046680	Ga0495646_0014284	Ga0495646_0014284_4142_4909	255
223	3300046680	Ga0495646_0020329	Ga0495646_0020329_833_1600	255
224	3300046680	Ga0495646_0209218	Ga0495646_0209218_52_819	255
225	3300046684	Ga0495669_0036061	Ga0495669_0036061_777_1544	255
226	3300046689	Ga0495613_0004462	Ga0495613_0004462_3682_4449	255
227	3300046689	Ga0495613_0089462	Ga0495613_0089462_336_1103	255
228	3300046690	Ga0495624_0000673	Ga0495624_0000673_22038_22805	255
229	3300046690	Ga0495624_0019701	Ga0495624_0019701_1826_2593	255
230	3300046690	Ga0495624_0060403	Ga0495624_0060403_1026_1793	255
231	3300046794	Ga0495589_0004649	Ga0495589_0004649_5686_6453	255
232	3300046809	Ga0495600_0002476	Ga0495600_0002476_2841_3608	255
233	3300047315	Ga0495581_0002671	Ga0495581_0002671_8706_9473	255
234	3300047315	Ga0495581_0006187	Ga0495581_0006187_1406_2173	255
235	3300047317	Ga0495604_0004557	Ga0495604_0004557_8079_8846	255
236	3300047317	Ga0495604_0007246	Ga0495604_0007246_6991_7758	255
237	3300047317	Ga0495604_0030537	Ga0495604_0030537_1712_2479	255
238	3300047319	Ga0495674_0005761	Ga0495674_0005761_1208_1975	255
239	3300047319	Ga0495674_0029100	Ga0495674_0029100_842_1609	255
240	3300047319	Ga0495674_0077585	Ga0495674_0077585_1128_1895	255
241	3300047319	Ga0495674_0192478	Ga0495674_0192478_19_786	255
242	3300047321	Ga0495676_0002760	Ga0495676_0002760_9318_10085	255
243	3300047321	Ga0495676_0027272	Ga0495676_0027272_1406_2173	255
244	3300047322	Ga0495680_0010660	Ga0495680_0010660_106_873	255
245	3300047322	Ga0495680_0399244	Ga0495680_0399244_29_796	255
246	3300047323	Ga0495683_0014935	Ga0495683_0014935_1172_1939	255
247	3300047444	Ga0495675_0004373	Ga0495675_0004373_2353_3120	255
248	3300047444	Ga0495675_0039701	Ga0495675_0039701_71_838	255
249	3300047446	Ga0495679_000441	Ga0495679_000441_9504_10271	255
250	3300047446	Ga0495679_004662	Ga0495679_004662_44_811	255
251	3300047471	Ga0495684_0025678	Ga0495684_0025678_2517_3284	255
252	3300047673	Ga0495593_0007350	Ga0495593_0007350_1554_2321	255
253	3300048088	Ga0495602_0039918	Ga0495602_0039918_805_1572	255
254	3300048088	Ga0495602_0042914	Ga0495602_0042914_336_1103	255
255	3300048088	Ga0495602_0100407	Ga0495602_0100407_544_1311	255
256	3300048089	Ga0495614_0003846	Ga0495614_0003846_336_1103	255
257	3300048905	Ga0496102_0058121	Ga0496102_0058121_1675_2442	255
258	3300048905	Ga0496102_0382634	Ga0496102_0382634_312_1079	255
259	3300048906	Ga0496103_0011346	Ga0496103_0011346_4133_4900	255
260	3300048920	Ga0496117_0001308	Ga0496117_0001308_29199_29966	255
261	3300048920	Ga0496117_0079019	Ga0496117_0079019_1258_2025	255
262	3300048921	Ga0496118_0000234	Ga0496118_0000234_7306_8073	255
263	3300048921	Ga0496118_0001165	Ga0496118_0001165_3630_4397	255
264	3300048929	Ga0496126_0000319	Ga0496126_0000319_97319_98086	255
265	iso_pu_bacteria	2738541280	2738738896	255
266	iso_pu_bacteria	2738541300	2738844797	255
267	iso_pu_bacteria	2738543018	2739276322	255
268	iso_pu_bacteria	2738543030	2739345154	255
269	3300009176	Ga0105242_10802942	Ga0105242_108029421	256
270	3300028794	Ga0307515_10117083	Ga0307515_101170832	256
271	3300031456	Ga0307513_10020823	Ga0307513_100208232	256
272	3300045976	Ga0466967_0399246	Ga0466967_0399246_30_827	256
273	3300046454	Ga0495592_0000783	Ga0495592_0000783_9567_10370	256
274	3300046462	Ga0495651_0014624	Ga0495651_0014624_4592_5395	256
275	3300046463	Ga0495653_0004293	Ga0495653_0004293_3132_3935	256
276	3300046472	Ga0495580_0006355	Ga0495580_0006355_2685_3488	256
277	3300046476	Ga0495662_0000845	Ga0495662_0000845_9174_9977	256
278	3300046477	Ga0495664_0000639	Ga0495664_0000639_14487_15290	256
279	3300046511	Ga0495608_0002116	Ga0495608_0002116_5217_6020	256
280	3300046516	Ga0495628_0002179	Ga0495628_0002179_5114_5917	256
281	3300046517	Ga0495630_0014955	Ga0495630_0014955_4592_5395	256
282	3300046526	Ga0495666_0002336	Ga0495666_0002336_4766_5569	256
283	3300046529	Ga0495652_0149517	Ga0495652_0149517_673_1455	256
284	3300046531	Ga0495665_0013591	Ga0495665_0013591_1140_1943	256
285	3300046535	Ga0495586_0006695	Ga0495586_0006695_2134_2937	256
286	3300046559	Ga0495667_0004100	Ga0495667_0004100_3532_4335	256
287	3300046642	Ga0495634_0100105	Ga0495634_0100105_787_1569	256
288	3300046679	Ga0495623_0011801	Ga0495623_0011801_265_1068	256
289	3300046680	Ga0495646_0000444	Ga0495646_0000444_18300_19103	256
290	3300046689	Ga0495613_0016684	Ga0495613_0016684_3532_4335	256
291	3300047315	Ga0495581_0003895	Ga0495581_0003895_5367_6170	256
292	3300047317	Ga0495604_0007750	Ga0495604_0007750_673_1476	256
293	3300047319	Ga0495674_0090441	Ga0495674_0090441_1140_1943	256
294	3300047471	Ga0495684_0213262	Ga0495684_0213262_351_1154	256
295	3300047673	Ga0495593_0009592	Ga0495593_0009592_121_924	256
296	3300048905	Ga0496102_0002634	Ga0496102_0002634_2654_3472	256
297	3300048906	Ga0496103_0004898	Ga0496103_0004898_3809_4627	256
298	3300048917	Ga0496114_0073909	Ga0496114_0073909_1925_2743	256
299	3300053077	Ga0495601_0008331	Ga0495601_0008331_800_1603	256
300	3300053140	Ga0500573_0141595	Ga0500573_0141595_81_863	256
301	3300059630	Ga0587128_012470	Ga0587128_012470_257_1075	256
302	3300059642	Ga0587069_000750	Ga0587069_000750_390_1208	256
303	iso_pu_bacteria	2643221609	2644057938	256
304	iso_pu_bacteria	2643221611	2644072973	256
305	iso_pu_bacteria	2738543012	2739242210	256
306	iso_pu_bacteria	2838054893	2838056569	256
307	iso_pu_bacteria	2919704043	2919705063	256
308	3300006048	Ga0075363_100097470	Ga0075363_1000974702	257
309	3300009553	Ga0105249_10164827	Ga0105249_101648272	257
310	3300013297	Ga0157378_10327503	Ga0157378_103275032	257
311	3300027682	Ga0209971_1065471	Ga0209971_10654711	257
312	3300027876	Ga0209974_10000950	Ga0209974_100009505	257
313	3300028794	Ga0307515_10115941	Ga0307515_101159412	257
314	3300031731	Ga0307405_10204400	Ga0307405_102044002	257
315	3300032005	Ga0307411_10148719	Ga0307411_101487192	257
316	3300044684	Ga0466966_0054535	Ga0466966_0054535_680_1537	257
317	3300044719	Ga0466971_0000346	Ga0466971_0000346_14305_15162	257
318	3300044901	Ga0466960_0212505	Ga0466960_0212505_103_924	257
319	3300045049	Ga0466959_0003033	Ga0466959_0003033_6138_6995	257
320	3300045836	Ga0466958_0075646	Ga0466958_0075646_126_950	257
321	3300045976	Ga0466967_0011773	Ga0466967_0011773_3757_4581	257
322	3300048912	Ga0496109_0116118	Ga0496109_0116118_55_912	257
323	3300049589	Ga0501073_0106192	Ga0501073_0106192_88_933	257
324	3300053090	Ga0500646_0000677	Ga0500646_0000677_2630_3475	257
325	3300053124	Ga0500617_141822	Ga0500617_141822_59_904	257
326	3300053146	Ga0500588_0002567	Ga0500588_0002567_1103_1948	257
327	3300053160	Ga0500633_0098163	Ga0500633_0098163_86_931	257
328	3300061719	Ga0466962_0000695	Ga0466962_0000695_12715_13572	257
329	iso_pu_bacteria	2513020051	2513226574	257
330	iso_pu_bacteria	2599185214	2599625821	257
331	iso_pu_bacteria	2599185226	2599675097	257
332	iso_pu_bacteria	2599185227	2599683991	257
333	iso_pu_bacteria	2599185229	2599695406	257
334	iso_pu_bacteria	2643221567	2643851729	257
335	iso_pu_bacteria	2643221624	2644137681	257
336	iso_pu_bacteria	2643221628	2644162886	257
337	iso_pu_bacteria	2643221658	2644329477	257
338	iso_pu_bacteria	2643221672	2644398240	257
339	iso_pu_bacteria	2643221683	2644469296	257
340	iso_pu_bacteria	2675903059	2676482252	257
341	iso_pu_bacteria	2738541277	2738722935	257
342	iso_pu_bacteria	2738541307	2738881362	257
343	iso_pu_bacteria	2738543019	2739283506	257
344	iso_pu_bacteria	2811994882	2812371643	257
345	iso_pu_bacteria	2816332133	2816470173	257
346	iso_pu_bacteria	2818991446	2819596310	257
347	iso_pu_bacteria	2831265667	2831270339	257
348	iso_pu_bacteria	2885198086	2885199822	257
349	iso_pu_bacteria	2885211737	2885213473	257
350	iso_pu_bacteria	2899924645	2899925693	257
351	iso_pu_bacteria	2904449895	2904454746	257
352	iso_pu_bacteria	2904456579	2904460331	257
353	iso_pu_bacteria	2904541872	2904546378	257
354	iso_pu_bacteria	2928037797	2928038207	257
355	iso_pu_bacteria	2928044640	2928046188	257
356	iso_pu_bacteria	2928051484	2928053883	257
357	iso_pu_bacteria	2928064002	2928067432	257
358	iso_pu_bacteria	2928070936	2928076418	257
359	iso_pu_bacteria	2928084124	2928088811	257
360	iso_pu_bacteria	2929160207	2929164189	257
361	iso_pu_bacteria	2929520902	2929524524	257
362	iso_pu_bacteria	2945909444	2945912960	257
363	iso_pu_bacteria	2945945610	2945946936	257
364	iso_pu_bacteria	2945972063	2945976635	257
365	iso_pu_bacteria	2945984333	2945984759	257
366	iso_pu_bacteria	2954767861	2954771700	257
367	3300005334	Ga0068869_100478460	Ga0068869_1004784602	258
368	3300005457	Ga0070662_100080733	Ga0070662_1000807332	258
369	3300005459	Ga0068867_100000977	Ga0068867_1000009773	258
370	3300005459	Ga0068867_100005245	Ga0068867_1000052457	258
371	3300005467	Ga0070706_100000271	Ga0070706_10000027115	258
372	3300005468	Ga0070707_100127632	Ga0070707_1001276322	258
373	3300005468	Ga0070707_100369657	Ga0070707_1003696571	258
374	3300005535	Ga0070684_100087430	Ga0070684_1000874303	258
375	3300005616	Ga0068852_100269820	Ga0068852_1002698202	258
376	3300006038	Ga0075365_10074220	Ga0075365_100742202	258
377	3300006051	Ga0075364_10268296	Ga0075364_102682962	258
378	3300006177	Ga0075362_10005491	Ga0075362_100054914	258
379	3300006178	Ga0075367_10008290	Ga0075367_100082905	258
380	3300006178	Ga0075367_10224884	Ga0075367_102248841	258
381	3300006186	Ga0075369_10003839	Ga0075369_100038394	258
382	3300006195	Ga0075366_10000948	Ga0075366_1000094812	258
383	3300006195	Ga0075366_10060142	Ga0075366_100601422	258
384	3300006353	Ga0075370_10000506	Ga0075370_100005062	258
385	3300006353	Ga0075370_10002994	Ga0075370_100029943	258
386	3300006353	Ga0075370_10009682	Ga0075370_100096822	258
387	3300009148	Ga0105243_10009662	Ga0105243_100096624	258
388	3300009553	Ga0105249_10129092	Ga0105249_101290922	258
