F494093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1457 | 712 | 1232 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100184441|Ga0070670_1001844412 |
| Length | 261 |
| Sequence | MPRFAANLTMLFTELPFLDRFDAAAKAGFTAVEFLFPYAYSVADLKQRLSANRLELVLHNLPAGDWDAGERGIACLPDRVAEFRDGVARAIDYASALGAPQVNCLAGKVAAGVSDDVLRDTFVGNLRFAAAALQRANIRLLIEPINTFDIPGFYLNRTAQALAIIDEVGSDNLFVQYDIYHAQRMEGELIATMTKQLARIGHIQLADNPGRNEPGTGEIHYDNVFKALDRIGYAGWIGCEYKPATTTEAGLGWLERARRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 22 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 23 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 24 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 25 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 26 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 27 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 28 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2791355199 | |||
| 32 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 33 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 34 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 45 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 46 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 47 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 48 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 49 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 50 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 51 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 52 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 53 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 54 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 55 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 56 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 57 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 58 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 59 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 60 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 61 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 62 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 63 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 64 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 65 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 66 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 67 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 68 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 69 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 70 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 71 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 72 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 73 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 74 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 75 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 76 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 77 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 78 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 79 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 80 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 81 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 82 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 83 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 84 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 85 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 86 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 87 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 88 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 89 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 90 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 91 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 92 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 93 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 94 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 95 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 96 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 97 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 98 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 99 | 2904699407 | |||
| 100 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 101 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 102 | 2906610324 | |||
| 103 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 104 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 105 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 106 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 107 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 108 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 109 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 110 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 111 | 2922368715 | |||
| 112 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 113 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 114 | 2922425934 | |||
| 115 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 116 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 117 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 118 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 119 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 120 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 121 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 122 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 123 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 124 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 125 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 126 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 127 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 128 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 129 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 130 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 131 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 132 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 133 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 134 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 135 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 136 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 137 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 138 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 139 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 140 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 141 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 142 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 143 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 144 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 145 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 146 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 147 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 148 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 149 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 150 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 151 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 152 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 153 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 154 