F494142

General Info

Members Datasets Scaffolds Average Seq Length
1463 454 1439 133

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10281142|Ga0207665_102811422
Length 145
Sequence MADPKMRFLVVDDFSTMRRIVRNLLKELGYANVDEAEDGVMALAKLRSESFDFVVSDWNMPNMDGLTMLQNIRADPALAKLPVLMVTAEAKKENIIAAAQAGANGYVSKNLPIEQLYCVLARILATCQQRKRGVPNSEPVLAGAA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2821131069 Duganella sp. 1224 Isolate Unclassified
19 2842711865 Duganella sp. R-73148 Isolate Unclassified
20 2857553236 Duganella sp. R-74557 Isolate Unclassified
21 2857558681 Duganella sp. R-74565 Isolate Unclassified
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2904424332 Duganella sp. 1411 Isolate Rhizosphere
24 2919476304 Duganella sp. 3397 Isolate Unclassified
25 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
39 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
246 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
247 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
248 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
249 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
250 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
251 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
312 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
316 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
317 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
354 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
395 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
396 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
404 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
405 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
406 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
407 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
408 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
409 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
410 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
413 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
421 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
422 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
423 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
454 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 3.76
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0.27
Rhizoplane 4.85
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3883174 2162886011 Bacteria 873
2 CNXas_1000109 3300000545 Bacteria 15185
3 JGI25154J39366_1001666 3300002738 Bacteria 7369
4 JGI25158J39367_1016024 3300002739 Bacteria 950
5 JGI25158J39367_1026400 3300002739 Bacteria 678
6 JGI25152J39213_1000395 3300002773 Bacteria 26530
7 JGI25152J39213_1021195 3300002773 Bacteria 1144
8 JGI25150J39212_1001869 3300002774 Bacteria 5551
9 JGI25150J39212_1003324 3300002774 Bacteria 3787
10 JGI25159J45721_1004182 3300002987 Bacteria 4878
11 JGI25159J45721_1007879 3300002987 Bacteria 2996
12 JGI25159J45721_1008010 3300002987 Bacteria 2955
13 Ga0006759J45824_1074564 3300003163 Bacteria 691
14 JGI25151J46595_10143722 3300003187 Bacteria 578
15 JGI25406J46586_10000011 3300003203 Bacteria 104720
16 JGI25153J46596_10016332 3300003215 Bacteria 2979
17 Ga0006770J48903_1038274 3300003305 Bacteria 562
18 rootL2_10109828 3300003322 Bacteria 4438
19 JGI25160J50197_1012431 3300003354 Bacteria 2955
20 JGI25161J50226_1004160 3300003374 Bacteria 3096
21 JGI25161J50226_1006147 3300003374 Bacteria 2216
22 JGI25161J50226_1008312 3300003374 Bacteria 1612
23 Ga0007417J51691_1055251 3300003544 Bacteria 824
24 Ga0007409J51694_1016091 3300003575 Bacteria 1464
25 Ga0055525_1000001 3300003759 Bacteria 1016948
26 Ga0055529_1000146 3300003763 Bacteria 100947
27 Ga0055526_1000074 3300003771 Bacteria 92854
28 Ga0055526_1000299 3300003771 Bacteria 41248
29 Ga0055526_1004222 3300003771 Bacteria 8724
30 Ga0055526_1015299 3300003771 Bacteria 3088
31 Ga0055526_1030873 3300003771 Bacteria 1552
32 Ga0055537_1000154 3300003773 Bacteria 51753
33 Ga0055537_1020048 3300003773 Bacteria 1024
34 Ga0055524_1000021 3300003775 Bacteria 227578
35 Ga0055524_1000099 3300003775 Bacteria 107171
36 Ga0055524_1009788 3300003775 Bacteria 3867
37 Ga0055524_1020989 3300003775 Bacteria 2181
38 Ga0055534_1000513 3300003784 Bacteria 20944
39 Ga0055534_1037235 3300003784 Bacteria 728
40 Ga0055534_1046031 3300003784 Bacteria 630
41 Ga0055528_1007230 3300003790 Bacteria 4933
42 Ga0055528_1027547 3300003790 Bacteria 1595
43 Ga0055530_10101324 3300003791 Bacteria 578
44 Ga0055530_10104705 3300003791 Bacteria 564
45 Ga0055531_10003560 3300003794 Bacteria 9889
46 Ga0055543_1002596 3300004625 Bacteria 5842
47 Ga0055543_1005900 3300004625 Bacteria 3053
48 Ga0055543_1026489 3300004625 Bacteria 1030
49 Ga0065165_1000055 3300005262 Bacteria 187003
50 Ga0065165_1003015 3300005262 Bacteria 12716
51 Ga0065165_1013829 3300005262 Bacteria 3175
52 Ga0065165_1031771 3300005262 Bacteria 1664
53 Ga0065165_1044818 3300005262 Bacteria 1292
54 Ga0065704_10301195 3300005289 Unclassified 885
55 Ga0065712_10098684 3300005290 Unclassified 2108
56 Ga0065712_10381451 3300005290 Bacteria 752
57 Ga0070676_10006530 3300005328 Bacteria 6232
58 Ga0070676_10027936 3300005328 Bacteria 3203
59 Ga0070676_10100217 3300005328 Bacteria 1788
60 Ga0070690_100159858 3300005330 Bacteria 1543
61 Ga0070690_100533002 3300005330 Unclassified 883
62 Ga0070690_101299440 3300005330 Unclassified 583
63 Ga0070670_100002302 3300005331 Bacteria 15736
64 Ga0070670_100006241 3300005331 Bacteria 10083
65 Ga0070670_100890794 3300005331 Unclassified 806
66 Ga0070666_10041425 3300005335 Bacteria 3078
67 Ga0070666_11129305 3300005335 Unclassified 583
68 Ga0070680_100113297 3300005336 Bacteria 2259
69 Ga0068868_100039996 3300005338 Bacteria 3647
70 Ga0070660_100045119 3300005339 Bacteria 3373
71 Ga0070689_100045940 3300005340 Bacteria 3364
72 Ga0070689_100209478 3300005340 Bacteria 1595
73 Ga0070661_100199014 3300005344 Bacteria 1530
74 Ga0070661_100571449 3300005344 Bacteria 912
75 Ga0070661_100887244 3300005344 Bacteria 735
76 Ga0070668_100012213 3300005347 Bacteria 6398
77 Ga0070668_101247694 3300005347 Unclassified 674
78 Ga0070669_100014990 3300005353 Bacteria 5525
79 Ga0070669_100050766 3300005353 Bacteria 3030
80 Ga0070675_100033029 3300005354 Bacteria 4192
81 Ga0070675_100327014 3300005354 Bacteria 1355
82 Ga0070671_100015082 3300005355 Bacteria 6241
83 Ga0070671_100022258 3300005355 Bacteria 5177
84 Ga0070671_100750893 3300005355 Unclassified 848
85 Ga0070671_101048816 3300005355 Unclassified 715
86 Ga0070674_100316035 3300005356 Unclassified 1250
87 Ga0070688_100001382 3300005365 Bacteria 12060
88 Ga0070688_100393804 3300005365 Bacteria 1024
89 Ga0070659_100016372 3300005366 Bacteria 5566
90 Ga0070659_101646324 3300005366 Bacteria 573
91 Ga0070667_100001152 3300005367 Bacteria 23990
92 Ga0070667_100037387 3300005367 Unclassified 4070
93 Ga0070667_100130998 3300005367 Bacteria 2189
94 Ga0070710_11084711 3300005437 Bacteria 587
95 Ga0070711_100309067 3300005439 Bacteria 1260
96 Ga0070708_100069853 3300005445 Bacteria 3159
97 Ga0070708_100095985 3300005445 Bacteria 2707
98 Ga0070708_100151113 3300005445 Bacteria 2159
99 Ga0070708_100678736 3300005445 Unclassified 970
100 Ga0070708_100993817 3300005445 Unclassified 787
101 Ga0070663_100487664 3300005455 Bacteria 1021
102 Ga0070663_100750009 3300005455 Unclassified 833
103 Ga0070678_100032818 3300005456 Bacteria 3597
104 Ga0070678_101004950 3300005456 Bacteria 767
105 Ga0070678_101026758 3300005456 Bacteria 759
106 Ga0070662_100166473 3300005457 Unclassified 1728
107 Ga0070662_100309108 3300005457 Bacteria 1286
108 Ga0068867_100830696 3300005459 Unclassified 826
109 Ga0068867_101237614 3300005459 Bacteria 687
110 Ga0070706_100000116 3300005467 Bacteria 97606
111 Ga0070706_100018698 3300005467 Bacteria 6389
112 Ga0070706_100030413 3300005467 Bacteria 4976
113 Ga0070706_100035119 3300005467 Bacteria 4629
114 Ga0070706_100394020 3300005467 Bacteria 1289
115 Ga0070706_101359080 3300005467 Bacteria 651
116 Ga0070706_101692047 3300005467 Unclassified 576
117 Ga0070707_100002729 3300005468 Bacteria 16791
118 Ga0070707_100024521 3300005468 Bacteria 5713
119 Ga0070707_100025365 3300005468 Bacteria 5623
120 Ga0070707_100025898 3300005468 Bacteria 5567
121 Ga0070707_100036840 3300005468 Bacteria 4669
122 Ga0070707_100040136 3300005468 Bacteria 4477
123 Ga0070707_100172499 3300005468 Bacteria 2107
124 Ga0070707_100174613 3300005468 Bacteria 2094
125 Ga0070707_100430691 3300005468 Bacteria 1279
126 Ga0070707_100634912 3300005468 Bacteria 1030
127 Ga0070707_101153467 3300005468 Bacteria 741
128 Ga0070698_100003134 3300005471 Bacteria 18214
129 Ga0070698_100010744 3300005471 Bacteria 9742
130 Ga0070698_100097143 3300005471 Unclassified 2922
131 Ga0070698_100521070 3300005471 Unclassified 1127
132 Ga0070698_101424514 3300005471 Unclassified 644
133 Ga0070699_100073974 3300005518 Bacteria 2964
134 Ga0070699_100121464 3300005518 Unclassified 2297
135 Ga0070699_100970298 3300005518 Bacteria 779
136 Ga0070679_101207007 3300005530 Bacteria 702
137 Ga0070697_100003060 3300005536 Bacteria 12826
138 Ga0070697_100004215 3300005536 Bacteria 11014
139 Ga0070697_100014381 3300005536 Bacteria 6216
140 Ga0070697_100045646 3300005536 Bacteria 3551
141 Ga0070697_100070956 3300005536 Unclassified 2856
142 Ga0070697_100171703 3300005536 Unclassified 1835
143 Ga0070697_100184858 3300005536 Unclassified 1767
144 Ga0070697_100362220 3300005536 Bacteria 1253
145 Ga0070697_101366158 3300005536 Bacteria 632
146 Ga0070672_100003958 3300005543 Bacteria 9661
147 Ga0070672_100311686 3300005543 Bacteria 1336
148 Ga0070672_100552408 3300005543 Unclassified 1000
149 Ga0070672_101073981 3300005543 Bacteria 715
150 Ga0070695_100045457 3300005545 Bacteria 2798
151 Ga0070693_100285770 3300005547 Unclassified 1106
152 Ga0070665_100046012 3300005548 Bacteria 4383
153 Ga0070665_100159514 3300005548 Unclassified 2257
154 Ga0070704_100924943 3300005549 Unclassified 785
155 Ga0070704_100937297 3300005549 Bacteria 780
156 Ga0068855_100044300 3300005563 Bacteria 5266
157 Ga0070664_100257608 3300005564 Unclassified 1569
158 Ga0070664_100271830 3300005564 Bacteria 1527
159 Ga0070664_100792839 3300005564 Bacteria 885
160 Ga0070664_101708942 3300005564 Bacteria 596
161 Ga0068857_100381724 3300005577 Bacteria 1308
162 Ga0068856_100937236 3300005614 Bacteria 885
163 Ga0068856_101631923 3300005614 Bacteria 658
164 Ga0070702_100522835 3300005615 Unclassified 875
165 Ga0070702_101523037 3300005615 Bacteria 551
166 Ga0068852_100132069 3300005616 Bacteria 2300
167 Ga0068866_10030064 3300005718 Unclassified 2603
168 Ga0068866_10155285 3300005718 Unclassified 1329
169 Ga0068851_10140563 3300005834 Bacteria 1313
170 Ga0068860_100603401 3300005843 Bacteria 1103
171 Ga0081540_1195395 3300005983 Unclassified 741
172 Ga0081539_10000139 3300005985 Bacteria 170623
173 Ga0081539_10002232 3300005985 Bacteria 28218
174 Ga0081539_10012174 3300005985 Bacteria 6675
175 Ga0081539_10052402 3300005985 Bacteria 2291
176 Ga0081539_10052887 3300005985 Bacteria 2277
177 Ga0070717_10002406 3300006028 Bacteria 13200
178 Ga0070717_10006132 3300006028 Bacteria 8828
179 Ga0070717_10148449 3300006028 Bacteria 2027
180 Ga0075364_10477428 3300006051 Bacteria 852
181 Ga0070716_100306864 3300006173 Unclassified 1106
182 Ga0070716_100311420 3300006173 Unclassified 1099
183 Ga0070716_100350730 3300006173 Bacteria 1044
184 Ga0070716_100643389 3300006173 Bacteria 803
185 Ga0075362_10055685 3300006177 Bacteria 1779
186 Ga0097621_100004370 3300006237 Bacteria 9828
187 Ga0097621_100004743 3300006237 Bacteria 9503
188 Ga0097621_101288069 3300006237 Unclassified 690
189 Ga0068871_100017920 3300006358 Bacteria 5370
190 Ga0068871_100040568 3300006358 Bacteria 3729
191 Ga0068871_100127459 3300006358 Bacteria 2155
192 Ga0068871_100263499 3300006358 Bacteria 1504
193 Ga0075433_10655378 3300006852 Unclassified 920
194 Ga0075434_100073372 3300006871 Bacteria 3415
195 Ga0075434_101182136 3300006871 Unclassified 777
196 Ga0068865_100083101 3300006881 Unclassified 2304
197 Ga0068865_100183875 3300006881 Bacteria 1611
198 Ga0075436_100021119 3300006914 Bacteria 4467
199 Ga0079104_1020522 3300006946 Bacteria 1818
200 Ga0099826_10000002 3300006948 Bacteria 1125830
201 Ga0099794_10138050 3300007265 Bacteria 1234
202 Ga0105244_10001358 3300009036 Bacteria 19911
203 Ga0105244_10001435 3300009036 Bacteria 19281
204 Ga0105244_10066484 3300009036 Bacteria 1804
205 Ga0105244_10526848 3300009036 Bacteria 544
206 Ga0105250_10242911 3300009092 Bacteria 768
207 Ga0105240_10686415 3300009093 Bacteria 1119
208 Ga0105240_10813296 3300009093 Unclassified 1011
209 Ga0105240_11305553 3300009093 Bacteria 765
210 Ga0111539_10260786 3300009094 Unclassified 2017
211 Ga0105245_10084318 3300009098 Bacteria 2911
212 Ga0105245_10119936 3300009098 Bacteria 2456
213 Ga0105245_10167216 3300009098 Bacteria 2091
214 Ga0105245_10651147 3300009098 Unclassified 1084
215 Ga0105245_13006666 3300009098 Bacteria 523
216 Ga0105243_10234788 3300009148 Bacteria 1629
217 Ga0105243_11841945 3300009148 Bacteria 637
218 Ga0105241_10193522 3300009174 Bacteria 1694
219 Ga0105242_10021980 3300009176 Bacteria 5014
220 Ga0105242_10974916 3300009176 Bacteria 854
221 Ga0105248_11780232 3300009177 Bacteria 698
222 Ga0105237_10302030 3300009545 Unclassified 1604
223 Ga0105237_10856390 3300009545 Bacteria 916
224 Ga0105238_10362340 3300009551 Bacteria 1439
225 Ga0105239_10068393 3300010375 Bacteria 3903
226 Ga0105239_10492732 3300010375 Bacteria 1393
227 Ga0105239_12258985 3300010375 Unclassified 633
228 Ga0157327_1013057 3300012512 Bacteria 829
229 Ga0157373_10078322 3300013100 Bacteria 2331
230 Ga0157373_10634948 3300013100 Bacteria 779
231 Ga0157373_11009385 3300013100 Bacteria 621
232 Ga0157371_10000078 3300013102 Bacteria 154095
233 Ga0157370_10796901 3300013104 Bacteria 860
234 Ga0157374_10020633 3300013296 Bacteria 5851
235 Ga0157374_10099139 3300013296 Unclassified 2790
236 Ga0157374_10116843 3300013296 Unclassified 2571
237 Ga0157374_10255295 3300013296 Bacteria 1726
238 Ga0157374_10610886 3300013296 Bacteria 1101
239 Ga0157378_10022702 3300013297 Bacteria 5523
240 Ga0157378_10023772 3300013297 Bacteria 5391
241 Ga0157378_10093439 3300013297 Bacteria 2738
242 Ga0157378_10093654 3300013297 Bacteria 2735
243 Ga0157378_10156781 3300013297 Bacteria 2126
244 Ga0157378_10258166 3300013297 Bacteria 1671
245 Ga0157378_10271158 3300013297 Bacteria 1632
246 Ga0157378_10297016 3300013297 Unclassified 1562
247 Ga0157378_10486787 3300013297 Bacteria 1230
248 Ga0157378_10626109 3300013297 Unclassified 1090
249 Ga0157378_10897282 3300013297 Unclassified 917
250 Ga0157378_12407997 3300013297 Bacteria 578
251 Ga0163162_10004766 3300013306 Bacteria 13090
252 Ga0163162_10112128 3300013306 Bacteria 2826
253 Ga0163162_10262665 3300013306 Bacteria 1858
254 Ga0157372_10224982 3300013307 Unclassified 2175
255 Ga0157372_10877763 3300013307 Bacteria 1041
256 Ga0157375_10000847 3300013308 Bacteria 26687
257 Ga0157375_10016097 3300013308 Bacteria 6709
258 Ga0157375_10168179 3300013308 Bacteria 2338
259 Ga0157375_10387053 3300013308 Bacteria 1565
260 Ga0157375_13139799 3300013308 Bacteria 551
261 Ga0182008_10021358 3300014497 Bacteria 3324
262 Ga0157377_11272339 3300014745 Bacteria 573
263 Ga0157376_10002921 3300014969 Bacteria 11722
264 Ga0157376_10486261 3300014969 Bacteria 1210
265 Ga0157376_10568546 3300014969 Bacteria 1124
266 Ga0182006_1000026 3300015261 Bacteria 253543
267 Ga0182006_1037798 3300015261 Bacteria 1912
268 Ga0182006_1097963 3300015261 Bacteria 1045
269 Ga0182006_1195413 3300015261 Bacteria 671
270 Ga0182007_10086611 3300015262 Bacteria 1030
271 Ga0182007_10276411 3300015262 Bacteria 610
272 Ga0182005_1000007 3300015265 Bacteria 490994
273 Ga0182005_1081840 3300015265 Bacteria 892
274 Ga0163161_10040505 3300017792 Bacteria 3346
275 Ga0163161_10262967 3300017792 Bacteria 1348
276 Ga0206351_10247105 3300020077 Bacteria 1290
277 Ga0206353_10452765 3300020082 Bacteria 590
278 Ga0154015_1381368 3300020610 Bacteria 982
279 Ga0213872_10000028 3300021361 Bacteria 148766
280 Ga0213872_10006879 3300021361 Bacteria 5659
281 Ga0213872_10033421 3300021361 Bacteria 2356
282 Ga0209436_100351 3300025208 Bacteria 20779
283 Ga0209436_103199 3300025208 Bacteria 4460
284 Ga0209563_100007 3300025230 Bacteria 1579402
285 Ga0209437_108742 3300025233 Bacteria 1608
286 Ga0209437_114140 3300025233 Bacteria 1121
287 Ga0207425_1000001 3300025245 Bacteria 2525432
288 Ga0207425_1000327 3300025245 Bacteria 33618
289 Ga0207425_1000339 3300025245 Bacteria 32468
290 Ga0207425_1064128 3300025245 Bacteria 642
291 Ga0209646_1000010 3300025246 Bacteria 573803
292 Ga0209677_104764 3300025253 Bacteria 3783
293 Ga0209148_1000360 3300025254 Bacteria 57908
294 Ga0209129_1000001 3300025258 Bacteria 1452436
295 Ga0209129_1011719 3300025258 Bacteria 2071
296 Ga0209565_1000057 3300025263 Bacteria 196908
297 Ga0209565_1003411 3300025263 Bacteria 5154
298 Ga0209565_1003951 3300025263 Bacteria 4642
299 Ga0209565_1087400 3300025263 Bacteria 506
300 Ga0209455_1000037 3300025272 Bacteria 464097
301 Ga0209673_1000051 3300025273 Bacteria 282161
302 Ga0209673_1007915 3300025273 Bacteria 4803
303 Ga0209130_1000091 3300025284 Bacteria 149502
304 Ga0209130_1002422 3300025284 Bacteria 9393
305 Ga0209130_1002705 3300025284 Bacteria 8437
306 Ga0209675_1000027 3300025291 Bacteria 282175
307 Ga0209675_1001211 3300025291 Bacteria 15650
308 Ga0209675_1005738 3300025291 Bacteria 5124
309 Ga0209675_1024807 3300025291 Bacteria 1524
310 Ga0209025_1005014 3300025294 Bacteria 11056
311 Ga0209564_1000009 3300025295 Bacteria 950196
312 Ga0209564_1000068 3300025295 Bacteria 311171
313 Ga0209564_1000094 3300025295 Bacteria 243176
314 Ga0209564_1001487 3300025295 Bacteria 23618
315 Ga0209564_1007956 3300025295 Bacteria 5334
316 Ga0209564_1010315 3300025295 Bacteria 4323
317 Ga0209564_1038751 3300025295 Bacteria 1321
318 Ga0209758_1000073 3300025297 Bacteria 276262
319 Ga0209758_1000227 3300025297 Bacteria 120073
320 Ga0209050_1000046 3300025298 Bacteria 386466
321 Ga0209050_1000442 3300025298 Bacteria 75310
322 Ga0209256_1000044 3300025299 Bacteria 337264
323 Ga0209256_1000116 3300025299 Bacteria 169876
324 Ga0209256_1000145 3300025299 Bacteria 150609
325 Ga0209256_1000988 3300025299 Bacteria 34026
326 Ga0209256_1007853 3300025299 Bacteria 5124
327 Ga0207426_1003827 3300025302 Bacteria 7778
328 Ga0209051_1045983 3300025303 Bacteria 1505
329 Ga0209257_1000068 3300025304 Bacteria 341291
330 Ga0207697_10000230 3300025315 Bacteria 30289
331 Ga0207656_10147600 3300025321 Bacteria 1112
332 Ga0207655_1015761 3300025728 Bacteria 4179
333 Ga0207642_10018395 3300025899 Bacteria 2681
334 Ga0207642_10133315 3300025899 Bacteria 1300
335 Ga0207642_11051782 3300025899 Bacteria 525
336 Ga0207688_10028875 3300025901 Bacteria 3051
337 Ga0207680_10022988 3300025903 Bacteria 3398
338 Ga0207699_10353593 3300025906 Bacteria 1037
339 Ga0207705_10001972 3300025909 Bacteria 15970
340 Ga0207705_10526539 3300025909 Bacteria 919
341 Ga0207684_10000190 3300025910 Bacteria 97762
342 Ga0207684_10030054 3300025910 Bacteria 4626
343 Ga0207684_10031627 3300025910 Bacteria 4501
344 Ga0207684_10059588 3300025910 Bacteria 3242
345 Ga0207684_10070092 3300025910 Bacteria 2979
346 Ga0207684_10539954 3300025910 Bacteria 998
347 Ga0207684_10779762 3300025910 Bacteria 809
348 Ga0207654_10008161 3300025911 Bacteria 5281
349 Ga0207671_10204875 3300025914 Unclassified 1541
350 Ga0207671_10830194 3300025914 Bacteria 732
351 Ga0207660_10057168 3300025917 Bacteria 2794
352 Ga0207657_10871977 3300025919 Bacteria 694
353 Ga0207649_10228473 3300025920 Bacteria 1329
354 Ga0207652_10809247 3300025921 Bacteria 832
355 Ga0207646_10003785 3300025922 Bacteria 16837
356 Ga0207646_10009717 3300025922 Bacteria 9483
357 Ga0207646_10015435 3300025922 Bacteria 7213
358 Ga0207646_10047841 3300025922 Bacteria 3835
359 Ga0207646_10114655 3300025922 Bacteria 2420
360 Ga0207646_10120029 3300025922 Bacteria 2362
361 Ga0207646_11511300 3300025922 Unclassified 581
362 Ga0207646_11862424 3300025922 Bacteria 513
363 Ga0207681_10069268 3300025923 Unclassified 2453
364 Ga0207681_10666174 3300025923 Unclassified 863
365 Ga0207694_10368309 3300025924 Bacteria 1191
366 Ga0207650_10015523 3300025925 Bacteria 5305
367 Ga0207650_11819441 3300025925 Bacteria 515
368 Ga0207659_10049775 3300025926 Bacteria 2973
369 Ga0207659_10203549 3300025926 Bacteria 1582
370 Ga0207687_10518458 3300025927 Bacteria 997
371 Ga0207644_10543189 3300025931 Unclassified 961
372 Ga0207644_11170587 3300025931 Unclassified 646