389	3300014745	Ga0157377_10000098	Ga0157377_1000009824	258
390	3300025910	Ga0207684_10022867	Ga0207684_100228672	258
391	3300025920	Ga0207649_10110454	Ga0207649_101104541	258
392	3300025922	Ga0207646_10081892	Ga0207646_100818922	258
393	3300025933	Ga0207706_10046814	Ga0207706_100468143	258
394	3300025935	Ga0207709_10003704	Ga0207709_100037046	258
395	3300025942	Ga0207689_10157992	Ga0207689_101579922	258
396	3300026067	Ga0207678_10197841	Ga0207678_101978412	258
397	3300026089	Ga0207648_10000614	Ga0207648_1000061417	258
398	3300026089	Ga0207648_10019266	Ga0207648_100192662	258
399	3300026118	Ga0207675_100099043	Ga0207675_1000990432	258
400	3300026142	Ga0207698_10588534	Ga0207698_105885342	258
401	3300027866	Ga0209813_10011641	Ga0209813_100116412	258
402	3300028794	Ga0307515_10000180	Ga0307515_1000018086	258
403	3300028794	Ga0307515_10001052	Ga0307515_1000105226	258
404	3300031456	Ga0307513_10300039	Ga0307513_103000392	258
405	3300031616	Ga0307508_10065901	Ga0307508_100659012	258
406	3300031730	Ga0307516_10034231	Ga0307516_100342313	258
407	3300037471	Ga0395905_0311176	Ga0395905_0311176_155_940	258
408	3300041999	Ga0439433_0018643	Ga0439433_0018643_68_898	258
409	3300042014	Ga0439457_009405	Ga0439457_009405_37_867	258
410	3300044656	Ga0466969_0009071	Ga0466969_0009071_3082_3867	258
411	3300044683	Ga0466965_0255852	Ga0466965_0255852_24_821	258
412	3300044684	Ga0466966_0105105	Ga0466966_0105105_69_854	258
413	3300044693	Ga0466961_0006616	Ga0466961_0006616_3573_4358	258
414	3300044719	Ga0466971_0148013	Ga0466971_0148013_240_1025	258
415	3300044765	Ga0466970_0110100	Ga0466970_0110100_276_1061	258
416	3300044901	Ga0466960_0068582	Ga0466960_0068582_372_1169	258
417	3300045049	Ga0466959_0077185	Ga0466959_0077185_1489_2274	258
418	3300046457	Ga0495590_0017553	Ga0495590_0017553_1356_2144	258
419	3300046519	Ga0495632_0005702	Ga0495632_0005702_2553_3341	258
420	3300046528	Ga0495642_0200864	Ga0495642_0200864_59_847	258
421	3300046616	Ga0495668_0213923	Ga0495668_0213923_15_803	258
422	3300046660	Ga0495625_0007125	Ga0495625_0007125_979_1767	258
423	3300046694	Ga0495649_0001187	Ga0495649_0001187_13998_14786	258
424	3300046810	Ga0495660_0007860	Ga0495660_0007860_1762_2550	258
425	3300047443	Ga0495687_000863	Ga0495687_000863_6059_6844	258
426	3300047443	Ga0495687_003425	Ga0495687_003425_3751_4539	258
427	3300048917	Ga0496114_0048117	Ga0496114_0048117_709_1554	258
428	3300050489	nmdc:mga03683_986_c1	nmdc:mga03683_986_c1_2242_3045	258
429	3300050490	nmdc:mga03n38_5724_c1	nmdc:mga03n38_5724_c1_1419_2222	258
430	3300050493	nmdc:mga0k408_10561_c1	nmdc:mga0k408_10561_c1_1227_2027	258
431	3300050493	nmdc:mga0k408_107565_c1	nmdc:mga0k408_107565_c1_451_1239	258
432	3300050493	nmdc:mga0k408_4590_c1	nmdc:mga0k408_4590_c1_2026_2829	258
433	3300050493	nmdc:mga0k408_838_c1	nmdc:mga0k408_838_c1_6694_7482	258
434	3300050494	nmdc:mga06z11_153444_c1	nmdc:mga06z11_153444_c1_460_1248	258
435	3300050494	nmdc:mga06z11_18075_c1	nmdc:mga06z11_18075_c1_1403_2242	258
436	3300050494	nmdc:mga06z11_1988_c1	nmdc:mga06z11_1988_c1_2713_3516	258
437	3300050495	nmdc:mga04h51_3929_c1	nmdc:mga04h51_3929_c1_261_1064	258
438	3300050496	nmdc:mga07m45_131_c1	nmdc:mga07m45_131_c1_22427_23215	258
439	3300050496	nmdc:mga07m45_308_c1	nmdc:mga07m45_308_c1_6976_7779	258
440	3300050496	nmdc:mga07m45_7090_c1	nmdc:mga07m45_7090_c1_3469_4257	258
441	3300053134	Ga0500658_0001793	Ga0500658_0001793_4778_5566	258
442	iso_pu_bacteria	2547132374	2548501636	258
443	iso_pu_bacteria	2585428057	2587729393	258
444	iso_pu_bacteria	2643221570	2643865098	258
445	iso_pu_bacteria	2643221592	2643967719	258
446	iso_pu_bacteria	2643221625	2644140541	258
447	iso_pu_bacteria	2643221648	2644273508	258
448	iso_pu_bacteria	2643221652	2644292379	258
449	iso_pu_bacteria	2643221664	2644356466	258
450	iso_pu_bacteria	2643221717	2644645419	258
451	iso_pu_bacteria	2842677519	2842680176	258
452	iso_pu_bacteria	2919462493	2919464124	258
453	iso_pu_bacteria	2990710928	2990710989	258
454	3300002738	JGI25154J39366_1003188	JGI25154J39366_10031883	259
455	3300002987	JGI25159J45721_1009411	JGI25159J45721_10094112	259
456	3300002987	JGI25159J45721_1009466	JGI25159J45721_10094662	259
457	3300003354	JGI25160J50197_1013586	JGI25160J50197_10135863	259
458	3300003373	JGI25407J50210_10001247	JGI25407J50210_100012474	259
459	3300003771	Ga0055526_1021868	Ga0055526_10218682	259
460	3300003775	Ga0055524_1021284	Ga0055524_10212842	259
461	3300003784	Ga0055534_1000343	Ga0055534_100034317	259
462	3300005262	Ga0065165_1051693	Ga0065165_10516931	259
463	3300005328	Ga0070676_10001363	Ga0070676_100013633	259
464	3300005333	Ga0070677_10115952	Ga0070677_101159521	259
465	3300005334	Ga0068869_100105785	Ga0068869_1001057852	259
466	3300005337	Ga0070682_100005801	Ga0070682_1000058017	259
467	3300005338	Ga0068868_100049768	Ga0068868_1000497684	259
468	3300005347	Ga0070668_100153050	Ga0070668_1001530501	259
469	3300005354	Ga0070675_100086136	Ga0070675_1000861362	259
470	3300005356	Ga0070674_100014145	Ga0070674_1000141454	259
471	3300005356	Ga0070674_100068403	Ga0070674_1000684033	259
472	3300005356	Ga0070674_100071417	Ga0070674_1000714172	259
473	3300005364	Ga0070673_100200375	Ga0070673_1002003752	259
474	3300005367	Ga0070667_100015373	Ga0070667_1000153735	259
475	3300005441	Ga0070700_100029085	Ga0070700_1000290854	259
476	3300005455	Ga0070663_100048938	Ga0070663_1000489382	259
477	3300005455	Ga0070663_100224353	Ga0070663_1002243532	259
478	3300005457	Ga0070662_100006889	Ga0070662_1000068892	259
479	3300005457	Ga0070662_100008417	Ga0070662_1000084173	259
480	3300005457	Ga0070662_100171560	Ga0070662_1001715602	259
481	3300005459	Ga0068867_100034907	Ga0068867_1000349073	259
482	3300005459	Ga0068867_100431738	Ga0068867_1004317382	259
483	3300005539	Ga0068853_100068696	Ga0068853_1000686961	259
484	3300005539	Ga0068853_100192723	Ga0068853_1001927232	259
485	3300005543	Ga0070672_100045578	Ga0070672_1000455782	259
486	3300005577	Ga0068857_100099511	Ga0068857_1000995113	259
487	3300005577	Ga0068857_100138930	Ga0068857_1001389303	259
488	3300005615	Ga0070702_100364041	Ga0070702_1003640411	259
489	3300005718	Ga0068866_10017942	Ga0068866_100179422	259
490	3300005719	Ga0068861_100035272	Ga0068861_1000352723	259
491	3300005719	Ga0068861_100206849	Ga0068861_1002068492	259
492	3300005843	Ga0068860_100116443	Ga0068860_1001164432	259
493	3300005844	Ga0068862_100016907	Ga0068862_1000169073	259
494	3300005937	Ga0081455_10003960	Ga0081455_100039608	259
495	3300005937	Ga0081455_10027308	Ga0081455_100273085	259
496	3300005937	Ga0081455_10033348	Ga0081455_100333481	259
497	3300005937	Ga0081455_10088364	Ga0081455_100883642	259
498	3300005981	Ga0081538_10000147	Ga0081538_1000014717	259
499	3300006048	Ga0075363_100035342	Ga0075363_1000353423	259
500	3300006048	Ga0075363_100069490	Ga0075363_1000694902	259
501	3300006058	Ga0075432_10000076	Ga0075432_1000007610	259
502	3300006177	Ga0075362_10003358	Ga0075362_100033582	259
503	3300006177	Ga0075362_10211126	Ga0075362_102111262	259
504	3300006178	Ga0075367_10002438	Ga0075367_100024388	259
505	3300006194	Ga0075427_10009530	Ga0075427_100095302	259
506	3300006195	Ga0075366_10004653	Ga0075366_100046536	259
507	3300006195	Ga0075366_10008559	Ga0075366_100085596	259
508	3300006353	Ga0075370_10006698	Ga0075370_100066985	259
509	3300006353	Ga0075370_10081713	Ga0075370_100817132	259
510	3300006353	Ga0075370_10245292	Ga0075370_102452922	259
511	3300006844	Ga0075428_100003665	Ga0075428_10000366510	259
512	3300006844	Ga0075428_100171690	Ga0075428_1001716902	259
513	3300006846	Ga0075430_100175620	Ga0075430_1001756202	259
514	3300006847	Ga0075431_100020564	Ga0075431_1000205642	259
515	3300006852	Ga0075433_10001214	Ga0075433_1000121410	259
516	3300006871	Ga0075434_100000624	Ga0075434_1000006249	259
517	3300006880	Ga0075429_100013889	Ga0075429_1000138894	259
518	3300006881	Ga0068865_100007809	Ga0068865_1000078098	259
519	3300007076	Ga0075435_100002217	Ga0075435_1000022177	259
520	3300009093	Ga0105240_10594444	Ga0105240_105944442	259
521	3300009094	Ga0111539_10009396	Ga0111539_100093967	259
522	3300009098	Ga0105245_10022614	Ga0105245_100226142	259
523	3300009098	Ga0105245_10078402	Ga0105245_100784022	259
524	3300009098	Ga0105245_10084013	Ga0105245_100840133	259
525	3300009098	Ga0105245_10331301	Ga0105245_103313012	259
526	3300009147	Ga0114129_10010725	Ga0114129_100107257	259
527	3300009176	Ga0105242_10004347	Ga0105242_100043477	259
528	3300009545	Ga0105237_10023570	Ga0105237_100235701	259
529	3300009545	Ga0105237_10137141	Ga0105237_101371412	259
530	3300009553	Ga0105249_10011730	Ga0105249_100117304	259
531	3300009553	Ga0105249_10142295	Ga0105249_101422952	259
532	3300009553	Ga0105249_10951899	Ga0105249_109518991	259
533	3300011119	Ga0105246_10155428	Ga0105246_101554282	259
534	3300012487	Ga0157321_1000281	Ga0157321_10002812	259
535	3300013102	Ga0157371_10076413	Ga0157371_100764132	259
536	3300013296	Ga0157374_10584958	Ga0157374_105849582	259
537	3300013297	Ga0157378_10012748	Ga0157378_100127482	259
538	3300013306	Ga0163162_10009563	Ga0163162_100095639	259
539	3300013306	Ga0163162_10403452	Ga0163162_104034522	259
540	3300013307	Ga0157372_10008088	Ga0157372_100080887	259
541	3300013308	Ga0157375_10009170	Ga0157375_100091703	259
542	3300013308	Ga0157375_10208032	Ga0157375_102080322	259
543	3300013308	Ga0157375_10320844	Ga0157375_103208442	259
544	3300014325	Ga0163163_10265341	Ga0163163_102653411	259
545	3300014326	Ga0157380_10009130	Ga0157380_100091309	259
546	3300014326	Ga0157380_10036997	Ga0157380_100369973	259
547	3300014326	Ga0157380_10294785	Ga0157380_102947852	259
548	3300014968	Ga0157379_10107820	Ga0157379_101078203	259
549	3300014969	Ga0157376_10245887	Ga0157376_102458872	259