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 155 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 156 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 157 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 158 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 159 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 160 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 161 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 162 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 163 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 164 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 165 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 166 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 167 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 168 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 169 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 170 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 171 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 172 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 173 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 174 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 175 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 176 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 177 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 178 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 179 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 180 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 181 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 182 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 183 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 184 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 185 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 186 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 187 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 188 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 189 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 190 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 191 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 192 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 193 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 194 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 195 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 196 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 197 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 199 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 200 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 203 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 206 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 208 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 210 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 229 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 230 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 231 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 236 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 240 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 241 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 242 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 247 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 248 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 249 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 250 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 251 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 252 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 253 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 254 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 255 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 256 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 257 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 259 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 260 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 261 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 263 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 264 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 265 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 266 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 267 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 268 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 270 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 271 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 272 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 273 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 276 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 277 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 278 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 279 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 280 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 292 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 305 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 310 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 311 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 312 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 313 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 314 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 315 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 316 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 317 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 329 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 390 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 391 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 392 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 393 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 394 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 398 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 399 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 400 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 401 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 402 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 403 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 404 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 405 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 406 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 407 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 408 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 409 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 410 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 411 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 412 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 413 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 414 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 415 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 416 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 417 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 418 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 419 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 420 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 421 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 422 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 423 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 424 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 425 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 426 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 427 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 428 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 429 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 430 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 431 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 432 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 433 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 434 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 435 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 436 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 437 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 438 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 439 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 440 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 441 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 442 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 443 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 444 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 445 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 446 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 447 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 448 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 449 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 450 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 451 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 452 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 453 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 454 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 455 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 456 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 457 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 458 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 459 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 460 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 461 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 462 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 463 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 464 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 465 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 466 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 467 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 468 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 469 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 470 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 471 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 472 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 473 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 474 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 475 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 476 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 477 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 478 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 479 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 557 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 558 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 559 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 560 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 561 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 562 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 563 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 564 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 565 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 566 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 567 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 568 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 569 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 570 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 571 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 572 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 573 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 574 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 575 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 576 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 577 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 578 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 579 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 580 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 581 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 582 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 598 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 601 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 606 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 607 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 608 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 609 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 610 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 612 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 616 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 620 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 623 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 625 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 626 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 627 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 628 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 629 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 630 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 632 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 633 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 634 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 635 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 636 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 637 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 639 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 640 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 641 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 642 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 643 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 644 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 645 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 646 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 647 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 648 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 649 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 650 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 651 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 652 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 653 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 654 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 655 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 656 