373 Ga0207690_10010877 3300025932 Bacteria 5422
374 Ga0207690_10152984 3300025932 Bacteria 1712
375 Ga0207690_11221363 3300025932 Bacteria 628
376 Ga0207706_10120143 3300025933 Unclassified 2310
377 Ga0207706_10127098 3300025933 Bacteria 2241
378 Ga0207706_10365512 3300025933 Bacteria 1253
379 Ga0207686_10028891 3300025934 Bacteria 3265
380 Ga0207686_10399664 3300025934 Unclassified 1046
381 Ga0207709_10683063 3300025935 Bacteria 820
382 Ga0207670_10026701 3300025936 Bacteria 3642
383 Ga0207670_10267760 3300025936 Unclassified 1327
384 Ga0207669_10125945 3300025937 Bacteria 1750
385 Ga0207669_11362432 3300025937 Unclassified 603
386 Ga0207704_10225664 3300025938 Bacteria 1389
387 Ga0207704_10339819 3300025938 Bacteria 1165
388 Ga0207665_10019448 3300025939 Bacteria 4465
389 Ga0207665_10082276 3300025939 Unclassified 2218
390 Ga0207665_10281142 3300025939 Bacteria 1238
391 Ga0207691_10001130 3300025940 Bacteria 26498
392 Ga0207691_10227193 3300025940 Bacteria 1617
393 Ga0207691_10312466 3300025940 Bacteria 1348
394 Ga0207691_11053828 3300025940 Bacteria 677
395 Ga0207691_11186069 3300025940 Unclassified 633
396 Ga0207679_10083312 3300025945 Bacteria 2451
397 Ga0207679_10088846 3300025945 Bacteria 2384
398 Ga0207667_10027566 3300025949 Bacteria 6180
399 Ga0207651_10987501 3300025960 Bacteria 752
400 Ga0207668_10236886 3300025972 Unclassified 1474
401 Ga0207668_10542504 3300025972 Bacteria 1006
402 Ga0207640_10715427 3300025981 Bacteria 860
403 Ga0207658_10010500 3300025986 Bacteria 6289
404 Ga0207677_10063774 3300026023 Bacteria 2563
405 Ga0207677_12103007 3300026023 Unclassified 525
406 Ga0207678_10063189 3300026067 Bacteria 3181
407 Ga0207678_10295105 3300026067 Unclassified 1392
408 Ga0207702_10880136 3300026078 Bacteria 887
409 Ga0207702_11275697 3300026078 Bacteria 729
410 Ga0207648_10098010 3300026089 Bacteria 2566
411 Ga0207648_10225463 3300026089 Bacteria 1666
412 Ga0207648_11146711 3300026089 Bacteria 729
413 Ga0207674_11315610 3300026116 Bacteria 692
414 Ga0207683_10006813 3300026121 Bacteria 9784
415 Ga0207683_10336655 3300026121 Bacteria 1384
416 Ga0207698_10222334 3300026142 Bacteria 1707
417 Ga0209281_1005666 3300027111 Bacteria 3412
418 Ga0209282_1000001 3300027666 Bacteria 2450367
419 Ga0268266_10013072 3300028379 Bacteria 7159
420 Ga0316180_1109616 3300030736 Bacteria 3644
421 Ga0316183_1134260 3300030742 Bacteria 893
422 Ga0316181_1070955 3300030744 Bacteria 1466
423 Ga0316181_1263623 3300030744 Bacteria 1678
424 Ga0316182_1023982 3300030745 Bacteria 3939
425 Ga0265316_10067224 3300031344 Bacteria 2772
426 Ga0265316_11107695 3300031344 Bacteria 549
427 Ga0307513_10136437 3300031456 Bacteria 2388
428 Ga0307408_100000981 3300031548 Bacteria 22068
429 Ga0307408_100001472 3300031548 Bacteria 17464
430 Ga0307408_100002767 3300031548 Bacteria 12179
431 Ga0307408_101680490 3300031548 Bacteria 604
432 Ga0307508_10139506 3300031616 Bacteria 2027
433 Ga0307518_10137449 3300031838 Bacteria 1709
434 Ga0307406_12051234 3300031901 Bacteria 512
435 Ga0307412_10476873 3300031911 Bacteria 1034
436 Ga0307412_10502414 3300031911 Bacteria 1010
437 Ga0307412_12064263 3300031911 Bacteria 529
438 Ga0307416_100011426 3300032002 Bacteria 5921
439 Ga0307416_101432393 3300032002 Bacteria 797
440 Ga0307416_102723184 3300032002 Bacteria 591
441 Ga0307414_10020067 3300032004 Bacteria 4156
442 Ga0307414_10541653 3300032004 Bacteria 1036
443 Ga0307411_10968862 3300032005 Bacteria 760
444 Ga0307415_102043720 3300032126 Bacteria 559
445 Ga0373943_0048876 3300035170 Bacteria 2074
446 Ga0373943_0947714 3300035170 Unclassified 515
447 Ga0373947_0040081 3300035725 Bacteria 2789
448 Ga0373947_0126165 3300035725 Bacteria 1630
449 Ga0373937_0168600 3300036401 Bacteria 2054
450 Ga0373925_0080283 3300037068 Bacteria 2479
451 Ga0373925_0771979 3300037068 Unclassified 792
452 Ga0395899_0000082 3300037312 Bacteria 168513
453 Ga0395899_0016969 3300037312 Bacteria 5549
454 Ga0395899_0024287 3300037312 Bacteria 4584
455 Ga0395899_0210055 3300037312 Bacteria 1353
456 Ga0395900_0000393 3300037418 Bacteria 63296
457 Ga0395900_0019995 3300037418 Bacteria 6826
458 Ga0395900_0046773 3300037418 Bacteria 4455
459 Ga0395900_0092327 3300037418 Bacteria 3110
460 Ga0395900_0113588 3300037418 Bacteria 2779
461 Ga0395900_0184192 3300037418 Bacteria 2120
462 Ga0395900_1822254 3300037418 Bacteria 519
463 Ga0395898_0106973 3300037466 Bacteria 2682
464 Ga0395898_0152641 3300037466 Bacteria 2209
465 Ga0395898_1003428 3300037466 Bacteria 770
466 Ga0395898_1377172 3300037466 Bacteria 633
467 Ga0395905_0009206 3300037471 Bacteria 9668
468 Ga0395905_0047340 3300037471 Bacteria 4030
469 Ga0395905_0549185 3300037471 Bacteria 1056
470 Ga0395905_0569842 3300037471 Bacteria 1034
471 Ga0395905_0701342 3300037471 Bacteria 914
472 Ga0395905_1823413 3300037471 Bacteria 514
473 Ga0395905_1847022 3300037471 Bacteria 510
474 Ga0436364_0101037 3300037853 Bacteria 585
475 Ga0395901_0000054 3300038443 Bacteria 160505
476 Ga0395901_0010533 3300038443 Bacteria 9365
477 Ga0395901_0163525 3300038443 Bacteria 2337
478 Ga0395901_0334325 3300038443 Bacteria 1565
479 Ga0395901_0359500 3300038443 Bacteria 1501
480 Ga0395901_1163544 3300038443 Bacteria 739
481 Ga0436361_0605732 3300039447 Bacteria 3541
482 Ga0436361_0616428 3300039447 Bacteria 15855
483 Ga0436361_1222516 3300039447 Bacteria 588
484 Ga0439436_0045720 3300041404 Bacteria 1245
485 Ga0451807_2769524 3300041486 Unclassified 669
486 Ga0451835_0242121 3300041492 Unclassified 506
487 Ga0451853_2377098 3300041512 Bacteria 678
488 Ga0451853_2842729 3300041512 Unclassified 854
489 Ga0451853_3225716 3300041512 Bacteria 855
490 Ga0439448_0316470 3300042005 Bacteria 555
491 Ga0439449_0028091 3300042007 Bacteria 2097
492 Ga0439450_156315 3300042008 Bacteria 599
493 Ga0439454_004952 3300042011 Bacteria 1567
494 Ga0439455_0105379 3300042012 Bacteria 781
495 Ga0450911_020566 3300042115 Bacteria 862
496 Ga0450920_092727 3300042122 Bacteria 624
497 Ga0450898_106442 3300042134 Bacteria 590
498 Ga0450904_000438 3300042139 Bacteria 8300
499 Ga0439446_0134383 3300042156 Bacteria 804
500 Ga0450893_0090164 3300042532 Bacteria 615
501 Ga0451577_0107899 3300042876 Bacteria 2489
502 Ga0451577_1143792 3300042876 Bacteria 695
503 Ga0466969_0062179 3300044656 Bacteria 1812
504 Ga0466969_0205223 3300044656 Bacteria 898
505 Ga0466972_0000042 3300044658 Bacteria 131971
506 Ga0466972_0127184 3300044658 Bacteria 1200
507 Ga0466972_0130545 3300044658 Bacteria 1183
508 Ga0466982_0387196 3300044672 Bacteria 762
509 Ga0466965_0123291 3300044683 Bacteria 1339
510 Ga0466965_0159673 3300044683 Bacteria 1181
511 Ga0466965_0182269 3300044683 Bacteria 1108
512 Ga0466966_0034358 3300044684 Bacteria 3278
513 Ga0466966_0180341 3300044684 Bacteria 1281
514 Ga0466963_0184915 3300044694 Bacteria 1455
515 Ga0466964_0000091 3300044706 Bacteria 21332
516 Ga0466964_0052645 3300044706 Bacteria 1673
517 Ga0466964_0429360 3300044706 Bacteria 696
518 Ga0453684_0000917 3300044712 Bacteria 97990
519 Ga0453684_1277106 3300044712 Bacteria 767
520 Ga0466971_0210479 3300044719 Bacteria 919
521 Ga0466971_0242506 3300044719 Bacteria 857
522 Ga0466968_0000777 3300044735 Bacteria 11090
523 Ga0466957_0166814 3300044842 Bacteria 1432
524 Ga0466957_0218946 3300044842 Bacteria 1256
525 Ga0466960_0144687 3300044901 Bacteria 1265
526 Ga0466960_0312230 3300044901 Bacteria 888
527 Ga0466960_0574434 3300044901 Bacteria 667
528 Ga0466959_0028509 3300045049 Bacteria 4140
529 Ga0466959_0220493 3300045049 Bacteria 1315
530 Ga0451576_0365370 3300045051 Bacteria 1512
531 Ga0466958_0208527 3300045836 Bacteria 1244
532 Ga0466967_0015997 3300045976 Bacteria 5900
533 Ga0466967_0118372 3300045976 Bacteria 2443
534 Ga0466967_0181032 3300045976 Bacteria 1988
535 Ga0495617_000041 3300046452 Bacteria 124027
536 Ga0495617_000057 3300046452 Bacteria 100673
537 Ga0495617_001102 3300046452 Bacteria 12291
538 Ga0495617_026400 3300046452 Bacteria 1955
539 Ga0495617_033783 3300046452 Bacteria 1716
540 Ga0495617_234914 3300046452 Bacteria 567
541 Ga0495627_000007 3300046453 Bacteria 575915
542 Ga0495627_001004 3300046453 Bacteria 18981
543 Ga0495627_014641 3300046453 Bacteria 2730
544 Ga0495603_0057009 3300046455 Bacteria 2312
545 Ga0495603_0183470 3300046455 Bacteria 1210
546 Ga0495603_0327998 3300046455 Bacteria 878
547 Ga0495603_0394385 3300046455 Bacteria 793
548 Ga0495590_0000001 3300046457 Bacteria 762984
549 Ga0495590_0000018 3300046457 Bacteria 216375
550 Ga0495590_0000251 3300046457 Bacteria 29217
551 Ga0495590_0003051 3300046457 Bacteria 6864
552 Ga0495590_0016843 3300046457 Bacteria 2637
553 Ga0495590_0122654 3300046457 Bacteria 931
554 Ga0495590_0186459 3300046457 Bacteria 759
555 Ga0495591_004295 3300046458 Bacteria 7030
556 Ga0495591_020659 3300046458 Bacteria 2169
557 Ga0495629_0008847 3300046459 Bacteria 7403
558 Ga0495629_0041207 3300046459 Bacteria 3249
559 Ga0495629_0093578 3300046459 Bacteria 2097
560 Ga0495629_0171494 3300046459 Bacteria 1505
561 Ga0495629_0377308 3300046459 Unclassified 965
562 Ga0495638_0000423 3300046460 Bacteria 51134
563 Ga0495638_0001950 3300046460 Bacteria 17693
564 Ga0495638_0002366 3300046460 Bacteria 15443
565 Ga0495638_0025941 3300046460 Bacteria 3804
566 Ga0495638_0097743 3300046460 Bacteria 1760
567 Ga0495638_0125695 3300046460 Bacteria 1511
568 Ga0495638_0148394 3300046460 Bacteria 1362
569 Ga0495638_0287897 3300046460 Bacteria 890
570 Ga0495653_0000002 3300046463 Bacteria 507262
571 Ga0495653_0005312 3300046463 Bacteria 10477
572 Ga0495653_0123169 3300046463 Bacteria 1844
573 Ga0495653_0126365 3300046463 Bacteria 1815
574 Ga0495653_0242459 3300046463 Bacteria 1200
575 Ga0495650_0000108 3300046471 Bacteria 200369
576 Ga0495650_0000118 3300046471 Bacteria 187358
577 Ga0495650_0000156 3300046471 Bacteria 155338
578 Ga0495650_0000166 3300046471 Bacteria 146047
579 Ga0495650_0001417 3300046471 Bacteria 23322
580 Ga0495650_0004758 3300046471 Bacteria 9125
581 Ga0495650_0033948 3300046471 Bacteria 2264
582 Ga0495650_0056190 3300046471 Bacteria 1598
583 Ga0495650_0129330 3300046471 Bacteria 922
584 Ga0495580_0029634 3300046472 Bacteria 3970
585 Ga0495580_0685629 3300046472 Bacteria 672
586 Ga0495582_0007542 3300046473 Bacteria 6017
587 Ga0495582_0096997 3300046473 Bacteria 1648
588 Ga0495582_0149706 3300046473 Bacteria 1325
589 Ga0495582_0378240 3300046473 Bacteria 816
590 Ga0495582_0717439 3300046473 Bacteria 578
591 Ga0495605_0000059 3300046474 Bacteria 146371
592 Ga0495605_0000260 3300046474 Bacteria 61729
593 Ga0495605_0000598 3300046474 Bacteria 28458
594 Ga0495605_0001111 3300046474 Bacteria 17923
595 Ga0495605_0003011 3300046474 Bacteria 10174
596 Ga0495605_0008745 3300046474 Bacteria 5716
597 Ga0495605_0029751 3300046474 Bacteria 2806
598 Ga0495605_0030368 3300046474 Bacteria 2772
599 Ga0495605_0037060 3300046474 Bacteria 2455
600 Ga0495605_0041669 3300046474 Bacteria 2286
601 Ga0495605_0062056 3300046474 Bacteria 1786
602 Ga0495605_0069744 3300046474 Bacteria 1663
603 Ga0495605_0089022 3300046474 Bacteria 1433
604 Ga0495605_0278526 3300046474 Bacteria 711
605 Ga0495605_0361635 3300046474 Bacteria 607
606 Ga0495605_0378819 3300046474 Bacteria 590
607 Ga0495639_0250894 3300046475 Bacteria 875
608 Ga0495664_0703930 3300046477 Bacteria 597
609 Ga0495584_0000006 3300046491 Bacteria 301775
610 Ga0495584_0001835 3300046491 Bacteria 12335
611 Ga0495584_0001841 3300046491 Bacteria 12302
612 Ga0495584_0002247 3300046491 Bacteria 11024
613 Ga0495584_0004974 3300046491 Bacteria 7082
614 Ga0495584_0007211 3300046491 Bacteria 5802
615 Ga0495584_0011682 3300046491 Bacteria 4493
616 Ga0495584_0013361 3300046491 Bacteria 4192
617 Ga0495584_0013827 3300046491 Bacteria 4114
618 Ga0495584_0036310 3300046491 Bacteria 2490
619 Ga0495584_0036816 3300046491 Bacteria 2471
620 Ga0495584_0041304 3300046491 Bacteria 2328
621 Ga0495584_0047001 3300046491 Bacteria 2176
622 Ga0495584_0058346 3300046491 Bacteria 1941
623 Ga0495584_0089372 3300046491 Bacteria 1553
624 Ga0495584_0091051 3300046491 Bacteria 1538
625 Ga0495584_0237158 3300046491 Bacteria 927
626 Ga0495584_0666068 3300046491 Bacteria 530
627 Ga0495585_0000282 3300046492 Bacteria 50936
628 Ga0495585_0003548 3300046492 Bacteria 10477
629 Ga0495585_0004128 3300046492 Bacteria 9503
630 Ga0495585_0004783 3300046492 Bacteria 8711
631 Ga0495585_0007364 3300046492 Bacteria 6745
632 Ga0495585_0008922 3300046492 Bacteria 6048
633 Ga0495585_0011838 3300046492 Bacteria 5153
634 Ga0495585_0014509 3300046492 Bacteria 4587
635 Ga0495585_0016543 3300046492 Bacteria 4273
636 Ga0495585_0023658 3300046492 Bacteria 3525
637 Ga0495585_0042612 3300046492 Bacteria 2541
638 Ga0495585_0047888 3300046492 Bacteria 2378
639 Ga0495585_0097886 3300046492 Bacteria 1572
640 Ga0495585_0101232 3300046492 Bacteria 1540
641 Ga0495585_0120605 3300046492 Bacteria 1387
642 Ga0495585_0134348 3300046492 Bacteria 1299
643 Ga0495585_0144154 3300046492 Bacteria 1245
644 Ga0495585_0146493 3300046492 Bacteria 1233
645 Ga0495585_0181351 3300046492 Bacteria 1082
646 Ga0495585_0208936 3300046492 Bacteria 990
647 Ga0495585_0635359 3300046492 Bacteria 500
648 Ga0495594_0006060 3300046499 Bacteria 6213
649 Ga0495594_0022540 3300046499 Bacteria 3368
650 Ga0495594_0056774 3300046499 Bacteria 2161
651 Ga0495594_0063287 3300046499 Bacteria 2049
652 Ga0495594_0088303 3300046499 Bacteria 1735
653 Ga0495594_0100196 3300046499 Bacteria 1629
654 Ga0495594_0103494 3300046499 Bacteria 1602
655 Ga0495594_0228512 3300046499 Bacteria 1061
656 Ga0495594_0471986 3300046499 Bacteria 713
657 Ga0495596_0000236 3300046500 Bacteria 37630
658 Ga0495596_0003733 3300046500 Bacteria 7608
659 Ga0495596_0003880 3300046500 Bacteria 7419
660 Ga0495596_0010298 3300046500 Bacteria 4076
661 Ga0495596_0016755 3300046500 Bacteria 3041
662 Ga0495596_0020946 3300046500 Bacteria 2672
663 Ga0495596_0032093 3300046500 Bacteria 2095
664 Ga0495596_0039830 3300046500 Bacteria 1855
665 Ga0495596_0066495 3300046500 Bacteria 1401
666 Ga0495596_0072165 3300046500 Bacteria 1340
667 Ga0495596_0112662 3300046500 Bacteria 1056
668 Ga0495596_0225634 3300046500 Bacteria 727
669 Ga0495607_0002467 3300046501 Bacteria 15021
670 Ga0495607_0003144 3300046501 Bacteria 12800
671 Ga0495607_0003634 3300046501 Bacteria 11712
672 Ga0495607_0008457 3300046501 Bacteria 7032
673 Ga0495607_0014610 3300046501 Bacteria 5105
674 Ga0495607_0014950 3300046501 Bacteria 5046
675 Ga0495607_0027861 3300046501 Bacteria 3488
676 Ga0495607_0038208 3300046501 Bacteria 2877
677 Ga0495607_0040944 3300046501 Bacteria 2754
678 Ga0495607_0051300 3300046501 Bacteria 2396
679 Ga0495607_0147306 3300046501 Bacteria 1208
680 Ga0495607_0226812 3300046501 Bacteria 910
681 Ga0495607_0336100 3300046501 Bacteria 700
682 Ga0495607_0419653 3300046501 Bacteria 605
683 Ga0495583_0000035 3300046506 Bacteria 246849
684 Ga0495583_0000525 3300046506 Bacteria 54370
685 Ga0495583_0000533 3300046506 Bacteria 53778
686 Ga0495583_0000608 3300046506 Bacteria 48449
687 Ga0495583_0001445 3300046506 Bacteria 24126
688 Ga0495583_0002759 3300046506 Bacteria 14503
689 Ga0495583_0004051 3300046506 Bacteria 10773
690 Ga0495583_0004816 3300046506 Bacteria 9459
691 Ga0495583_0011794 3300046506 Bacteria 4998
692 Ga0495583_0014446 3300046506 Bacteria 4356
693 Ga0495583_0020340 3300046506 Bacteria 3441
694 Ga0495583_0027832 3300046506 Bacteria 2785
695 Ga0495583_0063913 3300046506 Bacteria 1634
696 Ga0495583_0087871 3300046506 Bacteria 1342
697 Ga0495583_0138545 3300046506 Bacteria 1014
698 Ga0495606_0000011 3300046507 Bacteria 296816
699 Ga0495606_0000064 3300046507 Bacteria 183631
700 Ga0495606_0001147 3300046507 Bacteria 37572
701 Ga0495606_0001181 3300046507 Bacteria 36855
702 Ga0495606_0006161 3300046507 Bacteria 11164
703 Ga0495606_0009081 3300046507 Bacteria 8472
704 Ga0495606_0013368 3300046507 Bacteria 6489
705 Ga0495606_0014662 3300046507 Bacteria 6097
706 Ga0495606_0014803 3300046507 Bacteria 6059
707 Ga0495606_0026334 3300046507 Bacteria 4146
708 Ga0495606_0036164 3300046507 Bacteria 3367
709 Ga0495606_0037676 3300046507 Bacteria 3281
710 Ga0495606_0038517 3300046507 Bacteria 3233
711 Ga0495606_0084712 3300046507 Bacteria 1962
712 Ga0495606_0145115 3300046507 Bacteria 1398
713 Ga0495606_0151684 3300046507 Bacteria 1359
714 Ga0495606_0200207 3300046507 Bacteria 1138
715 Ga0495610_0000003 3300046512 Bacteria 1203910
716 Ga0495610_0000873 3300046512 Bacteria 28152
717 Ga0495610_0001162 3300046512 Bacteria 23954
718 Ga0495610_0008688 3300046512 Bacteria 6540
719 Ga0495616_0000272 3300046513 Bacteria 41986
720 Ga0495616_0000343 3300046513 Bacteria 36983
721 Ga0495616_0000680 3300046513 Bacteria 25142
722 Ga0495616_0001661 3300046513 Bacteria 15228
723 Ga0495616_0003238 3300046513 Bacteria 10474
724 Ga0495616_0009292 3300046513 Bacteria 5762
725 Ga0495616_0009654 3300046513 Bacteria 5625
726 Ga0495616_0012631 3300046513 Bacteria 4787
727 Ga0495616_0013294 3300046513 Bacteria 4649
728 Ga0495616_0028258 3300046513 Bacteria 2969
729 Ga0495616_0031645 3300046513 Bacteria 2768
730 Ga0495616_0045896 3300046513 Bacteria 2209
731 Ga0495616_0056668 3300046513 Bacteria 1934
732 Ga0495616_0064979 3300046513 Bacteria 1779
733 Ga0495616_0125523 3300046513 Bacteria 1180
734 Ga0495616_0139171 3300046513 Bacteria 1106
735 Ga0495620_0003145 3300046515 Bacteria 9470
736 Ga0495630_0017831 3300046517 Bacteria 5207
737 Ga0495631_0000983 3300046518 Bacteria 17719
738 Ga0495631_0002105 3300046518 Bacteria 11552
739 Ga0495631_0003385 3300046518 Bacteria 8732
740 Ga0495631_0005046 3300046518 Bacteria 6953
741 Ga0495631_0006876 3300046518 Bacteria 5836
742 Ga0495631_0007988 3300046518 Bacteria 5350
743 Ga0495631_0016269 3300046518 Bacteria 3551
744 Ga0495631_0039469 3300046518 Bacteria 2094
745 Ga0495631_0044435 3300046518 Bacteria 1957
746 Ga0495631_0072699 3300046518 Bacteria 1485
747 Ga0495631_0141351 3300046518 Bacteria 1033
748 Ga0495632_0000062 3300046519 Bacteria 118205
749 Ga0495632_0000235 3300046519 Bacteria 55317
750 Ga0495632_0000901 3300046519 Bacteria 26017
751 Ga0495632_0002631 3300046519 Bacteria 13521
752 Ga0495632_0007247 3300046519 Bacteria 6999
753 Ga0495632_0009591 3300046519 Bacteria 5820
754 Ga0495632_0019389 3300046519 Bacteria 3707
755 Ga0495637_0000004 3300046520 Bacteria 589740
756 Ga0495637_0000482 3300046520 Bacteria 29077
757 Ga0495637_0005727 3300046520 Bacteria 6296
758 Ga0495637_0022968 3300046520 Bacteria 2839
759 Ga0495637_0058812 3300046520 Bacteria 1583
760 Ga0495637_0085828 3300046520 Bacteria 1248
761 Ga0495637_0132682 3300046520 Bacteria 950
762 Ga0495643_0000123 3300046522 Bacteria 124936
763 Ga0495643_0000170 3300046522 Bacteria 103438
764 Ga0495643_0000969 3300046522 Bacteria 29411
765 Ga0495643_0001637 3300046522 Bacteria 19768
766 Ga0495643_0004001 3300046522 Bacteria 10529
767 Ga0495643_0007137 3300046522 Bacteria 7249
768 Ga0495643_0011059 3300046522 Bacteria 5518
769 Ga0495643_0014320 3300046522 Bacteria 4721
770 Ga0495643_0173562 3300046522 Bacteria 1052
771 Ga0495643_0195476 3300046522 Bacteria 974
772 Ga0495644_0003684 3300046523 Bacteria 6029
773 Ga0495644_0003719 3300046523 Bacteria 6004
774 Ga0495644_0006986 3300046523 Bacteria 4369
775 Ga0495644_0008087 3300046523 Bacteria 4045
776 Ga0495644_0008241 3300046523 Bacteria 4011
777 Ga0495644_0010379 3300046523 Bacteria 3590
778 Ga0495644_0021058 3300046523 Bacteria 2487
779 Ga0495644_0022081 3300046523 Bacteria 2426
780 Ga0495644_0022349 3300046523 Bacteria 2410
781 Ga0495644_0044530 3300046523 Bacteria 1669
782 Ga0495644_0144985 3300046523 Bacteria 907
783 Ga0495644_0164084 3300046523 Bacteria 852
784 Ga0495648_0000001 3300046524 Bacteria 696872
785 Ga0495648_0000109 3300046524 Bacteria 101519
786 Ga0495648_0000541 3300046524 Bacteria 40809
787 Ga0495648_0002349 3300046524 Bacteria 17563
788 Ga0495648_0013051 3300046524 Bacteria 6163
789 Ga0495648_0018771 3300046524 Bacteria 4881
790 Ga0495648_0027536 3300046524 Bacteria 3802
791 Ga0495648_0033572 3300046524 Bacteria 3349
792 Ga0495648_0041132 3300046524 Bacteria 2922
793 Ga0495648_0088906 3300046524 Bacteria 1735
794 Ga0495648_0130402 3300046524 Bacteria 1337
795 Ga0495648_0132888 3300046524 Bacteria 1321
796 Ga0495648_0164941 3300046524 Bacteria 1141
797 Ga0495648_0174124 3300046524 Bacteria 1100
798 Ga0495648_0175834 3300046524 Bacteria 1093
799 Ga0495663_0004570 3300046525 Bacteria 3881
800 Ga0495663_0043379 3300046525 Bacteria 1373
801 Ga0495663_0073136 3300046525 Bacteria 1094
802 Ga0495663_0311424 3300046525 Bacteria 568
803 Ga0495666_0000975 3300046526 Bacteria 13502
804 Ga0495666_0001244 3300046526 Bacteria 12329