550	3300017792	Ga0163161_10028182	Ga0163161_100281823	259
551	3300017792	Ga0163161_10101704	Ga0163161_101017042	259
552	3300020080	Ga0206350_10433884	Ga0206350_104338841	259
553	3300025246	Ga0209646_1000010	Ga0209646_1000010447	259
554	3300025273	Ga0209673_1000701	Ga0209673_10007016	259
555	3300025273	Ga0209673_1001758	Ga0209673_10017583	259
556	3300025284	Ga0209130_1002114	Ga0209130_10021147	259
557	3300025284	Ga0209130_1003858	Ga0209130_10038586	259
558	3300025291	Ga0209675_1000765	Ga0209675_10007657	259
559	3300025291	Ga0209675_1001622	Ga0209675_10016227	259
560	3300025291	Ga0209675_1020213	Ga0209675_10202131	259
561	3300025292	Ga0209676_1003444	Ga0209676_10034443	259
562	3300025295	Ga0209564_1000292	Ga0209564_100029237	259
563	3300025297	Ga0209758_1023531	Ga0209758_10235313	259
564	3300025298	Ga0209050_1016212	Ga0209050_10162122	259
565	3300025299	Ga0209256_1000038	Ga0209256_100003842	259
566	3300025302	Ga0207426_1000176	Ga0207426_10001769	259
567	3300025303	Ga0209051_1015265	Ga0209051_10152652	259
568	3300025304	Ga0209257_1007030	Ga0209257_10070302	259
569	3300025899	Ga0207642_10097923	Ga0207642_100979231	259
570	3300025907	Ga0207645_10001218	Ga0207645_1000121816	259
571	3300025913	Ga0207695_10034076	Ga0207695_100340765	259
572	3300025914	Ga0207671_10036946	Ga0207671_100369463	259
573	3300025914	Ga0207671_10087775	Ga0207671_100877752	259
574	3300025923	Ga0207681_10433107	Ga0207681_104331071	259
575	3300025924	Ga0207694_10264131	Ga0207694_102641311	259
576	3300025927	Ga0207687_10089586	Ga0207687_100895862	259
577	3300025927	Ga0207687_10495156	Ga0207687_104951562	259
578	3300025931	Ga0207644_10219288	Ga0207644_102192882	259
579	3300025932	Ga0207690_10029814	Ga0207690_100298142	259
580	3300025933	Ga0207706_10004998	Ga0207706_100049982	259
581	3300025933	Ga0207706_10005166	Ga0207706_100051669	259
582	3300025933	Ga0207706_10020349	Ga0207706_100203492	259
583	3300025937	Ga0207669_10010966	Ga0207669_100109664	259
584	3300025937	Ga0207669_10106743	Ga0207669_101067431	259
585	3300025938	Ga0207704_10068833	Ga0207704_100688331	259
586	3300025940	Ga0207691_10210843	Ga0207691_102108431	259
587	3300025942	Ga0207689_10008711	Ga0207689_100087116	259
588	3300025960	Ga0207651_10257487	Ga0207651_102574872	259
589	3300025960	Ga0207651_10369860	Ga0207651_103698602	259
590	3300025961	Ga0207712_10171473	Ga0207712_101714732	259
591	3300025972	Ga0207668_10006033	Ga0207668_100060337	259
592	3300025972	Ga0207668_10100610	Ga0207668_101006102	259
593	3300025986	Ga0207658_10010356	Ga0207658_100103565	259
594	3300025986	Ga0207658_10060391	Ga0207658_100603912	259
595	3300026023	Ga0207677_10064696	Ga0207677_100646962	259
596	3300026041	Ga0207639_10009566	Ga0207639_100095665	259
597	3300026041	Ga0207639_10242193	Ga0207639_102421932	259
598	3300026067	Ga0207678_10183442	Ga0207678_101834422	259
599	3300026067	Ga0207678_10393760	Ga0207678_103937602	259
600	3300026075	Ga0207708_10402387	Ga0207708_104023872	259
601	3300026089	Ga0207648_10001597	Ga0207648_1000159726	259
602	3300026089	Ga0207648_10005261	Ga0207648_1000526111	259
603	3300026089	Ga0207648_10019717	Ga0207648_100197173	259
604	3300026116	Ga0207674_10059264	Ga0207674_100592643	259
605	3300026118	Ga0207675_100004236	Ga0207675_10000423611	259
606	3300026118	Ga0207675_100023749	Ga0207675_1000237493	259
607	3300026121	Ga0207683_10019535	Ga0207683_100195356	259
608	3300026121	Ga0207683_10118428	Ga0207683_101184282	259
609	3300026121	Ga0207683_10719162	Ga0207683_107191621	259
610	3300027907	Ga0207428_10000246	Ga0207428_1000024647	259
611	3300028379	Ga0268266_10008775	Ga0268266_100087754	259
612	3300028380	Ga0268265_10031147	Ga0268265_100311474	259
613	3300028381	Ga0268264_10013578	Ga0268264_100135784	259
614	3300028786	Ga0307517_10000918	Ga0307517_100009184	259
615	3300028786	Ga0307517_10042428	Ga0307517_100424283	259
616	3300028794	Ga0307515_10001755	Ga0307515_100017559	259
617	3300028794	Ga0307515_10019603	Ga0307515_100196031	259
618	3300028794	Ga0307515_10047411	Ga0307515_100474112	259
619	3300028794	Ga0307515_10127404	Ga0307515_101274042	259
620	3300031456	Ga0307513_10043585	Ga0307513_100435853	259
621	3300031507	Ga0307509_10000509	Ga0307509_1000050933	259
622	3300031507	Ga0307509_10011291	Ga0307509_100112917	259
623	3300031507	Ga0307509_10017545	Ga0307509_100175457	259
624	3300031507	Ga0307509_10101898	Ga0307509_101018983	259
625	3300031548	Ga0307408_100004560	Ga0307408_1000045602	259
626	3300031548	Ga0307408_100076701	Ga0307408_1000767012	259
627	3300031548	Ga0307408_100139523	Ga0307408_1001395232	259
628	3300031548	Ga0307408_100174744	Ga0307408_1001747442	259
629	3300031616	Ga0307508_10000099	Ga0307508_1000009934	259
630	3300031649	Ga0307514_10001936	Ga0307514_1000193617	259
631	3300031730	Ga0307516_10000488	Ga0307516_1000048818	259
632	3300031730	Ga0307516_10000973	Ga0307516_1000097321	259
633	3300031730	Ga0307516_10008370	Ga0307516_100083705	259
634	3300031730	Ga0307516_10080742	Ga0307516_100807423	259
635	3300031824	Ga0307413_10036519	Ga0307413_100365193	259
636	3300031852	Ga0307410_10002643	Ga0307410_100026438	259
637	3300031852	Ga0307410_10013076	Ga0307410_100130763	259
638	3300031852	Ga0307410_10019209	Ga0307410_100192094	259
639	3300031852	Ga0307410_10173901	Ga0307410_101739012	259
640	3300031901	Ga0307406_10000033	Ga0307406_1000003353	259
641	3300031901	Ga0307406_10022465	Ga0307406_100224654	259
642	3300031901	Ga0307406_10180947	Ga0307406_101809472	259
643	3300031903	Ga0307407_10010285	Ga0307407_100102854	259
644	3300031903	Ga0307407_10017100	Ga0307407_100171004	259
645	3300031911	Ga0307412_10040320	Ga0307412_100403203	259
646	3300031911	Ga0307412_10331746	Ga0307412_103317462	259
647	3300031995	Ga0307409_100000041	Ga0307409_10000004115	259
648	3300031995	Ga0307409_100004833	Ga0307409_1000048334	259
649	3300031995	Ga0307409_100020526	Ga0307409_1000205264	259
650	3300032002	Ga0307416_100030465	Ga0307416_1000304652	259
651	3300032002	Ga0307416_100033456	Ga0307416_1000334561	259
652	3300032002	Ga0307416_100054803	Ga0307416_1000548033	259
653	3300032002	Ga0307416_100195739	Ga0307416_1001957392	259
654	3300032004	Ga0307414_10015378	Ga0307414_100153783	259
655	3300032004	Ga0307414_10019902	Ga0307414_100199023	259
656	3300032005	Ga0307411_10008910	Ga0307411_100089102	259
657	3300032005	Ga0307411_10012072	Ga0307411_100120724	259
658	3300032005	Ga0307411_10024459	Ga0307411_100244592	259
659	3300032126	Ga0307415_100001840	Ga0307415_1000018405	259
660	3300032126	Ga0307415_100003857	Ga0307415_1000038576	259
661	3300032126	Ga0307415_100019247	Ga0307415_1000192472	259
662	3300033180	Ga0307510_10000794	Ga0307510_1000079427	259
663	3300033180	Ga0307510_10010876	Ga0307510_100108761	259
664	3300035085	Ga0373929_0028438	Ga0373929_0028438_163_951	259
665	3300035111	Ga0373923_0175769	Ga0373923_0175769_26_820	259
666	3300035114	Ga0373939_0010945	Ga0373939_0010945_219_1007	259
667	3300035170	Ga0373943_0034815	Ga0373943_0034815_646_1440	259
668	3300035691	Ga0373931_0034988	Ga0373931_0034988_271_1059	259
669	3300035691	Ga0373931_0059157	Ga0373931_0059157_537_1325	259
670	3300035692	Ga0373935_0014634	Ga0373935_0014634_340_1134	259
671	3300035695	Ga0373927_0339795	Ga0373927_0339795_136_924	259
672	3300036401	Ga0373937_0024629	Ga0373937_0024629_2944_3738	259
673	3300037471	Ga0395905_0087107	Ga0395905_0087107_2027_2821	259
674	3300041406	Ga0439439_0025500	Ga0439439_0025500_285_1073	259
675	3300041410	Ga0439461_0009525	Ga0439461_0009525_701_1492	259
676	3300041446	Ga0451794_05375	Ga0451794_05375_12_866	259
677	3300041451	Ga0451791_1056810	Ga0451791_1056810_130_981	259
678	3300041451	Ga0451791_1212200	Ga0451791_1212200_1505_2359	259
679	3300041498	Ga0451841_0618492	Ga0451841_0618492_13_840	259
680	3300041498	Ga0451841_1382434	Ga0451841_1382434_305_1156	259
681	3300041509	Ga0451843_1188350	Ga0451843_1188350_102_953	259
682	3300041997	Ga0439431_0020494	Ga0439431_0020494_166_957	259
683	3300041999	Ga0439433_0028305	Ga0439433_0028305_408_1196	259
684	3300042005	Ga0439448_0009616	Ga0439448_0009616_1955_2827	259
685	3300042007	Ga0439449_0009571	Ga0439449_0009571_250_1038	259
686	3300042007	Ga0439449_0083998	Ga0439449_0083998_83_874	259
687	3300042016	Ga0439463_009820	Ga0439463_009820_750_1601	259
688	3300042436	Ga0439435_0010559	Ga0439435_0010559_279_1151	259
689	3300042439	Ga0439464_0000820	Ga0439464_0000820_2816_3688	259
690	3300042461	Ga0439460_0009146	Ga0439460_0009146_14_886	259
691	3300042461	Ga0439460_0024543	Ga0439460_0024543_435_1307	259
692	3300042993	Ga0439440_0050815	Ga0439440_0050815_53_904	259
693	3300044658	Ga0466972_0034704	Ga0466972_0034704_397_1185	259
694	3300044683	Ga0466965_0025044	Ga0466965_0025044_927_1715	259
695	3300044712	Ga0453684_0006064	Ga0453684_0006064_3381_4169	259
696	3300044712	Ga0453684_0078506	Ga0453684_0078506_2306_3097	259
697	3300046459	Ga0495629_0075981	Ga0495629_0075981_686_1480	259
698	3300046459	Ga0495629_0167511	Ga0495629_0167511_407_1201	259
699	3300046507	Ga0495606_0023737	Ga0495606_0023737_396_1184	259
700	3300046520	Ga0495637_0096456	Ga0495637_0096456_290_1078	259
701	3300046523	Ga0495644_0030361	Ga0495644_0030361_788_1639	259
702	3300046524	Ga0495648_0156063	Ga0495648_0156063_265_1053	259
703	3300046530	Ga0495654_0035827	Ga0495654_0035827_1300_2088	259
704	3300046535	Ga0495586_0047487	Ga0495586_0047487_122_913	259
705	3300046543	Ga0495645_0125466	Ga0495645_0125466_450_1244	259
706	3300046615	Ga0495656_0012876	Ga0495656_0012876_1812_2663	259
707	3300046660	Ga0495625_0004856	Ga0495625_0004856_3451_4239	259
708	3300046660	Ga0495625_0115590	Ga0495625_0115590_686_1474	259
709	3300046664	Ga0495659_0000004	Ga0495659_0000004_113741_114529	259
710	3300046681	Ga0495647_0017099	Ga0495647_0017099_584_1378	259
711	3300046683	Ga0495658_0013346	Ga0495658_0013346_2984_3778	259