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 657 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 658 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 659 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 660 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 661 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 662 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 663 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 664 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 665 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 666 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 667 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 668 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 669 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 670 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 671 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 672 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 673 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 674 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 675 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 676 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 677 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 678 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 679 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 680 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 681 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 682 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 683 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 684 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 685 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 686 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 687 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 688 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 689 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 690 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 691 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 692 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 693 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 694 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 695 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 696 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 697 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 698 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 699 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 700 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 701 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 702 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 703 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 704 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 705 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 706 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 707 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 708 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 709 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 710 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 711 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 712 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.78 |
| Metatranscriptomes | 0.07 |
| Isolates | 15.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.13 |
| Nodule | 12.29 |
| Rhizoplane | 4.67 |
| Rhizosphere | 55.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000071 | 3300002987 | Bacteria | 48764 |
| 2 | JGI25159J45721_1000191 | 3300002987 | Bacteria | 28445 |
| 3 | JGI25406J46586_10003417 | 3300003203 | Bacteria | 7474 |
| 4 | JGI25165J46597_1009845 | 3300003214 | Bacteria | 1418 |
| 5 | JGI25153J46596_10000952 | 3300003215 | Bacteria | 17565 |
| 6 | JGI25153J46596_10001246 | 3300003215 | Bacteria | 15361 |
| 7 | JGI25153J46596_10001884 | 3300003215 | Bacteria | 12431 |
| 8 | JGI25153J46596_10005466 | 3300003215 | Bacteria | 6654 |
| 9 | JGI25153J46596_10025964 | 3300003215 | Bacteria | 2083 |
| 10 | JGI25153J46596_10059954 | 3300003215 | Bacteria | 1039 |
| 11 | JGI25160J50197_1000162 | 3300003354 | Bacteria | 57595 |
| 12 | JGI25160J50197_1003726 | 3300003354 | Bacteria | 6720 |
| 13 | JGI25160J50197_1006214 | 3300003354 | Bacteria | 4860 |
| 14 | JGI25161J50226_1000988 | 3300003374 | Bacteria | 10020 |
| 15 | JGI25404J52841_10007977 | 3300003659 | Bacteria | 2247 |
| 16 | JGI25404J52841_10026367 | 3300003659 | Bacteria | 1251 |
| 17 | Ga0055539_1002463 | 3300003752 | Bacteria | 2813 |
| 18 | Ga0055524_1022659 | 3300003775 | Bacteria | 2045 |
| 19 | Ga0055536_1000667 | 3300003781 | Bacteria | 23117 |
| 20 | Ga0055540_1021009 | 3300003792 | Bacteria | 1709 |
| 21 | Ga0055531_10008008 | 3300003794 | Bacteria | 5651 |
| 22 | Ga0055531_10011656 | 3300003794 | Bacteria | 4212 |
| 23 | Ga0055531_10013844 | 3300003794 | Bacteria | 3688 |
| 24 | Ga0055543_1019666 | 3300004625 | Bacteria | 1247 |
| 25 | Ga0065165_1000535 | 3300005262 | Bacteria | 57606 |
| 26 | Ga0065165_1004449 | 3300005262 | Bacteria | 8687 |
| 27 | Ga0065165_1004595 | 3300005262 | Bacteria | 8409 |
| 28 | Ga0065165_1005514 | 3300005262 | Bacteria | 7075 |
| 29 | Ga0070658_10160218 | 3300005327 | Bacteria | 1887 |
| 30 | Ga0070683_100005150 | 3300005329 | Bacteria | 10876 |
| 31 | Ga0070683_100045815 | 3300005329 | Bacteria | 4037 |
| 32 | Ga0070683_100083116 | 3300005329 | Bacteria | 2999 |
| 33 | Ga0070690_100231860 | 3300005330 | Bacteria | 1298 |
| 34 | Ga0070670_100181651 | 3300005331 | Bacteria | 1827 |
| 35 | Ga0070670_100184441 | 3300005331 | Bacteria | 1812 |
| 36 | Ga0070677_10090431 | 3300005333 | Bacteria | 1330 |
| 37 | Ga0068869_100032152 | 3300005334 | Bacteria | 3696 |
| 38 | Ga0068869_100186479 | 3300005334 | Bacteria | 1629 |
| 39 | Ga0068869_100220068 | 3300005334 | Bacteria | 1504 |
| 40 | Ga0070666_10386542 | 3300005335 | Bacteria | 1005 |
| 41 | Ga0070680_100014277 | 3300005336 | Bacteria | 6203 |
| 42 | Ga0070680_100164630 | 3300005336 | Bacteria | 1864 |
| 43 | Ga0070680_100276688 | 3300005336 | Bacteria | 1422 |
| 44 | Ga0070682_100080829 | 3300005337 | Bacteria | 2103 |
| 45 | Ga0070682_100166017 | 3300005337 | Bacteria | 1530 |
| 46 | Ga0070682_100175997 | 3300005337 | Bacteria | 1491 |
| 47 | Ga0068868_100075518 | 3300005338 | Bacteria | 2693 |
| 48 | Ga0068868_100118384 | 3300005338 | Bacteria | 2159 |
| 49 | Ga0068868_100132633 | 3300005338 | Bacteria | 2040 |
| 50 | Ga0070660_100047303 | 3300005339 | Bacteria | 3300 |
| 51 | Ga0070660_100130249 | 3300005339 | Bacteria | 2012 |
| 52 | Ga0070660_100379673 | 3300005339 | Bacteria | 1166 |
| 53 | Ga0070691_10077070 | 3300005341 | Bacteria | 1626 |
| 54 | Ga0070661_100124364 | 3300005344 | Bacteria | 1934 |
| 55 | Ga0070661_100219599 | 3300005344 | Bacteria | 1457 |
| 56 | Ga0070661_100422026 | 3300005344 | Bacteria | 1057 |
| 57 | Ga0070692_10222391 | 3300005345 | Bacteria | 1117 |
| 58 | Ga0070668_100037793 | 3300005347 | Bacteria | 3688 |
| 59 | Ga0070668_100055398 | 3300005347 | Bacteria | 3060 |
| 60 | Ga0070668_100083103 | 3300005347 | Bacteria | 2513 |
| 61 | Ga0070668_100283446 | 3300005347 | Bacteria | 1385 |
| 62 | Ga0070668_100551240 | 3300005347 | Bacteria | 1003 |