805 Ga0495666_0022762 3300046526 Bacteria 3101
806 Ga0495666_0024822 3300046526 Bacteria 2961
807 Ga0495666_0088051 3300046526 Bacteria 1466
808 Ga0495642_0000196 3300046528 Bacteria 35510
809 Ga0495642_0002912 3300046528 Bacteria 6821
810 Ga0495642_0003623 3300046528 Bacteria 6064
811 Ga0495642_0006116 3300046528 Bacteria 4623
812 Ga0495642_0008553 3300046528 Bacteria 3916
813 Ga0495642_0008675 3300046528 Bacteria 3884
814 Ga0495642_0008881 3300046528 Bacteria 3845
815 Ga0495642_0018690 3300046528 Bacteria 2713
816 Ga0495642_0020087 3300046528 Bacteria 2620
817 Ga0495642_0021451 3300046528 Bacteria 2540
818 Ga0495642_0027433 3300046528 Bacteria 2266
819 Ga0495642_0032728 3300046528 Bacteria 2087
820 Ga0495642_0077602 3300046528 Bacteria 1395
821 Ga0495642_0088316 3300046528 Bacteria 1310
822 Ga0495642_0101537 3300046528 Bacteria 1224
823 Ga0495642_0116714 3300046528 Bacteria 1144
824 Ga0495642_0205702 3300046528 Bacteria 858
825 Ga0495642_0232419 3300046528 Bacteria 805
826 Ga0495652_0020052 3300046529 Bacteria 5947
827 Ga0495654_0000038 3300046530 Bacteria 185693
828 Ga0495654_0002038 3300046530 Bacteria 13252
829 Ga0495654_0011618 3300046530 Bacteria 4758
830 Ga0495654_0019835 3300046530 Bacteria 3511
831 Ga0495654_0049466 3300046530 Bacteria 2059
832 Ga0495654_0052082 3300046530 Bacteria 1995
833 Ga0495654_0062661 3300046530 Bacteria 1782
834 Ga0495654_0084811 3300046530 Bacteria 1479
835 Ga0495665_0004075 3300046531 Bacteria 7881
836 Ga0495665_0018192 3300046531 Bacteria 3776
837 Ga0495665_0022051 3300046531 Bacteria 3424
838 Ga0495665_0030374 3300046531 Bacteria 2891
839 Ga0495665_0136960 3300046531 Bacteria 1280
840 Ga0495665_0237927 3300046531 Bacteria 939
841 Ga0495665_0621341 3300046531 Bacteria 539
842 Ga0495640_0096951 3300046533 Bacteria 1939
843 Ga0495586_0010365 3300046535 Bacteria 4955
844 Ga0495586_0014931 3300046535 Bacteria 4126
845 Ga0495586_0197549 3300046535 Bacteria 1140
846 Ga0495586_0427977 3300046535 Bacteria 762
847 Ga0495587_0094550 3300046536 Bacteria 1725
848 Ga0495587_0241029 3300046536 Bacteria 1017
849 Ga0495587_0331613 3300046536 Bacteria 849
850 Ga0495598_0012534 3300046537 Bacteria 2084
851 Ga0495609_0000009 3300046538 Bacteria 354860
852 Ga0495609_0000636 3300046538 Bacteria 27314
853 Ga0495609_0003073 3300046538 Bacteria 9786
854 Ga0495609_0003510 3300046538 Bacteria 8955
855 Ga0495609_0003925 3300046538 Bacteria 8335
856 Ga0495609_0006181 3300046538 Bacteria 6158
857 Ga0495609_0010588 3300046538 Bacteria 4419
858 Ga0495609_0012139 3300046538 Bacteria 4088
859 Ga0495609_0018688 3300046538 Bacteria 3211
860 Ga0495609_0021303 3300046538 Bacteria 2990
861 Ga0495609_0023305 3300046538 Bacteria 2846
862 Ga0495609_0104995 3300046538 Bacteria 1222
863 Ga0495609_0107807 3300046538 Bacteria 1203
864 Ga0495609_0110710 3300046538 Bacteria 1185
865 Ga0495609_0194205 3300046538 Bacteria 850
866 Ga0495609_0216406 3300046538 Bacteria 796
867 Ga0495621_0207430 3300046539 Bacteria 790
868 Ga0495597_0001393 3300046542 Bacteria 17466
869 Ga0495597_0001520 3300046542 Bacteria 16508
870 Ga0495597_0001796 3300046542 Bacteria 14723
871 Ga0495597_0002277 3300046542 Bacteria 12472
872 Ga0495597_0004290 3300046542 Bacteria 7877
873 Ga0495597_0005992 3300046542 Bacteria 6340
874 Ga0495597_0007074 3300046542 Bacteria 5743
875 Ga0495597_0011554 3300046542 Bacteria 4278
876 Ga0495597_0013569 3300046542 Bacteria 3898
877 Ga0495597_0028551 3300046542 Bacteria 2553
878 Ga0495597_0035996 3300046542 Bacteria 2230
879 Ga0495597_0062840 3300046542 Bacteria 1614
880 Ga0495597_0067467 3300046542 Bacteria 1547
881 Ga0495597_0091483 3300046542 Bacteria 1291
882 Ga0495597_0197927 3300046542 Bacteria 806
883 Ga0495645_0125435 3300046543 Bacteria 1804
884 Ga0495645_0176359 3300046543 Bacteria 1468
885 Ga0495622_0000028 3300046557 Bacteria 133197
886 Ga0495622_0000398 3300046557 Bacteria 29440
887 Ga0495622_0028161 3300046557 Bacteria 2623
888 Ga0495622_0091127 3300046557 Bacteria 1400
889 Ga0495622_0108925 3300046557 Bacteria 1268
890 Ga0495622_0226951 3300046557 Bacteria 826
891 Ga0495622_0292540 3300046557 Bacteria 710
892 Ga0495622_0411964 3300046557 Bacteria 581
893 Ga0495633_0002074 3300046558 Bacteria 14420
894 Ga0495633_0002390 3300046558 Bacteria 13287
895 Ga0495633_0004129 3300046558 Bacteria 9350
896 Ga0495633_0007239 3300046558 Bacteria 6420
897 Ga0495633_0008374 3300046558 Bacteria 5834
898 Ga0495633_0015513 3300046558 Bacteria 3950
899 Ga0495633_0016604 3300046558 Bacteria 3789
900 Ga0495633_0016656 3300046558 Bacteria 3782
901 Ga0495633_0018775 3300046558 Bacteria 3506
902 Ga0495633_0028145 3300046558 Bacteria 2741
903 Ga0495633_0034928 3300046558 Bacteria 2416
904 Ga0495633_0036808 3300046558 Bacteria 2343
905 Ga0495633_0069418 3300046558 Bacteria 1645
906 Ga0495633_0077381 3300046558 Bacteria 1549
907 Ga0495633_0107297 3300046558 Bacteria 1295
908 Ga0495633_0132449 3300046558 Bacteria 1154
909 Ga0495633_0182335 3300046558 Bacteria 966
910 Ga0495633_0334694 3300046558 Bacteria 686
911 Ga0495633_0540313 3300046558 Bacteria 525
912 Ga0495667_0301968 3300046559 Bacteria 1014
913 Ga0495656_0003737 3300046615 Bacteria 5168
914 Ga0495656_0015862 3300046615 Bacteria 2851
915 Ga0495656_0043073 3300046615 Bacteria 1893
916 Ga0495656_0048042 3300046615 Bacteria 1812
917 Ga0495656_0120080 3300046615 Bacteria 1239
918 Ga0495668_0000048 3300046616 Bacteria 217867
919 Ga0495668_0001362 3300046616 Bacteria 23977
920 Ga0495668_0002401 3300046616 Bacteria 15518
921 Ga0495668_0002455 3300046616 Bacteria 15251
922 Ga0495668_0004786 3300046616 Bacteria 9440
923 Ga0495668_0005220 3300046616 Bacteria 8908
924 Ga0495668_0007462 3300046616 Bacteria 6987
925 Ga0495668_0010370 3300046616 Bacteria 5639
926 Ga0495668_0013225 3300046616 Bacteria 4878
927 Ga0495668_0013802 3300046616 Bacteria 4752
928 Ga0495668_0022879 3300046616 Bacteria 3569
929 Ga0495668_0025705 3300046616 Bacteria 3344
930 Ga0495668_0026212 3300046616 Bacteria 3308
931 Ga0495668_0027856 3300046616 Bacteria 3200
932 Ga0495668_0031057 3300046616 Bacteria 3010
933 Ga0495668_0045217 3300046616 Bacteria 2447
934 Ga0495668_0069580 3300046616 Bacteria 1935
935 Ga0495668_0151893 3300046616 Bacteria 1268
936 Ga0495668_0184006 3300046616 Bacteria 1144
937 Ga0495668_0531138 3300046616 Bacteria 649
938 Ga0495634_0003145 3300046642 Bacteria 13386
939 Ga0495634_0052778 3300046642 Bacteria 2725
940 Ga0495611_0003052 3300046648 Bacteria 7456
941 Ga0495611_0004232 3300046648 Bacteria 6247
942 Ga0495611_0005048 3300046648 Bacteria 5657
943 Ga0495611_0007604 3300046648 Bacteria 4597
944 Ga0495611_0034181 3300046648 Bacteria 2246
945 Ga0495611_0048649 3300046648 Bacteria 1906
946 Ga0495611_0052940 3300046648 Bacteria 1831
947 Ga0495611_0062572 3300046648 Bacteria 1693
948 Ga0495611_0098119 3300046648 Bacteria 1358
949 Ga0495611_0124226 3300046648 Bacteria 1203
950 Ga0495611_0185804 3300046648 Bacteria 970
951 Ga0495611_0269588 3300046648 Bacteria 787
952 Ga0495611_0328188 3300046648 Bacteria 703
953 Ga0495611_0357724 3300046648 Bacteria 669
954 Ga0495611_0448255 3300046648 Bacteria 588
955 Ga0495625_0000164 3300046660 Bacteria 103037
956 Ga0495625_0005794 3300046660 Bacteria 11161
957 Ga0495625_0009364 3300046660 Bacteria 8201
958 Ga0495625_0009819 3300046660 Bacteria 7965
959 Ga0495625_0015487 3300046660 Bacteria 6038
960 Ga0495625_0018254 3300046660 Bacteria 5482
961 Ga0495625_0021196 3300046660 Bacteria 5006
962 Ga0495625_0029832 3300046660 Bacteria 4074
963 Ga0495625_0038200 3300046660 Bacteria 3516
964 Ga0495625_0046986 3300046660 Bacteria 3113
965 Ga0495625_0069612 3300046660 Bacteria 2472
966 Ga0495625_0100232 3300046660 Bacteria 1991
967 Ga0495625_0245382 3300046660 Bacteria 1164
968 Ga0495625_0453458 3300046660 Bacteria 792
969 Ga0495625_0566492 3300046660 Bacteria 686
970 Ga0495635_0006579 3300046663 Bacteria 8109
971 Ga0495635_0619974 3300046663 Bacteria 705
972 Ga0495659_0000289 3300046664 Bacteria 20134
973 Ga0495659_0001247 3300046664 Bacteria 8795
974 Ga0495659_0009392 3300046664 Bacteria 3120
975 Ga0495659_0069126 3300046664 Bacteria 1320
976 Ga0495659_0123825 3300046664 Bacteria 1020
977 Ga0495661_0000368 3300046665 Bacteria 48926
978 Ga0495661_0001167 3300046665 Bacteria 22911
979 Ga0495661_0002363 3300046665 Bacteria 14562
980 Ga0495661_0006427 3300046665 Bacteria 8262
981 Ga0495661_0012089 3300046665 Bacteria 5837
982 Ga0495661_0015517 3300046665 Bacteria 5083
983 Ga0495661_0019494 3300046665 Bacteria 4444
984 Ga0495661_0023664 3300046665 Bacteria 3983
985 Ga0495661_0029376 3300046665 Bacteria 3509
986 Ga0495661_0037274 3300046665 Bacteria 3036
987 Ga0495661_0040171 3300046665 Bacteria 2903
988 Ga0495661_0052747 3300046665 Bacteria 2448
989 Ga0495661_0067409 3300046665 Bacteria 2102
990 Ga0495661_0072941 3300046665 Bacteria 2001
991 Ga0495661_0083536 3300046665 Bacteria 1835
992 Ga0495661_0103370 3300046665 Bacteria 1599
993 Ga0495661_0104872 3300046665 Bacteria 1584
994 Ga0495661_0124413 3300046665 Bacteria 1420
995 Ga0495661_0141254 3300046665 Bacteria 1309
996 Ga0495661_0147861 3300046665 Bacteria 1271
997 Ga0495661_0235293 3300046665 Bacteria 942
998 Ga0495661_0256340 3300046665 Bacteria 890
999 Ga0495661_0267876 3300046665 Bacteria 865
1000 Ga0495588_0000077 3300046674 Bacteria 215338
1001 Ga0495588_0035172 3300046674 Bacteria 2537
1002 Ga0495588_0045378 3300046674 Bacteria 2252
1003 Ga0495588_0064739 3300046674 Bacteria 1896
1004 Ga0495588_0065381 3300046674 Bacteria 1886
1005 Ga0495588_0071146 3300046674 Bacteria 1808
1006 Ga0495588_0080651 3300046674 Bacteria 1698
1007 Ga0495588_0109500 3300046674 Bacteria 1454
1008 Ga0495588_0121903 3300046674 Bacteria 1374
1009 Ga0495588_0123522 3300046674 Unclassified 1365
1010 Ga0495588_0164135 3300046674 Bacteria 1174
1011 Ga0495588_0173649 3300046674 Bacteria 1139
1012 Ga0495588_0708148 3300046674 Bacteria 526
1013 Ga0495599_0266621 3300046678 Bacteria 1040
1014 Ga0495623_0007712 3300046679 Bacteria 6995
1015 Ga0495623_0027846 3300046679 Bacteria 3638
1016 Ga0495623_0091002 3300046679 Bacteria 1872
1017 Ga0495623_0220094 3300046679 Bacteria 1082
1018 Ga0495646_0190750 3300046680 Bacteria 1120
1019 Ga0495669_0000217 3300046684 Bacteria 34603
1020 Ga0495669_0001851 3300046684 Bacteria 8677
1021 Ga0495669_0010502 3300046684 Bacteria 3914
1022 Ga0495669_0017194 3300046684 Bacteria 3101
1023 Ga0495669_0033212 3300046684 Bacteria 2270
1024 Ga0495669_0036868 3300046684 Bacteria 2162
1025 Ga0495669_0053078 3300046684 Bacteria 1822
1026 Ga0495669_0538708 3300046684 Unclassified 568
1027 Ga0495613_0069142 3300046689 Bacteria 2575
1028 Ga0495613_0793672 3300046689 Bacteria 618
1029 Ga0495624_0007752 3300046690 Bacteria 7532
1030 Ga0495624_0340855 3300046690 Bacteria 902
1031 Ga0495670_0009961 3300046691 Bacteria 4671
1032 Ga0495670_0021082 3300046691 Bacteria 3213
1033 Ga0495670_0021157 3300046691 Bacteria 3208
1034 Ga0495670_0022494 3300046691 Bacteria 3112
1035 Ga0495670_0031986 3300046691 Bacteria 2615
1036 Ga0495670_0034737 3300046691 Bacteria 2512
1037 Ga0495670_0039198 3300046691 Bacteria 2362
1038 Ga0495670_0195811 3300046691 Bacteria 1069
1039 Ga0495670_0199854 3300046691 Bacteria 1058
1040 Ga0495670_0274896 3300046691 Bacteria 900
1041 Ga0495670_0391270 3300046691 Bacteria 750
1042 Ga0495670_0408214 3300046691 Bacteria 734
1043 Ga0495670_0421933 3300046691 Bacteria 721
1044 Ga0495670_0464390 3300046691 Bacteria 686
1045 Ga0495670_0523431 3300046691 Bacteria 645
1046 Ga0495671_0000001 3300046692 Bacteria 1169494
1047 Ga0495671_0000744 3300046692 Bacteria 23455
1048 Ga0495671_0000848 3300046692 Bacteria 21841
1049 Ga0495671_0022004 3300046692 Bacteria 3344
1050 Ga0495671_0023568 3300046692 Bacteria 3214
1051 Ga0495671_0027348 3300046692 Bacteria 2947
1052 Ga0495671_0028223 3300046692 Bacteria 2893
1053 Ga0495671_0079765 3300046692 Bacteria 1604
1054 Ga0495671_0112690 3300046692 Bacteria 1328
1055 Ga0495671_0180502 3300046692 Bacteria 1025
1056 Ga0495671_0397099 3300046692 Bacteria 660
1057 Ga0495649_0002149 3300046694 Bacteria 14104
1058 Ga0495649_0007989 3300046694 Bacteria 6396
1059 Ga0495649_0019739 3300046694 Bacteria 3784
1060 Ga0495649_0031292 3300046694 Bacteria 2935
1061 Ga0495649_0051556 3300046694 Bacteria 2231
1062 Ga0495649_0133357 3300046694 Bacteria 1310
1063 Ga0495649_0159202 3300046694 Bacteria 1184
1064 Ga0495649_0206303 3300046694 Bacteria 1019
1065 Ga0495649_0218901 3300046694 Bacteria 985
1066 Ga0495589_0000037 3300046794 Bacteria 150603
1067 Ga0495589_0001177 3300046794 Bacteria 15597
1068 Ga0495589_0001260 3300046794 Bacteria 14998
1069 Ga0495589_0010118 3300046794 Bacteria 4900
1070 Ga0495589_0014498 3300046794 Bacteria 4056
1071 Ga0495589_0017796 3300046794 Bacteria 3645
1072 Ga0495589_0026334 3300046794 Bacteria 2947
1073 Ga0495589_0038794 3300046794 Bacteria 2382
1074 Ga0495589_0042313 3300046794 Bacteria 2270
1075 Ga0495589_0085592 3300046794 Bacteria 1531
1076 Ga0495589_0163846 3300046794 Bacteria 1058
1077 Ga0495589_0180011 3300046794 Bacteria 1003
1078 Ga0495589_0241467 3300046794 Bacteria 845
1079 Ga0495600_0002155 3300046809 Bacteria 11161
1080 Ga0495600_0104154 3300046809 Bacteria 1849
1081 Ga0495660_0000178 3300046810 Bacteria 68956
1082 Ga0495660_0001476 3300046810 Bacteria 15998
1083 Ga0495660_0003120 3300046810 Bacteria 10328
1084 Ga0495660_0003323 3300046810 Bacteria 9978
1085 Ga0495660_0017672 3300046810 Bacteria 4103
1086 Ga0495660_0022155 3300046810 Bacteria 3630
1087 Ga0495660_0043740 3300046810 Bacteria 2467
1088 Ga0495660_0044082 3300046810 Bacteria 2456
1089 Ga0495660_0059138 3300046810 Bacteria 2062
1090 Ga0495660_0095189 3300046810 Bacteria 1541
1091 Ga0495660_0118619 3300046810 Bacteria 1341
1092 Ga0495660_0124887 3300046810 Bacteria 1297
1093 Ga0495660_0128231 3300046810 Bacteria 1275
1094 Ga0495581_0008712 3300047315 Bacteria 5876
1095 Ga0495581_0066676 3300047315 Bacteria 2081
1096 Ga0495581_0078795 3300047315 Bacteria 1906
1097 Ga0495581_0287595 3300047315 Bacteria 961
1098 Ga0495604_0036530 3300047317 Bacteria 3873
1099 Ga0495604_0085661 3300047317 Bacteria 2351
1100 Ga0495604_0148305 3300047317 Bacteria 1669
1101 Ga0495604_0192669 3300047317 Bacteria 1419
1102 Ga0495604_0223117 3300047317 Bacteria 1296
1103 Ga0495604_0262021 3300047317 Bacteria 1174
1104 Ga0495636_0006148 3300047318 Bacteria 4715
1105 Ga0495636_0012768 3300047318 Bacteria 3327
1106 Ga0495636_0017608 3300047318 Bacteria 2860
1107 Ga0495636_0069736 3300047318 Bacteria 1498
1108 Ga0495636_0087023 3300047318 Bacteria 1352
1109 Ga0495636_0094728 3300047318 Bacteria 1299
1110 Ga0495636_0104862 3300047318 Bacteria 1239
1111 Ga0495636_0180386 3300047318 Bacteria 958
1112 Ga0495636_0367497 3300047318 Bacteria 681
1113 Ga0495636_0445788 3300047318 Bacteria 621
1114 Ga0495674_0003394 3300047319 Bacteria 15471
1115 Ga0495674_0784125 3300047319 Bacteria 742
1116 Ga0495672_0000097 3300047320 Bacteria 141608
1117 Ga0495672_0000424 3300047320 Bacteria 50607
1118 Ga0495672_0000590 3300047320 Bacteria 41027
1119 Ga0495672_0000758 3300047320 Bacteria 35256
1120 Ga0495672_0001440 3300047320 Bacteria 23361
1121 Ga0495672_0001672 3300047320 Bacteria 21505
1122 Ga0495672_0002152 3300047320 Bacteria 18417
1123 Ga0495672_0011872 3300047320 Bacteria 6114
1124 Ga0495672_0098796 3300047320 Bacteria 1587
1125 Ga0495672_0108065 3300047320 Bacteria 1497
1126 Ga0495676_0000342 3300047321 Bacteria 38031
1127 Ga0495676_0014902 3300047321 Bacteria 6942
1128 Ga0495676_0077540 3300047321 Bacteria 2534
1129 Ga0495676_0108382 3300047321 Bacteria 2043
1130 Ga0495676_0123990 3300047321 Bacteria 1875
1131 Ga0495676_0169465 3300047321 Bacteria 1538
1132 Ga0495676_0202693 3300047321 Bacteria 1378
1133 Ga0495680_0005344 3300047322 Bacteria 12118
1134 Ga0495680_0086272 3300047322 Bacteria 2362
1135 Ga0495680_0909474 3300047322 Bacteria 568
1136 Ga0495683_0000144 3300047323 Bacteria 69959
1137 Ga0495683_0000952 3300047323 Bacteria 20358
1138 Ga0495683_0001039 3300047323 Bacteria 19287
1139 Ga0495683_0016641 3300047323 Bacteria 3816
1140 Ga0495683_0017608 3300047323 Bacteria 3701
1141 Ga0495683_0029959 3300047323 Bacteria 2779
1142 Ga0495683_0035711 3300047323 Bacteria 2526
1143 Ga0495683_0087662 3300047323 Bacteria 1511
1144 Ga0495683_0095436 3300047323 Bacteria 1436
1145 Ga0495683_0169338 3300047323 Bacteria 1005
1146 Ga0495687_000002 3300047443 Bacteria 1085770
1147 Ga0495687_000017 3300047443 Bacteria 350429
1148 Ga0495687_000024 3300047443 Bacteria 316676
1149 Ga0495687_000148 3300047443 Bacteria 106947
1150 Ga0495687_001539 3300047443 Bacteria 20979
1151 Ga0495687_005580 3300047443 Bacteria 7970
1152 Ga0495687_005608 3300047443 Bacteria 7936
1153 Ga0495687_010840 3300047443 Bacteria 4952
1154 Ga0495687_015538 3300047443 Bacteria 3867
1155 Ga0495687_029001 3300047443 Bacteria 2566
1156 Ga0495687_076171 3300047443 Bacteria 1328
1157 Ga0495675_0002413 3300047444 Bacteria 11164
1158 Ga0495675_0004400 3300047444 Bacteria 8527
1159 Ga0495675_0147236 3300047444 Bacteria 1456
1160 Ga0495677_0000011 3300047445 Bacteria 149837
1161 Ga0495677_0000979 3300047445 Bacteria 11487
1162 Ga0495677_0001358 3300047445 Bacteria 9771
1163 Ga0495677_0003050 3300047445 Bacteria 6513
1164 Ga0495677_0004099 3300047445 Bacteria 5626
1165 Ga0495677_0006130 3300047445 Bacteria 4549
1166 Ga0495677_0007985 3300047445 Bacteria 3932
1167 Ga0495677_0011203 3300047445 Bacteria 3282
1168 Ga0495677_0016146 3300047445 Bacteria 2709
1169 Ga0495677_0074320 3300047445 Bacteria 1268
1170 Ga0495677_0139302 3300047445 Bacteria 931
1171 Ga0495677_0141551 3300047445 Bacteria 924
1172 Ga0495677_0149027 3300047445 Bacteria 900
1173 Ga0495677_0165097 3300047445 Bacteria 855
1174 Ga0495679_003113 3300047446 Bacteria 8123
1175 Ga0495679_003957 3300047446 Bacteria 6981
1176 Ga0495679_009988 3300047446 Bacteria 3760
1177 Ga0495679_016017 3300047446 Bacteria 2723
1178 Ga0495679_017414 3300047446 Bacteria 2572
1179 Ga0495679_050542 3300047446 Bacteria 1249
1180 Ga0495685_000077 3300047447 Bacteria 37238
1181 Ga0495685_006760 3300047447 Bacteria 3769
1182 Ga0495685_010360 3300047447 Bacteria 3124
1183 Ga0495685_024841 3300047447 Bacteria 2062
1184 Ga0495685_034772 3300047447 Bacteria 1731
1185 Ga0495685_095119 3300047447 Bacteria 985
1186 Ga0495685_175374 3300047447 Bacteria 692
1187 Ga0495673_0000003 3300047469 Bacteria 1491337
1188 Ga0495673_0000097 3300047469 Bacteria 182247
1189 Ga0495673_0000100 3300047469 Bacteria 173962
1190 Ga0495673_0002730 3300047469 Bacteria 12103
1191 Ga0495673_0010183 3300047469 Bacteria 5136
1192 Ga0495681_0002294 3300047470 Bacteria 13753
1193 Ga0495681_0002968 3300047470 Bacteria 11956
1194 Ga0495681_0007086 3300047470 Bacteria 7235
1195 Ga0495681_0009449 3300047470 Bacteria 6007
1196 Ga0495681_0011139 3300047470 Bacteria 5385
1197 Ga0495681_0011368 3300047470 Bacteria 5304
1198 Ga0495681_0011590 3300047470 Bacteria 5236
1199 Ga0495681_0014249 3300047470 Bacteria 4569
1200 Ga0495681_0020183 3300047470 Bacteria 3620
1201 Ga0495681_0020331 3300047470 Bacteria 3605
1202 Ga0495681_0048194 3300047470 Bacteria 2021
1203 Ga0495681_0155420 3300047470 Bacteria 956
1204 Ga0495686_0000428 3300047472 Bacteria 65588
1205 Ga0495686_0001462 3300047472 Bacteria 25726
1206 Ga0495686_0001479 3300047472 Bacteria 25538
1207 Ga0495686_0003365 3300047472 Bacteria 13932
1208 Ga0495686_0008053 3300047472 Bacteria 7807
1209 Ga0495686_0049892 3300047472 Bacteria 2631
1210 Ga0495686_0121758 3300047472 Bacteria 1554
1211 Ga0495686_0184539 3300047472 Bacteria 1206
1212 Ga0495686_0189731 3300047472 Bacteria 1185
1213 Ga0495686_0228281 3300047472 Bacteria 1055
1214 Ga0495686_0293147 3300047472 Bacteria 900
1215 Ga0495686_0377640 3300047472 Bacteria 765
1216 Ga0495593_0002473 3300047673 Bacteria 11113
1217 Ga0495593_0021073 3300047673 Bacteria 3644
1218 Ga0495593_0128819 3300047673 Bacteria 1285
1219 Ga0495602_0086299 3300048088 Bacteria 2620
1220 Ga0495602_0128484 3300048088 Bacteria 2025
1221 Ga0495602_0459422 3300048088 Bacteria 897
1222 Ga0495614_0002563 3300048089 Bacteria 8081
1223 Ga0495614_0162459 3300048089 Bacteria 1000
1224 Ga0495614_0181823 3300048089 Bacteria 946
1225 Ga0495614_0205280 3300048089 Bacteria 893
1226 Ga0495614_0251407 3300048089 Bacteria 808
1227 Ga0495615_0000530 3300048090 Bacteria 5448
1228 Ga0495615_0080961 3300048090 Bacteria 890
1229 Ga0495626_0000004 3300048091 Bacteria 356599
1230 Ga0495626_0000016 3300048091 Bacteria 232214
1231 Ga0495626_0000569 3300048091 Bacteria 36626
1232 Ga0495626_0005849 3300048091 Bacteria 7094
1233 Ga0495626_0008239 3300048091 Bacteria 5734
1234 Ga0495626_0009582 3300048091 Bacteria 5226
1235 Ga0495626_0027385 3300048091 Bacteria 2772