712	3300046690	Ga0495624_0037050	Ga0495624_0037050_1227_2015	259
713	3300046692	Ga0495671_0000548	Ga0495671_0000548_7982_8770	259
714	3300046810	Ga0495660_0058044	Ga0495660_0058044_1223_2011	259
715	3300047320	Ga0495672_0000045	Ga0495672_0000045_50294_51082	259
716	3300047471	Ga0495684_0107577	Ga0495684_0107577_614_1408	259
717	3300047472	Ga0495686_0001957	Ga0495686_0001957_218_1006	259
718	3300047673	Ga0495593_0086379	Ga0495593_0086379_696_1484	259
719	3300048088	Ga0495602_0206259	Ga0495602_0206259_350_1138	259
720	3300048924	Ga0496121_0007376	Ga0496121_0007376_6714_7511	259
721	3300049459	Ga0495678_019873	Ga0495678_019873_378_1166	259
722	3300049534	Ga0501318_009628	Ga0501318_009628_86_937	259
723	3300049661	Ga0501217_013429	Ga0501217_013429_875_1726	259
724	3300050489	nmdc:mga03683_63200_c1	nmdc:mga03683_63200_c1_373_1164	259
725	3300050491	nmdc:mga00v17_115324_c1	nmdc:mga00v17_115324_c1_225_1013	259
726	3300050493	nmdc:mga0k408_16255_c1	nmdc:mga0k408_16255_c1_1746_2540	259
727	3300050493	nmdc:mga0k408_2622_c1	nmdc:mga0k408_2622_c1_6269_7057	259
728	3300050494	nmdc:mga06z11_21345_c1	nmdc:mga06z11_21345_c1_661_1452	259
729	3300050496	nmdc:mga07m45_34042_c1	nmdc:mga07m45_34042_c1_765_1556	259
730	3300050507	nmdc:mga05p37_13917_c1	nmdc:mga05p37_13917_c1_7141_7992	259
731	3300050508	nmdc:mga09592_12256_c1	nmdc:mga09592_12256_c1_2499_3371	259
732	3300050509	nmdc:mga0qj67_173811_c1	nmdc:mga0qj67_173811_c1_420_1292	259
733	3300050510	nmdc:mga06r32_107170_c1	nmdc:mga06r32_107170_c1_322_1194	259
734	3300050511	nmdc:mga08y16_22407_c1	nmdc:mga08y16_22407_c1_5285_6136	259
735	3300050512	nmdc:mga0n895_2134_c1	nmdc:mga0n895_2134_c1_4189_5040	259
736	3300050513	nmdc:mga0rr50_5124_c1	nmdc:mga0rr50_5124_c1_2998_3870	259
737	3300050515	nmdc:mga0a205_11905_c1	nmdc:mga0a205_11905_c1_1895_2746	259
738	3300053085	Ga0495619_0143497	Ga0495619_0143497_158_952	259
739	3300053091	Ga0500647_0110655	Ga0500647_0110655_450_1238	259
740	3300053093	Ga0500651_0212236	Ga0500651_0212236_242_1033	259
741	3300053118	Ga0500594_0000823	Ga0500594_0000823_77_865	259
742	3300053121	Ga0500607_094451	Ga0500607_094451_638_1426	259
743	3300053126	Ga0500621_132426	Ga0500621_132426_132_923	259
744	3300053131	Ga0500652_095153	Ga0500652_095153_132_920	259
745	3300053136	Ga0500559_0000027	Ga0500559_0000027_96458_97246	259
746	3300053156	Ga0500622_0018677	Ga0500622_0018677_2859_3647	259
747	iso_pu_bacteria	2643221644	2644246440	259
748	iso_pu_bacteria	2643221654	2644303661	259
749	iso_pu_bacteria	2738543013	2739247937	259
750	iso_pu_bacteria	2808606365	2808872503	259
751	3300003187	JGI25151J46595_10003822	JGI25151J46595_1000382210	260
752	3300003187	JGI25151J46595_10004098	JGI25151J46595_100040982	260
753	3300003374	JGI25161J50226_1003713	JGI25161J50226_10037132	260
754	3300003544	Ga0007417J51691_1058084	Ga0007417J51691_10580842	260
755	3300003578	Ga0006562J51391_1206897	Ga0006562J51391_12068972	260
756	3300003578	Ga0006562J51391_1206898	Ga0006562J51391_12068982	260
757	3300003762	Ga0055542_1000004	Ga0055542_1000004519	260
758	3300003771	Ga0055526_1023712	Ga0055526_10237122	260
759	3300003773	Ga0055537_1000067	Ga0055537_100006747	260
760	3300003775	Ga0055524_1022038	Ga0055524_10220382	260
761	3300003781	Ga0055536_1002788	Ga0055536_10027886	260
762	3300003784	Ga0055534_1000079	Ga0055534_100007921	260
763	3300003790	Ga0055528_1003321	Ga0055528_10033213	260
764	3300003792	Ga0055540_1001704	Ga0055540_10017046	260
765	3300003792	Ga0055540_1004292	Ga0055540_10042925	260
766	3300003792	Ga0055540_1021025	Ga0055540_10210252	260
767	3300003794	Ga0055531_10002097	Ga0055531_100020977	260
768	3300004625	Ga0055543_1009384	Ga0055543_10093842	260
769	3300005288	Ga0065714_10028239	Ga0065714_100282391	260
770	3300005289	Ga0065704_10086689	Ga0065704_100866892	260
771	3300005329	Ga0070683_100262557	Ga0070683_1002625572	260
772	3300005334	Ga0068869_100320614	Ga0068869_1003206142	260
773	3300005337	Ga0070682_100406680	Ga0070682_1004066801	260
774	3300005344	Ga0070661_100292950	Ga0070661_1002929502	260
775	3300005347	Ga0070668_100510368	Ga0070668_1005103681	260
776	3300005353	Ga0070669_100203236	Ga0070669_1002032362	260
777	3300005355	Ga0070671_100072689	Ga0070671_1000726892	260
778	3300005356	Ga0070674_100207987	Ga0070674_1002079872	260
779	3300005364	Ga0070673_100500361	Ga0070673_1005003612	260
780	3300005440	Ga0070705_100049775	Ga0070705_1000497752	260
781	3300005455	Ga0070663_100291672	Ga0070663_1002916721	260
782	3300005456	Ga0070678_100077416	Ga0070678_1000774161	260
783	3300005539	Ga0068853_100006049	Ga0068853_1000060495	260
784	3300005547	Ga0070693_100080760	Ga0070693_1000807602	260
785	3300005548	Ga0070665_100104984	Ga0070665_1001049842	260
786	3300005563	Ga0068855_100403842	Ga0068855_1004038422	260
787	3300005578	Ga0068854_100132102	Ga0068854_1001321022	260
788	3300005616	Ga0068852_100157142	Ga0068852_1001571423	260
789	3300005618	Ga0068864_100047704	Ga0068864_1000477042	260
790	3300005719	Ga0068861_100110521	Ga0068861_1001105213	260
791	3300005719	Ga0068861_100491426	Ga0068861_1004914262	260
792	3300005834	Ga0068851_10061305	Ga0068851_100613052	260
793	3300005842	Ga0068858_100146191	Ga0068858_1001461912	260
794	3300005843	Ga0068860_100554143	Ga0068860_1005541432	260
795	3300005844	Ga0068862_100072872	Ga0068862_1000728721	260
796	3300005983	Ga0081540_1037494	Ga0081540_10374943	260
797	3300006028	Ga0070717_10072751	Ga0070717_100727513	260
798	3300006038	Ga0075365_10004368	Ga0075365_100043688	260
799	3300006051	Ga0075364_10102148	Ga0075364_101021482	260
800	3300006058	Ga0075432_10012016	Ga0075432_100120163	260
801	3300006177	Ga0075362_10001578	Ga0075362_100015782	260
802	3300006178	Ga0075367_10098781	Ga0075367_100987812	260
803	3300006186	Ga0075369_10018959	Ga0075369_100189592	260
804	3300006195	Ga0075366_10010974	Ga0075366_100109746	260
805	3300006353	Ga0075370_10000290	Ga0075370_100002907	260
806	3300006353	Ga0075370_10001075	Ga0075370_100010759	260
807	3300006353	Ga0075370_10026684	Ga0075370_100266843	260
808	3300006353	Ga0075370_10048439	Ga0075370_100484392	260
809	3300006353	Ga0075370_10100271	Ga0075370_101002712	260
810	3300006358	Ga0068871_100324926	Ga0068871_1003249262	260
811	3300006946	Ga0079104_1027068	Ga0079104_10270681	260
812	3300006948	Ga0099826_10004066	Ga0099826_100040663	260
813	3300009036	Ga0105244_10010743	Ga0105244_100107433	260
814	3300009098	Ga0105245_10223596	Ga0105245_102235962	260
815	3300009148	Ga0105243_10002076	Ga0105243_1000207615	260
816	3300009148	Ga0105243_10002736	Ga0105243_1000273616	260
817	3300009148	Ga0105243_10006737	Ga0105243_100067374	260
818	3300009148	Ga0105243_10026824	Ga0105243_100268244	260
819	3300009148	Ga0105243_10135715	Ga0105243_101357152	260
820	3300009176	Ga0105242_10185682	Ga0105242_101856823	260
821	3300009551	Ga0105238_10457161	Ga0105238_104571612	260
822	3300009551	Ga0105238_10672206	Ga0105238_106722062	260
823	3300009553	Ga0105249_10150297	Ga0105249_101502973	260
824	3300010375	Ga0105239_10171693	Ga0105239_101716933	260
825	3300011119	Ga0105246_10110698	Ga0105246_101106982	260
826	3300013100	Ga0157373_10060247	Ga0157373_100602473	260
827	3300013102	Ga0157371_10060094	Ga0157371_100600942	260
828	3300013105	Ga0157369_10034289	Ga0157369_100342892	260
829	3300013297	Ga0157378_10040785	Ga0157378_100407853	260
830	3300013306	Ga0163162_10056229	Ga0163162_100562292	260
831	3300013306	Ga0163162_10386582	Ga0163162_103865822	260
832	3300013308	Ga0157375_10590936	Ga0157375_105909362	260
833	3300014497	Ga0182008_10003892	Ga0182008_100038929	260
834	3300014497	Ga0182008_10010702	Ga0182008_100107023	260
835	3300014497	Ga0182008_10028545	Ga0182008_100285452	260
836	3300015261	Ga0182006_1001700	Ga0182006_100170011	260
837	3300015261	Ga0182006_1053986	Ga0182006_10539862	260
838	3300015262	Ga0182007_10017719	Ga0182007_100177192	260
839	3300015262	Ga0182007_10042761	Ga0182007_100427612	260
840	3300017792	Ga0163161_10000069	Ga0163161_1000006942	260
841	3300017792	Ga0163161_10037700	Ga0163161_100377002	260
842	3300021384	Ga0213876_10033761	Ga0213876_100337613	260
843	3300025208	Ga0209436_111831	Ga0209436_1118312	260
844	3300025229	Ga0209147_101692	Ga0209147_1016926	260
845	3300025242	Ga0209258_100022	Ga0209258_100022518	260
846	3300025245	Ga0207425_1001900	Ga0207425_10019008	260
847	3300025254	Ga0209148_1000034	Ga0209148_1000034518	260
848	3300025258	Ga0209129_1002491	Ga0209129_10024916	260
849	3300025263	Ga0209565_1000146	Ga0209565_10001466	260
850	3300025263	Ga0209565_1000294	Ga0209565_100029420	260
851	3300025273	Ga0209673_1000860	Ga0209673_100086021	260
852	3300025291	Ga0209675_1000024	Ga0209675_1000024286	260
853	3300025291	Ga0209675_1001125	Ga0209675_10011252	260
854	3300025292	Ga0209676_1000005	Ga0209676_1000005182	260
855	3300025292	Ga0209676_1000434	Ga0209676_100043440	260
856	3300025292	Ga0209676_1001176	Ga0209676_100117615	260
857	3300025292	Ga0209676_1036020	Ga0209676_10360201	260
858	3300025294	Ga0209025_1000116	Ga0209025_10001166	260
859	3300025294	Ga0209025_1000394	Ga0209025_100039485	260
860	3300025294	Ga0209025_1001285	Ga0209025_100128520	260
861	3300025295	Ga0209564_1000155	Ga0209564_10001556	260
862	3300025297	Ga0209758_1000107	Ga0209758_10001076	260
863	3300025298	Ga0209050_1000007	Ga0209050_1000007915	260
864	3300025298	Ga0209050_1002520	Ga0209050_100252014	260
865	3300025299	Ga0209256_1000087	Ga0209256_10000876	260
866	3300025302	Ga0207426_1000123	Ga0207426_10001236	260
867	3300025303	Ga0209051_1000009	Ga0209051_1000009182	260
868	3300025303	Ga0209051_1000174	Ga0209051_100017454	260
869	3300025303	Ga0209051_1000262	Ga0209051_100026242	260
870	3300025303	Ga0209051_1001248	Ga0209051_10012484	260
871	3300025304	Ga0209257_1000011	Ga0209257_1000011156	260
872	3300025304	Ga0209257_1000139	Ga0209257_100013946	260