| 63 | Ga0070671_100019925 | 3300005355 | Bacteria | 5464 |
| 64 | Ga0070671_100036506 | 3300005355 | Bacteria | 4075 |
| 65 | Ga0070671_100201753 | 3300005355 | Bacteria | 1687 |
| 66 | Ga0070674_100158026 | 3300005356 | Bacteria | 1717 |
| 67 | Ga0070673_100070300 | 3300005364 | Bacteria | 2808 |
| 68 | Ga0070673_100153388 | 3300005364 | Bacteria | 1953 |
| 69 | Ga0070667_100001599 | 3300005367 | Bacteria | 20262 |
| 70 | Ga0070667_100522897 | 3300005367 | Bacteria | 1089 |
| 71 | Ga0070709_10000900 | 3300005434 | Bacteria | 16554 |
| 72 | Ga0070709_10012197 | 3300005434 | Bacteria | 4806 |
| 73 | Ga0070709_10016286 | 3300005434 | Bacteria | 4242 |
| 74 | Ga0070709_10295482 | 3300005434 | Bacteria | 1182 |
| 75 | Ga0070714_100037902 | 3300005435 | Bacteria | 4053 |
| 76 | Ga0070714_100039125 | 3300005435 | Bacteria | 3991 |
| 77 | Ga0070714_100043651 | 3300005435 | Bacteria | 3793 |
| 78 | Ga0070714_100049342 | 3300005435 | Bacteria | 3582 |
| 79 | Ga0070714_100169252 | 3300005435 | Bacteria | 1982 |
| 80 | Ga0070714_100223183 | 3300005435 | Bacteria | 1733 |
| 81 | Ga0070714_100468964 | 3300005435 | Bacteria | 1198 |
| 82 | Ga0070713_100003714 | 3300005436 | Bacteria | 10103 |
| 83 | Ga0070713_100006598 | 3300005436 | Bacteria | 8063 |
| 84 | Ga0070713_100024687 | 3300005436 | Bacteria | 4688 |
| 85 | Ga0070713_100037885 | 3300005436 | Bacteria | 3901 |
| 86 | Ga0070713_100153428 | 3300005436 | Bacteria | 2051 |
| 87 | Ga0070713_100158512 | 3300005436 | Bacteria | 2019 |
| 88 | Ga0070713_100340318 | 3300005436 | Bacteria | 1390 |
| 89 | Ga0070710_10000221 | 3300005437 | Bacteria | 26514 |
| 90 | Ga0070710_10002129 | 3300005437 | Bacteria | 9383 |
| 91 | Ga0070710_10093835 | 3300005437 | Bacteria | 1775 |
| 92 | Ga0070711_100002818 | 3300005439 | Bacteria | 9977 |
| 93 | Ga0070711_100011819 | 3300005439 | Bacteria | 5432 |
| 94 | Ga0070711_100015227 | 3300005439 | Bacteria | 4865 |
| 95 | Ga0070711_100015454 | 3300005439 | Bacteria | 4832 |
| 96 | Ga0070708_100287046 | 3300005445 | Bacteria | 1549 |
| 97 | Ga0070708_100355514 | 3300005445 | Bacteria | 1380 |
| 98 | Ga0070663_100026611 | 3300005455 | Bacteria | 3920 |
| 99 | Ga0070663_100047197 | 3300005455 | Bacteria | 3051 |
| 100 | Ga0070663_100070451 | 3300005455 | Bacteria | 2543 |
| 101 | Ga0070663_100212421 | 3300005455 | Bacteria | 1516 |
| 102 | Ga0070663_100264491 | 3300005455 | Bacteria | 1365 |
| 103 | Ga0070678_100156643 | 3300005456 | Bacteria | 1841 |
| 104 | Ga0070678_100249071 | 3300005456 | Bacteria | 1489 |
| 105 | Ga0070678_100350850 | 3300005456 | Bacteria | 1269 |
| 106 | Ga0070662_100472113 | 3300005457 | Bacteria | 1043 |
| 107 | Ga0070681_10029417 | 3300005458 | Bacteria | 5517 |
| 108 | Ga0070681_10104881 | 3300005458 | Bacteria | 2769 |
| 109 | Ga0068867_100041887 | 3300005459 | Bacteria | 3346 |
| 110 | Ga0070706_100027803 | 3300005467 | Bacteria | 5202 |
| 111 | Ga0070707_100052509 | 3300005468 | Bacteria | 3908 |
| 112 | Ga0070707_100799645 | 3300005468 | Bacteria | 907 |
| 113 | Ga0070698_100154623 | 3300005471 | Bacteria | 2239 |
| 114 | Ga0070679_100079100 | 3300005530 | Bacteria | 3277 |
| 115 | Ga0070679_100228659 | 3300005530 | Bacteria | 1820 |
| 116 | Ga0070684_100003497 | 3300005535 | Bacteria | 11794 |
| 117 | Ga0070684_100065035 | 3300005535 | Bacteria | 3200 |
| 118 | Ga0070684_100417106 | 3300005535 | Bacteria | 1239 |
| 119 | Ga0068853_100055518 | 3300005539 | Bacteria | 3414 |
| 120 | Ga0068853_100203223 | 3300005539 | Bacteria | 1803 |
| 121 | Ga0068853_100459002 | 3300005539 | Bacteria | 1199 |
| 122 | Ga0070672_100250820 | 3300005543 | Bacteria | 1491 |
| 123 | Ga0070693_100169621 | 3300005547 | Bacteria | 1397 |
| 124 | Ga0070693_100256270 | 3300005547 | Bacteria | 1162 |
| 125 | Ga0070665_100015861 | 3300005548 | Bacteria | 7564 |
| 126 | Ga0070665_100043157 | 3300005548 | Bacteria | 4532 |
| 127 | Ga0070665_100090850 | 3300005548 | Bacteria | 3059 |
| 128 | Ga0070665_100147619 | 3300005548 | Bacteria | 2354 |
| 129 | Ga0070665_100193242 | 3300005548 | Bacteria | 2036 |
| 130 | Ga0070665_100266585 | 3300005548 | Bacteria | 1714 |
| 131 | Ga0070665_100300012 | 3300005548 | Bacteria | 1609 |
| 132 | Ga0068855_100051385 | 3300005563 | Bacteria | 4856 |
| 133 | Ga0068855_100121344 | 3300005563 | Bacteria | 2991 |
| 134 | Ga0068855_100171911 | 3300005563 | Bacteria | 2454 |
| 135 | Ga0068855_100286719 | 3300005563 | Bacteria | 1826 |
| 136 | Ga0068855_100550684 | 3300005563 | Bacteria | 1249 |
| 137 | Ga0068857_100013693 | 3300005577 | Bacteria | 7068 |
| 138 | Ga0068857_100054592 | 3300005577 | Bacteria | 3546 |
| 139 | Ga0068857_100071994 | 3300005577 | Bacteria | 3080 |
| 140 | Ga0068857_100141781 | 3300005577 | Bacteria | 2172 |
| 141 | Ga0068854_100062848 | 3300005578 | Bacteria | 2694 |
| 142 | Ga0068854_100382872 | 3300005578 | Bacteria | 1160 |
| 143 | Ga0068856_100009329 | 3300005614 | Bacteria | 9530 |
| 144 | Ga0068856_100036241 | 3300005614 | Bacteria | 4836 |
| 145 | Ga0068856_100724103 | 3300005614 | Bacteria | 1015 |
| 146 | Ga0068852_100011643 | 3300005616 | Bacteria | 6635 |
| 147 | Ga0068852_100115660 | 3300005616 | Bacteria | 2446 |
| 148 | Ga0068852_100251961 | 3300005616 | Bacteria | 1692 |
| 149 | Ga0068852_100597347 | 3300005616 | Bacteria | 1108 |
| 150 | Ga0068859_100202522 | 3300005617 | Bacteria | 2070 |
| 151 | Ga0068864_100117766 | 3300005618 | Bacteria | 2371 |
| 152 | Ga0068864_100349063 | 3300005618 | Bacteria | 1395 |
| 153 | Ga0068866_10011069 | 3300005718 | Bacteria | 3888 |
| 154 | Ga0068866_10057771 | 3300005718 | Bacteria | 2001 |
| 155 | Ga0068861_100036398 | 3300005719 | Bacteria | 3652 |
| 156 | Ga0068861_100488715 | 3300005719 | Bacteria | 1110 |
| 157 | Ga0068861_100535543 | 3300005719 | Bacteria | 1064 |
| 158 | Ga0068851_10035787 | 3300005834 | Bacteria | 2484 |
| 159 | Ga0068863_100086436 | 3300005841 | Bacteria | 2971 |
| 160 | Ga0068858_100444685 | 3300005842 | Bacteria | 1249 |
| 161 | Ga0068858_100550879 | 3300005842 | Bacteria | 1116 |
| 162 | Ga0068860_100358312 | 3300005843 | Bacteria | 1437 |
| 163 | Ga0068860_100690660 | 3300005843 | Bacteria | 1030 |
| 164 | Ga0068862_100131326 | 3300005844 | Bacteria | 2215 |
| 165 | Ga0068862_100350977 | 3300005844 | Bacteria | 1369 |
| 166 | Ga0081455_10031043 | 3300005937 | Bacteria | 4842 |
| 167 | Ga0081455_10052548 | 3300005937 | Bacteria | 3487 |
| 168 | Ga0081455_10082536 | 3300005937 | Bacteria | 2629 |
| 169 | Ga0081455_10099099 | 3300005937 | Bacteria | 2345 |
| 170 | Ga0081538_10069547 | 3300005981 | Bacteria | 1949 |
| 171 | Ga0081540_1000884 | 3300005983 | Bacteria | 27058 |
| 172 | Ga0081540_1003783 | 3300005983 | Bacteria | 11839 |
| 173 | Ga0081540_1004220 | 3300005983 | Bacteria | 11042 |
| 174 | Ga0081540_1005132 | 3300005983 | Bacteria | 9811 |
| 175 | Ga0081540_1012953 | 3300005983 | Bacteria | 5449 |
| 176 | Ga0081540_1014508 | 3300005983 | Bacteria | 5041 |
| 177 | Ga0081540_1019658 | 3300005983 | Bacteria | 4094 |
| 178 | Ga0081540_1021814 | 3300005983 | Bacteria | 3799 |
| 179 | Ga0081540_1025835 | 3300005983 | Bacteria | 3368 |
| 180 | Ga0081540_1062976 | 3300005983 | Bacteria | 1758 |
| 181 | Ga0081539_10006229 | 3300005985 | Bacteria | 11559 |
| 182 | Ga0081539_10010493 | 3300005985 | Bacteria | 7513 |