1236 Ga0495626_0033635 3300048091 Bacteria 2455
1237 Ga0495626_0040645 3300048091 Bacteria 2195
1238 Ga0495626_0054570 3300048091 Bacteria 1834
1239 Ga0495626_0069092 3300048091 Bacteria 1591
1240 Ga0495626_0091745 3300048091 Bacteria 1335
1241 Ga0495626_0092145 3300048091 Bacteria 1331
1242 Ga0495626_0118149 3300048091 Bacteria 1142
1243 Ga0495626_0176147 3300048091 Bacteria 889
1244 Ga0496100_0004475 3300048903 Bacteria 7416
1245 Ga0496100_0266561 3300048903 Bacteria 1272
1246 Ga0496100_0332721 3300048903 Bacteria 1143
1247 Ga0496100_0380203 3300048903 Bacteria 1072
1248 Ga0496101_0106911 3300048904 Bacteria 2101
1249 Ga0496101_0108970 3300048904 Bacteria 2083
1250 Ga0496101_0702507 3300048904 Bacteria 798
1251 Ga0496101_0820075 3300048904 Bacteria 733
1252 Ga0496102_0000461 3300048905 Bacteria 45293
1253 Ga0496102_0016630 3300048905 Bacteria 6431
1254 Ga0496102_0020653 3300048905 Bacteria 5820
1255 Ga0496102_0023210 3300048905 Bacteria 5506
1256 Ga0496102_0040178 3300048905 Bacteria 4230
1257 Ga0496102_0069033 3300048905 Bacteria 3244
1258 Ga0496102_0076786 3300048905 Bacteria 3073
1259 Ga0496102_0178602 3300048905 Bacteria 1999
1260 Ga0496102_0205505 3300048905 Bacteria 1857
1261 Ga0496102_0760861 3300048905 Bacteria 891
1262 Ga0496102_0941197 3300048905 Bacteria 785
1263 Ga0496102_1447319 3300048905 Bacteria 606
1264 Ga0496103_0001321 3300048906 Bacteria 16822
1265 Ga0496103_0002752 3300048906 Bacteria 10969
1266 Ga0496103_0006660 3300048906 Bacteria 6896
1267 Ga0496103_0007974 3300048906 Bacteria 6290
1268 Ga0496103_0045259 3300048906 Bacteria 2716
1269 Ga0496103_0143904 3300048906 Bacteria 1525
1270 Ga0496104_0616755 3300048907 Bacteria 995
1271 Ga0496104_0668275 3300048907 Bacteria 947
1272 Ga0496104_1316698 3300048907 Bacteria 625
1273 Ga0496105_0077123 3300048908 Bacteria 2752
1274 Ga0496105_0113339 3300048908 Bacteria 2238
1275 Ga0496105_0747240 3300048908 Bacteria 747
1276 Ga0496106_0230450 3300048909 Bacteria 1479
1277 Ga0496106_0268693 3300048909 Bacteria 1365
1278 Ga0496107_0021795 3300048910 Bacteria 4527
1279 Ga0496108_0010622 3300048911 Bacteria 7469
1280 Ga0496108_0023299 3300048911 Bacteria 5093
1281 Ga0496108_0394878 3300048911 Unclassified 1208
1282 Ga0496108_0483826 3300048911 Bacteria 1081
1283 Ga0496109_0081610 3300048912 Unclassified 2980
1284 Ga0496109_0149594 3300048912 Bacteria 2186
1285 Ga0496109_0321254 3300048912 Bacteria 1461
1286 Ga0496109_0656844 3300048912 Bacteria 985
1287 Ga0496109_1427618 3300048912 Bacteria 627
1288 Ga0496110_0000019 3300048913 Bacteria 79137
1289 Ga0496110_0003499 3300048913 Bacteria 12050
1290 Ga0496110_0807477 3300048913 Bacteria 842
1291 Ga0496111_0031224 3300048914 Bacteria 3794
1292 Ga0496111_0246770 3300048914 Bacteria 1325
1293 Ga0496112_0032351 3300048915 Bacteria 5079
1294 Ga0496112_0037388 3300048915 Bacteria 4739
1295 Ga0496112_0037948 3300048915 Bacteria 4705
1296 Ga0496112_0246092 3300048915 Bacteria 1740
1297 Ga0496112_0252691 3300048915 Bacteria 1714
1298 Ga0496112_1095950 3300048915 Bacteria 715
1299 Ga0496113_0037686 3300048916 Bacteria 3550
1300 Ga0496113_0123029 3300048916 Bacteria 2030
1301 Ga0496113_0328300 3300048916 Bacteria 1227
1302 Ga0496113_0421049 3300048916 Bacteria 1073
1303 Ga0496113_0738842 3300048916 Bacteria 784
1304 Ga0496113_0782382 3300048916 Unclassified 759
1305 Ga0496114_0436287 3300048917 Bacteria 1160
1306 Ga0496114_0475759 3300048917 Bacteria 1105
1307 Ga0496114_0532190 3300048917 Unclassified 1039
1308 Ga0496115_0011854 3300048918 Bacteria 6548
1309 Ga0496115_0034428 3300048918 Bacteria 4003
1310 Ga0496115_0060772 3300048918 Bacteria 3045
1311 Ga0496115_0251481 3300048918 Bacteria 1455
1312 Ga0496115_0282915 3300048918 Bacteria 1361
1313 Ga0496115_0712674 3300048918 Bacteria 788
1314 Ga0496116_0039030 3300048919 Bacteria 3288
1315 Ga0496116_0080004 3300048919 Bacteria 2031
1316 Ga0496117_0000132 3300048920 Bacteria 162117
1317 Ga0496118_0000099 3300048921 Bacteria 160412
1318 Ga0496119_0321679 3300048922 Bacteria 757
1319 Ga0496120_0105101 3300048923 Bacteria 1485
1320 Ga0496121_0080423 3300048924 Bacteria 2583
1321 Ga0496121_0127464 3300048924 Bacteria 1911
1322 Ga0496121_0210954 3300048924 Bacteria 1376
1323 Ga0496121_0236303 3300048924 Bacteria 1276
1324 Ga0496121_0615776 3300048924 Bacteria 667
1325 Ga0496122_0000835 3300048925 Bacteria 58311
1326 Ga0496122_0001402 3300048925 Bacteria 39141
1327 Ga0496122_0036243 3300048925 Bacteria 3993
1328 Ga0496122_0477397 3300048925 Bacteria 611
1329 Ga0496123_0001003 3300048926 Bacteria 43216
1330 Ga0496123_0004574 3300048926 Bacteria 14422
1331 Ga0496123_0051903 3300048926 Bacteria 2726
1332 Ga0496123_0053089 3300048926 Bacteria 2682
1333 Ga0496123_0299454 3300048926 Bacteria 768
1334 Ga0496124_0008384 3300048927 Bacteria 10812
1335 Ga0496124_0017479 3300048927 Bacteria 6757
1336 Ga0496124_0041651 3300048927 Bacteria 3961
1337 Ga0496124_0061626 3300048927 Bacteria 3144
1338 Ga0496124_0118308 3300048927 Bacteria 2121
1339 Ga0496124_0143321 3300048927 Bacteria 1883
1340 Ga0496124_0173038 3300048927 Bacteria 1670
1341 Ga0496124_0218266 3300048927 Bacteria 1436
1342 Ga0496124_0295788 3300048927 Bacteria 1172
1343 Ga0496124_0731909 3300048927 Bacteria 622
1344 Ga0496125_0001280 3300048928 Bacteria 37321
1345 Ga0496125_0023719 3300048928 Bacteria 5656
1346 Ga0496125_0381725 3300048928 Bacteria 830
1347 Ga0496126_0015539 3300048929 Bacteria 7649
1348 Ga0501308_001629 3300049128 Bacteria 1839
1349 Ga0501309_047482 3300049129 Bacteria 668
1350 Ga0501310_022591 3300049130 Bacteria 795
1351 Ga0501310_073953 3300049130 Bacteria 526
1352 Ga0501304_002381 3300049160 Bacteria 1301
1353 Ga0501305_098766 3300049161 Bacteria 542
1354 Ga0501307_014325 3300049162 Bacteria 967
1355 Ga0501307_033547 3300049162 Bacteria 722
1356 Ga0495678_000004 3300049459 Bacteria 532920
1357 Ga0495678_000384 3300049459 Bacteria 44841
1358 Ga0495678_000515 3300049459 Bacteria 37716
1359 Ga0495678_000866 3300049459 Bacteria 26949
1360 Ga0495678_001499 3300049459 Bacteria 18192
1361 Ga0495678_017736 3300049459 Bacteria 3217
1362 Ga0495678_024378 3300049459 Bacteria 2612
1363 Ga0495678_040952 3300049459 Bacteria 1857
1364 Ga0495678_043619 3300049459 Bacteria 1779
1365 Ga0495678_045351 3300049459 Bacteria 1734
1366 Ga0495678_156665 3300049459 Bacteria 731
1367 Ga0495678_209202 3300049459 Bacteria 597
1368 Ga0495682_0000869 3300049460 Bacteria 18741
1369 Ga0495682_0001115 3300049460 Bacteria 15630
1370 Ga0495682_0006435 3300049460 Bacteria 4749
1371 Ga0495682_0031927 3300049460 Bacteria 1945
1372 Ga0501312_034371 3300049528 Bacteria 808
1373 Ga0501314_024195 3300049530 Bacteria 647
1374 Ga0501315_022278 3300049531 Bacteria 863
1375 Ga0501315_037778 3300049531 Bacteria 720
1376 Ga0501316_013762 3300049532 Bacteria 959
1377 Ga0501318_020502 3300049534 Bacteria 833
1378 Ga0501322_024908 3300049538 Bacteria 543
1379 Ga0501323_054399 3300049539 Bacteria 614
1380 Ga0501230_002780 3300049667 Bacteria 2255
1381 Ga0501238_008754 3300049671 Bacteria 1335
1382 Ga0501249_002892 3300049679 Bacteria 3455
1383 Ga0501234_055166 3300049707 Bacteria 667
1384 Ga0501263_027310 3300049760 Bacteria 793
1385 Ga0501265_102468 3300049762 Bacteria 525
1386 Ga0501269_000099 3300049766 Bacteria 27098
1387 Ga0501279_002296 3300049775 Bacteria 2512
1388 Ga0501279_017123 3300049775 Bacteria 1013
1389 Ga0501035_0000965 3300049822 Bacteria 30391
1390 Ga0501220_04705 3300049852 Bacteria 638
1391 nmdc:mga03683_52564_c1 3300050489 Bacteria 1703
1392 nmdc:mga0qj67_80226_c1 3300050509 Bacteria 2614
1393 nmdc:mga08y16_312463_c1 3300050511 Unclassified 1618
1394 nmdc:mga0n895_1047098_c1 3300050512 Unclassified 795
1395 nmdc:mga0n895_197141_c1 3300050512 Bacteria 2045
1396 nmdc:mga0rr50_1700061_c1 3300050513 Unclassified 532
1397 nmdc:mga08x19_320078_c1 3300050514 Bacteria 1079
1398 nmdc:mga08x19_8569_c1 3300050514 Bacteria 4583
1399 nmdc:mga0a205_759673_c1 3300050515 Unclassified 818
1400 Ga0500647_0364579 3300053091 Bacteria 597
1401 Ga0500594_0024669 3300053118 Bacteria 1534
1402 Ga0500618_000358 3300053125 Bacteria 31730
1403 Ga0500618_035890 3300053125 Bacteria 1150
1404 Ga0500586_027112 3300053145 Bacteria 1860
1405 Ga0500622_0000001 3300053156 Bacteria 657715
1406 Ga0587093_037672 3300059478 Bacteria 722
1407 Ga0587066_061325 3300059490 Bacteria 768
1408 Ga0587073_0052305 3300059492 Bacteria 930
1409 Ga0587077_036677 3300059493 Bacteria 964
1410 Ga0587080_003170 3300059503 Bacteria 2020
1411 Ga0587080_031135 3300059503 Bacteria 930
1412 Ga0587088_048226 3300059508 Bacteria 826
1413 Ga0587090_041300 3300059510 Bacteria 813
1414 Ga0587091_088410 3300059511 Bacteria 707
1415 Ga0587094_056969 3300059513 Bacteria 675
1416 Ga0587098_052710 3300059604 Bacteria 621
1417 Ga0587106_023638 3300059605 Bacteria 933
1418 Ga0587129_024236 3300059608 Bacteria 555
1419 Ga0587099_051983 3300059622 Bacteria 549
1420 Ga0587101_024610 3300059623 Bacteria 895
1421 Ga0587115_053305 3300059626 Bacteria 662
1422 Ga0587117_035241 3300059627 Bacteria 774
1423 Ga0587062_061390 3300059639 Bacteria 660
1424 Ga0587062_068412 3300059639 Bacteria 638
1425 Ga0587068_003385 3300059641 Bacteria 2033
1426 Ga0587068_138221 3300059641 Bacteria 542
1427 Ga0587069_004663 3300059642 Bacteria 1557
1428 Ga0587075_024541 3300059644 Bacteria 921
1429 Ga0587076_036335 3300059645 Bacteria 900
1430 Ga0587079_042086 3300059647 Bacteria 927
1431 Ga0587102_045335 3300059649 Bacteria 579
1432 Ga0587105_007802 3300059651 Bacteria 765
1433 Ga0587107_073157 3300059652 Bacteria 630
1434 Ga0587124_019618 3300059660 Bacteria 682
1435 Ga0587071_061264 3300060344 Bacteria 800
1436 Ga0587111_0057014 3300060346 Bacteria 878
1437 Ga0587111_0084966 3300060346 Bacteria 763
1438 Ga0466962_0083668 3300061719 Bacteria 1526
1439 Ga0466962_0114442 3300061719 Bacteria 1299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_101359080 Ga0070706_1013590801 113
2 3300046523 Ga0495644_0021058 Ga0495644_0021058_14_364 113
3 3300047447 Ga0495685_175374 Ga0495685_175374_323_673 113
4 3300048904 Ga0496101_0108970 Ga0496101_0108970_1710_2060 113
5 3300048924 Ga0496121_0080423 Ga0496121_0080423_2207_2557 113
6 3300048924 Ga0496121_0236303 Ga0496121_0236303_27_377 113
7 3300046460 Ga0495638_0097743 Ga0495638_0097743_771_1121 115
8 3300046471 Ga0495650_0129330 Ga0495650_0129330_20_382 117
9 3300046455 Ga0495603_0183470 Ga0495603_0183470_70_441 120
10 3300046459 Ga0495629_0093578 Ga0495629_0093578_83_454 120
11 3300046492 Ga0495585_0042612 Ga0495585_0042612_756_1127 120
12 3300046558 Ga0495633_0069418 Ga0495633_0069418_611_982 120
13 3300046648 Ga0495611_0328188 Ga0495611_0328188_162_533 120
14 3300046664 Ga0495659_0069126 Ga0495659_0069126_262_633 120
15 3300046690 Ga0495624_0340855 Ga0495624_0340855_49_420 120
16 3300046691 Ga0495670_0421933 Ga0495670_0421933_217_588 120
17 3300047321 Ga0495676_0014902 Ga0495676_0014902_197_568 120
18 3300039447 Ga0436361_0605732 Ga0436361_0605732_62_436 121
19 3300046453 Ga0495627_014641 Ga0495627_014641_2318_2692 121
20 3300046492 Ga0495585_0097886 Ga0495585_0097886_498_872 121
21 3300046499 Ga0495594_0103494 Ga0495594_0103494_837_1211 121
22 3300046500 Ga0495596_0003733 Ga0495596_0003733_1549_1923 121
23 3300046500 Ga0495596_0066495 Ga0495596_0066495_445_819 121
24 3300046500 Ga0495596_0225634 Ga0495596_0225634_308_682 121
25 3300046506 Ga0495583_0063913 Ga0495583_0063913_318_692 121
26 3300046519 Ga0495632_0000235 Ga0495632_0000235_40886_41260 121
27 3300046542 Ga0495597_0028551 Ga0495597_0028551_752_1126 121
28 3300046558 Ga0495633_0034928 Ga0495633_0034928_573_947 121
29 3300046616 Ga0495668_0069580 Ga0495668_0069580_1290_1664 121
30 3300046648 Ga0495611_0004232 Ga0495611_0004232_5854_6228 121
31 3300046665 Ga0495661_0147861 Ga0495661_0147861_431_805 121
32 3300046674 Ga0495588_0045378 Ga0495588_0045378_908_1282 121
33 3300046684 Ga0495669_0053078 Ga0495669_0053078_826_1200 121
34 3300046691 Ga0495670_0464390 Ga0495670_0464390_153_527 121
35 3300046694 Ga0495649_0159202 Ga0495649_0159202_577_951 121
36 3300046810 Ga0495660_0124887 Ga0495660_0124887_353_727 121
37 3300047318 Ga0495636_0445788 Ga0495636_0445788_236_610 121
38 3300047443 Ga0495687_005608 Ga0495687_005608_3322_3696 121
39 3300047470 Ga0495681_0002294 Ga0495681_0002294_6328_6702 121
40 3300047472 Ga0495686_0003365 Ga0495686_0003365_9946_10320 121
41 3300048091 Ga0495626_0005849 Ga0495626_0005849_4242_4616 121
42 3300048091 Ga0495626_0054570 Ga0495626_0054570_27_401 121
43 3300048912 Ga0496109_0149594 Ga0496109_0149594_1423_1797 121
44 3300048913 Ga0496110_0000019 Ga0496110_0000019_35204_35578 121
45 3300048916 Ga0496113_0328300 Ga0496113_0328300_411_785 121
46 3300048924 Ga0496121_0615776 Ga0496121_0615776_96_470 121
47 3300049459 Ga0495678_043619 Ga0495678_043619_26_400 121
48 3300050489 nmdc:mga03683_52564_c1 nmdc:mga03683_52564_c1_617_991 121
49 3300038443 Ga0395901_1163544 Ga0395901_1163544_227_625 122
50 3300046455 Ga0495603_0057009 Ga0495603_0057009_501_878 122
51 3300046455 Ga0495603_0394385 Ga0495603_0394385_167_544 122
52 3300046492 Ga0495585_0004783 Ga0495585_0004783_3965_4342 122
53 3300046492 Ga0495585_0047888 Ga0495585_0047888_1769_2146 122
54 3300046500 Ga0495596_0003880 Ga0495596_0003880_5977_6354 122
55 3300046501 Ga0495607_0419653 Ga0495607_0419653_139_516 122
56 3300046506 Ga0495583_0001445 Ga0495583_0001445_7749_8126 122
57 3300046513 Ga0495616_0003238 Ga0495616_0003238_3623_4000 122
58 3300046518 Ga0495631_0072699 Ga0495631_0072699_613_990 122
59 3300046519 Ga0495632_0000901 Ga0495632_0000901_15766_16143 122
60 3300046522 Ga0495643_0001637 Ga0495643_0001637_3495_3872 122
61 3300046524 Ga0495648_0013051 Ga0495648_0013051_2627_3004 122
62 3300046524 Ga0495648_0164941 Ga0495648_0164941_285_662 122
63 3300046528 Ga0495642_0088316 Ga0495642_0088316_29_406 122
64 3300046530 Ga0495654_0019835 Ga0495654_0019835_1074_1451 122
65 3300046616 Ga0495668_0151893 Ga0495668_0151893_187_564 122
66 3300046660 Ga0495625_0021196 Ga0495625_0021196_436_813 122
67 3300046674 Ga0495588_0164135 Ga0495588_0164135_548_925 122
68 3300046674 Ga0495588_0708148 Ga0495588_0708148_117_494 122
69 3300046684 Ga0495669_0001851 Ga0495669_0001851_2353_2730 122
70 3300046691 Ga0495670_0031986 Ga0495670_0031986_705_1082 122
71 3300046794 Ga0495589_0001177 Ga0495589_0001177_848_1225 122
72 3300047315 Ga0495581_0066676 Ga0495581_0066676_1328_1705 122
73 3300047318 Ga0495636_0104862 Ga0495636_0104862_377_754 122
74 3300047445 Ga0495677_0139302 Ga0495677_0139302_117_494 122
75 iso_pu_bacteria 2643221554 2643786992 122
76 iso_pu_bacteria 2643221638 2644215914 122
77 iso_pu_bacteria 2643221645 2644254384 122
78 iso_pu_bacteria 2643221664 2644357949 122
79 iso_pu_bacteria 2738541280 2738741196 122
80 iso_pu_bacteria 2738541297 2738829264 122
81 iso_pu_bacteria 2738541300 2738845662 122
82 iso_pu_bacteria 2738541357 2739153060 122
83 iso_pu_bacteria 2738543003 2739194980 122
84 iso_pu_bacteria 2738543018 2739277470 122
85 iso_pu_bacteria 2738543026 2739321456 122
86 iso_pu_bacteria 2738543029 2739339988 122
87 iso_pu_bacteria 2738543030 2739346607 122
88 iso_pu_bacteria 2821131069 2821131543 122
89 iso_pu_bacteria 2842711865 2842718111 122
90 iso_pu_bacteria 2857553236 2857554423 122
91 iso_pu_bacteria 2857558681 2857563850 122
92 iso_pu_bacteria 2857564685 2857564791 122
93 iso_pu_bacteria 2904424332 2904426082 122
94 iso_pu_bacteria 2919476304 2919478473 122
95 3300009036 Ga0105244_10066484 Ga0105244_100664842 123
96 3300009093 Ga0105240_10686415 Ga0105240_106864152 123
97 3300009098 Ga0105245_10084318 Ga0105245_100843182 123
98 3300009148 Ga0105243_10234788 Ga0105243_102347882 123
99 3300009174 Ga0105241_10193522 Ga0105241_101935222 123
100 3300009176 Ga0105242_10021980 Ga0105242_100219805 123
101 3300009545 Ga0105237_10856390 Ga0105237_108563902 123
102 3300009551 Ga0105238_10362340 Ga0105238_103623402 123
103 3300010375 Ga0105239_10492732 Ga0105239_104927321 123
104 3300013100 Ga0157373_10078322 Ga0157373_100783222 123
105 3300013104 Ga0157370_10796901 Ga0157370_107969011 123
106 3300013296 Ga0157374_10255295 Ga0157374_102552953 123
107 3300013297 Ga0157378_10486787 Ga0157378_104867872 123
108 3300014969 Ga0157376_10486261 Ga0157376_104862612 123
109 3300015261 Ga0182006_1097963 Ga0182006_10979632 123
110 3300037418 Ga0395900_0046773 Ga0395900_0046773_782_1162 123
111 3300037418 Ga0395900_0184192 Ga0395900_0184192_1208_1588 123
112 3300037466 Ga0395898_0152641 Ga0395898_0152641_1217_1597 123
113 3300037466 Ga0395898_1377172 Ga0395898_1377172_70_450 123
114 3300038443 Ga0395901_0010533 Ga0395901_0010533_4880_5260 123
115 3300038443 Ga0395901_0359500 Ga0395901_0359500_290_670 123
116 3300041404 Ga0439436_0045720 Ga0439436_0045720_32_412 123
117 3300042007 Ga0439449_0028091 Ga0439449_0028091_75_455 123
118 3300042008 Ga0439450_156315 Ga0439450_156315_32_412 123
119 3300042011 Ga0439454_004952 Ga0439454_004952_167_547 123
120 3300042115 Ga0450911_020566 Ga0450911_020566_161_541 123
121 3300042134 Ga0450898_106442 Ga0450898_106442_120_500 123
122 3300044656 Ga0466969_0205223 Ga0466969_0205223_364_744 123
123 3300044658 Ga0466972_0130545 Ga0466972_0130545_334_714 123
124 3300044683 Ga0466965_0159673 Ga0466965_0159673_702_1082 123
125 3300044684 Ga0466966_0034358 Ga0466966_0034358_860_1240 123
126 3300044706 Ga0466964_0000091 Ga0466964_0000091_12119_12499 123
127 3300044719 Ga0466971_0242506 Ga0466971_0242506_84_464 123
128 3300045049 Ga0466959_0028509 Ga0466959_0028509_2989_3369 123
129 3300045976 Ga0466967_0015997 Ga0466967_0015997_4354_4734 123
130 3300046463 Ga0495653_0242459 Ga0495653_0242459_493_873 123
131 3300046472 Ga0495580_0029634 Ga0495580_0029634_857_1237 123
132 3300046473 Ga0495582_0007542 Ga0495582_0007542_1953_2333 123
133 3300046474 Ga0495605_0000260 Ga0495605_0000260_60454_60834 123
134 3300046474 Ga0495605_0003011 Ga0495605_0003011_4342_4722 123
135 3300046475 Ga0495639_0250894 Ga0495639_0250894_327_707 123
136 3300046477 Ga0495664_0703930 Ga0495664_0703930_94_474 123
137 3300046491 Ga0495584_0001835 Ga0495584_0001835_4361_4741 123
138 3300046499 Ga0495594_0022540 Ga0495594_0022540_738_1118 123
139 3300046507 Ga0495606_0037676 Ga0495606_0037676_469_849 123
140 3300046517 Ga0495630_0017831 Ga0495630_0017831_2923_3303 123
141 3300046522 Ga0495643_0011059 Ga0495643_0011059_2900_3280 123
142 3300046524 Ga0495648_0033572 Ga0495648_0033572_31_411 123
143 3300046526 Ga0495666_0000975 Ga0495666_0000975_9502_9882 123
144 3300046528 Ga0495642_0002912 Ga0495642_0002912_3682_4062 123
145 3300046529 Ga0495652_0020052 Ga0495652_0020052_4534_4914 123
146 3300046531 Ga0495665_0004075 Ga0495665_0004075_4431_4811 123
147 3300046535 Ga0495586_0014931 Ga0495586_0014931_1172_1552 123
148 3300046536 Ga0495587_0241029 Ga0495587_0241029_442_822 123
149 3300046559 Ga0495667_0301968 Ga0495667_0301968_389_769 123
150 3300046642 Ga0495634_0003145 Ga0495634_0003145_12364_12744 123
151 3300046665 Ga0495661_0012089 Ga0495661_0012089_1489_1869 123
152 3300046665 Ga0495661_0052747 Ga0495661_0052747_499_879 123
153 3300046674 Ga0495588_0121903 Ga0495588_0121903_522_902 123
154 3300046694 Ga0495649_0051556 Ga0495649_0051556_99_479 123
155 3300046794 Ga0495589_0010118 Ga0495589_0010118_1084_1464 123
156 3300046809 Ga0495600_0104154 Ga0495600_0104154_806_1186 123
157 3300046810 Ga0495660_0000178 Ga0495660_0000178_4468_4848 123
158 3300047317 Ga0495604_0192669 Ga0495604_0192669_570_950 123
159 3300047318 Ga0495636_0087023 Ga0495636_0087023_64_444 123
160 3300047320 Ga0495672_0000590 Ga0495672_0000590_8771_9151 123
161 3300047322 Ga0495680_0086272 Ga0495680_0086272_247_627 123
162 3300047443 Ga0495687_001539 Ga0495687_001539_5454_5834 123
163 3300047443 Ga0495687_005580 Ga0495687_005580_6155_6535 123
164 3300047444 Ga0495675_0002413 Ga0495675_0002413_9715_10095 123
165 3300047445 Ga0495677_0004099 Ga0495677_0004099_3018_3398 123
166 3300048088 Ga0495602_0128484 Ga0495602_0128484_733_1113 123
167 3300048091 Ga0495626_0000016 Ga0495626_0000016_79000_79380 123
168 3300048903 Ga0496100_0332721 Ga0496100_0332721_26_406 123
169 3300048903 Ga0496100_0380203 Ga0496100_0380203_665_1045 123
170 3300048905 Ga0496102_0076786 Ga0496102_0076786_344_724 123
171 3300048906 Ga0496103_0045259 Ga0496103_0045259_607_987 123
172 3300048907 Ga0496104_1316698 Ga0496104_1316698_158_538 123
173 3300048909 Ga0496106_0268693 Ga0496106_0268693_874_1254 123
174 3300048912 Ga0496109_1427618 Ga0496109_1427618_168_548 123
175 3300048917 Ga0496114_0436287 Ga0496114_0436287_221_601 123
176 3300048918 Ga0496115_0251481 Ga0496115_0251481_758_1138 123