873	3300025304	Ga0209257_1007189	Ga0209257_10071892	260
874	3300025304	Ga0209257_1010519	Ga0209257_10105193	260
875	3300025728	Ga0207655_1001900	Ga0207655_10019008	260
876	3300025924	Ga0207694_10114573	Ga0207694_101145732	260
877	3300025927	Ga0207687_10019603	Ga0207687_100196032	260
878	3300025931	Ga0207644_10033476	Ga0207644_100334762	260
879	3300025933	Ga0207706_10021056	Ga0207706_100210563	260
880	3300025933	Ga0207706_10219796	Ga0207706_102197962	260
881	3300025934	Ga0207686_10078433	Ga0207686_100784332	260
882	3300025935	Ga0207709_10000242	Ga0207709_1000024230	260
883	3300025935	Ga0207709_10015707	Ga0207709_100157074	260
884	3300025935	Ga0207709_10066064	Ga0207709_100660643	260
885	3300025937	Ga0207669_10201472	Ga0207669_102014722	260
886	3300025942	Ga0207689_10322259	Ga0207689_103222592	260
887	3300025945	Ga0207679_10015159	Ga0207679_100151593	260
888	3300025981	Ga0207640_10115003	Ga0207640_101150032	260
889	3300025981	Ga0207640_10402743	Ga0207640_104027432	260
890	3300026035	Ga0207703_10054670	Ga0207703_100546702	260
891	3300026067	Ga0207678_10288635	Ga0207678_102886352	260
892	3300026095	Ga0207676_10101719	Ga0207676_101017193	260
893	3300026116	Ga0207674_10234577	Ga0207674_102345772	260
894	3300026116	Ga0207674_10339859	Ga0207674_103398592	260
895	3300026118	Ga0207675_100107582	Ga0207675_1001075823	260
896	3300026118	Ga0207675_100141004	Ga0207675_1001410042	260
897	3300026121	Ga0207683_10253361	Ga0207683_102533612	260
898	3300027666	Ga0209282_1002689	Ga0209282_10026893	260
899	3300027907	Ga0207428_10245401	Ga0207428_102454012	260
900	3300028379	Ga0268266_10059220	Ga0268266_100592203	260
901	3300028381	Ga0268264_10321275	Ga0268264_103212752	260
902	3300030744	Ga0316181_1040477	Ga0316181_10404772	260
903	3300031456	Ga0307513_10153793	Ga0307513_101537932	260
904	3300031649	Ga0307514_10070423	Ga0307514_100704232	260
905	3300031731	Ga0307405_10007092	Ga0307405_100070928	260
906	3300031852	Ga0307410_10164949	Ga0307410_101649492	260
907	3300031901	Ga0307406_10002798	Ga0307406_100027983	260
908	3300031903	Ga0307407_10337008	Ga0307407_103370081	260
909	3300031911	Ga0307412_10019946	Ga0307412_100199462	260
910	3300032004	Ga0307414_10034677	Ga0307414_100346772	260
911	3300032005	Ga0307411_10365617	Ga0307411_103656172	260
912	3300037312	Ga0395899_0011426	Ga0395899_0011426_3357_4148	260
913	3300037471	Ga0395905_0118684	Ga0395905_0118684_1204_2028	260
914	3300039437	Ga0436365_1786770	Ga0436365_1786770_1377_2183	260
915	3300041512	Ga0451853_2013300	Ga0451853_2013300_318_1142	260
916	3300042531	Ga0450918_003064	Ga0450918_003064_697_1494	260
917	3300044658	Ga0466972_0161396	Ga0466972_0161396_111_902	260
918	3300044683	Ga0466965_0039324	Ga0466965_0039324_472_1263	260
919	3300044901	Ga0466960_0068430	Ga0466960_0068430_177_1031	260
920	3300045976	Ga0466967_0162297	Ga0466967_0162297_450_1283	260
921	3300046453	Ga0495627_015598	Ga0495627_015598_1348_2145	260
922	3300046460	Ga0495638_0031429	Ga0495638_0031429_2464_3261	260
923	3300046507	Ga0495606_0000297	Ga0495606_0000297_65993_66784	260
924	3300046513	Ga0495616_0001038	Ga0495616_0001038_15368_16165	260
925	3300046515	Ga0495620_0012100	Ga0495620_0012100_2154_2951	260
926	3300046518	Ga0495631_0002040	Ga0495631_0002040_5159_5956	260
927	3300046660	Ga0495625_0000311	Ga0495625_0000311_28280_29077	260
928	3300046683	Ga0495658_0133474	Ga0495658_0133474_582_1436	260
929	3300047321	Ga0495676_0012050	Ga0495676_0012050_1887_2684	260
930	3300047471	Ga0495684_0307516	Ga0495684_0307516_183_1037	260
931	3300048089	Ga0495614_0092873	Ga0495614_0092873_21_875	260
932	3300048089	Ga0495614_0163484	Ga0495614_0163484_58_891	260
933	3300048904	Ga0496101_0012659	Ga0496101_0012659_4388_5185	260
934	3300048908	Ga0496105_0188107	Ga0496105_0188107_732_1565	260
935	3300048917	Ga0496114_0034444	Ga0496114_0034444_3067_3900	260
936	3300048917	Ga0496114_0190124	Ga0496114_0190124_870_1703	260
937	3300048919	Ga0496116_0126852	Ga0496116_0126852_39_836	260
938	3300048921	Ga0496118_0005315	Ga0496118_0005315_6706_7503	260
939	3300048924	Ga0496121_0173480	Ga0496121_0173480_203_1000	260
940	3300048924	Ga0496121_0175089	Ga0496121_0175089_574_1371	260
941	3300048926	Ga0496123_0053308	Ga0496123_0053308_317_1114	260
942	3300048928	Ga0496125_0071362	Ga0496125_0071362_737_1534	260
943	3300049823	Ga0501044_0009388	Ga0501044_0009388_102_908	260
944	3300050489	nmdc:mga03683_2284_c1	nmdc:mga03683_2284_c1_604_1401	260
945	3300050490	nmdc:mga03n38_213179_c1	nmdc:mga03n38_213179_c1_114_911	260
946	3300050491	nmdc:mga00v17_2326_c1	nmdc:mga00v17_2326_c1_3789_4586	260
947	3300050493	nmdc:mga0k408_12401_c1	nmdc:mga0k408_12401_c1_3757_4554	260
948	3300050493	nmdc:mga0k408_249069_c1	nmdc:mga0k408_249069_c1_201_1007	260
949	3300050494	nmdc:mga06z11_63742_c1	nmdc:mga06z11_63742_c1_424_1221	260
950	3300050496	nmdc:mga07m45_1016_c1	nmdc:mga07m45_1016_c1_843_1640	260
951	3300050496	nmdc:mga07m45_103_c1	nmdc:mga07m45_103_c1_1734_2531	260
952	3300050496	nmdc:mga07m45_16917_c1	nmdc:mga07m45_16917_c1_2945_3742	260
953	3300050516	nmdc:mga0sz30_107646_c1	nmdc:mga0sz30_107646_c1_268_1065	260
954	3300053079	Ga0500610_0002412	Ga0500610_0002412_5403_6200	260
955	3300053079	Ga0500610_0045703	Ga0500610_0045703_643_1440	260
956	3300053093	Ga0500651_0000133	Ga0500651_0000133_5751_6548	260
957	3300053110	Ga0500571_000153	Ga0500571_000153_10227_11024	260
958	3300053117	Ga0500593_000449	Ga0500593_000449_6117_6914	260
959	3300053122	Ga0500608_016018	Ga0500608_016018_458_1255	260
960	3300053128	Ga0500626_008205	Ga0500626_008205_1224_2021	260
961	3300053134	Ga0500658_0000124	Ga0500658_0000124_1198_1995	260
962	3300053134	Ga0500658_0000342	Ga0500658_0000342_1197_1994	260
963	3300053139	Ga0500568_0001367	Ga0500568_0001367_56_853	260
964	3300053141	Ga0500574_044027	Ga0500574_044027_170_967	260
965	3300053153	Ga0500616_0101260	Ga0500616_0101260_72_869	260
966	3300053161	Ga0500634_0001113	Ga0500634_0001113_5452_6249	260
967	3300059478	Ga0587093_013104	Ga0587093_013104_95_886	260
968	3300059493	Ga0587077_003034	Ga0587077_003034_1221_2012	260
969	3300059505	Ga0587083_0000943	Ga0587083_0000943_2024_2815	260
970	3300059505	Ga0587083_0011458	Ga0587083_0011458_417_1208	260
971	3300059508	Ga0587088_018093	Ga0587088_018093_221_1054	260
972	3300059511	Ga0587091_016961	Ga0587091_016961_360_1193	260
973	3300059512	Ga0587092_009834	Ga0587092_009834_55_846	260
974	3300059512	Ga0587092_011086	Ga0587092_011086_50_841	260
975	3300059605	Ga0587106_003751	Ga0587106_003751_370_1224	260
976	3300059623	Ga0587101_001108	Ga0587101_001108_1368_2159	260
977	3300059630	Ga0587128_020880	Ga0587128_020880_31_885	260
978	3300059642	Ga0587069_001296	Ga0587069_001296_1447_2238	260
979	3300059645	Ga0587076_001845	Ga0587076_001845_1414_2205	260
980	3300059645	Ga0587076_032277	Ga0587076_032277_46_837	260
981	3300059646	Ga0587078_000307	Ga0587078_000307_392_1183	260
982	3300059647	Ga0587079_002858	Ga0587079_002858_1345_2136	260
983	3300059648	Ga0587100_002107	Ga0587100_002107_418_1209	260
984	3300059649	Ga0587102_000521	Ga0587102_000521_1399_2190	260
985	3300060344	Ga0587071_000866	Ga0587071_000866_384_1175	260
986	3300060344	Ga0587071_018214	Ga0587071_018214_418_1209	260
987	3300060346	Ga0587111_0000679	Ga0587111_0000679_354_1145	260
988	3300060346	Ga0587111_0008702	Ga0587111_0008702_208_999	260
989	iso_pu_bacteria	2515154123	2515687665	260
990	3300003203	JGI25406J46586_10021010	JGI25406J46586_100210103	261
991	3300003756	Ga0055533_1000061	Ga0055533_1000061149	261
992	3300003759	Ga0055525_1000793	Ga0055525_10007939	261
993	3300005327	Ga0070658_10007950	Ga0070658_100079502	261
994	3300005328	Ga0070676_10033292	Ga0070676_100332923	261
995	3300005329	Ga0070683_100169237	Ga0070683_1001692372	261
996	3300005335	Ga0070666_10088031	Ga0070666_100880311	261
997	3300005339	Ga0070660_100016980	Ga0070660_1000169802	261
998	3300005339	Ga0070660_100525746	Ga0070660_1005257461	261
999	3300005354	Ga0070675_100654737	Ga0070675_1006547371	261
1000	3300005366	Ga0070659_100349316	Ga0070659_1003493162	261
1001	3300005367	Ga0070667_100121574	Ga0070667_1001215743	261
1002	3300005456	Ga0070678_100306936	Ga0070678_1003069361	261
1003	3300005468	Ga0070707_100134597	Ga0070707_1001345972	261
1004	3300005471	Ga0070698_100026399	Ga0070698_1000263994	261
1005	3300005471	Ga0070698_100158593	Ga0070698_1001585931	261
1006	3300005547	Ga0070693_100155754	Ga0070693_1001557542	261
1007	3300005563	Ga0068855_100094627	Ga0068855_1000946273	261
1008	3300005563	Ga0068855_100667810	Ga0068855_1006678102	261
1009	3300005577	Ga0068857_100303679	Ga0068857_1003036792	261
1010	3300005616	Ga0068852_100863816	Ga0068852_1008638161	261
1011	3300005841	Ga0068863_100342419	Ga0068863_1003424192	261
1012	3300005985	Ga0081539_10001917	Ga0081539_100019172	261
1013	3300006038	Ga0075365_10009361	Ga0075365_100093612	261
1014	3300006042	Ga0075368_10000442	Ga0075368_100004426	261
1015	3300006048	Ga0075363_100069465	Ga0075363_1000694652	261
1016	3300006048	Ga0075363_100236402	Ga0075363_1002364021	261
1017	3300006051	Ga0075364_10103371	Ga0075364_101033712	261
1018	3300006177	Ga0075362_10193032	Ga0075362_101930322	261
1019	3300006178	Ga0075367_10080911	Ga0075367_100809112	261
1020	3300006195	Ga0075366_10020320	Ga0075366_100203203	261
1021	3300006195	Ga0075366_10075234	Ga0075366_100752342	261
1022	3300006237	Ga0097621_100064286	Ga0097621_1000642862	261
1023	3300006353	Ga0075370_10000491	Ga0075370_100004916	261
1024	3300006358	Ga0068871_100121631	Ga0068871_1001216312	261
1025	3300006844	Ga0075428_100514864	Ga0075428_1005148642	261
1026	3300006847	Ga0075431_100239981	Ga0075431_1002399812	261
1027	3300009093	Ga0105240_10103006	Ga0105240_101030063	261
1028	3300013104	Ga0157370_10449763	Ga0157370_104497631	261
1029	3300013105	Ga0157369_10017323	Ga0157369_100173234	261