| 183 | Ga0081539_10094131 | 3300005985 | Bacteria | 1542 |
| 184 | Ga0070717_10003635 | 3300006028 | Bacteria | 11063 |
| 185 | Ga0070717_10005810 | 3300006028 | Bacteria | 9034 |
| 186 | Ga0070717_10292098 | 3300006028 | Bacteria | 1447 |
| 187 | Ga0075365_10007730 | 3300006038 | Bacteria | 6051 |
| 188 | Ga0075365_10010419 | 3300006038 | Bacteria | 5414 |
| 189 | Ga0075365_10157441 | 3300006038 | Bacteria | 1581 |
| 190 | Ga0075365_10236242 | 3300006038 | Bacteria | 1284 |
| 191 | Ga0075365_10357414 | 3300006038 | Bacteria | 1030 |
| 192 | Ga0075365_10520866 | 3300006038 | Bacteria | 841 |
| 193 | Ga0075363_100016000 | 3300006048 | Bacteria | 3699 |
| 194 | Ga0075363_100017124 | 3300006048 | Bacteria | 3588 |
| 195 | Ga0075363_100023095 | 3300006048 | Bacteria | 3149 |
| 196 | Ga0075363_100183728 | 3300006048 | Bacteria | 1190 |
| 197 | Ga0075364_10009798 | 3300006051 | Bacteria | 5761 |
| 198 | Ga0075364_10085133 | 3300006051 | Bacteria | 2093 |
| 199 | Ga0075364_10178494 | 3300006051 | Bacteria | 1436 |
| 200 | Ga0070715_10001911 | 3300006163 | Bacteria | 6264 |
| 201 | Ga0070716_100001730 | 3300006173 | Bacteria | 9850 |
| 202 | Ga0070716_100039266 | 3300006173 | Bacteria | 2627 |
| 203 | Ga0070712_100021309 | 3300006175 | Bacteria | 4256 |
| 204 | Ga0070712_100022055 | 3300006175 | Bacteria | 4190 |
| 205 | Ga0070712_100139414 | 3300006175 | Bacteria | 1848 |
| 206 | Ga0075362_10008537 | 3300006177 | Bacteria | 3922 |
| 207 | Ga0075362_10105690 | 3300006177 | Bacteria | 1321 |
| 208 | Ga0075367_10002035 | 3300006178 | Bacteria | 9046 |
| 209 | Ga0075367_10017795 | 3300006178 | Bacteria | 3907 |
| 210 | Ga0075367_10025516 | 3300006178 | Bacteria | 3343 |
| 211 | Ga0075367_10035016 | 3300006178 | Bacteria | 2904 |
| 212 | Ga0075367_10060179 | 3300006178 | Bacteria | 2264 |
| 213 | Ga0075367_10065458 | 3300006178 | Bacteria | 2176 |
| 214 | Ga0075367_10083923 | 3300006178 | Bacteria | 1931 |
| 215 | Ga0075367_10106264 | 3300006178 | Bacteria | 1720 |
| 216 | Ga0075367_10405211 | 3300006178 | Bacteria | 863 |
| 217 | Ga0075369_10004785 | 3300006186 | Bacteria | 5033 |
| 218 | Ga0075369_10013004 | 3300006186 | Bacteria | 3294 |
| 219 | Ga0075369_10014241 | 3300006186 | Bacteria | 3173 |
| 220 | Ga0075366_10013043 | 3300006195 | Bacteria | 4726 |
| 221 | Ga0075366_10022723 | 3300006195 | Bacteria | 3651 |
| 222 | Ga0075366_10028915 | 3300006195 | Bacteria | 3254 |
| 223 | Ga0075366_10097027 | 3300006195 | Bacteria | 1767 |
| 224 | Ga0075366_10219323 | 3300006195 | Bacteria | 1159 |
| 225 | Ga0097621_100680899 | 3300006237 | Bacteria | 945 |
| 226 | Ga0075370_10000773 | 3300006353 | Bacteria | 12813 |
| 227 | Ga0075370_10026104 | 3300006353 | Bacteria | 3233 |
| 228 | Ga0075370_10040686 | 3300006353 | Bacteria | 2622 |
| 229 | Ga0075370_10044333 | 3300006353 | Bacteria | 2514 |
| 230 | Ga0075370_10074578 | 3300006353 | Bacteria | 1944 |
| 231 | Ga0075370_10111113 | 3300006353 | Bacteria | 1592 |
| 232 | Ga0075370_10122359 | 3300006353 | Bacteria | 1515 |
| 233 | Ga0075370_10168621 | 3300006353 | Bacteria | 1286 |
| 234 | Ga0068871_100138832 | 3300006358 | Bacteria | 2065 |
| 235 | Ga0075434_100043289 | 3300006871 | Bacteria | 4465 |
| 236 | Ga0068865_100157826 | 3300006881 | Bacteria | 1727 |
| 237 | Ga0068865_100168730 | 3300006881 | Bacteria | 1676 |
| 238 | Ga0075436_100117404 | 3300006914 | Bacteria | 1860 |
| 239 | Ga0097620_100202531 | 3300006931 | Bacteria | 2070 |
| 240 | Ga0099825_1046449 | 3300006941 | Bacteria | 1056 |
| 241 | Ga0099824_1013115 | 3300006942 | Bacteria | 8742 |
| 242 | Ga0099822_1000072 | 3300006943 | Bacteria | 55118 |
| 243 | Ga0099822_1050290 | 3300006943 | Bacteria | 1757 |
| 244 | Ga0099823_1106656 | 3300006944 | Bacteria | 810 |
| 245 | Ga0099794_10086065 | 3300007265 | Bacteria | 1556 |
| 246 | Ga0105240_10010472 | 3300009093 | Bacteria | 13035 |
| 247 | Ga0105240_10030277 | 3300009093 | Bacteria | 7034 |
| 248 | Ga0105240_10052653 | 3300009093 | Bacteria | 5114 |
| 249 | Ga0105240_10110255 | 3300009093 | Bacteria | 3331 |
| 250 | Ga0105240_10152628 | 3300009093 | Bacteria | 2749 |
| 251 | Ga0105240_11184085 | 3300009093 | Bacteria | 810 |
| 252 | Ga0105245_10021491 | 3300009098 | Bacteria | 5662 |
| 253 | Ga0105245_10074935 | 3300009098 | Bacteria | 3080 |
| 254 | Ga0105245_10362233 | 3300009098 | Bacteria | 1439 |
| 255 | Ga0105245_10573276 | 3300009098 | Bacteria | 1153 |
| 256 | Ga0105245_10815845 | 3300009098 | Bacteria | 971 |
| 257 | Ga0105247_10389207 | 3300009101 | Bacteria | 990 |
| 258 | Ga0114129_11234225 | 3300009147 | Bacteria | 929 |
| 259 | Ga0105243_10254861 | 3300009148 | Bacteria | 1568 |
| 260 | Ga0105243_10674557 | 3300009148 | Bacteria | 1004 |
| 261 | Ga0105243_10784188 | 3300009148 | Bacteria | 938 |
| 262 | Ga0105241_10028754 | 3300009174 | Bacteria | 4143 |
| 263 | Ga0105241_10034445 | 3300009174 | Bacteria | 3804 |
| 264 | Ga0105241_10161360 | 3300009174 | Bacteria | 1843 |
| 265 | Ga0105241_10613434 | 3300009174 | Bacteria | 984 |
| 266 | Ga0105242_10280153 | 3300009176 | Bacteria | 1514 |
| 267 | Ga0105242_10539701 | 3300009176 | Bacteria | 1116 |
| 268 | Ga0105248_10095221 | 3300009177 | Bacteria | 3352 |
| 269 | Ga0105237_10004025 | 3300009545 | Bacteria | 17170 |
| 270 | Ga0105237_10121559 | 3300009545 | Bacteria | 2606 |
| 271 | Ga0105237_10271117 | 3300009545 | Bacteria | 1700 |
| 272 | Ga0105237_10480421 | 3300009545 | Bacteria | 1249 |
| 273 | Ga0105237_10547947 | 3300009545 | Bacteria | 1163 |
| 274 | Ga0105238_10324664 | 3300009551 | Bacteria | 1525 |
| 275 | Ga0105238_10464430 | 3300009551 | Bacteria | 1264 |
| 276 | Ga0105238_10509255 | 3300009551 | Bacteria | 1205 |
| 277 | Ga0105238_10637057 | 3300009551 | Bacteria | 1075 |
| 278 | Ga0105238_10846207 | 3300009551 | Bacteria | 932 |
| 279 | Ga0105238_10925623 | 3300009551 | Bacteria | 891 |
| 280 | Ga0105249_10194251 | 3300009553 | Bacteria | 1983 |
| 281 | Ga0105249_10291673 | 3300009553 | Bacteria | 1633 |
| 282 | Ga0105249_10680109 | 3300009553 | Bacteria | 1088 |
| 283 | Ga0105249_10795402 | 3300009553 | Bacteria | 1010 |
| 284 | Ga0099796_10052412 | 3300010159 | Bacteria | 1421 |
| 285 | Ga0105239_10031497 | 3300010375 | Bacteria | 5831 |
| 286 | Ga0105239_10088799 | 3300010375 | Bacteria | 3408 |
| 287 | Ga0105239_10125231 | 3300010375 | Bacteria | 2855 |
| 288 | Ga0105239_10224672 | 3300010375 | Bacteria | 2106 |
| 289 | Ga0105239_10725714 | 3300010375 | Bacteria | 1137 |
| 290 | Ga0105246_10020341 | 3300011119 | Bacteria | 4255 |
| 291 | Ga0157373_10070722 | 3300013100 | Bacteria | 2466 |
| 292 | Ga0157370_10511429 | 3300013104 | Bacteria | 1102 |
| 293 | Ga0157369_10017188 | 3300013105 | Bacteria | 8128 |
| 294 | Ga0157369_10039801 | 3300013105 | Bacteria | 5136 |
| 295 | Ga0157369_10104094 | 3300013105 | Bacteria | 3023 |
| 296 | Ga0157369_10279232 | 3300013105 | Bacteria | 1740 |
| 297 | Ga0157374_10108670 | 3300013296 | Bacteria | 2666 |
| 298 | Ga0157374_10271655 | 3300013296 | Bacteria | 1672 |
| 299 | Ga0157374_10457713 | 3300013296 | Bacteria | 1278 |
| 300 | Ga0157378_10110756 | 3300013297 | Bacteria | 2517 |
| 301 | Ga0157378_10215565 | 3300013297 | Bacteria | 1822 |
| 302 | Ga0157378_10490499 | 3300013297 | Bacteria | 1226 |
| 303 | Ga0163162_10048614 | 3300013306 | Bacteria | 4250 |