177 3300048927 Ga0496124_0017479 Ga0496124_0017479_686_1066 123
178 3300048927 Ga0496124_0218266 Ga0496124_0218266_554_934 123
179 3300049128 Ga0501308_001629 Ga0501308_001629_1056_1436 123
180 3300049129 Ga0501309_047482 Ga0501309_047482_237_617 123
181 3300049130 Ga0501310_022591 Ga0501310_022591_253_633 123
182 3300049160 Ga0501304_002381 Ga0501304_002381_721_1101 123
183 3300049162 Ga0501307_014325 Ga0501307_014325_391_771 123
184 3300049528 Ga0501312_034371 Ga0501312_034371_377_757 123
185 3300049534 Ga0501318_020502 Ga0501318_020502_219_599 123
186 3300049538 Ga0501322_024908 Ga0501322_024908_153_533 123
187 3300061719 Ga0466962_0114442 Ga0466962_0114442_563_943 123
188 3300046452 Ga0495617_001102 Ga0495617_001102_6325_6708 124
189 3300046474 Ga0495605_0069744 Ga0495605_0069744_700_1083 124
190 3300046492 Ga0495585_0000282 Ga0495585_0000282_20086_20469 124
191 3300046492 Ga0495585_0004128 Ga0495585_0004128_1275_1658 124
192 3300046492 Ga0495585_0023658 Ga0495585_0023658_1346_1729 124
193 3300046500 Ga0495596_0072165 Ga0495596_0072165_308_691 124
194 3300046513 Ga0495616_0000680 Ga0495616_0000680_9001_9384 124
195 3300046518 Ga0495631_0016269 Ga0495631_0016269_1215_1598 124
196 3300046523 Ga0495644_0022081 Ga0495644_0022081_1812_2195 124
197 3300046524 Ga0495648_0000109 Ga0495648_0000109_14588_14971 124
198 3300046557 Ga0495622_0108925 Ga0495622_0108925_440_823 124
199 3300046660 Ga0495625_0046986 Ga0495625_0046986_479_862 124
200 3300046691 Ga0495670_0021157 Ga0495670_0021157_1170_1553 124
201 3300047445 Ga0495677_0165097 Ga0495677_0165097_250_633 124
202 3300048091 Ga0495626_0092145 Ga0495626_0092145_350_733 124
203 3300048091 Ga0495626_0176147 Ga0495626_0176147_495_878 124
204 3300049161 Ga0501305_098766 Ga0501305_098766_28_411 124
205 iso_pu_bacteria 2643221556 2643802316 124
206 iso_pu_bacteria 2643221684 2644475824 124
207 iso_pu_bacteria 2808606418 2809145361 124
208 iso_pu_bacteria 8047673197 8047673826 124
209 3300046473 Ga0495582_0717439 Ga0495582_0717439_99_485 125
210 3300046491 Ga0495584_0013827 Ga0495584_0013827_1915_2301 125
211 3300046499 Ga0495594_0006060 Ga0495594_0006060_5261_5647 125
212 3300046526 Ga0495666_0024822 Ga0495666_0024822_1909_2295 125
213 3300046531 Ga0495665_0621341 Ga0495665_0621341_138_524 125
214 3300046557 Ga0495622_0091127 Ga0495622_0091127_686_1072 125
215 3300047318 Ga0495636_0094728 Ga0495636_0094728_758_1144 125
216 3300048089 Ga0495614_0205280 Ga0495614_0205280_388_774 125
217 3300002738 JGI25154J39366_1001666 JGI25154J39366_10016666 126
218 3300002739 JGI25158J39367_1016024 JGI25158J39367_10160241 126
219 3300002739 JGI25158J39367_1026400 JGI25158J39367_10264001 126
220 3300002773 JGI25152J39213_1000395 JGI25152J39213_100039514 126
221 3300002773 JGI25152J39213_1021195 JGI25152J39213_10211952 126
222 3300002774 JGI25150J39212_1001869 JGI25150J39212_10018693 126
223 3300002774 JGI25150J39212_1003324 JGI25150J39212_10033245 126
224 3300002987 JGI25159J45721_1004182 JGI25159J45721_10041824 126
225 3300002987 JGI25159J45721_1007879 JGI25159J45721_10078794 126
226 3300002987 JGI25159J45721_1008010 JGI25159J45721_10080102 126
227 3300003187 JGI25151J46595_10143722 JGI25151J46595_101437221 126
228 3300003215 JGI25153J46596_10016332 JGI25153J46596_100163323 126
229 3300003322 rootL2_10109828 rootL2_101098285 126
230 3300003354 JGI25160J50197_1012431 JGI25160J50197_10124312 126
231 3300003374 JGI25161J50226_1004160 JGI25161J50226_10041601 126
232 3300003374 JGI25161J50226_1006147 JGI25161J50226_10061473 126
233 3300003374 JGI25161J50226_1008312 JGI25161J50226_10083122 126
234 3300003544 Ga0007417J51691_1055251 Ga0007417J51691_10552512 126
235 3300003763 Ga0055529_1000146 Ga0055529_100014621 126
236 3300003771 Ga0055526_1000074 Ga0055526_100007472 126
237 3300003771 Ga0055526_1000299 Ga0055526_100029920 126
238 3300003771 Ga0055526_1004222 Ga0055526_10042224 126
239 3300003771 Ga0055526_1015299 Ga0055526_10152994 126
240 3300003771 Ga0055526_1030873 Ga0055526_10308732 126
241 3300003773 Ga0055537_1000154 Ga0055537_100015447 126
242 3300003773 Ga0055537_1020048 Ga0055537_10200482 126
243 3300003775 Ga0055524_1000021 Ga0055524_100002110 126
244 3300003775 Ga0055524_1000099 Ga0055524_100009982 126
245 3300003775 Ga0055524_1009788 Ga0055524_10097886 126
246 3300003775 Ga0055524_1020989 Ga0055524_10209892 126
247 3300003784 Ga0055534_1000513 Ga0055534_100051314 126
248 3300003784 Ga0055534_1037235 Ga0055534_10372351 126
249 3300003784 Ga0055534_1046031 Ga0055534_10460311 126
250 3300003790 Ga0055528_1007230 Ga0055528_10072305 126
251 3300003790 Ga0055528_1027547 Ga0055528_10275472 126
252 3300003791 Ga0055530_10101324 Ga0055530_101013241 126
253 3300003791 Ga0055530_10104705 Ga0055530_101047051 126
254 3300003794 Ga0055531_10003560 Ga0055531_100035601 126
255 3300004625 Ga0055543_1002596 Ga0055543_10025964 126
256 3300004625 Ga0055543_1005900 Ga0055543_10059003 126
257 3300004625 Ga0055543_1026489 Ga0055543_10264892 126
258 3300005262 Ga0065165_1000055 Ga0065165_100005558 126
259 3300005262 Ga0065165_1003015 Ga0065165_100301512 126
260 3300005262 Ga0065165_1013829 Ga0065165_10138294 126
261 3300005262 Ga0065165_1044818 Ga0065165_10448182 126
262 3300006028 Ga0070717_10148449 Ga0070717_101484492 126
263 3300006051 Ga0075364_10477428 Ga0075364_104774282 126
264 3300006173 Ga0070716_100643389 Ga0070716_1006433892 126
265 3300006177 Ga0075362_10055685 Ga0075362_100556852 126
266 3300006946 Ga0079104_1020522 Ga0079104_10205222 126
267 3300006948 Ga0099826_10000002 Ga0099826_10000002936 126
268 3300009036 Ga0105244_10001358 Ga0105244_1000135819 126
269 3300009036 Ga0105244_10001435 Ga0105244_1000143515 126
270 3300009036 Ga0105244_10526848 Ga0105244_105268481 126
271 3300009092 Ga0105250_10242911 Ga0105250_102429111 126
272 3300009148 Ga0105243_11841945 Ga0105243_118419452 126
273 3300010375 Ga0105239_10068393 Ga0105239_100683933 126
274 3300012512 Ga0157327_1013057 Ga0157327_10130571 126
275 3300013307 Ga0157372_10877763 Ga0157372_108777632 126
276 3300015261 Ga0182006_1000026 Ga0182006_1000026187 126
277 3300015261 Ga0182006_1195413 Ga0182006_11954132 126
278 3300015262 Ga0182007_10276411 Ga0182007_102764111 126
279 3300015265 Ga0182005_1000007 Ga0182005_1000007192 126
280 3300017792 Ga0163161_10262967 Ga0163161_102629672 126
281 3300021361 Ga0213872_10000028 Ga0213872_10000028126 126
282 3300021361 Ga0213872_10006879 Ga0213872_100068793 126
283 3300021361 Ga0213872_10033421 Ga0213872_100334211 126
284 3300025208 Ga0209436_100351 Ga0209436_10035116 126
285 3300025208 Ga0209436_103199 Ga0209436_1031995 126
286 3300025233 Ga0209437_108742 Ga0209437_1087422 126
287 3300025233 Ga0209437_114140 Ga0209437_1141402 126
288 3300025245 Ga0207425_1000001 Ga0207425_10000011355 126
289 3300025245 Ga0207425_1000327 Ga0207425_10003277 126
290 3300025245 Ga0207425_1000339 Ga0207425_100033914 126
291 3300025245 Ga0207425_1064128 Ga0207425_10641281 126
292 3300025246 Ga0209646_1000010 Ga0209646_100001073 126
293 3300025258 Ga0209129_1000001 Ga0209129_1000001532 126
294 3300025258 Ga0209129_1011719 Ga0209129_10117192 126
295 3300025263 Ga0209565_1000057 Ga0209565_1000057175 126
296 3300025263 Ga0209565_1003411 Ga0209565_10034115 126
297 3300025263 Ga0209565_1003951 Ga0209565_10039511 126
298 3300025263 Ga0209565_1087400 Ga0209565_10874001 126
299 3300025272 Ga0209455_1000037 Ga0209455_1000037263 126
300 3300025273 Ga0209673_1000051 Ga0209673_1000051111 126
301 3300025273 Ga0209673_1007915 Ga0209673_10079152 126
302 3300025284 Ga0209130_1000091 Ga0209130_100009121 126
303 3300025284 Ga0209130_1002422 Ga0209130_10024221 126
304 3300025284 Ga0209130_1002705 Ga0209130_10027054 126
305 3300025291 Ga0209675_1000027 Ga0209675_1000027111 126
306 3300025291 Ga0209675_1001211 Ga0209675_10012117 126
307 3300025291 Ga0209675_1005738 Ga0209675_10057385 126
308 3300025291 Ga0209675_1024807 Ga0209675_10248073 126
309 3300025294 Ga0209025_1005014 Ga0209025_10050142 126
310 3300025295 Ga0209564_1000009 Ga0209564_1000009227 126
311 3300025295 Ga0209564_1000068 Ga0209564_100006820 126
312 3300025295 Ga0209564_1000094 Ga0209564_1000094174 126
313 3300025295 Ga0209564_1001487 Ga0209564_100148722 126
314 3300025295 Ga0209564_1007956 Ga0209564_10079562 126
315 3300025295 Ga0209564_1010315 Ga0209564_10103154 126
316 3300025295 Ga0209564_1038751 Ga0209564_10387512 126
317 3300025297 Ga0209758_1000073 Ga0209758_100007381 126
318 3300025297 Ga0209758_1000227 Ga0209758_1000227108 126
319 3300025298 Ga0209050_1000046 Ga0209050_1000046180 126
320 3300025298 Ga0209050_1000442 Ga0209050_100044222 126
321 3300025299 Ga0209256_1000044 Ga0209256_100004494 126
322 3300025299 Ga0209256_1000116 Ga0209256_10001169 126
323 3300025299 Ga0209256_1000145 Ga0209256_100014520 126
324 3300025299 Ga0209256_1000988 Ga0209256_100098827 126
325 3300025299 Ga0209256_1007853 Ga0209256_10078532 126
326 3300025302 Ga0207426_1003827 Ga0207426_10038277 126
327 3300025303 Ga0209051_1045983 Ga0209051_10459832 126
328 3300025304 Ga0209257_1000068 Ga0209257_1000068150 126
329 3300025728 Ga0207655_1015761 Ga0207655_10157615 126
330 3300025932 Ga0207690_11221363 Ga0207690_112213632 126
331 3300025935 Ga0207709_10683063 Ga0207709_106830632 126
332 3300026089 Ga0207648_11146711 Ga0207648_111467111 126
333 3300027111 Ga0209281_1005666 Ga0209281_10056664 126
334 3300027666 Ga0209282_1000001 Ga0209282_1000001225 126
335 3300030744 Ga0316181_1070955 Ga0316181_10709552 126
336 3300031548 Ga0307408_100000981 Ga0307408_10000098116 126
337 3300031548 Ga0307408_100001472 Ga0307408_10000147216 126
338 3300031548 Ga0307408_100002767 Ga0307408_1000027675 126
339 3300031548 Ga0307408_101680490 Ga0307408_1016804902 126
340 3300031838 Ga0307518_10137449 Ga0307518_101374492 126
341 3300031911 Ga0307412_10502414 Ga0307412_105024142 126
342 3300032002 Ga0307416_100011426 Ga0307416_1000114266 126
343 3300032002 Ga0307416_102723184 Ga0307416_1027231842 126
344 3300032005 Ga0307411_10968862 Ga0307411_109688621 126
345 3300037418 Ga0395900_0019995 Ga0395900_0019995_5038_5427 126
346 3300037418 Ga0395900_1822254 Ga0395900_1822254_90_479 126
347 3300037471 Ga0395905_0569842 Ga0395905_0569842_457_846 126
348 3300037471 Ga0395905_1823413 Ga0395905_1823413_54_443 126
349 3300039447 Ga0436361_0616428 Ga0436361_0616428_3194_3583 126
350 3300042005 Ga0439448_0316470 Ga0439448_0316470_14_403 126
351 3300042532 Ga0450893_0090164 Ga0450893_0090164_180_569 126
352 3300042876 Ga0451577_1143792 Ga0451577_1143792_273_662 126
353 3300044658 Ga0466972_0000042 Ga0466972_0000042_5345_5734 126
354 3300044672 Ga0466982_0387196 Ga0466982_0387196_53_442 126
355 3300044683 Ga0466965_0182269 Ga0466965_0182269_201_590 126
356 3300044706 Ga0466964_0429360 Ga0466964_0429360_14_403 126
357 3300044901 Ga0466960_0574434 Ga0466960_0574434_254_643 126
358 3300046452 Ga0495617_000041 Ga0495617_000041_18432_18821 126
359 3300046452 Ga0495617_000057 Ga0495617_000057_83187_83576 126
360 3300046452 Ga0495617_026400 Ga0495617_026400_630_1019 126
361 3300046452 Ga0495617_033783 Ga0495617_033783_427_816 126
362 3300046452 Ga0495617_234914 Ga0495617_234914_69_458 126
363 3300046453 Ga0495627_000007 Ga0495627_000007_479876_480265 126
364 3300046453 Ga0495627_001004 Ga0495627_001004_10207_10596 126
365 3300046457 Ga0495590_0000001 Ga0495590_0000001_591843_592232 126
366 3300046457 Ga0495590_0000018 Ga0495590_0000018_151564_151953 126
367 3300046457 Ga0495590_0016843 Ga0495590_0016843_669_1058 126
368 3300046457 Ga0495590_0122654 Ga0495590_0122654_415_804 126
369 3300046458 Ga0495591_004295 Ga0495591_004295_3634_4023 126
370 3300046458 Ga0495591_020659 Ga0495591_020659_388_777 126
371 3300046460 Ga0495638_0000423 Ga0495638_0000423_20647_21036 126
372 3300046460 Ga0495638_0001950 Ga0495638_0001950_12976_13365 126
373 3300046460 Ga0495638_0025941 Ga0495638_0025941_1617_2006 126
374 3300046460 Ga0495638_0148394 Ga0495638_0148394_771_1160 126
375 3300046463 Ga0495653_0000002 Ga0495653_0000002_107024_107413 126
376 3300046471 Ga0495650_0000118 Ga0495650_0000118_54630_55019 126
377 3300046471 Ga0495650_0000156 Ga0495650_0000156_90636_91025 126
378 3300046471 Ga0495650_0000166 Ga0495650_0000166_16490_16879 126
379 3300046471 Ga0495650_0001417 Ga0495650_0001417_22397_22786 126
380 3300046471 Ga0495650_0004758 Ga0495650_0004758_8716_9105 126
381 3300046471 Ga0495650_0033948 Ga0495650_0033948_458_847 126
382 3300046474 Ga0495605_0000059 Ga0495605_0000059_17301_17690 126
383 3300046474 Ga0495605_0000598 Ga0495605_0000598_14281_14670 126
384 3300046474 Ga0495605_0001111 Ga0495605_0001111_17039_17428 126
385 3300046474 Ga0495605_0041669 Ga0495605_0041669_508_897 126
386 3300046474 Ga0495605_0089022 Ga0495605_0089022_897_1286 126
387 3300046474 Ga0495605_0361635 Ga0495605_0361635_140_529 126
388 3300046491 Ga0495584_0001841 Ga0495584_0001841_7575_7964 126
389 3300046491 Ga0495584_0004974 Ga0495584_0004974_5129_5518 126
390 3300046491 Ga0495584_0007211 Ga0495584_0007211_1214_1603 126
391 3300046491 Ga0495584_0041304 Ga0495584_0041304_1855_2244 126
392 3300046492 Ga0495585_0007364 Ga0495585_0007364_5266_5655 126
393 3300046492 Ga0495585_0014509 Ga0495585_0014509_774_1163 126
394 3300046492 Ga0495585_0016543 Ga0495585_0016543_3339_3728 126
395 3300046492 Ga0495585_0101232 Ga0495585_0101232_1023_1412 126
396 3300046492 Ga0495585_0134348 Ga0495585_0134348_496_885 126
397 3300046492 Ga0495585_0181351 Ga0495585_0181351_215_604 126
398 3300046500 Ga0495596_0020946 Ga0495596_0020946_891_1280 126
399 3300046500 Ga0495596_0032093 Ga0495596_0032093_925_1314 126
400 3300046500 Ga0495596_0039830 Ga0495596_0039830_1367_1756 126
401 3300046500 Ga0495596_0112662 Ga0495596_0112662_253_642 126
402 3300046501 Ga0495607_0003144 Ga0495607_0003144_2796_3185 126
403 3300046501 Ga0495607_0003634 Ga0495607_0003634_2916_3305 126
404 3300046501 Ga0495607_0014610 Ga0495607_0014610_2116_2505 126
405 3300046501 Ga0495607_0014950 Ga0495607_0014950_3746_4135 126
406 3300046501 Ga0495607_0040944 Ga0495607_0040944_973_1362 126
407 3300046501 Ga0495607_0051300 Ga0495607_0051300_615_1004 126
408 3300046501 Ga0495607_0226812 Ga0495607_0226812_404_793 126
409 3300046501 Ga0495607_0336100 Ga0495607_0336100_29_418 126
410 3300046506 Ga0495583_0000035 Ga0495583_0000035_29197_29586 126
411 3300046506 Ga0495583_0000533 Ga0495583_0000533_27230_27619 126
412 3300046506 Ga0495583_0002759 Ga0495583_0002759_11232_11621 126
413 3300046506 Ga0495583_0004051 Ga0495583_0004051_1393_1782 126
414 3300046506 Ga0495583_0014446 Ga0495583_0014446_581_970 126
415 3300046507 Ga0495606_0000011 Ga0495606_0000011_142455_142844 126
416 3300046507 Ga0495606_0000064 Ga0495606_0000064_47364_47753 126
417 3300046507 Ga0495606_0001147 Ga0495606_0001147_18144_18533 126
418 3300046507 Ga0495606_0001181 Ga0495606_0001181_9021_9410 126
419 3300046507 Ga0495606_0006161 Ga0495606_0006161_8023_8412 126
420 3300046507 Ga0495606_0014662 Ga0495606_0014662_2510_2899 126
421 3300046507 Ga0495606_0026334 Ga0495606_0026334_3609_3998 126
422 3300046507 Ga0495606_0036164 Ga0495606_0036164_268_657 126
423 3300046507 Ga0495606_0084712 Ga0495606_0084712_438_827 126
424 3300046507 Ga0495606_0151684 Ga0495606_0151684_455_844 126
425 3300046512 Ga0495610_0000003 Ga0495610_0000003_565282_565671 126
426 3300046512 Ga0495610_0000873 Ga0495610_0000873_3936_4325 126
427 3300046512 Ga0495610_0001162 Ga0495610_0001162_20092_20481 126
428 3300046512 Ga0495610_0008688 Ga0495610_0008688_2044_2433 126
429 3300046513 Ga0495616_0012631 Ga0495616_0012631_1909_2298 126
430 3300046513 Ga0495616_0013294 Ga0495616_0013294_1328_1717 126
431 3300046513 Ga0495616_0031645 Ga0495616_0031645_2241_2630 126
432 3300046513 Ga0495616_0056668 Ga0495616_0056668_819_1208 126
433 3300046513 Ga0495616_0064979 Ga0495616_0064979_468_857 126
434 3300046513 Ga0495616_0139171 Ga0495616_0139171_273_662 126
435 3300046518 Ga0495631_0003385 Ga0495631_0003385_2246_2635 126
436 3300046518 Ga0495631_0006876 Ga0495631_0006876_477_866 126
437 3300046518 Ga0495631_0039469 Ga0495631_0039469_709_1098 126
438 3300046518 Ga0495631_0141351 Ga0495631_0141351_313_702 126
439 3300046519 Ga0495632_0009591 Ga0495632_0009591_3036_3425 126
440 3300046519 Ga0495632_0019389 Ga0495632_0019389_1365_1754 126
441 3300046520 Ga0495637_0000004 Ga0495637_0000004_545968_546357 126
442 3300046520 Ga0495637_0000482 Ga0495637_0000482_17986_18375 126
443 3300046520 Ga0495637_0058812 Ga0495637_0058812_169_558 126
444 3300046520 Ga0495637_0085828 Ga0495637_0085828_258_647 126
445 3300046522 Ga0495643_0000123 Ga0495643_0000123_102179_102568 126
446 3300046522 Ga0495643_0000170 Ga0495643_0000170_24460_24849 126
447 3300046522 Ga0495643_0004001 Ga0495643_0004001_1547_1936 126
448 3300046522 Ga0495643_0195476 Ga0495643_0195476_71_460 126
449 3300046523 Ga0495644_0003684 Ga0495644_0003684_4507_4896 126
450 3300046523 Ga0495644_0006986 Ga0495644_0006986_3488_3877 126
451 3300046523 Ga0495644_0008087 Ga0495644_0008087_3212_3601 126
452 3300046523 Ga0495644_0008241 Ga0495644_0008241_2258_2647 126
453 3300046523 Ga0495644_0010379 Ga0495644_0010379_2437_2826 126
454 3300046523 Ga0495644_0022349 Ga0495644_0022349_793_1182 126
455 3300046524 Ga0495648_0000001 Ga0495648_0000001_169928_170317 126
456 3300046524 Ga0495648_0000541 Ga0495648_0000541_2676_3065 126
457 3300046524 Ga0495648_0002349 Ga0495648_0002349_3014_3403 126
458 3300046524 Ga0495648_0027536 Ga0495648_0027536_2466_2855 126
459 3300046524 Ga0495648_0041132 Ga0495648_0041132_171_560 126
460 3300046524 Ga0495648_0132888 Ga0495648_0132888_740_1129 126
461 3300046524 Ga0495648_0175834 Ga0495648_0175834_170_559 126
462 3300046525 Ga0495663_0311424 Ga0495663_0311424_145_534 126
463 3300046528 Ga0495642_0000196 Ga0495642_0000196_18182_18571 126
464 3300046528 Ga0495642_0003623 Ga0495642_0003623_3680_4069 126
465 3300046528 Ga0495642_0020087 Ga0495642_0020087_1784_2173 126
466 3300046528 Ga0495642_0021451 Ga0495642_0021451_311_700 126
467 3300046528 Ga0495642_0027433 Ga0495642_0027433_1374_1763 126
468 3300046528 Ga0495642_0077602 Ga0495642_0077602_448_837 126
469 3300046528 Ga0495642_0205702 Ga0495642_0205702_238_627 126
470 3300046530 Ga0495654_0000038 Ga0495654_0000038_167347_167736 126
471 3300046530 Ga0495654_0049466 Ga0495654_0049466_448_837 126
472 3300046530 Ga0495654_0062661 Ga0495654_0062661_112_501 126
473 3300046538 Ga0495609_0000636 Ga0495609_0000636_15962_16351 126
474 3300046538 Ga0495609_0003073 Ga0495609_0003073_7086_7475 126
475 3300046538 Ga0495609_0003510 Ga0495609_0003510_571_960 126
476 3300046538 Ga0495609_0003925 Ga0495609_0003925_6583_6972 126
477 3300046538 Ga0495609_0010588 Ga0495609_0010588_1098_1487 126
478 3300046538 Ga0495609_0018688 Ga0495609_0018688_270_659 126
479 3300046538 Ga0495609_0021303 Ga0495609_0021303_2508_2897 126
480 3300046538 Ga0495609_0194205 Ga0495609_0194205_56_445 126
481 3300046542 Ga0495597_0001393 Ga0495597_0001393_15111_15500 126
482 3300046542 Ga0495597_0001520 Ga0495597_0001520_9927_10316 126
483 3300046542 Ga0495597_0002277 Ga0495597_0002277_5816_6205 126
484 3300046542 Ga0495597_0013569 Ga0495597_0013569_3469_3858 126
485 3300046542 Ga0495597_0062840 Ga0495597_0062840_499_888 126
486 3300046557 Ga0495622_0000028 Ga0495622_0000028_84650_85039 126
487 3300046557 Ga0495622_0000398 Ga0495622_0000398_2922_3311 126
488 3300046557 Ga0495622_0226951 Ga0495622_0226951_131_520 126
489 3300046558 Ga0495633_0002074 Ga0495633_0002074_1730_2119 126
490 3300046558 Ga0495633_0004129 Ga0495633_0004129_2890_3279 126
491 3300046558 Ga0495633_0008374 Ga0495633_0008374_2268_2657 126
492 3300046558 Ga0495633_0015513 Ga0495633_0015513_3412_3801 126
493 3300046558 Ga0495633_0018775 Ga0495633_0018775_2474_2863 126
494 3300046558 Ga0495633_0036808 Ga0495633_0036808_1566_1955 126
495 3300046558 Ga0495633_0107297 Ga0495633_0107297_501_890 126
496 3300046558 Ga0495633_0540313 Ga0495633_0540313_96_485 126
497 3300046615 Ga0495656_0043073 Ga0495656_0043073_1058_1447 126
498 3300046615 Ga0495656_0120080 Ga0495656_0120080_456_845 126
499 3300046616 Ga0495668_0000048 Ga0495668_0000048_191790_192179 126
500 3300046616 Ga0495668_0001362 Ga0495668_0001362_3693_4082 126
501 3300046616 Ga0495668_0002401 Ga0495668_0002401_6236_6625 126
502 3300046616 Ga0495668_0002455 Ga0495668_0002455_8409_8798 126
503 3300046616 Ga0495668_0005220 Ga0495668_0005220_3040_3429 126
504 3300046616 Ga0495668_0010370 Ga0495668_0010370_4254_4643 126
505 3300046616 Ga0495668_0013225 Ga0495668_0013225_3716_4105 126
506 3300046616 Ga0495668_0013802 Ga0495668_0013802_1603_1992 126
507 3300046616 Ga0495668_0027856 Ga0495668_0027856_751_1140 126