1030	3300013306	Ga0163162_10061387	Ga0163162_100613873	261
1031	3300014326	Ga0157380_10245554	Ga0157380_102455541	261
1032	3300015261	Ga0182006_1022637	Ga0182006_10226373	261
1033	3300017792	Ga0163161_10022021	Ga0163161_100220212	261
1034	3300017792	Ga0163161_10160197	Ga0163161_101601972	261
1035	3300025226	Ga0209674_100003	Ga0209674_100003202	261
1036	3300025230	Ga0209563_100086	Ga0209563_100086149	261
1037	3300025231	Ga0207427_100546	Ga0207427_1005465	261
1038	3300025253	Ga0209677_100133	Ga0209677_10013331	261
1039	3300025256	Ga0209759_1010820	Ga0209759_10108202	261
1040	3300025901	Ga0207688_10039253	Ga0207688_100392532	261
1041	3300025903	Ga0207680_10061354	Ga0207680_100613543	261
1042	3300025907	Ga0207645_10045017	Ga0207645_100450171	261
1043	3300025909	Ga0207705_10007480	Ga0207705_100074808	261
1044	3300025909	Ga0207705_10043255	Ga0207705_100432552	261
1045	3300025909	Ga0207705_10095883	Ga0207705_100958832	261
1046	3300025913	Ga0207695_10324379	Ga0207695_103243792	261
1047	3300025919	Ga0207657_10057170	Ga0207657_100571702	261
1048	3300025919	Ga0207657_10565808	Ga0207657_105658081	261
1049	3300025922	Ga0207646_10121746	Ga0207646_101217462	261
1050	3300025932	Ga0207690_10137976	Ga0207690_101379762	261
1051	3300025934	Ga0207686_10123662	Ga0207686_101236622	261
1052	3300025944	Ga0207661_10158756	Ga0207661_101587561	261
1053	3300025986	Ga0207658_10045504	Ga0207658_100455043	261
1054	3300026088	Ga0207641_10659530	Ga0207641_106595302	261
1055	3300026121	Ga0207683_10208057	Ga0207683_102080572	261
1056	3300027866	Ga0209813_10014749	Ga0209813_100147492	261
1057	3300030733	Ga0314311_1070217	Ga0314311_10702176	261
1058	3300030735	Ga0316178_1038078	Ga0316178_10380782	261
1059	3300030742	Ga0316183_1076181	Ga0316183_10761812	261
1060	3300030745	Ga0316182_1383588	Ga0316182_13835882	261
1061	3300031251	Ga0265327_10008779	Ga0265327_100087798	261
1062	3300031838	Ga0307518_10104727	Ga0307518_101047273	261
1063	3300037466	Ga0395898_0006478	Ga0395898_0006478_439_1239	261
1064	3300038443	Ga0395901_0000336	Ga0395901_0000336_6934_7734	261
1065	3300041453	Ga0451797_0293764	Ga0451797_0293764_1026_1889	261
1066	3300041460	Ga0451802_0382733	Ga0451802_0382733_27_830	261
1067	3300044656	Ga0466969_0020264	Ga0466969_0020264_754_1548	261
1068	3300044658	Ga0466972_0079847	Ga0466972_0079847_282_1076	261
1069	3300044683	Ga0466965_0134393	Ga0466965_0134393_145_939	261
1070	3300046452	Ga0495617_002533	Ga0495617_002533_5106_5900	261
1071	3300046457	Ga0495590_0038270	Ga0495590_0038270_532_1326	261
1072	3300046459	Ga0495629_0259972	Ga0495629_0259972_114_908	261
1073	3300046463	Ga0495653_0232313	Ga0495653_0232313_375_1172	261
1074	3300046471	Ga0495650_0035343	Ga0495650_0035343_1393_2187	261
1075	3300046475	Ga0495639_0001849	Ga0495639_0001849_845_1639	261
1076	3300046491	Ga0495584_0002297	Ga0495584_0002297_5102_5896	261
1077	3300046491	Ga0495584_0038277	Ga0495584_0038277_652_1446	261
1078	3300046492	Ga0495585_0003905	Ga0495585_0003905_1187_1981	261
1079	3300046492	Ga0495585_0010619	Ga0495585_0010619_2262_3056	261
1080	3300046492	Ga0495585_0080518	Ga0495585_0080518_894_1688	261
1081	3300046501	Ga0495607_0014431	Ga0495607_0014431_777_1571	261
1082	3300046501	Ga0495607_0018499	Ga0495607_0018499_963_1757	261
1083	3300046506	Ga0495583_0000008	Ga0495583_0000008_382793_383587	261
1084	3300046506	Ga0495583_0000159	Ga0495583_0000159_14251_15051	261
1085	3300046506	Ga0495583_0000185	Ga0495583_0000185_74510_75304	261
1086	3300046523	Ga0495644_0000163	Ga0495644_0000163_602_1396	261
1087	3300046523	Ga0495644_0000657	Ga0495644_0000657_9141_9935	261
1088	3300046523	Ga0495644_0002234	Ga0495644_0002234_3513_4307	261
1089	3300046524	Ga0495648_0005067	Ga0495648_0005067_7424_8218	261
1090	3300046538	Ga0495609_0001121	Ga0495609_0001121_768_1562	261
1091	3300046538	Ga0495609_0076602	Ga0495609_0076602_74_868	261
1092	3300046557	Ga0495622_0072660	Ga0495622_0072660_15_809	261
1093	3300046557	Ga0495622_0133353	Ga0495622_0133353_93_887	261
1094	3300046558	Ga0495633_0012733	Ga0495633_0012733_920_1714	261
1095	3300046558	Ga0495633_0195765	Ga0495633_0195765_45_839	261
1096	3300046615	Ga0495656_0034603	Ga0495656_0034603_1003_1797	261
1097	3300046615	Ga0495656_0039784	Ga0495656_0039784_785_1579	261
1098	3300046615	Ga0495656_0178128	Ga0495656_0178128_73_867	261
1099	3300046648	Ga0495611_0018132	Ga0495611_0018132_1492_2286	261
1100	3300046648	Ga0495611_0019535	Ga0495611_0019535_624_1418	261
1101	3300046660	Ga0495625_0003763	Ga0495625_0003763_3564_4364	261
1102	3300046660	Ga0495625_0011468	Ga0495625_0011468_3836_4630	261
1103	3300046660	Ga0495625_0057926	Ga0495625_0057926_1015_1809	261
1104	3300046664	Ga0495659_0002446	Ga0495659_0002446_4054_4848	261
1105	3300046664	Ga0495659_0010315	Ga0495659_0010315_758_1552	261
1106	3300046665	Ga0495661_0030390	Ga0495661_0030390_2198_2992	261
1107	3300046691	Ga0495670_0004151	Ga0495670_0004151_3533_4327	261
1108	3300046691	Ga0495670_0042781	Ga0495670_0042781_642_1436	261
1109	3300046692	Ga0495671_0030601	Ga0495671_0030601_93_887	261
1110	3300046692	Ga0495671_0043887	Ga0495671_0043887_219_1013	261
1111	3300047318	Ga0495636_0000383	Ga0495636_0000383_9211_10005	261
1112	3300047318	Ga0495636_0008721	Ga0495636_0008721_2827_3621	261
1113	3300047320	Ga0495672_0000835	Ga0495672_0000835_25960_26754	261
1114	3300047320	Ga0495672_0013305	Ga0495672_0013305_2790_3584	261
1115	3300047320	Ga0495672_0013478	Ga0495672_0013478_392_1186	261
1116	3300047321	Ga0495676_0045103	Ga0495676_0045103_1514_2308	261
1117	3300047323	Ga0495683_0026971	Ga0495683_0026971_1291_2094	261
1118	3300047443	Ga0495687_001223	Ga0495687_001223_18776_19570	261
1119	3300047445	Ga0495677_0001387	Ga0495677_0001387_7040_7834	261
1120	3300047445	Ga0495677_0024225	Ga0495677_0024225_1021_1815	261
1121	3300047447	Ga0495685_000161	Ga0495685_000161_16857_17651	261
1122	3300047469	Ga0495673_0038168	Ga0495673_0038168_150_944	261
1123	3300047470	Ga0495681_0156814	Ga0495681_0156814_73_867	261
1124	3300047472	Ga0495686_0063442	Ga0495686_0063442_1259_2059	261
1125	3300047472	Ga0495686_0117636	Ga0495686_0117636_79_873	261
1126	3300048903	Ga0496100_0012954	Ga0496100_0012954_645_1439	261
1127	3300048904	Ga0496101_0031505	Ga0496101_0031505_548_1342	261
1128	3300048905	Ga0496102_0055796	Ga0496102_0055796_2387_3181	261
1129	3300048906	Ga0496103_0002745	Ga0496103_0002745_2197_3003	261
1130	3300048907	Ga0496104_0024837	Ga0496104_0024837_4176_4970	261
1131	3300048907	Ga0496104_0125490	Ga0496104_0125490_162_1022	261
1132	3300048908	Ga0496105_0019902	Ga0496105_0019902_4433_5293	261
1133	3300048911	Ga0496108_0018614	Ga0496108_0018614_538_1398	261
1134	3300048911	Ga0496108_0145019	Ga0496108_0145019_886_1680	261
1135	3300048912	Ga0496109_0113871	Ga0496109_0113871_1646_2440	261
1136	3300048913	Ga0496110_0004179	Ga0496110_0004179_4558_5418	261
1137	3300048913	Ga0496110_0018524	Ga0496110_0018524_3930_4724	261
1138	3300048914	Ga0496111_0030896	Ga0496111_0030896_1568_2428	261
1139	3300048914	Ga0496111_0053960	Ga0496111_0053960_1243_2037	261
1140	3300048917	Ga0496114_0064732	Ga0496114_0064732_1372_2178	261
1141	3300048917	Ga0496114_0087100	Ga0496114_0087100_1407_2201	261
1142	3300048917	Ga0496114_0327276	Ga0496114_0327276_165_1025	261
1143	3300048918	Ga0496115_0349709	Ga0496115_0349709_50_907	261
1144	3300048926	Ga0496123_0110166	Ga0496123_0110166_13_807	261
1145	3300048927	Ga0496124_0008990	Ga0496124_0008990_5828_6622	261
1146	3300049459	Ga0495678_002384	Ga0495678_002384_2830_3624	261
1147	3300049460	Ga0495682_0000206	Ga0495682_0000206_23839_24633	261
1148	3300049460	Ga0495682_0000261	Ga0495682_0000261_7576_8370	261
1149	3300049460	Ga0495682_0012369	Ga0495682_0012369_479_1273	261
1150	3300049460	Ga0495682_0020172	Ga0495682_0020172_818_1612	261
1151	3300049532	Ga0501316_000316	Ga0501316_000316_2080_2874	261
1152	3300049571	Ga0501034_0153351	Ga0501034_0153351_1199_1993	261
1153	3300049580	Ga0501046_0205335	Ga0501046_0205335_508_1317	261
1154	3300049705	Ga0501225_0003407	Ga0501225_0003407_1101_1907	261
1155	3300049759	Ga0501262_000459	Ga0501262_000459_2447_3253	261
1156	3300050489	nmdc:mga03683_2086_c1	nmdc:mga03683_2086_c1_672_1484	261
1157	3300050489	nmdc:mga03683_61583_c1	nmdc:mga03683_61583_c1_205_1014	261
1158	3300050490	nmdc:mga03n38_32485_c1	nmdc:mga03n38_32485_c1_489_1301	261
1159	3300050491	nmdc:mga00v17_5314_c1	nmdc:mga00v17_5314_c1_1061_1873	261
1160	3300050494	nmdc:mga06z11_6819_c1	nmdc:mga06z11_6819_c1_3664_4476	261
1161	3300050510	nmdc:mga06r32_128917_c1	nmdc:mga06r32_128917_c1_1656_2453	261
1162	3300053177	Ga0500636_0010811	Ga0500636_0010811_3465_4265	261
1163	3300059477	Ga0587084_000297	Ga0587084_000297_433_1227	261
1164	3300059491	Ga0587070_000447	Ga0587070_000447_348_1142	261
1165	3300059493	Ga0587077_000158	Ga0587077_000158_3434_4228	261
1166	3300059505	Ga0587083_0000234	Ga0587083_0000234_1188_1982	261
1167	3300059506	Ga0587085_000466	Ga0587085_000466_2155_2949	261
1168	3300059510	Ga0587090_000183	Ga0587090_000183_2240_3034	261
1169	3300059511	Ga0587091_000456	Ga0587091_000456_214_1008	261
1170	3300059512	Ga0587092_000527	Ga0587092_000527_54_848	261
1171	3300059623	Ga0587101_000394	Ga0587101_000394_183_977	261
1172	3300059639	Ga0587062_000340	Ga0587062_000340_56_850	261
1173	3300059641	Ga0587068_000926	Ga0587068_000926_191_985	261
1174	3300059641	Ga0587068_002162	Ga0587068_002162_1512_2306	261
1175	3300059645	Ga0587076_000484	Ga0587076_000484_2234_3028	261
1176	3300059660	Ga0587124_000224	Ga0587124_000224_1939_2733	261
1177	3300060346	Ga0587111_0000401	Ga0587111_0000401_2081_2875	261
1178	iso_pu_bacteria	2508501039	2508672414	261
1179	iso_pu_bacteria	2508501125	2509130472	261
1180	iso_pu_bacteria	2513237151	2513958522	261
1181	iso_pu_bacteria	2526164713	2527077463	261