| 304 | Ga0163162_10738497 | 3300013306 | Bacteria | 1104 |
| 305 | Ga0157372_10295020 | 3300013307 | Bacteria | 1886 |
| 306 | Ga0157375_10058051 | 3300013308 | Bacteria | 3827 |
| 307 | Ga0157375_10162251 | 3300013308 | Bacteria | 2377 |
| 308 | Ga0157375_10207808 | 3300013308 | Bacteria | 2114 |
| 309 | Ga0157375_10552587 | 3300013308 | Bacteria | 1313 |
| 310 | Ga0163163_10365399 | 3300014325 | Bacteria | 1500 |
| 311 | Ga0157380_10001485 | 3300014326 | Bacteria | 15341 |
| 312 | Ga0157380_10436727 | 3300014326 | Bacteria | 1253 |
| 313 | Ga0157380_10505548 | 3300014326 | Bacteria | 1175 |
| 314 | Ga0182008_10086411 | 3300014497 | Bacteria | 1545 |
| 315 | Ga0157377_10191461 | 3300014745 | Bacteria | 1293 |
| 316 | Ga0157379_10197211 | 3300014968 | Bacteria | 1820 |
| 317 | Ga0157379_10517438 | 3300014968 | Bacteria | 1107 |
| 318 | Ga0157379_10560603 | 3300014968 | Bacteria | 1064 |
| 319 | Ga0157376_10072632 | 3300014969 | Bacteria | 2927 |
| 320 | Ga0157376_10148203 | 3300014969 | Bacteria | 2113 |
| 321 | Ga0157376_10596002 | 3300014969 | Bacteria | 1099 |
| 322 | Ga0163161_10184790 | 3300017792 | Bacteria | 1600 |
| 323 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 324 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 325 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 326 | Ga0214543_1003164 | 3300021327 | Bacteria | 32141 |
| 327 | Ga0213872_10076914 | 3300021361 | Bacteria | 1501 |
| 328 | Ga0213874_10068795 | 3300021377 | Bacteria | 1125 |
| 329 | Ga0213876_10051082 | 3300021384 | Bacteria | 2185 |
| 330 | Ga0224712_10168337 | 3300022467 | Bacteria | 981 |
| 331 | Ga0209436_101866 | 3300025208 | Bacteria | 6829 |
| 332 | Ga0209677_100908 | 3300025253 | Bacteria | 14482 |
| 333 | Ga0209677_106221 | 3300025253 | Bacteria | 2883 |
| 334 | Ga0209148_1000699 | 3300025254 | Bacteria | 27192 |
| 335 | Ga0209233_1001449 | 3300025261 | Bacteria | 9377 |
| 336 | Ga0209233_1002356 | 3300025261 | Bacteria | 7030 |
| 337 | Ga0209233_1011713 | 3300025261 | Bacteria | 2575 |
| 338 | Ga0209233_1012838 | 3300025261 | Bacteria | 2412 |
| 339 | Ga0209455_1004211 | 3300025272 | Bacteria | 4798 |
| 340 | Ga0209455_1005909 | 3300025272 | Bacteria | 3696 |
| 341 | Ga0209455_1015444 | 3300025272 | Bacteria | 1678 |
| 342 | Ga0209130_1000147 | 3300025284 | Bacteria | 109796 |
| 343 | Ga0209676_1001620 | 3300025292 | Bacteria | 19915 |
| 344 | Ga0209025_1000240 | 3300025294 | Bacteria | 128397 |
| 345 | Ga0209564_1001127 | 3300025295 | Bacteria | 31429 |
| 346 | Ga0209564_1009146 | 3300025295 | Bacteria | 4764 |
| 347 | Ga0209564_1009950 | 3300025295 | Bacteria | 4446 |
| 348 | Ga0209564_1015362 | 3300025295 | Bacteria | 3120 |
| 349 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 350 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 351 | Ga0209758_1001858 | 3300025297 | Bacteria | 23145 |
| 352 | Ga0209758_1002537 | 3300025297 | Bacteria | 18401 |
| 353 | Ga0209758_1006910 | 3300025297 | Bacteria | 7926 |
| 354 | Ga0209758_1011139 | 3300025297 | Bacteria | 5252 |
| 355 | Ga0209758_1027721 | 3300025297 | Bacteria | 2414 |
| 356 | Ga0209758_1032160 | 3300025297 | Bacteria | 2136 |
| 357 | Ga0209050_1014213 | 3300025298 | Bacteria | 3452 |
| 358 | Ga0209256_1001569 | 3300025299 | Bacteria | 22476 |
| 359 | Ga0209256_1005335 | 3300025299 | Bacteria | 7472 |
| 360 | Ga0207426_1000267 | 3300025302 | Bacteria | 109797 |
| 361 | Ga0207426_1001289 | 3300025302 | Bacteria | 21656 |
| 362 | Ga0207426_1002137 | 3300025302 | Bacteria | 13493 |
| 363 | Ga0207426_1002396 | 3300025302 | Bacteria | 12077 |
| 364 | Ga0207426_1065167 | 3300025302 | Bacteria | 1034 |
| 365 | Ga0209051_1008485 | 3300025303 | Bacteria | 5428 |
| 366 | Ga0209257_1002116 | 3300025304 | Bacteria | 20743 |
| 367 | Ga0209257_1006326 | 3300025304 | Bacteria | 7704 |
| 368 | Ga0207697_10035020 | 3300025315 | Bacteria | 2055 |
| 369 | Ga0207697_10076204 | 3300025315 | Bacteria | 1409 |
| 370 | Ga0207656_10015273 | 3300025321 | Bacteria | 2970 |
| 371 | Ga0207682_10032066 | 3300025893 | Bacteria | 2111 |
| 372 | Ga0207682_10049223 | 3300025893 | Bacteria | 1739 |
| 373 | Ga0207692_10000364 | 3300025898 | Bacteria | 15516 |
| 374 | Ga0207692_10003951 | 3300025898 | Bacteria | 5821 |
| 375 | Ga0207692_10005642 | 3300025898 | Bacteria | 5026 |
| 376 | Ga0207692_10062720 | 3300025898 | Bacteria | 1930 |
| 377 | Ga0207710_10097636 | 3300025900 | Bacteria | 1382 |
| 378 | Ga0207688_10302558 | 3300025901 | Bacteria | 978 |
| 379 | Ga0207680_10253326 | 3300025903 | Bacteria | 1216 |
| 380 | Ga0207647_10019836 | 3300025904 | Bacteria | 4515 |
| 381 | Ga0207647_10238473 | 3300025904 | Bacteria | 1045 |
| 382 | Ga0207699_10000319 | 3300025906 | Bacteria | 25750 |
| 383 | Ga0207699_10002988 | 3300025906 | Bacteria | 8041 |
| 384 | Ga0207699_10020623 | 3300025906 | Bacteria | 3537 |
| 385 | Ga0207699_10074695 | 3300025906 | Bacteria | 2083 |
| 386 | Ga0207699_10440202 | 3300025906 | Bacteria | 934 |
| 387 | Ga0207643_10276233 | 3300025908 | Bacteria | 1041 |
| 388 | Ga0207684_10024140 | 3300025910 | Bacteria | 5187 |
| 389 | Ga0207654_10003032 | 3300025911 | Bacteria | 8518 |
| 390 | Ga0207654_10082507 | 3300025911 | Bacteria | 1939 |
| 391 | Ga0207654_10144837 | 3300025911 | Bacteria | 1519 |
| 392 | Ga0207707_10000378 | 3300025912 | Bacteria | 46582 |
| 393 | Ga0207707_10018699 | 3300025912 | Bacteria | 6043 |
| 394 | Ga0207707_10031747 | 3300025912 | Bacteria | 4623 |
| 395 | Ga0207707_10080028 | 3300025912 | Bacteria | 2853 |
| 396 | Ga0207707_10419105 | 3300025912 | Bacteria | 1148 |
| 397 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 398 | Ga0207695_10048138 | 3300025913 | Bacteria | 4505 |
| 399 | Ga0207695_10051139 | 3300025913 | Bacteria | 4341 |
| 400 | Ga0207695_10143916 | 3300025913 | Bacteria | 2330 |
| 401 | Ga0207695_10158677 | 3300025913 | Bacteria | 2195 |
| 402 | Ga0207695_10241625 | 3300025913 | Bacteria | 1707 |
| 403 | Ga0207695_10322552 | 3300025913 | Bacteria | 1434 |
| 404 | Ga0207671_10004403 | 3300025914 | Bacteria | 13492 |
| 405 | Ga0207671_10065749 | 3300025914 | Bacteria | 2698 |
| 406 | Ga0207671_10127093 | 3300025914 | Bacteria | 1954 |
| 407 | Ga0207671_10441043 | 3300025914 | Bacteria | 1037 |
| 408 | Ga0207693_10007176 | 3300025915 | Bacteria | 9179 |
| 409 | Ga0207693_10043239 | 3300025915 | Bacteria | 3545 |
| 410 | Ga0207693_10098517 | 3300025915 | Bacteria | 2292 |
| 411 | Ga0207663_10000417 | 3300025916 | Bacteria | 18473 |
| 412 | Ga0207663_10006343 | 3300025916 | Bacteria | 6044 |
| 413 | Ga0207663_10015030 | 3300025916 | Bacteria | 4259 |
| 414 | Ga0207663_10039890 | 3300025916 | Bacteria | 2849 |
| 415 | Ga0207660_10003159 | 3300025917 | Bacteria | 10789 |
| 416 | Ga0207660_10081145 | 3300025917 | Bacteria | 2383 |
| 417 | Ga0207660_10091050 | 3300025917 | Bacteria | 2261 |
| 418 | Ga0207660_10148620 | 3300025917 | Bacteria | 1798 |
| 419 | Ga0207662_10134864 | 3300025918 | Bacteria | 1560 |
| 420 | Ga0207657_10001107 | 3300025919 | Bacteria | 28599 |
| 421 | Ga0207657_10004372 | 3300025919 | Bacteria | 14956 |
| 422 | Ga0207657_10108304 | 3300025919 | Bacteria | 2297 |
| 423 | Ga0207657_10334546 | 3300025919 | Bacteria | 1196 |
| 424 | Ga0207649_10194117 | 3300025920 | Bacteria | 1430 |
| 425 | Ga0207649_10364299 | 3300025920 | Bacteria | 1073 |