508 3300046648 Ga0495611_0005048 Ga0495611_0005048_1328_1717 126
509 3300046648 Ga0495611_0048649 Ga0495611_0048649_118_507 126
510 3300046648 Ga0495611_0052940 Ga0495611_0052940_50_439 126
511 3300046648 Ga0495611_0062572 Ga0495611_0062572_617_1006 126
512 3300046648 Ga0495611_0357724 Ga0495611_0357724_157_546 126
513 3300046648 Ga0495611_0448255 Ga0495611_0448255_122_511 126
514 3300046660 Ga0495625_0000164 Ga0495625_0000164_81539_81928 126
515 3300046660 Ga0495625_0005794 Ga0495625_0005794_10219_10608 126
516 3300046660 Ga0495625_0009364 Ga0495625_0009364_334_723 126
517 3300046660 Ga0495625_0015487 Ga0495625_0015487_2835_3224 126
518 3300046660 Ga0495625_0018254 Ga0495625_0018254_2222_2611 126
519 3300046660 Ga0495625_0038200 Ga0495625_0038200_219_608 126
520 3300046660 Ga0495625_0453458 Ga0495625_0453458_272_661 126
521 3300046660 Ga0495625_0566492 Ga0495625_0566492_258_647 126
522 3300046664 Ga0495659_0000289 Ga0495659_0000289_16685_17074 126
523 3300046664 Ga0495659_0001247 Ga0495659_0001247_5983_6372 126
524 3300046664 Ga0495659_0009392 Ga0495659_0009392_754_1143 126
525 3300046664 Ga0495659_0123825 Ga0495659_0123825_523_912 126
526 3300046665 Ga0495661_0002363 Ga0495661_0002363_10343_10732 126
527 3300046665 Ga0495661_0006427 Ga0495661_0006427_4564_4953 126
528 3300046665 Ga0495661_0067409 Ga0495661_0067409_1365_1754 126
529 3300046665 Ga0495661_0072941 Ga0495661_0072941_758_1147 126
530 3300046665 Ga0495661_0083536 Ga0495661_0083536_317_706 126
531 3300046665 Ga0495661_0235293 Ga0495661_0235293_363_752 126
532 3300046684 Ga0495669_0033212 Ga0495669_0033212_1724_2113 126
533 3300046684 Ga0495669_0036868 Ga0495669_0036868_496_885 126
534 3300046691 Ga0495670_0009961 Ga0495670_0009961_3893_4282 126
535 3300046691 Ga0495670_0022494 Ga0495670_0022494_1115_1504 126
536 3300046691 Ga0495670_0034737 Ga0495670_0034737_1887_2276 126
537 3300046691 Ga0495670_0039198 Ga0495670_0039198_574_963 126
538 3300046691 Ga0495670_0195811 Ga0495670_0195811_519_908 126
539 3300046691 Ga0495670_0274896 Ga0495670_0274896_296_685 126
540 3300046692 Ga0495671_0000001 Ga0495671_0000001_105243_105632 126
541 3300046692 Ga0495671_0000744 Ga0495671_0000744_22051_22440 126
542 3300046692 Ga0495671_0000848 Ga0495671_0000848_13031_13420 126
543 3300046692 Ga0495671_0023568 Ga0495671_0023568_750_1139 126
544 3300046692 Ga0495671_0027348 Ga0495671_0027348_1412_1801 126
545 3300046692 Ga0495671_0028223 Ga0495671_0028223_130_519 126
546 3300046692 Ga0495671_0112690 Ga0495671_0112690_132_521 126
547 3300046692 Ga0495671_0180502 Ga0495671_0180502_301_690 126
548 3300046694 Ga0495649_0002149 Ga0495649_0002149_12409_12798 126
549 3300046694 Ga0495649_0007989 Ga0495649_0007989_4904_5293 126
550 3300046694 Ga0495649_0031292 Ga0495649_0031292_205_594 126
551 3300046694 Ga0495649_0133357 Ga0495649_0133357_814_1203 126
552 3300046694 Ga0495649_0206303 Ga0495649_0206303_49_438 126
553 3300046794 Ga0495589_0001260 Ga0495589_0001260_11093_11482 126
554 3300046794 Ga0495589_0017796 Ga0495589_0017796_1219_1608 126
555 3300046794 Ga0495589_0085592 Ga0495589_0085592_384_773 126
556 3300046794 Ga0495589_0180011 Ga0495589_0180011_340_729 126
557 3300046810 Ga0495660_0001476 Ga0495660_0001476_8814_9203 126
558 3300046810 Ga0495660_0003120 Ga0495660_0003120_9919_10308 126
559 3300046810 Ga0495660_0003323 Ga0495660_0003323_9569_9958 126
560 3300046810 Ga0495660_0022155 Ga0495660_0022155_2630_3019 126
561 3300046810 Ga0495660_0044082 Ga0495660_0044082_1133_1522 126
562 3300046810 Ga0495660_0059138 Ga0495660_0059138_1303_1692 126
563 3300046810 Ga0495660_0095189 Ga0495660_0095189_758_1147 126
564 3300046810 Ga0495660_0128231 Ga0495660_0128231_294_683 126
565 3300047318 Ga0495636_0006148 Ga0495636_0006148_2982_3371 126
566 3300047318 Ga0495636_0017608 Ga0495636_0017608_2095_2484 126
567 3300047320 Ga0495672_0000424 Ga0495672_0000424_44784_45173 126
568 3300047320 Ga0495672_0000758 Ga0495672_0000758_14181_14570 126
569 3300047320 Ga0495672_0001440 Ga0495672_0001440_15855_16244 126
570 3300047320 Ga0495672_0011872 Ga0495672_0011872_1352_1741 126
571 3300047323 Ga0495683_0000952 Ga0495683_0000952_6053_6442 126
572 3300047323 Ga0495683_0001039 Ga0495683_0001039_15414_15803 126
573 3300047323 Ga0495683_0016641 Ga0495683_0016641_1781_2170 126
574 3300047323 Ga0495683_0029959 Ga0495683_0029959_1570_1959 126
575 3300047323 Ga0495683_0087662 Ga0495683_0087662_276_665 126
576 3300047443 Ga0495687_000148 Ga0495687_000148_83152_83541 126
577 3300047443 Ga0495687_010840 Ga0495687_010840_772_1161 126
578 3300047443 Ga0495687_076171 Ga0495687_076171_134_523 126
579 3300047445 Ga0495677_0000979 Ga0495677_0000979_8005_8394 126
580 3300047445 Ga0495677_0003050 Ga0495677_0003050_5649_6038 126
581 3300047445 Ga0495677_0007985 Ga0495677_0007985_2336_2725 126
582 3300047445 Ga0495677_0016146 Ga0495677_0016146_734_1123 126
583 3300047445 Ga0495677_0149027 Ga0495677_0149027_113_502 126
584 3300047446 Ga0495679_003957 Ga0495679_003957_4178_4567 126
585 3300047446 Ga0495679_016017 Ga0495679_016017_1786_2175 126
586 3300047446 Ga0495679_017414 Ga0495679_017414_815_1204 126
587 3300047446 Ga0495679_050542 Ga0495679_050542_271_660 126
588 3300047447 Ga0495685_000077 Ga0495685_000077_26354_26743 126
589 3300047447 Ga0495685_006760 Ga0495685_006760_806_1195 126
590 3300047447 Ga0495685_010360 Ga0495685_010360_1271_1660 126
591 3300047469 Ga0495673_0000003 Ga0495673_0000003_1347350_1347739 126
592 3300047469 Ga0495673_0000097 Ga0495673_0000097_139374_139763 126
593 3300047469 Ga0495673_0000100 Ga0495673_0000100_19387_19776 126
594 3300047469 Ga0495673_0010183 Ga0495673_0010183_1128_1517 126
595 3300047470 Ga0495681_0002968 Ga0495681_0002968_10847_11236 126
596 3300047470 Ga0495681_0009449 Ga0495681_0009449_4424_4813 126
597 3300047470 Ga0495681_0011139 Ga0495681_0011139_3305_3694 126
598 3300047470 Ga0495681_0011368 Ga0495681_0011368_1313_1702 126
599 3300047470 Ga0495681_0048194 Ga0495681_0048194_1198_1587 126
600 3300047472 Ga0495686_0001462 Ga0495686_0001462_20944_21333 126
601 3300047472 Ga0495686_0001479 Ga0495686_0001479_836_1225 126
602 3300047472 Ga0495686_0008053 Ga0495686_0008053_2598_2987 126
603 3300047472 Ga0495686_0049892 Ga0495686_0049892_900_1289 126
604 3300047472 Ga0495686_0228281 Ga0495686_0228281_560_949 126
605 3300047472 Ga0495686_0377640 Ga0495686_0377640_173_562 126
606 3300048091 Ga0495626_0009582 Ga0495626_0009582_4327_4716 126
607 3300048091 Ga0495626_0027385 Ga0495626_0027385_108_497 126
608 3300048903 Ga0496100_0266561 Ga0496100_0266561_163_552 126
609 3300048905 Ga0496102_0016630 Ga0496102_0016630_2005_2394 126
610 3300048905 Ga0496102_0020653 Ga0496102_0020653_4535_4924 126
611 3300048905 Ga0496102_0023210 Ga0496102_0023210_2102_2491 126
612 3300048905 Ga0496102_0178602 Ga0496102_0178602_1229_1618 126
613 3300048906 Ga0496103_0001321 Ga0496103_0001321_5496_5885 126
614 3300048906 Ga0496103_0002752 Ga0496103_0002752_4239_4628 126
615 3300048907 Ga0496104_0668275 Ga0496104_0668275_251_640 126
616 3300048908 Ga0496105_0113339 Ga0496105_0113339_1693_2082 126
617 3300048909 Ga0496106_0230450 Ga0496106_0230450_61_450 126
618 3300048910 Ga0496107_0021795 Ga0496107_0021795_2393_2782 126
619 3300048911 Ga0496108_0483826 Ga0496108_0483826_457_846 126
620 3300048912 Ga0496109_0321254 Ga0496109_0321254_339_728 126
621 3300048913 Ga0496110_0003499 Ga0496110_0003499_1517_1906 126
622 3300048914 Ga0496111_0031224 Ga0496111_0031224_573_962 126
623 3300048917 Ga0496114_0475759 Ga0496114_0475759_580_969 126
624 3300048918 Ga0496115_0282915 Ga0496115_0282915_500_889 126
625 3300048919 Ga0496116_0080004 Ga0496116_0080004_377_766 126
626 3300048922 Ga0496119_0321679 Ga0496119_0321679_113_502 126
627 3300048923 Ga0496120_0105101 Ga0496120_0105101_39_428 126
628 3300048926 Ga0496123_0053089 Ga0496123_0053089_1196_1585 126
629 3300048926 Ga0496123_0299454 Ga0496123_0299454_74_463 126
630 3300048927 Ga0496124_0041651 Ga0496124_0041651_399_788 126
631 3300048927 Ga0496124_0173038 Ga0496124_0173038_542_931 126
632 3300048927 Ga0496124_0295788 Ga0496124_0295788_115_504 126
633 3300048927 Ga0496124_0731909 Ga0496124_0731909_13_402 126
634 3300048929 Ga0496126_0015539 Ga0496126_0015539_6238_6627 126
635 3300049162 Ga0501307_033547 Ga0501307_033547_244_633 126
636 3300049459 Ga0495678_000004 Ga0495678_000004_426106_426495 126
637 3300049459 Ga0495678_000384 Ga0495678_000384_19992_20381 126
638 3300049459 Ga0495678_000515 Ga0495678_000515_9903_10292 126
639 3300049459 Ga0495678_001499 Ga0495678_001499_13460_13849 126
640 3300049459 Ga0495678_024378 Ga0495678_024378_475_864 126
641 3300049459 Ga0495678_040952 Ga0495678_040952_1431_1820 126
642 3300049459 Ga0495678_156665 Ga0495678_156665_324_713 126
643 3300049459 Ga0495678_209202 Ga0495678_209202_70_459 126
644 3300049460 Ga0495682_0000869 Ga0495682_0000869_13974_14363 126
645 3300049460 Ga0495682_0001115 Ga0495682_0001115_1405_1794 126
646 3300049460 Ga0495682_0031927 Ga0495682_0031927_1359_1748 126
647 3300049530 Ga0501314_024195 Ga0501314_024195_169_558 126
648 3300049531 Ga0501315_022278 Ga0501315_022278_215_604 126
649 3300049531 Ga0501315_037778 Ga0501315_037778_80_469 126
650 3300049532 Ga0501316_013762 Ga0501316_013762_391_780 126
651 3300049667 Ga0501230_002780 Ga0501230_002780_520_909 126
652 3300049671 Ga0501238_008754 Ga0501238_008754_530_919 126
653 3300049679 Ga0501249_002892 Ga0501249_002892_1716_2105 126
654 3300049707 Ga0501234_055166 Ga0501234_055166_176_565 126
655 3300049760 Ga0501263_027310 Ga0501263_027310_350_739 126
656 3300049762 Ga0501265_102468 Ga0501265_102468_99_488 126
657 3300049766 Ga0501269_000099 Ga0501269_000099_23426_23815 126
658 3300049775 Ga0501279_002296 Ga0501279_002296_1039_1428 126
659 3300049775 Ga0501279_017123 Ga0501279_017123_414_803 126
660 3300049852 Ga0501220_04705 Ga0501220_04705_35_424 126
661 3300053091 Ga0500647_0364579 Ga0500647_0364579_35_424 126
662 3300053118 Ga0500594_0024669 Ga0500594_0024669_877_1266 126
663 3300053125 Ga0500618_000358 Ga0500618_000358_27465_27854 126
664 3300053125 Ga0500618_035890 Ga0500618_035890_121_510 126
665 3300053145 Ga0500586_027112 Ga0500586_027112_82_471 126
666 3300059627 Ga0587117_035241 Ga0587117_035241_347_736 126
667 3300059639 Ga0587062_061390 Ga0587062_061390_170_559 126
668 3300059641 Ga0587068_138221 Ga0587068_138221_56_445 126
669 3300060346 Ga0587111_0057014 Ga0587111_0057014_347_736 126
670 3300031344 Ga0265316_10067224 Ga0265316_100672242 127
671 3300031616 Ga0307508_10139506 Ga0307508_101395063 127
672 3300031911 Ga0307412_10476873 Ga0307412_104768732 127
673 3300032002 Ga0307416_101432393 Ga0307416_1014323932 127
674 3300037068 Ga0373925_0080283 Ga0373925_0080283_1887_2282 127
675 3300037471 Ga0395905_1847022 Ga0395905_1847022_84_476 127
676 3300042139 Ga0450904_000438 Ga0450904_000438_4304_4696 127
677 3300042876 Ga0451577_0107899 Ga0451577_0107899_78_473 127
678 3300044712 Ga0453684_0000917 Ga0453684_0000917_42411_42806 127
679 3300044712 Ga0453684_1277106 Ga0453684_1277106_254_649 127
680 3300045051 Ga0451576_0365370 Ga0451576_0365370_201_596 127
681 3300046455 Ga0495603_0327998 Ga0495603_0327998_426_818 127
682 3300046457 Ga0495590_0003051 Ga0495590_0003051_2730_3122 127
683 3300046457 Ga0495590_0186459 Ga0495590_0186459_46_438 127
684 3300046459 Ga0495629_0008847 Ga0495629_0008847_4303_4695 127
685 3300046459 Ga0495629_0041207 Ga0495629_0041207_1428_1820 127
686 3300046459 Ga0495629_0171494 Ga0495629_0171494_320_712 127
687 3300046460 Ga0495638_0287897 Ga0495638_0287897_241_633 127
688 3300046463 Ga0495653_0005312 Ga0495653_0005312_5679_6071 127
689 3300046463 Ga0495653_0123169 Ga0495653_0123169_1120_1512 127
690 3300046471 Ga0495650_0000108 Ga0495650_0000108_9466_9858 127
691 3300046472 Ga0495580_0685629 Ga0495580_0685629_235_627 127
692 3300046473 Ga0495582_0096997 Ga0495582_0096997_719_1111 127
693 3300046473 Ga0495582_0149706 Ga0495582_0149706_189_581 127
694 3300046473 Ga0495582_0378240 Ga0495582_0378240_299_691 127
695 3300046474 Ga0495605_0029751 Ga0495605_0029751_105_497 127
696 3300046474 Ga0495605_0037060 Ga0495605_0037060_636_1028 127
697 3300046474 Ga0495605_0062056 Ga0495605_0062056_514_906 127
698 3300046474 Ga0495605_0378819 Ga0495605_0378819_162_554 127
699 3300046491 Ga0495584_0011682 Ga0495584_0011682_1957_2349 127
700 3300046491 Ga0495584_0036310 Ga0495584_0036310_272_664 127
701 3300046491 Ga0495584_0089372 Ga0495584_0089372_138_530 127
702 3300046491 Ga0495584_0666068 Ga0495584_0666068_15_407 127
703 3300046492 Ga0495585_0208936 Ga0495585_0208936_51_443 127
704 3300046499 Ga0495594_0056774 Ga0495594_0056774_577_969 127
705 3300046499 Ga0495594_0063287 Ga0495594_0063287_291_683 127
706 3300046499 Ga0495594_0088303 Ga0495594_0088303_725_1117 127
707 3300046499 Ga0495594_0100196 Ga0495594_0100196_286_678 127
708 3300046499 Ga0495594_0228512 Ga0495594_0228512_410_802 127
709 3300046500 Ga0495596_0016755 Ga0495596_0016755_1036_1428 127
710 3300046507 Ga0495606_0009081 Ga0495606_0009081_4021_4413 127
711 3300046507 Ga0495606_0145115 Ga0495606_0145115_804_1196 127
712 3300046513 Ga0495616_0000343 Ga0495616_0000343_20657_21049 127
713 3300046513 Ga0495616_0009654 Ga0495616_0009654_3649_4041 127
714 3300046518 Ga0495631_0002105 Ga0495631_0002105_4339_4731 127
715 3300046518 Ga0495631_0044435 Ga0495631_0044435_535_927 127
716 3300046519 Ga0495632_0000062 Ga0495632_0000062_13491_13883 127
717 3300046520 Ga0495637_0005727 Ga0495637_0005727_3333_3725 127
718 3300046520 Ga0495637_0022968 Ga0495637_0022968_893_1285 127
719 3300046523 Ga0495644_0144985 Ga0495644_0144985_249_641 127
720 3300046524 Ga0495648_0130402 Ga0495648_0130402_651_1043 127
721 3300046526 Ga0495666_0001244 Ga0495666_0001244_3431_3823 127
722 3300046526 Ga0495666_0022762 Ga0495666_0022762_1059_1451 127
723 3300046526 Ga0495666_0088051 Ga0495666_0088051_317_709 127
724 3300046528 Ga0495642_0008881 Ga0495642_0008881_2673_3065 127
725 3300046528 Ga0495642_0032728 Ga0495642_0032728_505_897 127
726 3300046528 Ga0495642_0101537 Ga0495642_0101537_356_748 127
727 3300046530 Ga0495654_0002038 Ga0495654_0002038_756_1148 127
728 3300046530 Ga0495654_0052082 Ga0495654_0052082_163_555 127
729 3300046530 Ga0495654_0084811 Ga0495654_0084811_701_1093 127
730 3300046531 Ga0495665_0018192 Ga0495665_0018192_3258_3650 127
731 3300046531 Ga0495665_0022051 Ga0495665_0022051_2920_3312 127
732 3300046531 Ga0495665_0030374 Ga0495665_0030374_1720_2112 127
733 3300046531 Ga0495665_0136960 Ga0495665_0136960_799_1191 127
734 3300046531 Ga0495665_0237927 Ga0495665_0237927_521_913 127
735 3300046533 Ga0495640_0096951 Ga0495640_0096951_453_845 127
736 3300046535 Ga0495586_0010365 Ga0495586_0010365_4132_4524 127
737 3300046535 Ga0495586_0197549 Ga0495586_0197549_196_588 127
738 3300046535 Ga0495586_0427977 Ga0495586_0427977_180_572 127
739 3300046536 Ga0495587_0094550 Ga0495587_0094550_1244_1636 127
740 3300046536 Ga0495587_0331613 Ga0495587_0331613_404_796 127
741 3300046538 Ga0495609_0023305 Ga0495609_0023305_1700_2092 127
742 3300046538 Ga0495609_0107807 Ga0495609_0107807_312_704 127
743 3300046538 Ga0495609_0110710 Ga0495609_0110710_292_684 127
744 3300046542 Ga0495597_0001796 Ga0495597_0001796_13454_13846 127
745 3300046542 Ga0495597_0004290 Ga0495597_0004290_3124_3516 127
746 3300046542 Ga0495597_0007074 Ga0495597_0007074_2677_3069 127
747 3300046542 Ga0495597_0067467 Ga0495597_0067467_246_638 127
748 3300046542 Ga0495597_0091483 Ga0495597_0091483_236_628 127
749 3300046543 Ga0495645_0125435 Ga0495645_0125435_1034_1426 127
750 3300046557 Ga0495622_0292540 Ga0495622_0292540_246_638 127
751 3300046558 Ga0495633_0007239 Ga0495633_0007239_3848_4240 127
752 3300046558 Ga0495633_0077381 Ga0495633_0077381_999_1391 127
753 3300046616 Ga0495668_0004786 Ga0495668_0004786_2330_2722 127
754 3300046616 Ga0495668_0007462 Ga0495668_0007462_789_1181 127
755 3300046616 Ga0495668_0184006 Ga0495668_0184006_260_652 127
756 3300046642 Ga0495634_0052778 Ga0495634_0052778_1738_2130 127
757 3300046648 Ga0495611_0034181 Ga0495611_0034181_1375_1767 127
758 3300046660 Ga0495625_0009819 Ga0495625_0009819_13_405 127
759 3300046660 Ga0495625_0245382 Ga0495625_0245382_38_430 127
760 3300046663 Ga0495635_0006579 Ga0495635_0006579_786_1178 127
761 3300046663 Ga0495635_0619974 Ga0495635_0619974_127_519 127
762 3300046665 Ga0495661_0001167 Ga0495661_0001167_6467_6859 127
763 3300046665 Ga0495661_0103370 Ga0495661_0103370_519_911 127
764 3300046665 Ga0495661_0104872 Ga0495661_0104872_623_1015 127
765 3300046665 Ga0495661_0141254 Ga0495661_0141254_756_1148 127
766 3300046665 Ga0495661_0256340 Ga0495661_0256340_426_818 127
767 3300046665 Ga0495661_0267876 Ga0495661_0267876_104_496 127
768 3300046674 Ga0495588_0035172 Ga0495588_0035172_204_596 127
769 3300046674 Ga0495588_0064739 Ga0495588_0064739_1283_1675 127
770 3300046674 Ga0495588_0065381 Ga0495588_0065381_1330_1722 127
771 3300046674 Ga0495588_0071146 Ga0495588_0071146_1281_1673 127
772 3300046678 Ga0495599_0266621 Ga0495599_0266621_306_698 127
773 3300046679 Ga0495623_0007712 Ga0495623_0007712_5953_6345 127
774 3300046679 Ga0495623_0027846 Ga0495623_0027846_216_608 127
775 3300046679 Ga0495623_0091002 Ga0495623_0091002_354_746 127
776 3300046679 Ga0495623_0220094 Ga0495623_0220094_481_873 127
777 3300046680 Ga0495646_0190750 Ga0495646_0190750_117_509 127
778 3300046684 Ga0495669_0000217 Ga0495669_0000217_13372_13764 127
779 3300046689 Ga0495613_0069142 Ga0495613_0069142_657_1049 127
780 3300046690 Ga0495624_0007752 Ga0495624_0007752_5491_5883 127
781 3300046691 Ga0495670_0021082 Ga0495670_0021082_299_691 127
782 3300046691 Ga0495670_0199854 Ga0495670_0199854_153_545 127
783 3300046691 Ga0495670_0408214 Ga0495670_0408214_73_465 127
784 3300046694 Ga0495649_0218901 Ga0495649_0218901_311_703 127
785 3300046794 Ga0495589_0042313 Ga0495589_0042313_1269_1661 127
786 3300046794 Ga0495589_0163846 Ga0495589_0163846_80_472 127
787 3300046794 Ga0495589_0241467 Ga0495589_0241467_190_582 127
788 3300046809 Ga0495600_0002155 Ga0495600_0002155_10633_11025 127
789 3300046810 Ga0495660_0017672 Ga0495660_0017672_2531_2923 127
790 3300047315 Ga0495581_0008712 Ga0495581_0008712_1362_1754 127
791 3300047315 Ga0495581_0078795 Ga0495581_0078795_1181_1573 127
792 3300047317 Ga0495604_0036530 Ga0495604_0036530_236_628 127
793 3300047317 Ga0495604_0085661 Ga0495604_0085661_69_461 127
794 3300047317 Ga0495604_0148305 Ga0495604_0148305_200_592 127
795 3300047317 Ga0495604_0223117 Ga0495604_0223117_133_525 127
796 3300047317 Ga0495604_0262021 Ga0495604_0262021_484_876 127
797 3300047319 Ga0495674_0003394 Ga0495674_0003394_609_1001 127
798 3300047319 Ga0495674_0784125 Ga0495674_0784125_207_599 127
799 3300047320 Ga0495672_0001672 Ga0495672_0001672_15204_15596 127
800 3300047320 Ga0495672_0002152 Ga0495672_0002152_5452_5844 127
801 3300047320 Ga0495672_0108065 Ga0495672_0108065_701_1093 127
802 3300047321 Ga0495676_0000342 Ga0495676_0000342_20040_20432 127
803 3300047321 Ga0495676_0077540 Ga0495676_0077540_223_615 127
804 3300047321 Ga0495676_0123990 Ga0495676_0123990_63_455 127
805 3300047321 Ga0495676_0169465 Ga0495676_0169465_374_766 127
806 3300047322 Ga0495680_0005344 Ga0495680_0005344_1023_1415 127
807 3300047322 Ga0495680_0909474 Ga0495680_0909474_130_522 127
808 3300047323 Ga0495683_0095436 Ga0495683_0095436_467_859 127
809 3300047443 Ga0495687_000017 Ga0495687_000017_120017_120409 127
810 3300047444 Ga0495675_0004400 Ga0495675_0004400_4990_5382 127
811 3300047444 Ga0495675_0147236 Ga0495675_0147236_1015_1407 127
812 3300047445 Ga0495677_0011203 Ga0495677_0011203_1428_1820 127
813 3300047446 Ga0495679_003113 Ga0495679_003113_913_1305 127
814 3300047447 Ga0495685_034772 Ga0495685_034772_611_1003 127
815 3300047447 Ga0495685_095119 Ga0495685_095119_121_513 127
816 3300047470 Ga0495681_0014249 Ga0495681_0014249_2630_3022 127
817 3300047470 Ga0495681_0020331 Ga0495681_0020331_198_590 127
818 3300047472 Ga0495686_0000428 Ga0495686_0000428_58222_58614 127
819 3300047472 Ga0495686_0293147 Ga0495686_0293147_164_556 127
820 3300047673 Ga0495593_0002473 Ga0495593_0002473_2433_2825 127
821 3300047673 Ga0495593_0021073 Ga0495593_0021073_844_1236 127
822 3300047673 Ga0495593_0128819 Ga0495593_0128819_68_460 127
823 3300048088 Ga0495602_0086299 Ga0495602_0086299_823_1215 127
824 3300048088 Ga0495602_0459422 Ga0495602_0459422_71_463 127
825 3300048089 Ga0495614_0002563 Ga0495614_0002563_4682_5074 127
826 3300048089 Ga0495614_0162459 Ga0495614_0162459_52_444 127
827 3300048089 Ga0495614_0181823 Ga0495614_0181823_519_911 127
828 3300048089 Ga0495614_0251407 Ga0495614_0251407_105_497 127