1182	iso_pu_bacteria	2600255067	2600814869	261
1183	iso_pu_bacteria	2622736626	2623589660	261
1184	iso_pu_bacteria	2687453737	2689959550	261
1185	iso_pu_bacteria	2738541296	2738822571	261
1186	iso_pu_bacteria	2738541298	2738834778	261
1187	iso_pu_bacteria	2738541306	2738876257	261
1188	iso_pu_bacteria	2738543002	2739188201	261
1189	iso_pu_bacteria	2738543008	2739222854	261
1190	iso_pu_bacteria	2744054900	2746085135	261
1191	iso_pu_bacteria	2744054901	2746095040	261
1192	iso_pu_bacteria	2751185846	2753568646	261
1193	iso_pu_bacteria	2818991450	2819618946	261
1194	iso_pu_bacteria	2842324504	2842329584	261
1195	iso_pu_bacteria	2842348783	2842354317	261
1196	iso_pu_bacteria	2842454564	2842456208	261
1197	iso_pu_bacteria	2900634093	2900638343	261
1198	iso_pu_bacteria	2904424332	2904424828	261
1199	iso_pu_bacteria	2904483920	2904488936	261
1200	iso_pu_bacteria	2919527303	2919529545	261
1201	iso_pu_bacteria	2928108538	2928113985	261
1202	iso_pu_bacteria	2928135762	2928141361	261
1203	iso_pu_bacteria	2928503688	2928509471	261
1204	iso_pu_bacteria	2945934425	2945940128	261
1205	iso_pu_bacteria	2990703756	2990707250	261
1206	iso_pu_bacteria	641736151	642424206	261
1207	iso_pu_bacteria	642555113	642615669	261
1208	iso_pu_bacteria	8055266321	8055269251	261
1209	iso_pu_bacteria	8055301274	8055303569	261
1210	3300003775	Ga0055524_1000097	Ga0055524_100009735	262
1211	3300003791	Ga0055530_10001788	Ga0055530_100017884	262
1212	3300003792	Ga0055540_1000023	Ga0055540_1000023122	262
1213	3300006946	Ga0079104_1000019	Ga0079104_100001961	262
1214	3300013296	Ga0157374_10449498	Ga0157374_104494981	262
1215	3300025263	Ga0209565_1009636	Ga0209565_10096362	262
1216	3300025273	Ga0209673_1024823	Ga0209673_10248232	262
1217	3300025291	Ga0209675_1005663	Ga0209675_10056634	262
1218	3300025297	Ga0209758_1000572	Ga0209758_100057244	262
1219	3300025298	Ga0209050_1000378	Ga0209050_100037812	262
1220	3300025298	Ga0209050_1000489	Ga0209050_100048915	262
1221	3300025298	Ga0209050_1007769	Ga0209050_10077692	262
1222	3300025299	Ga0209256_1000051	Ga0209256_100005164	262
1223	3300025303	Ga0209051_1000079	Ga0209051_100007965	262
1224	3300025303	Ga0209051_1016576	Ga0209051_10165763	262
1225	3300025304	Ga0209257_1000183	Ga0209257_100018323	262
1226	3300027111	Ga0209281_1000160	Ga0209281_100016061	262
1227	3300027876	Ga0209974_10046153	Ga0209974_100461532	262
1228	3300031548	Ga0307408_100002069	Ga0307408_1000020693	262
1229	3300031649	Ga0307514_10067037	Ga0307514_100670373	262
1230	3300031731	Ga0307405_10082128	Ga0307405_100821282	262
1231	3300031852	Ga0307410_10020811	Ga0307410_100208112	262
1232	3300031901	Ga0307406_10010897	Ga0307406_100108973	262
1233	3300031903	Ga0307407_10010702	Ga0307407_100107022	262
1234	3300031995	Ga0307409_100030253	Ga0307409_1000302533	262
1235	3300032002	Ga0307416_100010402	Ga0307416_1000104022	262
1236	3300032126	Ga0307415_100085161	Ga0307415_1000851612	262
1237	3300038443	Ga0395901_0129540	Ga0395901_0129540_293_1108	262
1238	3300038443	Ga0395901_0306882	Ga0395901_0306882_739_1554	262
1239	3300041408	Ga0439453_0016628	Ga0439453_0016628_466_1263	262
1240	3300042005	Ga0439448_0019396	Ga0439448_0019396_135_950	262
1241	3300042144	Ga0450889_003410	Ga0450889_003410_279_1076	262
1242	3300042156	Ga0439446_0012573	Ga0439446_0012573_576_1373	262
1243	3300042435	Ga0439434_0049834	Ga0439434_0049834_296_1093	262
1244	3300042876	Ga0451577_0008497	Ga0451577_0008497_6439_7236	262
1245	3300044673	Ga0453683_0006829	Ga0453683_0006829_2398_3195	262
1246	3300044712	Ga0453684_0034636	Ga0453684_0034636_4684_5481	262
1247	3300045051	Ga0451576_0014933	Ga0451576_0014933_6555_7352	262
1248	3300049568	Ga0501031_0003149	Ga0501031_0003149_5228_6088	262
1249	3300049570	Ga0501033_0095289	Ga0501033_0095289_754_1614	262
1250	3300049573	Ga0501037_0115604	Ga0501037_0115604_478_1338	262
1251	3300049574	Ga0501038_0005725	Ga0501038_0005725_7105_7965	262
1252	3300049575	Ga0501039_0024042	Ga0501039_0024042_3106_3966	262
1253	3300049576	Ga0501040_0006222	Ga0501040_0006222_5553_6413	262
1254	3300049578	Ga0501042_0087935	Ga0501042_0087935_378_1238	262
1255	3300049579	Ga0501043_0028821	Ga0501043_0028821_2829_3689	262
1256	3300049580	Ga0501046_0013645	Ga0501046_0013645_216_1076	262
1257	3300049582	Ga0501048_0004930	Ga0501048_0004930_7826_8686	262
1258	3300049586	Ga0501070_0222642	Ga0501070_0222642_469_1308	262
1259	3300049587	Ga0501071_0021994	Ga0501071_0021994_203_1063	262
1260	3300049588	Ga0501072_0051261	Ga0501072_0051261_2160_3020	262
1261	3300049591	Ga0501075_0060240	Ga0501075_0060240_325_1185	262
1262	3300049592	Ga0501076_0003690	Ga0501076_0003690_1901_2761	262
1263	3300049593	Ga0501077_0014989	Ga0501077_0014989_518_1357	262
1264	3300049741	Ga0501079_0020845	Ga0501079_0020845_3369_4229	262
1265	3300049742	Ga0501080_0146023	Ga0501080_0146023_1174_2034	262
1266	3300049824	Ga0501045_0002017	Ga0501045_0002017_8852_9712	262
1267	3300053086	Ga0500578_0000057	Ga0500578_0000057_20905_21702	262
1268	3300053093	Ga0500651_0040039	Ga0500651_0040039_1895_2692	262
1269	3300053109	Ga0500569_001196	Ga0500569_001196_1839_2636	262
1270	3300053131	Ga0500652_000112	Ga0500652_000112_4651_5448	262
1271	3300053156	Ga0500622_0000187	Ga0500622_0000187_12483_13280	262
1272	3300061734	Ga0530510_0004113	Ga0530510_0004113_253_1113	262
1273	iso_pu_bacteria	2562617112	2563061322	262
1274	iso_pu_bacteria	2585428058	2587732781	262
1275	iso_pu_bacteria	2643221596	2643990755	262
1276	iso_pu_bacteria	2711768613	2713476284	262
1277	iso_pu_bacteria	2904615490	2904621761	262
1278	3300005843	Ga0068860_100489548	Ga0068860_1004895482	263
1279	3300014968	Ga0157379_10095344	Ga0157379_100953443	263
1280	3300028381	Ga0268264_10080456	Ga0268264_100804563	263
1281	3300031456	Ga0307513_10000004	Ga0307513_10000004460	263
1282	3300031548	Ga0307408_100324150	Ga0307408_1003241501	263
1283	3300037466	Ga0395898_0092874	Ga0395898_0092874_1242_2045	263
1284	3300037471	Ga0395905_0081705	Ga0395905_0081705_1934_2737	263
1285	3300046457	Ga0495590_0010622	Ga0495590_0010622_1560_2399	263
1286	3300047472	Ga0495686_0081582	Ga0495686_0081582_104_916	263
1287	iso_pu_bacteria	2512047030	2512348970	263
1288	iso_pu_bacteria	2515154122	2515680384	263
1289	iso_pu_bacteria	2885270888	2885277991	263
1290	iso_pu_bacteria	2902682994	2902687871	263
1291	3300002067	JGI24735J21928_10019846	JGI24735J21928_100198461	264
1292	3300005327	Ga0070658_10075766	Ga0070658_100757662	264
1293	3300005339	Ga0070660_100021754	Ga0070660_1000217542	264
1294	3300005563	Ga0068855_100094414	Ga0068855_1000944142	264
1295	3300009093	Ga0105240_10056606	Ga0105240_100566066	264
1296	3300009545	Ga0105237_10256388	Ga0105237_102563882	264
1297	3300013100	Ga0157373_10011998	Ga0157373_100119987	264
1298	3300013104	Ga0157370_10012136	Ga0157370_1001213610	264
1299	3300013105	Ga0157369_10014451	Ga0157369_100144512	264
1300	3300013296	Ga0157374_10000034	Ga0157374_1000003499	264
1301	3300013307	Ga0157372_10002485	Ga0157372_1000248522	264
1302	3300015261	Ga0182006_1030628	Ga0182006_10306282	264
1303	3300025228	Ga0209672_103145	Ga0209672_1031454	264
1304	3300025904	Ga0207647_10010669	Ga0207647_100106692	264
1305	3300025909	Ga0207705_10058871	Ga0207705_100588712	264
1306	3300025914	Ga0207671_10278520	Ga0207671_102785202	264
1307	3300025919	Ga0207657_10003961	Ga0207657_100039615	264
1308	3300025949	Ga0207667_10016581	Ga0207667_100165819	264
1309	3300026075	Ga0207708_10478006	Ga0207708_104780062	264
1310	3300037418	Ga0395900_0338305	Ga0395900_0338305_406_1200	264
1311	3300038443	Ga0395901_0147446	Ga0395901_0147446_416_1210	264
1312	3300042005	Ga0439448_0000010	Ga0439448_0000010_25334_26128	264
1313	3300042876	Ga0451577_0004101	Ga0451577_0004101_1845_2666	264
1314	3300044656	Ga0466969_0006244	Ga0466969_0006244_4212_5006	264
1315	3300044693	Ga0466961_0010176	Ga0466961_0010176_2627_3421	264
1316	3300044712	Ga0453684_0000121	Ga0453684_0000121_122331_123152	264
1317	3300044719	Ga0466971_0085763	Ga0466971_0085763_379_1173	264
1318	3300044765	Ga0466970_0122764	Ga0466970_0122764_99_893	264
1319	3300044842	Ga0466957_0135501	Ga0466957_0135501_99_893	264
1320	3300044901	Ga0466960_0034165	Ga0466960_0034165_563_1357	264
1321	3300045049	Ga0466959_0012085	Ga0466959_0012085_3773_4567	264
1322	3300045049	Ga0466959_0154470	Ga0466959_0154470_432_1226	264
1323	3300001979	JGI24740J21852_10000879	JGI24740J21852_1000087911	265
1324	3300001989	JGI24739J22299_10005422	JGI24739J22299_100054225	265
1325	3300001989	JGI24739J22299_10006203	JGI24739J22299_100062032	265
1326	3300001989	JGI24739J22299_10013704	JGI24739J22299_100137042	265
1327	3300002067	JGI24735J21928_10006447	JGI24735J21928_100064475	265
1328	3300002075	JGI24738J21930_10003693	JGI24738J21930_100036932	265
1329	3300002705	JGI25156J39149_1000664	JGI25156J39149_100066413	265
1330	3300002705	JGI25156J39149_1001065	JGI25156J39149_10010654	265
1331	3300002705	JGI25156J39149_1001192	JGI25156J39149_10011928	265
1332	3300003214	JGI25165J46597_1001095	JGI25165J46597_10010953	265
1333	3300003756	Ga0055533_1000205	Ga0055533_10002055	265
1334	3300003756	Ga0055533_1004187	Ga0055533_10041872	265
1335	3300003758	Ga0055532_1000007	Ga0055532_1000007259	265
1336	3300003760	Ga0055527_1000007	Ga0055527_1000007147	265
1337	3300003761	Ga0055535_1000005	Ga0055535_1000005259	265
1338	3300003762	Ga0055542_1000008	Ga0055542_1000008259	265
1339	3300003763	Ga0055529_1000005	Ga0055529_1000005259	265
1340	3300005327	Ga0070658_10005449	Ga0070658_100054496	265
1341	3300005344	Ga0070661_100166362	Ga0070661_1001663622	265
1342	3300005366	Ga0070659_100172141	Ga0070659_1001721412	265
1343	3300005456	Ga0070678_100053570	Ga0070678_1000535703	265
1344	3300005563	Ga0068855_100004782	Ga0068855_1000047823	265
1345	3300005563	Ga0068855_100253827	Ga0068855_1002538272	265