829 3300048091 Ga0495626_0033635 Ga0495626_0033635_108_500 127
830 3300048091 Ga0495626_0040645 Ga0495626_0040645_1127_1519 127
831 3300048903 Ga0496100_0004475 Ga0496100_0004475_1162_1554 127
832 3300048904 Ga0496101_0106911 Ga0496101_0106911_386_778 127
833 3300048905 Ga0496102_0205505 Ga0496102_0205505_324_716 127
834 3300048915 Ga0496112_0037388 Ga0496112_0037388_1788_2180 127
835 3300048915 Ga0496112_1095950 Ga0496112_1095950_197_589 127
836 3300048916 Ga0496113_0123029 Ga0496113_0123029_1334_1726 127
837 3300048918 Ga0496115_0011854 Ga0496115_0011854_5327_5719 127
838 3300048925 Ga0496122_0000835 Ga0496122_0000835_45285_45677 127
839 3300048926 Ga0496123_0001003 Ga0496123_0001003_27067_27459 127
840 3300048927 Ga0496124_0143321 Ga0496124_0143321_970_1362 127
841 3300048928 Ga0496125_0001280 Ga0496125_0001280_23813_24205 127
842 3300049459 Ga0495678_000866 Ga0495678_000866_16942_17334 127
843 3300003163 Ga0006759J45824_1074564 Ga0006759J45824_10745641 128
844 3300003575 Ga0007409J51694_1016091 Ga0007409J51694_10160911 128
845 3300003759 Ga0055525_1000001 Ga0055525_1000001503 128
846 3300005262 Ga0065165_1031771 Ga0065165_10317712 128
847 3300005328 Ga0070676_10100217 Ga0070676_101002172 128
848 3300005336 Ga0070680_100113297 Ga0070680_1001132973 128
849 3300005339 Ga0070660_100045119 Ga0070660_1000451193 128
850 3300005344 Ga0070661_100571449 Ga0070661_1005714492 128
851 3300005344 Ga0070661_100887244 Ga0070661_1008872441 128
852 3300005354 Ga0070675_100327014 Ga0070675_1003270142 128
853 3300005366 Ga0070659_100016372 Ga0070659_1000163724 128
854 3300005366 Ga0070659_101646324 Ga0070659_1016463242 128
855 3300005455 Ga0070663_100487664 Ga0070663_1004876642 128
856 3300005530 Ga0070679_101207007 Ga0070679_1012070072 128
857 3300005563 Ga0068855_100044300 Ga0068855_1000443002 128
858 3300005564 Ga0070664_100271830 Ga0070664_1002718302 128
859 3300005564 Ga0070664_100792839 Ga0070664_1007928391 128
860 3300005564 Ga0070664_101708942 Ga0070664_1017089421 128
861 3300005577 Ga0068857_100381724 Ga0068857_1003817242 128
862 3300005614 Ga0068856_100937236 Ga0068856_1009372362 128
863 3300005616 Ga0068852_100132069 Ga0068852_1001320693 128
864 3300005834 Ga0068851_10140563 Ga0068851_101405632 128
865 3300006358 Ga0068871_100127459 Ga0068871_1001274593 128
866 3300009093 Ga0105240_11305553 Ga0105240_113055532 128
867 3300013308 Ga0157375_13139799 Ga0157375_131397991 128
868 3300014745 Ga0157377_11272339 Ga0157377_112723392 128
869 3300020077 Ga0206351_10247105 Ga0206351_102471052 128
870 3300020082 Ga0206353_10452765 Ga0206353_104527652 128
871 3300020610 Ga0154015_1381368 Ga0154015_13813682 128
872 3300025230 Ga0209563_100007 Ga0209563_100007593 128
873 3300025253 Ga0209677_104764 Ga0209677_1047645 128
874 3300025254 Ga0209148_1000360 Ga0209148_100036018 128
875 3300025321 Ga0207656_10147600 Ga0207656_101476001 128
876 3300025909 Ga0207705_10001972 Ga0207705_1000197214 128
877 3300025909 Ga0207705_10526539 Ga0207705_105265392 128
878 3300025911 Ga0207654_10008161 Ga0207654_100081616 128
879 3300025914 Ga0207671_10830194 Ga0207671_108301941 128
880 3300025917 Ga0207660_10057168 Ga0207660_100571683 128
881 3300025919 Ga0207657_10871977 Ga0207657_108719772 128
882 3300025920 Ga0207649_10228473 Ga0207649_102284732 128
883 3300025921 Ga0207652_10809247 Ga0207652_108092472 128
884 3300025924 Ga0207694_10368309 Ga0207694_103683092 128
885 3300025926 Ga0207659_10203549 Ga0207659_102035491 128
886 3300025927 Ga0207687_10518458 Ga0207687_105184582 128
887 3300025932 Ga0207690_10010877 Ga0207690_100108775 128
888 3300025932 Ga0207690_10152984 Ga0207690_101529843 128
889 3300025933 Ga0207706_10127098 Ga0207706_101270982 128
890 3300025934 Ga0207686_10028891 Ga0207686_100288913 128
891 3300025938 Ga0207704_10225664 Ga0207704_102256642 128
892 3300025945 Ga0207679_10083312 Ga0207679_100833123 128
893 3300025949 Ga0207667_10027566 Ga0207667_100275662 128
894 3300025981 Ga0207640_10715427 Ga0207640_107154272 128
895 3300026067 Ga0207678_10063189 Ga0207678_100631893 128
896 3300026078 Ga0207702_10880136 Ga0207702_108801361 128
897 3300026089 Ga0207648_10098010 Ga0207648_100980103 128
898 3300026116 Ga0207674_11315610 Ga0207674_113156102 128
899 3300026142 Ga0207698_10222334 Ga0207698_102223343 128
900 3300031911 Ga0307412_12064263 Ga0307412_120642631 128
901 3300037312 Ga0395899_0000082 Ga0395899_0000082_81827_82222 128
902 3300037312 Ga0395899_0016969 Ga0395899_0016969_554_949 128
903 3300037312 Ga0395899_0024287 Ga0395899_0024287_3511_3906 128
904 3300037312 Ga0395899_0210055 Ga0395899_0210055_458_853 128
905 3300037418 Ga0395900_0000393 Ga0395900_0000393_9154_9549 128
906 3300037418 Ga0395900_0092327 Ga0395900_0092327_1416_1811 128
907 3300037418 Ga0395900_0113588 Ga0395900_0113588_569_964 128
908 3300037466 Ga0395898_0106973 Ga0395898_0106973_1160_1555 128
909 3300037466 Ga0395898_1003428 Ga0395898_1003428_217_612 128
910 3300037471 Ga0395905_0047340 Ga0395905_0047340_519_914 128
911 3300037471 Ga0395905_0549185 Ga0395905_0549185_295_690 128
912 3300037471 Ga0395905_0701342 Ga0395905_0701342_503_898 128
913 3300037853 Ga0436364_0101037 Ga0436364_0101037_45_440 128
914 3300038443 Ga0395901_0000054 Ga0395901_0000054_67467_67862 128
915 3300038443 Ga0395901_0163525 Ga0395901_0163525_1380_1775 128
916 3300038443 Ga0395901_0334325 Ga0395901_0334325_599_994 128
917 3300039447 Ga0436361_1222516 Ga0436361_1222516_88_483 128
918 3300042012 Ga0439455_0105379 Ga0439455_0105379_334_729 128
919 3300044656 Ga0466969_0062179 Ga0466969_0062179_614_1009 128
920 3300044658 Ga0466972_0127184 Ga0466972_0127184_131_526 128
921 3300044683 Ga0466965_0123291 Ga0466965_0123291_297_692 128
922 3300044684 Ga0466966_0180341 Ga0466966_0180341_250_645 128
923 3300044694 Ga0466963_0184915 Ga0466963_0184915_337_732 128
924 3300044706 Ga0466964_0052645 Ga0466964_0052645_925_1320 128
925 3300044719 Ga0466971_0210479 Ga0466971_0210479_381_776 128
926 3300044735 Ga0466968_0000777 Ga0466968_0000777_8401_8796 128
927 3300044842 Ga0466957_0166814 Ga0466957_0166814_515_910 128
928 3300044842 Ga0466957_0218946 Ga0466957_0218946_564_959 128
929 3300044901 Ga0466960_0144687 Ga0466960_0144687_710_1105 128
930 3300044901 Ga0466960_0312230 Ga0466960_0312230_232_627 128
931 3300045049 Ga0466959_0220493 Ga0466959_0220493_307_702 128
932 3300045836 Ga0466958_0208527 Ga0466958_0208527_652_1047 128
933 3300045976 Ga0466967_0118372 Ga0466967_0118372_273_668 128
934 3300046457 Ga0495590_0000251 Ga0495590_0000251_2796_3191 128
935 3300046463 Ga0495653_0126365 Ga0495653_0126365_1261_1656 128
936 3300046474 Ga0495605_0030368 Ga0495605_0030368_944_1339 128
937 3300046474 Ga0495605_0278526 Ga0495605_0278526_118_513 128
938 3300046491 Ga0495584_0036816 Ga0495584_0036816_1957_2352 128
939 3300046492 Ga0495585_0008922 Ga0495585_0008922_184_579 128
940 3300046492 Ga0495585_0011838 Ga0495585_0011838_3324_3719 128
941 3300046501 Ga0495607_0002467 Ga0495607_0002467_8909_9304 128
942 3300046501 Ga0495607_0008457 Ga0495607_0008457_3764_4159 128
943 3300046501 Ga0495607_0038208 Ga0495607_0038208_425_820 128
944 3300046506 Ga0495583_0004816 Ga0495583_0004816_5873_6268 128
945 3300046506 Ga0495583_0011794 Ga0495583_0011794_2479_2874 128
946 3300046507 Ga0495606_0038517 Ga0495606_0038517_497_892 128
947 3300046513 Ga0495616_0000272 Ga0495616_0000272_3091_3486 128
948 3300046513 Ga0495616_0001661 Ga0495616_0001661_9032_9427 128
949 3300046513 Ga0495616_0028258 Ga0495616_0028258_1713_2108 128
950 3300046513 Ga0495616_0045896 Ga0495616_0045896_809_1204 128
951 3300046518 Ga0495631_0000983 Ga0495631_0000983_15308_15703 128
952 3300046519 Ga0495632_0002631 Ga0495632_0002631_7889_8284 128
953 3300046522 Ga0495643_0000969 Ga0495643_0000969_21116_21511 128
954 3300046522 Ga0495643_0014320 Ga0495643_0014320_3316_3711 128
955 3300046523 Ga0495644_0003719 Ga0495644_0003719_926_1321 128
956 3300046524 Ga0495648_0018771 Ga0495648_0018771_3016_3411 128
957 3300046528 Ga0495642_0008675 Ga0495642_0008675_1672_2067 128
958 3300046538 Ga0495609_0000009 Ga0495609_0000009_218865_219260 128
959 3300046538 Ga0495609_0104995 Ga0495609_0104995_814_1209 128
960 3300046543 Ga0495645_0176359 Ga0495645_0176359_965_1360 128
961 3300046558 Ga0495633_0016656 Ga0495633_0016656_1371_1766 128
962 3300046616 Ga0495668_0026212 Ga0495668_0026212_1871_2266 128
963 3300046648 Ga0495611_0003052 Ga0495611_0003052_4538_4933 128
964 3300046648 Ga0495611_0007604 Ga0495611_0007604_1369_1764 128
965 3300046660 Ga0495625_0069612 Ga0495625_0069612_491_886 128
966 3300046660 Ga0495625_0100232 Ga0495625_0100232_1020_1415 128
967 3300046665 Ga0495661_0000368 Ga0495661_0000368_38456_38851 128
968 3300046665 Ga0495661_0029376 Ga0495661_0029376_2901_3296 128
969 3300046665 Ga0495661_0037274 Ga0495661_0037274_2063_2458 128
970 3300046665 Ga0495661_0124413 Ga0495661_0124413_73_468 128
971 3300046674 Ga0495588_0000077 Ga0495588_0000077_117191_117586 128
972 3300046684 Ga0495669_0017194 Ga0495669_0017194_1954_2349 128
973 3300046694 Ga0495649_0019739 Ga0495649_0019739_1701_2096 128
974 3300046794 Ga0495589_0000037 Ga0495589_0000037_135603_135998 128
975 3300046794 Ga0495589_0014498 Ga0495589_0014498_2002_2397 128
976 3300046810 Ga0495660_0043740 Ga0495660_0043740_1912_2307 128
977 3300047315 Ga0495581_0287595 Ga0495581_0287595_457_852 128
978 3300047323 Ga0495683_0017608 Ga0495683_0017608_597_992 128
979 3300047323 Ga0495683_0035711 Ga0495683_0035711_576_971 128
980 3300047443 Ga0495687_000002 Ga0495687_000002_931990_932385 128
981 3300047443 Ga0495687_000024 Ga0495687_000024_305916_306311 128
982 3300047445 Ga0495677_0000011 Ga0495677_0000011_13840_14235 128
983 3300047445 Ga0495677_0001358 Ga0495677_0001358_21_416 128
984 3300047446 Ga0495679_009988 Ga0495679_009988_1653_2048 128
985 3300047470 Ga0495681_0007086 Ga0495681_0007086_5497_5892 128
986 3300047472 Ga0495686_0184539 Ga0495686_0184539_722_1117 128
987 3300048091 Ga0495626_0000004 Ga0495626_0000004_351727_352122 128
988 3300048091 Ga0495626_0000569 Ga0495626_0000569_3325_3720 128
989 3300048091 Ga0495626_0008239 Ga0495626_0008239_707_1102 128
990 3300048091 Ga0495626_0118149 Ga0495626_0118149_268_663 128
991 3300048904 Ga0496101_0702507 Ga0496101_0702507_162_557 128
992 3300048906 Ga0496103_0006660 Ga0496103_0006660_440_835 128
993 3300048908 Ga0496105_0077123 Ga0496105_0077123_550_945 128
994 3300048915 Ga0496112_0246092 Ga0496112_0246092_650_1045 128
995 3300048916 Ga0496113_0037686 Ga0496113_0037686_2078_2473 128
996 3300048918 Ga0496115_0060772 Ga0496115_0060772_1605_2000 128
997 3300048924 Ga0496121_0210954 Ga0496121_0210954_356_751 128
998 3300048925 Ga0496122_0036243 Ga0496122_0036243_662_1057 128
999 3300048925 Ga0496122_0477397 Ga0496122_0477397_145_540 128
1000 3300048926 Ga0496123_0004574 Ga0496123_0004574_13991_14386 128
1001 3300048927 Ga0496124_0061626 Ga0496124_0061626_1687_2082 128
1002 3300048928 Ga0496125_0381725 Ga0496125_0381725_48_443 128
1003 3300049459 Ga0495678_045351 Ga0495678_045351_327_722 128
1004 3300049539 Ga0501323_054399 Ga0501323_054399_154_549 128
1005 3300049822 Ga0501035_0000965 Ga0501035_0000965_12525_12920 128
1006 3300059478 Ga0587093_037672 Ga0587093_037672_245_640 128
1007 3300059490 Ga0587066_061325 Ga0587066_061325_286_681 128
1008 3300059492 Ga0587073_0052305 Ga0587073_0052305_326_721 128
1009 3300059493 Ga0587077_036677 Ga0587077_036677_276_671 128
1010 3300059503 Ga0587080_003170 Ga0587080_003170_632_1027 128
1011 3300059503 Ga0587080_031135 Ga0587080_031135_203_598 128
1012 3300059508 Ga0587088_048226 Ga0587088_048226_181_576 128
1013 3300059510 Ga0587090_041300 Ga0587090_041300_349_744 128
1014 3300059511 Ga0587091_088410 Ga0587091_088410_59_454 128
1015 3300059513 Ga0587094_056969 Ga0587094_056969_109_504 128
1016 3300059604 Ga0587098_052710 Ga0587098_052710_59_454 128
1017 3300059605 Ga0587106_023638 Ga0587106_023638_302_697 128
1018 3300059608 Ga0587129_024236 Ga0587129_024236_59_454 128
1019 3300059622 Ga0587099_051983 Ga0587099_051983_11_406 128
1020 3300059623 Ga0587101_024610 Ga0587101_024610_219_614 128
1021 3300059626 Ga0587115_053305 Ga0587115_053305_58_453 128
1022 3300059639 Ga0587062_068412 Ga0587062_068412_207_602 128
1023 3300059641 Ga0587068_003385 Ga0587068_003385_1086_1481 128
1024 3300059642 Ga0587069_004663 Ga0587069_004663_455_850 128
1025 3300059644 Ga0587075_024541 Ga0587075_024541_196_591 128
1026 3300059645 Ga0587076_036335 Ga0587076_036335_242_637 128
1027 3300059647 Ga0587079_042086 Ga0587079_042086_205_600 128
1028 3300059649 Ga0587102_045335 Ga0587102_045335_109_504 128
1029 3300059651 Ga0587105_007802 Ga0587105_007802_72_467 128
1030 3300059652 Ga0587107_073157 Ga0587107_073157_60_455 128
1031 3300059660 Ga0587124_019618 Ga0587124_019618_34_429 128
1032 3300060344 Ga0587071_061264 Ga0587071_061264_245_640 128
1033 3300060346 Ga0587111_0084966 Ga0587111_0084966_59_454 128
1034 3300061719 Ga0466962_0083668 Ga0466962_0083668_902_1297 128
1035 3300003305 Ga0006770J48903_1038274 Ga0006770J48903_10382741 129
1036 3300005615 Ga0070702_101523037 Ga0070702_1015230371 129
1037 3300013102 Ga0157371_10000078 Ga0157371_10000078121 129
1038 3300013306 Ga0163162_10262665 Ga0163162_102626652 129
1039 3300014497 Ga0182008_10021358 Ga0182008_100213583 129
1040 3300015261 Ga0182006_1037798 Ga0182006_10377983 129
1041 3300015262 Ga0182007_10086611 Ga0182007_100866112 129
1042 3300017792 Ga0163161_10040505 Ga0163161_100405054 129
1043 3300025925 Ga0207650_11819441 Ga0207650_118194411 129
1044 3300030736 Ga0316180_1109616 Ga0316180_11096162 129
1045 3300030742 Ga0316183_1134260 Ga0316183_11342602 129
1046 3300030744 Ga0316181_1263623 Ga0316181_12636233 129
1047 3300030745 Ga0316182_1023982 Ga0316182_10239823 129
1048 3300031344 Ga0265316_11107695 Ga0265316_111076951 129
1049 3300031901 Ga0307406_12051234 Ga0307406_120512341 129
1050 3300032004 Ga0307414_10020067 Ga0307414_100200675 129
1051 3300032004 Ga0307414_10541653 Ga0307414_105416532 129
1052 3300032126 Ga0307415_102043720 Ga0307415_1020437201 129
1053 3300037471 Ga0395905_0009206 Ga0395905_0009206_3289_3687 129
1054 3300042122 Ga0450920_092727 Ga0450920_092727_76_474 129
1055 3300042156 Ga0439446_0134383 Ga0439446_0134383_345_743 129
1056 3300046460 Ga0495638_0002366 Ga0495638_0002366_67_465 129
1057 3300046460 Ga0495638_0125695 Ga0495638_0125695_66_464 129
1058 3300046471 Ga0495650_0056190 Ga0495650_0056190_531_929 129
1059 3300046474 Ga0495605_0008745 Ga0495605_0008745_1745_2143 129
1060 3300046491 Ga0495584_0000006 Ga0495584_0000006_142736_143134 129
1061 3300046491 Ga0495584_0002247 Ga0495584_0002247_1331_1729 129
1062 3300046491 Ga0495584_0013361 Ga0495584_0013361_47_445 129
1063 3300046491 Ga0495584_0047001 Ga0495584_0047001_448_846 129
1064 3300046491 Ga0495584_0058346 Ga0495584_0058346_246_644 129
1065 3300046491 Ga0495584_0091051 Ga0495584_0091051_446_844 129
1066 3300046491 Ga0495584_0237158 Ga0495584_0237158_303_701 129
1067 3300046492 Ga0495585_0003548 Ga0495585_0003548_1620_2018 129
1068 3300046492 Ga0495585_0120605 Ga0495585_0120605_669_1067 129
1069 3300046492 Ga0495585_0144154 Ga0495585_0144154_139_537 129
1070 3300046492 Ga0495585_0146493 Ga0495585_0146493_134_532 129
1071 3300046492 Ga0495585_0635359 Ga0495585_0635359_26_424 129
1072 3300046499 Ga0495594_0471986 Ga0495594_0471986_84_482 129
1073 3300046500 Ga0495596_0000236 Ga0495596_0000236_28638_29036 129
1074 3300046500 Ga0495596_0010298 Ga0495596_0010298_615_1013 129
1075 3300046501 Ga0495607_0027861 Ga0495607_0027861_1910_2308 129
1076 3300046501 Ga0495607_0147306 Ga0495607_0147306_644_1042 129
1077 3300046506 Ga0495583_0000525 Ga0495583_0000525_1320_1718 129
1078 3300046506 Ga0495583_0000608 Ga0495583_0000608_16547_16945 129
1079 3300046506 Ga0495583_0020340 Ga0495583_0020340_259_657 129
1080 3300046506 Ga0495583_0027832 Ga0495583_0027832_1483_1881 129
1081 3300046506 Ga0495583_0087871 Ga0495583_0087871_167_565 129
1082 3300046506 Ga0495583_0138545 Ga0495583_0138545_228_626 129
1083 3300046507 Ga0495606_0013368 Ga0495606_0013368_4435_4833 129
1084 3300046507 Ga0495606_0014803 Ga0495606_0014803_4097_4495 129
1085 3300046507 Ga0495606_0200207 Ga0495606_0200207_323_721 129
1086 3300046513 Ga0495616_0009292 Ga0495616_0009292_3733_4131 129
1087 3300046513 Ga0495616_0125523 Ga0495616_0125523_207_605 129
1088 3300046515 Ga0495620_0003145 Ga0495620_0003145_6255_6653 129
1089 3300046518 Ga0495631_0005046 Ga0495631_0005046_5135_5533 129
1090 3300046518 Ga0495631_0007988 Ga0495631_0007988_4476_4874 129
1091 3300046519 Ga0495632_0007247 Ga0495632_0007247_207_605 129
1092 3300046520 Ga0495637_0132682 Ga0495637_0132682_301_699 129
1093 3300046522 Ga0495643_0007137 Ga0495643_0007137_2676_3074 129
1094 3300046522 Ga0495643_0173562 Ga0495643_0173562_54_452 129
1095 3300046523 Ga0495644_0044530 Ga0495644_0044530_41_439 129
1096 3300046523 Ga0495644_0164084 Ga0495644_0164084_408_806 129
1097 3300046524 Ga0495648_0088906 Ga0495648_0088906_314_712 129
1098 3300046524 Ga0495648_0174124 Ga0495648_0174124_470_868 129
1099 3300046525 Ga0495663_0004570 Ga0495663_0004570_549_947 129
1100 3300046525 Ga0495663_0043379 Ga0495663_0043379_215_613 129
1101 3300046525 Ga0495663_0073136 Ga0495663_0073136_120_518 129
1102 3300046528 Ga0495642_0006116 Ga0495642_0006116_2381_2779 129
1103 3300046528 Ga0495642_0008553 Ga0495642_0008553_2598_2996 129
1104 3300046528 Ga0495642_0018690 Ga0495642_0018690_615_1013 129
1105 3300046528 Ga0495642_0116714 Ga0495642_0116714_23_424 129
1106 3300046528 Ga0495642_0232419 Ga0495642_0232419_191_589 129
1107 3300046530 Ga0495654_0011618 Ga0495654_0011618_2679_3077 129
1108 3300046538 Ga0495609_0006181 Ga0495609_0006181_3579_3977 129
1109 3300046538 Ga0495609_0012139 Ga0495609_0012139_918_1316 129
1110 3300046538 Ga0495609_0216406 Ga0495609_0216406_273_671 129
1111 3300046539 Ga0495621_0207430 Ga0495621_0207430_180_581 129
1112 3300046542 Ga0495597_0005992 Ga0495597_0005992_5688_6086 129
1113 3300046542 Ga0495597_0011554 Ga0495597_0011554_726_1124 129
1114 3300046542 Ga0495597_0035996 Ga0495597_0035996_1497_1895 129
1115 3300046542 Ga0495597_0197927 Ga0495597_0197927_272_670 129
1116 3300046557 Ga0495622_0028161 Ga0495622_0028161_1691_2089 129
1117 3300046557 Ga0495622_0411964 Ga0495622_0411964_41_439 129
1118 3300046558 Ga0495633_0002390 Ga0495633_0002390_1872_2270 129
1119 3300046558 Ga0495633_0016604 Ga0495633_0016604_736_1134 129
1120 3300046558 Ga0495633_0028145 Ga0495633_0028145_1343_1741 129
1121 3300046558 Ga0495633_0132449 Ga0495633_0132449_425_823 129
1122 3300046558 Ga0495633_0182335 Ga0495633_0182335_44_442 129
1123 3300046558 Ga0495633_0334694 Ga0495633_0334694_19_417 129
1124 3300046615 Ga0495656_0003737 Ga0495656_0003737_713_1111 129
1125 3300046615 Ga0495656_0015862 Ga0495656_0015862_1173_1571 129
1126 3300046615 Ga0495656_0048042 Ga0495656_0048042_673_1071 129
1127 3300046616 Ga0495668_0022879 Ga0495668_0022879_1834_2232 129
1128 3300046616 Ga0495668_0025705 Ga0495668_0025705_860_1258 129
1129 3300046616 Ga0495668_0031057 Ga0495668_0031057_924_1322 129
1130 3300046616 Ga0495668_0045217 Ga0495668_0045217_1031_1429 129
1131 3300046616 Ga0495668_0531138 Ga0495668_0531138_53_451 129
1132 3300046648 Ga0495611_0098119 Ga0495611_0098119_178_576 129
1133 3300046648 Ga0495611_0124226 Ga0495611_0124226_694_1092 129
1134 3300046648 Ga0495611_0185804 Ga0495611_0185804_357_755 129
1135 3300046648 Ga0495611_0269588 Ga0495611_0269588_62_460 129
1136 3300046660 Ga0495625_0029832 Ga0495625_0029832_1949_2347 129
1137 3300046665 Ga0495661_0015517 Ga0495661_0015517_4210_4608 129
1138 3300046665 Ga0495661_0019494 Ga0495661_0019494_677_1075 129
1139 3300046665 Ga0495661_0023664 Ga0495661_0023664_2280_2678 129
1140 3300046665 Ga0495661_0040171 Ga0495661_0040171_2438_2836 129
1141 3300046674 Ga0495588_0080651 Ga0495588_0080651_611_1009 129
1142 3300046674 Ga0495588_0109500 Ga0495588_0109500_69_467 129
1143 3300046674 Ga0495588_0173649 Ga0495588_0173649_335_733 129
1144 3300046684 Ga0495669_0010502 Ga0495669_0010502_659_1057 129
1145 3300046691 Ga0495670_0391270 Ga0495670_0391270_202_600 129
1146 3300046691 Ga0495670_0523431 Ga0495670_0523431_154_552 129
1147 3300046692 Ga0495671_0022004 Ga0495671_0022004_499_897 129
1148 3300046692 Ga0495671_0079765 Ga0495671_0079765_165_563 129
1149 3300046692 Ga0495671_0397099 Ga0495671_0397099_44_442 129
1150 3300046794 Ga0495589_0026334 Ga0495589_0026334_1355_1753 129
1151 3300046794 Ga0495589_0038794 Ga0495589_0038794_640_1038 129
1152 3300046810 Ga0495660_0118619 Ga0495660_0118619_761_1159 129
1153 3300047318 Ga0495636_0012768 Ga0495636_0012768_2895_3293 129
1154 3300047318 Ga0495636_0069736 Ga0495636_0069736_869_1267 129
1155 3300047318 Ga0495636_0180386 Ga0495636_0180386_42_440 129
1156 3300047320 Ga0495672_0000097 Ga0495672_0000097_138789_139187 129
1157 3300047320 Ga0495672_0098796 Ga0495672_0098796_694_1092 129
1158 3300047321 Ga0495676_0108382 Ga0495676_0108382_704_1102 129
1159 3300047321 Ga0495676_0202693 Ga0495676_0202693_526_924 129
1160 3300047323 Ga0495683_0000144 Ga0495683_0000144_16171_16569 129
1161 3300047323 Ga0495683_0169338 Ga0495683_0169338_507_905 129
1162 3300047443 Ga0495687_015538 Ga0495687_015538_2796_3197 129
1163 3300047443 Ga0495687_029001 Ga0495687_029001_1564_1962 129
1164 3300047445 Ga0495677_0006130 Ga0495677_0006130_2847_3245 129
1165 3300047445 Ga0495677_0074320 Ga0495677_0074320_79_477 129
1166 3300047445 Ga0495677_0141551 Ga0495677_0141551_326_724 129
1167 3300047447 Ga0495685_024841 Ga0495685_024841_808_1206 129
1168 3300047469 Ga0495673_0002730 Ga0495673_0002730_1707_2105 129
1169 3300047470 Ga0495681_0011590 Ga0495681_0011590_3298_3696 129
1170 3300047470 Ga0495681_0020183 Ga0495681_0020183_669_1067 129
1171 3300047470 Ga0495681_0155420 Ga0495681_0155420_71_469 129
1172 3300047472 Ga0495686_0121758 Ga0495686_0121758_1117_1515 129
1173 3300047472 Ga0495686_0189731 Ga0495686_0189731_178_576 129
1174 3300048090 Ga0495615_0000530 Ga0495615_0000530_1537_1935 129
1175 3300048090 Ga0495615_0080961 Ga0495615_0080961_432_830 129
1176 3300048091 Ga0495626_0069092 Ga0495626_0069092_1115_1513 129
1177 3300048091 Ga0495626_0091745 Ga0495626_0091745_871_1269 129
1178 3300048904 Ga0496101_0820075 Ga0496101_0820075_20_421 129
1179 3300048905 Ga0496102_0000461 Ga0496102_0000461_17744_18142 129
1180 3300048905 Ga0496102_0040178 Ga0496102_0040178_1657_2058 129
1181 3300048905 Ga0496102_0069033 Ga0496102_0069033_2117_2515 129
1182 3300048905 Ga0496102_0760861 Ga0496102_0760861_293_694 129
1183 3300048905 Ga0496102_0941197 Ga0496102_0941197_75_473 129
1184 3300048906 Ga0496103_0007974 Ga0496103_0007974_5381_5779 129
1185 3300048906 Ga0496103_0143904 Ga0496103_0143904_184_585 129
1186 3300048907 Ga0496104_0616755 Ga0496104_0616755_313_714 129
1187 3300048908 Ga0496105_0747240 Ga0496105_0747240_193_594 129
1188 3300048911 Ga0496108_0010622 Ga0496108_0010622_4267_4668 129
1189 3300048912 Ga0496109_0656844 Ga0496109_0656844_65_466 129
1190 3300048913 Ga0496110_0807477 Ga0496110_0807477_224_625 129
1191 3300048914 Ga0496111_0246770 Ga0496111_0246770_868_1266 129
1192 3300048916 Ga0496113_0421049 Ga0496113_0421049_358_756 129
1193 3300048916 Ga0496113_0738842 Ga0496113_0738842_168_569 129
1194 3300048918 Ga0496115_0034428 Ga0496115_0034428_3430_3828 129
1195 3300048918 Ga0496115_0712674 Ga0496115_0712674_218_616 129
1196 3300048919 Ga0496116_0039030 Ga0496116_0039030_1973_2371 129
1197 3300048920 Ga0496117_0000132 Ga0496117_0000132_59519_59917 129
1198 3300048921 Ga0496118_0000099 Ga0496118_0000099_59519_59917 129
1199 3300048924 Ga0496121_0127464 Ga0496121_0127464_522_920 129
1200 3300048925 Ga0496122_0001402 Ga0496122_0001402_22551_22949 129
1201 3300048926 Ga0496123_0051903 Ga0496123_0051903_1497_1895 129
1202 3300048927 Ga0496124_0008384 Ga0496124_0008384_8675_9073 129
1203 3300048927 Ga0496124_0118308 Ga0496124_0118308_1681_2079 129
1204 3300048928 Ga0496125_0023719 Ga0496125_0023719_1111_1509 129
1205 3300049130 Ga0501310_073953 Ga0501310_073953_41_439 129
1206 3300049459 Ga0495678_017736 Ga0495678_017736_2303_2701 129
1207 3300049460 Ga0495682_0006435 Ga0495682_0006435_187_585 129
1208 3300053156 Ga0500622_0000001 Ga0500622_0000001_2986_3384 129
1209 3300050509 nmdc:mga0qj67_80226_c1 nmdc:mga0qj67_80226_c1_1914_2315 130
1210 3300005536 Ga0070697_101366158 Ga0070697_1013661581 131
1211 3300025910 Ga0207684_10539954 Ga0207684_105399542 131
1212 3300005985 Ga0081539_10012174 Ga0081539_100121742 136
1213 3300005985 Ga0081539_10052887 Ga0081539_100528872 136
1214 3300005468 Ga0070707_100174613 Ga0070707_1001746132 140
1215 3300005437 Ga0070710_11084711 Ga0070710_110847111 141
1216 3300005545 Ga0070695_100045457 Ga0070695_1000454572 141
1217 3300013100 Ga0157373_11009385 Ga0157373_110093851 141
1218 3300048905 Ga0496102_1447319 Ga0496102_1447319_99_527 141
1219 3300025939 Ga0207665_10281142 Ga0207665_102811422 142
1220 3300005467 Ga0070706_101692047 Ga0070706_1016920471 144
1221 3300005983 Ga0081540_1195395 Ga0081540_11953951 145
1222 3300045976 Ga0466967_0181032 Ga0466967_0181032_319_756 145
1223 3300005536 Ga0070697_100003060 Ga0070697_1000030608 146
1224 3300005549 Ga0070704_100924943 Ga0070704_1009249431 146
1225 3300005985 Ga0081539_10002232 Ga0081539_100022321 146
1226 3300006871 Ga0075434_101182136 Ga0075434_1011821361 146
1227 3300006914 Ga0075436_100021119 Ga0075436_1000211192 146
1228 3300009545 Ga0105237_10302030 Ga0105237_103020301 146
1229 3300013297 Ga0157378_10258166 Ga0157378_102581661 146
1230 3300013307 Ga0157372_10224982 Ga0157372_102249823 146
1231 3300025914 Ga0207671_10204875 Ga0207671_102048751 146
1232 3300035725 Ga0373947_0126165 Ga0373947_0126165_944_1384 146
1233 3300050512 nmdc:mga0n895_1047098_c1 nmdc:mga0n895_1047098_c1_176_616 146
1234 3300050514 nmdc:mga08x19_8569_c1 nmdc:mga08x19_8569_c1_4039_4479 146
1235 3300005355 Ga0070671_100750893 Ga0070671_1007508931 147
1236 3300005445 Ga0070708_100069853 Ga0070708_1000698532 147
1237 3300005467 Ga0070706_100030413 Ga0070706_1000304133 147
1238 3300005468 Ga0070707_100002729 Ga0070707_10000272910 147
1239 3300005468 Ga0070707_100025898 Ga0070707_1000258985 147
1240 3300006173 Ga0070716_100350730 Ga0070716_1003507302 147
1241 3300025910 Ga0207684_10070092 Ga0207684_100700923 147
1242 3300025922 Ga0207646_10003785 Ga0207646_100037856 147
1243 3300025922 Ga0207646_10114655 Ga0207646_101146552 147
1244 3300025922 Ga0207646_11511300 Ga0207646_115113001 147
1245 3300025931 Ga0207644_11170587 Ga0207644_111705871 147
1246 3300037068 Ga0373925_0771979 Ga0373925_0771979_246_689 147
1247 3300050514 nmdc:mga08x19_320078_c1 nmdc:mga08x19_320078_c1_11_454 147
1248 2162886011 MRS1b_contig_3883174 MRS1b_0030.00002940 148
1249 3300000545 CNXas_1000109 CNXas_10001098 148
1250 3300003203 JGI25406J46586_10000011 JGI25406J46586_1000001112 148
1251 3300005289 Ga0065704_10301195 Ga0065704_103011951 148
1252 3300005290 Ga0065712_10098684 Ga0065712_100986843 148
1253 3300005290 Ga0065712_10381451 Ga0065712_103814511 148
1254 3300005328 Ga0070676_10006530 Ga0070676_100065304 148
1255 3300005328 Ga0070676_10027936 Ga0070676_100279363 148
1256 3300005330 Ga0070690_100159858 Ga0070690_1001598582 148
1257 3300005330 Ga0070690_100533002 Ga0070690_1005330021 148
1258 3300005330 Ga0070690_101299440 Ga0070690_1012994401 148
1259 3300005331 Ga0070670_100002302 Ga0070670_1000023023 148
1260 3300005331 Ga0070670_100006241 Ga0070670_10000624110 148
1261 3300005331 Ga0070670_100890794 Ga0070670_1008907942 148
1262 3300005335 Ga0070666_10041425 Ga0070666_100414255 148
1263 3300005335 Ga0070666_11129305 Ga0070666_111293051 148
1264 3300005338 Ga0068868_100039996 Ga0068868_1000399962 148
1265 3300005340 Ga0070689_100045940 Ga0070689_1000459402 148
1266 3300005340 Ga0070689_100209478 Ga0070689_1002094782 148
1267 3300005344 Ga0070661_100199014 Ga0070661_1001990141 148
1268 3300005347 Ga0070668_100012213 Ga0070668_1000122132 148
1269 3300005347 Ga0070668_101247694 Ga0070668_1012476941 148
1270 3300005353 Ga0070669_100014990 Ga0070669_1000149905 148
1271 3300005353 Ga0070669_100050766 Ga0070669_1000507662 148
1272 3300005354 Ga0070675_100033029 Ga0070675_1000330292 148
1273 3300005355 Ga0070671_100015082 Ga0070671_1000150823 148
1274 3300005355 Ga0070671_100022258 Ga0070671_1000222582 148
1275 3300005355 Ga0070671_101048816 Ga0070671_1010488161 148
1276 3300005356 Ga0070674_100316035 Ga0070674_1003160352 148
1277 3300005365 Ga0070688_100001382 Ga0070688_1000013823 148
1278 3300005365 Ga0070688_100393804 Ga0070688_1003938042 148
1279 3300005367 Ga0070667_100001152 Ga0070667_10000115223 148
1280 3300005367 Ga0070667_100037387 Ga0070667_1000373872 148
1281 3300005367 Ga0070667_100130998 Ga0070667_1001309982 148
1282 3300005439 Ga0070711_100309067 Ga0070711_1003090672 148
1283 3300005445 Ga0070708_100095985 Ga0070708_1000959852 148
1284 3300005445 Ga0070708_100151113 Ga0070708_1001511132 148
1285 3300005445 Ga0070708_100678736 Ga0070708_1006787362 148
1286 3300005445 Ga0070708_100993817 Ga0070708_1009938171 148
1287 3300005455 Ga0070663_100750009 Ga0070663_1007500091 148
1288 3300005456 Ga0070678_100032818 Ga0070678_1000328185 148
1289 3300005456 Ga0070678_101004950 Ga0070678_1010049501 148
1290 3300005456 Ga0070678_101026758 Ga0070678_1010267582 148
1291 3300005457 Ga0070662_100166473 Ga0070662_1001664731 148
1292 3300005457 Ga0070662_100309108 Ga0070662_1003091082 148
1293 3300005459 Ga0068867_100830696 Ga0068867_1008306961 148
1294 3300005459 Ga0068867_101237614 Ga0068867_1012376141 148
1295 3300005467 Ga0070706_100000116 Ga0070706_10000011621 148
1296 3300005467 Ga0070706_100018698 Ga0070706_1000186987 148
1297 3300005467 Ga0070706_100035119 Ga0070706_1000351192 148
1298 3300005467 Ga0070706_100394020 Ga0070706_1003940202 148
1299 3300005468 Ga0070707_100024521 Ga0070707_1000245216 148
1300 3300005468 Ga0070707_100025365 Ga0070707_1000253655 148
1301 3300005468 Ga0070707_100036840 Ga0070707_1000368402 148
1302 3300005468 Ga0070707_100040136 Ga0070707_1000401365 148
1303 3300005468 Ga0070707_100172499 Ga0070707_1001724992 148
1304 3300005468 Ga0070707_100430691 Ga0070707_1004306912 148
1305 3300005468 Ga0070707_100634912 Ga0070707_1006349121 148
1306 3300005468 Ga0070707_101153467 Ga0070707_1011534671 148
1307 3300005471 Ga0070698_100003134 Ga0070698_1000031345 148
1308 3300005471 Ga0070698_100010744 Ga0070698_1000107444 148
1309 3300005471 Ga0070698_100097143 Ga0070698_1000971436 148
1310 3300005471 Ga0070698_100521070 Ga0070698_1005210702 148
1311 3300005471 Ga0070698_101424514 Ga0070698_1014245141 148
1312 3300005518 Ga0070699_100073974 Ga0070699_1000739742 148
1313 3300005518 Ga0070699_100121464 Ga0070699_1001214642 148
1314 3300005518 Ga0070699_100970298 Ga0070699_1009702982 148
1315 3300005536 Ga0070697_100004215 Ga0070697_1000042153 148
1316 3300005536 Ga0070697_100014381 Ga0070697_1000143812 148
1317 3300005536 Ga0070697_100045646 Ga0070697_1000456462 148
1318 3300005536 Ga0070697_100070956 Ga0070697_1000709562 148
1319 3300005536 Ga0070697_100171703 Ga0070697_1001717032 148
1320 3300005536 Ga0070697_100184858 Ga0070697_1001848582 148
1321 3300005536 Ga0070697_100362220 Ga0070697_1003622202 148
1322 3300005543 Ga0070672_100003958 Ga0070672_1000039586 148
1323 3300005543 Ga0070672_100311686 Ga0070672_1003116862 148
1324 3300005543 Ga0070672_100552408 Ga0070672_1005524082 148
1325 3300005543 Ga0070672_101073981 Ga0070672_1010739812 148
1326 3300005547 Ga0070693_100285770 Ga0070693_1002857702 148
1327 3300005548 Ga0070665_100046012 Ga0070665_1000460125 148
1328 3300005548 Ga0070665_100159514 Ga0070665_1001595143 148
1329 3300005549 Ga0070704_100937297 Ga0070704_1009372971 148
1330 3300005564 Ga0070664_100257608 Ga0070664_1002576082 148
1331 3300005614 Ga0068856_101631923 Ga0068856_1016319231 148
1332 3300005615 Ga0070702_100522835 Ga0070702_1005228352 148
1333 3300005718 Ga0068866_10030064 Ga0068866_100300644 148
1334 3300005718 Ga0068866_10155285 Ga0068866_101552853 148
1335 3300005843 Ga0068860_100603401 Ga0068860_1006034012 148
1336 3300005985 Ga0081539_10000139 Ga0081539_1000013941 148
1337 3300005985 Ga0081539_10052402 Ga0081539_100524023 148
1338 3300006028 Ga0070717_10002406 Ga0070717_1000240611 148
1339 3300006028 Ga0070717_10006132 Ga0070717_100061326 148
1340 3300006173 Ga0070716_100306864 Ga0070716_1003068642 148
1341 3300006173 Ga0070716_100311420 Ga0070716_1003114202 148
1342 3300006237 Ga0097621_100004370 Ga0097621_1000043703 148
1343 3300006237 Ga0097621_100004743 Ga0097621_1000047435 148
1344 3300006237 Ga0097621_101288069 Ga0097621_1012880691 148
1345 3300006358 Ga0068871_100017920 Ga0068871_1000179207 148
1346 3300006358 Ga0068871_100040568 Ga0068871_1000405683 148
1347 3300006358 Ga0068871_100263499 Ga0068871_1002634992 148
1348 3300006852 Ga0075433_10655378 Ga0075433_106553782 148
1349 3300006871 Ga0075434_100073372 Ga0075434_1000733723 148
1350 3300006881 Ga0068865_100083101 Ga0068865_1000831012 148
1351 3300006881 Ga0068865_100183875 Ga0068865_1001838751 148
1352 3300007265 Ga0099794_10138050 Ga0099794_101380502 148
1353 3300009093 Ga0105240_10813296 Ga0105240_108132962 148
1354 3300009094 Ga0111539_10260786 Ga0111539_102607862 148
1355 3300009098 Ga0105245_10119936 Ga0105245_101199361 148
1356 3300009098 Ga0105245_10167216 Ga0105245_101672162 148
1357 3300009098 Ga0105245_10651147 Ga0105245_106511472 148
1358 3300009098 Ga0105245_13006666 Ga0105245_130066661 148
1359 3300009176 Ga0105242_10974916 Ga0105242_109749162 148
1360 3300009177 Ga0105248_11780232 Ga0105248_117802322 148
1361 3300010375 Ga0105239_12258985 Ga0105239_122589851 148
1362 3300013100 Ga0157373_10634948 Ga0157373_106349482 148
1363 3300013296 Ga0157374_10020633 Ga0157374_100206332 148
1364 3300013296 Ga0157374_10099139 Ga0157374_100991392 148
1365 3300013296 Ga0157374_10116843 Ga0157374_101168434 148
1366 3300013296 Ga0157374_10610886 Ga0157374_106108862 148
1367 3300013297 Ga0157378_10022702 Ga0157378_100227023 148
1368 3300013297 Ga0157378_10023772 Ga0157378_100237725 148
1369 3300013297 Ga0157378_10093439 Ga0157378_100934394 148
1370 3300013297 Ga0157378_10093654 Ga0157378_100936542 148
1371 3300013297 Ga0157378_10156781 Ga0157378_101567813 148
1372 3300013297 Ga0157378_10271158 Ga0157378_102711582 148
1373 3300013297 Ga0157378_10297016 Ga0157378_102970162 148
1374 3300013297 Ga0157378_10626109 Ga0157378_106261092 148
1375 3300013297 Ga0157378_10897282 Ga0157378_108972822 148
1376 3300013297 Ga0157378_12407997 Ga0157378_124079972 148
1377 3300013306 Ga0163162_10004766 Ga0163162_1000476611 148
1378 3300013306 Ga0163162_10112128 Ga0163162_101121282 148
1379 3300013308 Ga0157375_10000847 Ga0157375_100008475 148
1380 3300013308 Ga0157375_10016097 Ga0157375_100160972 148
1381 3300013308 Ga0157375_10168179 Ga0157375_101681792 148
1382 3300013308 Ga0157375_10387053 Ga0157375_103870532 148
1383 3300014969 Ga0157376_10002921 Ga0157376_100029218 148
1384 3300014969 Ga0157376_10568546 Ga0157376_105685461 148
1385 3300015265 Ga0182005_1081840 Ga0182005_10818402 148
1386 3300025315 Ga0207697_10000230 Ga0207697_100002308 148
1387 3300025899 Ga0207642_10018395 Ga0207642_100183952 148
1388 3300025899 Ga0207642_10133315 Ga0207642_101333152 148
1389 3300025899 Ga0207642_11051782 Ga0207642_110517821 148
1390 3300025901 Ga0207688_10028875 Ga0207688_100288752 148
1391 3300025903 Ga0207680_10022988 Ga0207680_100229882 148
1392 3300025906 Ga0207699_10353593 Ga0207699_103535932 148
1393 3300025910 Ga0207684_10000190 Ga0207684_1000019020 148
1394 3300025910 Ga0207684_10030054 Ga0207684_100300543 148
1395 3300025910 Ga0207684_10031627 Ga0207684_100316274 148
1396 3300025910 Ga0207684_10059588 Ga0207684_100595882 148
1397 3300025910 Ga0207684_10779762 Ga0207684_107797621 148
1398 3300025922 Ga0207646_10009717 Ga0207646_100097175 148
1399 3300025922 Ga0207646_10015435 Ga0207646_100154355 148
1400 3300025922 Ga0207646_10047841 Ga0207646_100478413 148
1401 3300025922 Ga0207646_10120029 Ga0207646_101200293 148
1402 3300025922 Ga0207646_11862424 Ga0207646_118624241 148
1403 3300025923 Ga0207681_10069268 Ga0207681_100692681 148
1404 3300025923 Ga0207681_10666174 Ga0207681_106661742 148
1405 3300025925 Ga0207650_10015523 Ga0207650_100155232 148
1406 3300025926 Ga0207659_10049775 Ga0207659_100497755 148
1407 3300025931 Ga0207644_10543189 Ga0207644_105431892 148
1408 3300025933 Ga0207706_10120143 Ga0207706_101201431 148
1409 3300025933 Ga0207706_10365512 Ga0207706_103655122 148
1410 3300025934 Ga0207686_10399664 Ga0207686_103996642 148
1411 3300025936 Ga0207670_10026701 Ga0207670_100267012 148
1412 3300025936 Ga0207670_10267760 Ga0207670_102677601 148
1413 3300025937 Ga0207669_10125945 Ga0207669_101259452 148
1414 3300025937 Ga0207669_11362432 Ga0207669_113624321 148
1415 3300025938 Ga0207704_10339819 Ga0207704_103398192 148
1416 3300025939 Ga0207665_10019448 Ga0207665_100194483 148
1417 3300025939 Ga0207665_10082276 Ga0207665_100822763 148
1418 3300025940 Ga0207691_10001130 Ga0207691_1000113023 148
1419 3300025940 Ga0207691_10227193 Ga0207691_102271932 148
1420 3300025940 Ga0207691_10312466 Ga0207691_103124662 148
1421 3300025940 Ga0207691_11053828 Ga0207691_110538281 148
1422 3300025940 Ga0207691_11186069 Ga0207691_111860692 148
1423 3300025945 Ga0207679_10088846 Ga0207679_100888462 148
1424 3300025960 Ga0207651_10987501 Ga0207651_109875011 148
1425 3300025972 Ga0207668_10236886 Ga0207668_102368862 148
1426 3300025972 Ga0207668_10542504 Ga0207668_105425042 148
1427 3300025986 Ga0207658_10010500 Ga0207658_100105007 148
1428 3300026023 Ga0207677_10063774 Ga0207677_100637742 148
1429 3300026023 Ga0207677_12103007 Ga0207677_121030071 148
1430 3300026067 Ga0207678_10295105 Ga0207678_102951052 148
1431 3300026078 Ga0207702_11275697 Ga0207702_112756971 148
1432 3300026089 Ga0207648_10225463 Ga0207648_102254633 148
1433 3300026121 Ga0207683_10006813 Ga0207683_100068136 148
1434 3300026121 Ga0207683_10336655 Ga0207683_103366551 148
1435 3300028379 Ga0268266_10013072 Ga0268266_100130722 148
1436 3300031456 Ga0307513_10136437 Ga0307513_101364373 148
1437 3300035170 Ga0373943_0048876 Ga0373943_0048876_316_762 148
1438 3300035170 Ga0373943_0947714 Ga0373943_0947714_12_458 148
1439 3300035725 Ga0373947_0040081 Ga0373947_0040081_2317_2763 148
1440 3300036401 Ga0373937_0168600 Ga0373937_0168600_550_996 148
1441 3300041486 Ga0451807_2769524 Ga0451807_2769524_177_626 148
1442 3300041492 Ga0451835_0242121 Ga0451835_0242121_33_479 148
1443 3300041512 Ga0451853_2377098 Ga0451853_2377098_24_470 148
1444 3300041512 Ga0451853_2842729 Ga0451853_2842729_167_616 148
1445 3300041512 Ga0451853_3225716 Ga0451853_3225716_261_710 148
1446 3300046459 Ga0495629_0377308 Ga0495629_0377308_469_915 148
1447 3300046537 Ga0495598_0012534 Ga0495598_0012534_315_761 148
1448 3300046674 Ga0495588_0123522 Ga0495588_0123522_183_629 148
1449 3300046684 Ga0495669_0538708 Ga0495669_0538708_19_465 148
1450 3300046689 Ga0495613_0793672 Ga0495613_0793672_74_520 148
1451 3300047318 Ga0495636_0367497 Ga0495636_0367497_182_628 148
1452 3300048911 Ga0496108_0023299 Ga0496108_0023299_2043_2489 148
1453 3300048911 Ga0496108_0394878 Ga0496108_0394878_391_837 148
1454 3300048912 Ga0496109_0081610 Ga0496109_0081610_521_967 148
1455 3300048915 Ga0496112_0032351 Ga0496112_0032351_3761_4207 148
1456 3300048915 Ga0496112_0037948 Ga0496112_0037948_2107_2553 148
1457 3300048915 Ga0496112_0252691 Ga0496112_0252691_982_1428 148
1458 3300048916 Ga0496113_0782382 Ga0496113_0782382_180_626 148
1459 3300048917 Ga0496114_0532190 Ga0496114_0532190_122_568 148
1460 3300050511 nmdc:mga08y16_312463_c1 nmdc:mga08y16_312463_c1_510_956 148
1461 3300050512 nmdc:mga0n895_197141_c1 nmdc:mga0n895_197141_c1_221_667 148
1462 3300050513 nmdc:mga0rr50_1700061_c1 nmdc:mga0rr50_1700061_c1_34_480 148
1463 3300050515 nmdc:mga0a205_759673_c1 nmdc:mga0a205_759673_c1_184_630 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.954 8 126
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9516 9 126
3dzd-assembly1.cif.gz_B crystal structure of sigma54 activator ntrc4 in the inactive state 0.9508 10 128
5m7n-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.9502 8 137
5m7o-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus processed with the crystaldirect automated mounting and cryo-cooling technology 0.9501 8 137
ID Description Score Start End Superfamily
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.952 10 85 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9513 10 129 3.40.50.2300
5m7oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9483 8 137 3.40.50.2300
3nhzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.947 9 122 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9465 9 87 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6M0H3-F1-model_v4 DNA-binding response regulator 0.9691 7 118 GO:0000160
GO:0003677
AF-A0A832MF14-F1-model_v4 Response regulator 0.9654 8 126 GO:0000160
AF-A0A679HR12-F1-model_v4 Response regulator 0.965 9 127 GO:0000160
AF-A0A2V5MZM0-F1-model_v4 Response regulatory domain-containing protein 0.9636 8 125 GO:0000160
AF-A0A2D6G530-F1-model_v4 Response regulator 0.9625 8 125 GO:0000160

Feature Viewer

pLDDT pTM Quality
80.62 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map