1346	3300009011	Ga0105251_10102649	Ga0105251_101026492	265
1347	3300009093	Ga0105240_10303644	Ga0105240_103036442	265
1348	3300009148	Ga0105243_10298403	Ga0105243_102984031	265
1349	3300009551	Ga0105238_10357627	Ga0105238_103576272	265
1350	3300013102	Ga0157371_10173501	Ga0157371_101735012	265
1351	3300013104	Ga0157370_10000978	Ga0157370_1000097819	265
1352	3300013105	Ga0157369_10000084	Ga0157369_10000084105	265
1353	3300013105	Ga0157369_10000178	Ga0157369_1000017860	265
1354	3300013105	Ga0157369_10032829	Ga0157369_100328292	265
1355	3300013307	Ga0157372_10254182	Ga0157372_102541822	265
1356	3300014497	Ga0182008_10062063	Ga0182008_100620632	265
1357	3300016635	Ga0183361_10003	Ga0183361_10003218	265
1358	3300020070	Ga0206356_10233507	Ga0206356_102335072	265
1359	3300022467	Ga0224712_10000033	Ga0224712_100000337	265
1360	3300025206	Ga0209435_101848	Ga0209435_1018483	265
1361	3300025226	Ga0209674_100020	Ga0209674_100020290	265
1362	3300025226	Ga0209674_100029	Ga0209674_10002998	265
1363	3300025228	Ga0209672_100013	Ga0209672_100013404	265
1364	3300025229	Ga0209147_100013	Ga0209147_100013280	265
1365	3300025231	Ga0207427_104197	Ga0207427_1041972	265
1366	3300025242	Ga0209258_100016	Ga0209258_100016404	265
1367	3300025254	Ga0209148_1000020	Ga0209148_1000020404	265
1368	3300025256	Ga0209759_1000008	Ga0209759_1000008259	265
1369	3300025256	Ga0209759_1000022	Ga0209759_1000022168	265
1370	3300025256	Ga0209759_1000052	Ga0209759_100005217	265
1371	3300025261	Ga0209233_1000055	Ga0209233_1000055143	265
1372	3300025272	Ga0209455_1000017	Ga0209455_1000017404	265
1373	3300025735	Ga0207713_1000401	Ga0207713_100040119	265
1374	3300025904	Ga0207647_10038302	Ga0207647_100383022	265
1375	3300025904	Ga0207647_10051497	Ga0207647_100514972	265
1376	3300025932	Ga0207690_10207803	Ga0207690_102078032	265
1377	3300025941	Ga0207711_10048700	Ga0207711_100487003	265
1378	3300025949	Ga0207667_10001018	Ga0207667_100010187	265
1379	3300026067	Ga0207678_10070107	Ga0207678_100701072	265
1380	3300026121	Ga0207683_10032411	Ga0207683_100324113	265
1381	3300027312	Ga0209371_1004239	Ga0209371_10042392	265
1382	3300030500	Ga0268256_1003971	Ga0268256_10039712	265
1383	3300031548	Ga0307408_100009082	Ga0307408_1000090821	265
1384	3300031911	Ga0307412_10000082	Ga0307412_1000008221	265
1385	3300031911	Ga0307412_10116855	Ga0307412_101168552	265
1386	3300037418	Ga0395900_0002516	Ga0395900_0002516_10138_10935	265
1387	3300037418	Ga0395900_0075702	Ga0395900_0075702_1995_2792	265
1388	3300037466	Ga0395898_0001980	Ga0395898_0001980_8045_8842	265
1389	3300037471	Ga0395905_0338165	Ga0395905_0338165_56_856	265
1390	3300039447	Ga0436361_0673985	Ga0436361_0673985_299_1096	265
1391	3300044658	Ga0466972_0053332	Ga0466972_0053332_626_1423	265
1392	3300044684	Ga0466966_0042121	Ga0466966_0042121_1067_1864	265
1393	3300044693	Ga0466961_0039542	Ga0466961_0039542_1329_2126	265
1394	3300044719	Ga0466971_0007704	Ga0466971_0007704_1971_2768	265
1395	3300044842	Ga0466957_0065491	Ga0466957_0065491_728_1525	265
1396	3300046454	Ga0495592_0004900	Ga0495592_0004900_2464_3261	265
1397	3300046455	Ga0495603_0196837	Ga0495603_0196837_186_983	265
1398	3300046457	Ga0495590_0007624	Ga0495590_0007624_513_1310	265
1399	3300046459	Ga0495629_0005681	Ga0495629_0005681_699_1496	265
1400	3300046460	Ga0495638_0023970	Ga0495638_0023970_1140_1937	265
1401	3300046461	Ga0495641_0044386	Ga0495641_0044386_494_1291	265
1402	3300046461	Ga0495641_0100519	Ga0495641_0100519_43_915	265
1403	3300046463	Ga0495653_0061926	Ga0495653_0061926_1366_2163	265
1404	3300046463	Ga0495653_0088994	Ga0495653_0088994_438_1235	265
1405	3300046471	Ga0495650_0003649	Ga0495650_0003649_3528_4325	265
1406	3300046474	Ga0495605_0010958	Ga0495605_0010958_454_1251	265
1407	3300046474	Ga0495605_0024442	Ga0495605_0024442_292_1089	265
1408	3300046477	Ga0495664_0029650	Ga0495664_0029650_2332_3129	265
1409	3300046491	Ga0495584_0156087	Ga0495584_0156087_207_1004	265
1410	3300046491	Ga0495584_0156252	Ga0495584_0156252_247_1044	265
1411	3300046500	Ga0495596_0005084	Ga0495596_0005084_1664_2461	265
1412	3300046506	Ga0495583_0002666	Ga0495583_0002666_9058_9855	265
1413	3300046507	Ga0495606_0026344	Ga0495606_0026344_735_1532	265
1414	3300046512	Ga0495610_0000281	Ga0495610_0000281_39409_40206	265
1415	3300046514	Ga0495618_0017955	Ga0495618_0017955_2106_2903	265
1416	3300046515	Ga0495620_0014853	Ga0495620_0014853_391_1188	265
1417	3300046516	Ga0495628_0018684	Ga0495628_0018684_4763_5560	265
1418	3300046517	Ga0495630_0021432	Ga0495630_0021432_2609_3406	265
1419	3300046526	Ga0495666_0003519	Ga0495666_0003519_3340_4137	265
1420	3300046526	Ga0495666_0093368	Ga0495666_0093368_552_1349	265
1421	3300046528	Ga0495642_0006334	Ga0495642_0006334_1702_2499	265
1422	3300046528	Ga0495642_0007489	Ga0495642_0007489_2504_3301	265
1423	3300046529	Ga0495652_0043504	Ga0495652_0043504_2396_3193	265
1424	3300046531	Ga0495665_0021088	Ga0495665_0021088_1366_2163	265
1425	3300046533	Ga0495640_0008119	Ga0495640_0008119_4437_5234	265
1426	3300046538	Ga0495609_0042730	Ga0495609_0042730_940_1737	265
1427	3300046557	Ga0495622_0000005	Ga0495622_0000005_228489_229286	265
1428	3300046559	Ga0495667_0022746	Ga0495667_0022746_961_1758	265
1429	3300046648	Ga0495611_0022203	Ga0495611_0022203_1424_2221	265
1430	3300046663	Ga0495635_0001935	Ga0495635_0001935_13228_14025	265
1431	3300046675	Ga0495657_0032773	Ga0495657_0032773_989_1786	265
1432	3300046679	Ga0495623_0049305	Ga0495623_0049305_1622_2419	265
1433	3300046680	Ga0495646_0007933	Ga0495646_0007933_2199_2996	265
1434	3300046694	Ga0495649_0018907	Ga0495649_0018907_1315_2112	265
1435	3300046694	Ga0495649_0027296	Ga0495649_0027296_1628_2425	265
1436	3300046809	Ga0495600_0025388	Ga0495600_0025388_629_1426	265
1437	3300047315	Ga0495581_0003725	Ga0495581_0003725_410_1207	265
1438	3300047317	Ga0495604_0053846	Ga0495604_0053846_1238_2035	265
1439	3300047322	Ga0495680_0030264	Ga0495680_0030264_2260_3057	265
1440	3300047323	Ga0495683_0016313	Ga0495683_0016313_1213_2010	265
1441	3300047323	Ga0495683_0029725	Ga0495683_0029725_903_1700	265
1442	3300047323	Ga0495683_0127558	Ga0495683_0127558_228_1025	265
1443	3300047443	Ga0495687_003938	Ga0495687_003938_4269_5066	265
1444	3300047444	Ga0495675_0003747	Ga0495675_0003747_4701_5498	265
1445	3300047446	Ga0495679_000009	Ga0495679_000009_78505_79302	265
1446	3300047469	Ga0495673_0155653	Ga0495673_0155653_72_869	265
1447	3300047472	Ga0495686_0037205	Ga0495686_0037205_1247_2056	265
1448	3300047472	Ga0495686_0093636	Ga0495686_0093636_817_1614	265
1449	3300047472	Ga0495686_0166036	Ga0495686_0166036_359_1156	265
1450	3300047673	Ga0495593_0017392	Ga0495593_0017392_2905_3702	265
1451	3300048089	Ga0495614_0008069	Ga0495614_0008069_3739_4536	265
1452	3300048091	Ga0495626_0027005	Ga0495626_0027005_583_1380	265
1453	3300048091	Ga0495626_0052987	Ga0495626_0052987_806_1603	265
1454	3300048091	Ga0495626_0074386	Ga0495626_0074386_452_1249	265
1455	3300048905	Ga0496102_0151281	Ga0496102_0151281_817_1614	265
1456	3300048919	Ga0496116_0038974	Ga0496116_0038974_1413_2222	265
1457	3300048920	Ga0496117_0019630	Ga0496117_0019630_3011_3808	265
1458	3300048920	Ga0496117_0050422	Ga0496117_0050422_1652_2449	265
1459	3300048920	Ga0496117_0082613	Ga0496117_0082613_460_1269	265
1460	3300048921	Ga0496118_0016947	Ga0496118_0016947_1544_2341	265
1461	3300048921	Ga0496118_0024099	Ga0496118_0024099_978_1775	265
1462	3300048924	Ga0496121_0000896	Ga0496121_0000896_7972_8775	265
1463	3300048924	Ga0496121_0016264	Ga0496121_0016264_5758_6582	265
1464	3300048924	Ga0496121_0165210	Ga0496121_0165210_233_1042	265
1465	3300048929	Ga0496126_0004229	Ga0496126_0004229_14747_15550	265
1466	3300059623	Ga0587101_008156	Ga0587101_008156_128_937	265
1467	3300061719	Ga0466962_0000165	Ga0466962_0000165_19178_19975	265
1468	iso_pu_bacteria	2510065045	2510248876	265
1469	iso_pu_bacteria	2718217991	2719642701	265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

208

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6z67-assembly3.cif.gz_E	ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution	0.9013	12	241
2it1-assembly1.cif.gz_B	structure of ph0203 protein from pyrococcus horikoshii	0.8986	14	245
8ja7-assembly1.cif.gz_D	cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose	0.8906	14	243
7caf-assembly1.cif.gz_C	mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state	0.8878	14	245
6mjp-assembly1.cif.gz_B	lptb(e163q)fgc from vibrio cholerae	0.887	14	243

ID	Description	Score	Start	End	Superfamily
af_P37388_2_240_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9524	12	255	3.40.50.300
af_P37388_2_240_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9446	12	255	3.40.50.300
af_Q6BEX0_1_254_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9431	1	255	3.40.50.300
af_P77509_7_245_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9331	11	252	3.40.50.300
af_P04983_1_243_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9315	12	260	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A7W8U6K7-F1-model_v4	Fructose transport system ATP-binding protein	0.9849	9	265	GO:0005524 GO:0016887
AF-A0A3S3EQK0-F1-model_v4	Sugar ABC transporter ATP-binding protein	0.9833	9	265	GO:0005524 GO:0016887
AF-A0A6J6IZJ1-F1-model_v4	Unannotated protein	0.9746	10	260	GO:0005524 GO:0016887
AF-A0A2U2S9Q4-F1-model_v4	ABC transporter ATP-binding protein	0.9732	12	259	GO:0005524 GO:0016887
AF-A0A2T0UCU5-F1-model_v4	Monosaccharide ABC transporter ATP-binding protein (CUT2 family)	0.9718	14	256	GO:0005524 GO:0016887

Feature Viewer

pLDDT	pTM	Quality
88.91	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494186

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

50

208

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map