| 426 | Ga0207649_10379229 | 3300025920 | Bacteria | 1053 |
| 427 | Ga0207649_10505693 | 3300025920 | Bacteria | 919 |
| 428 | Ga0207652_10005634 | 3300025921 | Bacteria | 10161 |
| 429 | Ga0207652_10020624 | 3300025921 | Bacteria | 5431 |
| 430 | Ga0207652_10186135 | 3300025921 | Bacteria | 1867 |
| 431 | Ga0207652_10205936 | 3300025921 | Bacteria | 1771 |
| 432 | Ga0207646_10346623 | 3300025922 | Bacteria | 1342 |
| 433 | Ga0207646_10454260 | 3300025922 | Bacteria | 1156 |
| 434 | Ga0207681_10315252 | 3300025923 | Bacteria | 1242 |
| 435 | Ga0207681_10483934 | 3300025923 | Bacteria | 1011 |
| 436 | Ga0207694_10019080 | 3300025924 | Bacteria | 5183 |
| 437 | Ga0207694_10070032 | 3300025924 | Bacteria | 2740 |
| 438 | Ga0207694_10321180 | 3300025924 | Bacteria | 1278 |
| 439 | Ga0207694_10342462 | 3300025924 | Bacteria | 1236 |
| 440 | Ga0207694_10583105 | 3300025924 | Bacteria | 940 |
| 441 | Ga0207650_10206520 | 3300025925 | Bacteria | 1576 |
| 442 | Ga0207650_10220521 | 3300025925 | Bacteria | 1526 |
| 443 | Ga0207687_10022826 | 3300025927 | Bacteria | 4167 |
| 444 | Ga0207700_10013002 | 3300025928 | Bacteria | 5395 |
| 445 | Ga0207700_10082107 | 3300025928 | Bacteria | 2519 |
| 446 | Ga0207700_10095530 | 3300025928 | Bacteria | 2358 |
| 447 | Ga0207700_10120873 | 3300025928 | Bacteria | 2123 |
| 448 | Ga0207700_10132389 | 3300025928 | Bacteria | 2038 |
| 449 | Ga0207700_10139247 | 3300025928 | Bacteria | 1992 |
| 450 | Ga0207700_10245489 | 3300025928 | Bacteria | 1528 |
| 451 | Ga0207664_10040468 | 3300025929 | Bacteria | 3625 |
| 452 | Ga0207664_10059002 | 3300025929 | Bacteria | 3055 |
| 453 | Ga0207664_10107641 | 3300025929 | Bacteria | 2313 |
| 454 | Ga0207664_10272313 | 3300025929 | Bacteria | 1483 |
| 455 | Ga0207664_10388327 | 3300025929 | Bacteria | 1240 |
| 456 | Ga0207644_10038532 | 3300025931 | Bacteria | 3368 |
| 457 | Ga0207644_10239483 | 3300025931 | Bacteria | 1444 |
| 458 | Ga0207690_10125196 | 3300025932 | Bacteria | 1873 |
| 459 | Ga0207690_10266891 | 3300025932 | Bacteria | 1328 |
| 460 | Ga0207706_10013484 | 3300025933 | Bacteria | 7428 |
| 461 | Ga0207706_10190586 | 3300025933 | Bacteria | 1800 |
| 462 | Ga0207686_10338352 | 3300025934 | Bacteria | 1129 |
| 463 | Ga0207686_10354493 | 3300025934 | Bacteria | 1105 |
| 464 | Ga0207709_10064438 | 3300025935 | Bacteria | 2301 |
| 465 | Ga0207704_10057211 | 3300025938 | Bacteria | 2394 |
| 466 | Ga0207704_10268800 | 3300025938 | Bacteria | 1290 |
| 467 | Ga0207665_10000190 | 3300025939 | Bacteria | 41515 |
| 468 | Ga0207665_10016066 | 3300025939 | Bacteria | 4916 |
| 469 | Ga0207665_10212063 | 3300025939 | Bacteria | 1415 |
| 470 | Ga0207665_10367662 | 3300025939 | Bacteria | 1089 |
| 471 | Ga0207665_10510225 | 3300025939 | Bacteria | 930 |
| 472 | Ga0207691_10032277 | 3300025940 | Bacteria | 4883 |
| 473 | Ga0207689_10013133 | 3300025942 | Bacteria | 7068 |
| 474 | Ga0207689_10043683 | 3300025942 | Bacteria | 3705 |
| 475 | Ga0207661_10007635 | 3300025944 | Bacteria | 7690 |
| 476 | Ga0207661_10013657 | 3300025944 | Bacteria | 5930 |
| 477 | Ga0207661_10347895 | 3300025944 | Bacteria | 1337 |
| 478 | Ga0207679_10208915 | 3300025945 | Bacteria | 1636 |
| 479 | Ga0207679_10864755 | 3300025945 | Bacteria | 826 |
| 480 | Ga0207667_10005778 | 3300025949 | Bacteria | 15094 |
| 481 | Ga0207667_10483827 | 3300025949 | Bacteria | 1256 |
| 482 | Ga0207651_10042541 | 3300025960 | Bacteria | 3024 |
| 483 | Ga0207651_10116934 | 3300025960 | Bacteria | 2014 |
| 484 | Ga0207651_10624516 | 3300025960 | Bacteria | 944 |
| 485 | Ga0207712_10049315 | 3300025961 | Bacteria | 2933 |
| 486 | Ga0207668_10061439 | 3300025972 | Bacteria | 2642 |
| 487 | Ga0207668_10196091 | 3300025972 | Bacteria | 1604 |
| 488 | Ga0207668_10506424 | 3300025972 | Bacteria | 1039 |
| 489 | Ga0207640_10135585 | 3300025981 | Bacteria | 1786 |
| 490 | Ga0207658_10000701 | 3300025986 | Bacteria | 29053 |
| 491 | Ga0207658_10086325 | 3300025986 | Bacteria | 2420 |
| 492 | Ga0207658_10145331 | 3300025986 | Bacteria | 1925 |
| 493 | Ga0207677_10039546 | 3300026023 | Bacteria | 3102 |
| 494 | Ga0207677_10197555 | 3300026023 | Bacteria | 1596 |
| 495 | Ga0207703_10616397 | 3300026035 | Bacteria | 1027 |
| 496 | Ga0207703_10710473 | 3300026035 | Bacteria | 956 |
| 497 | Ga0207639_10107575 | 3300026041 | Bacteria | 2265 |
| 498 | Ga0207639_10275252 | 3300026041 | Bacteria | 1478 |
| 499 | Ga0207639_10279803 | 3300026041 | Bacteria | 1467 |
| 500 | Ga0207639_10378559 | 3300026041 | Bacteria | 1270 |
| 501 | Ga0207639_10671936 | 3300026041 | Bacteria | 959 |
| 502 | Ga0207678_10048644 | 3300026067 | Bacteria | 3665 |
| 503 | Ga0207678_10064676 | 3300026067 | Bacteria | 3142 |
| 504 | Ga0207678_10068316 | 3300026067 | Bacteria | 3050 |
| 505 | Ga0207678_10423203 | 3300026067 | Bacteria | 1155 |
| 506 | Ga0207708_10168656 | 3300026075 | Bacteria | 1732 |
| 507 | Ga0207708_10293111 | 3300026075 | Bacteria | 1321 |
| 508 | Ga0207702_10000779 | 3300026078 | Bacteria | 33703 |
| 509 | Ga0207702_10088634 | 3300026078 | Bacteria | 2704 |
| 510 | Ga0207702_10386413 | 3300026078 | Bacteria | 1347 |
| 511 | Ga0207648_10017982 | 3300026089 | Bacteria | 6409 |
| 512 | Ga0207648_10124804 | 3300026089 | Bacteria | 2264 |
| 513 | Ga0207648_10636806 | 3300026089 | Bacteria | 985 |
| 514 | Ga0207674_10028009 | 3300026116 | Bacteria | 5954 |
| 515 | Ga0207674_10046213 | 3300026116 | Bacteria | 4472 |
| 516 | Ga0207674_10067952 | 3300026116 | Bacteria | 3587 |
| 517 | Ga0207674_10109148 | 3300026116 | Bacteria | 2743 |
| 518 | Ga0207674_10604412 | 3300026116 | Bacteria | 1059 |
| 519 | Ga0207675_100161090 | 3300026118 | Bacteria | 2140 |
| 520 | Ga0207675_100685017 | 3300026118 | Bacteria | 1033 |
| 521 | Ga0207675_100730608 | 3300026118 | Bacteria | 1000 |
| 522 | Ga0207675_100755197 | 3300026118 | Bacteria | 984 |
| 523 | Ga0207683_10008222 | 3300026121 | Bacteria | 8926 |
| 524 | Ga0207683_10031453 | 3300026121 | Bacteria | 4606 |
| 525 | Ga0207683_10049770 | 3300026121 | Bacteria | 3669 |
| 526 | Ga0207683_10209554 | 3300026121 | Bacteria | 1774 |
| 527 | Ga0207698_10074151 | 3300026142 | Bacteria | 2713 |
| 528 | Ga0207698_10100743 | 3300026142 | Bacteria | 2394 |
| 529 | Ga0207698_10148732 | 3300026142 | Bacteria | 2029 |
| 530 | Ga0207698_10916551 | 3300026142 | Bacteria | 884 |
| 531 | Ga0207698_10939462 | 3300026142 | Bacteria | 873 |
| 532 | Ga0207698_11046332 | 3300026142 | Bacteria | 828 |
| 533 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 534 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 535 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 536 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 537 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 538 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 539 | Ga0209489_100612 | 3300027361 | Bacteria | 69168 |
| 540 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 541 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 542 | Ga0207428_10028694 | 3300027907 | Bacteria | 4620 |
| 543 | Ga0268266_10001082 | 3300028379 | Bacteria | 34140 |
| 544 | Ga0268266_10018792 | 3300028379 | Bacteria | 5889 |
| 545 | Ga0268266_10020256 | 3300028379 | Bacteria | 5671 |
| 546 | Ga0268266_10090253 | 3300028379 | Bacteria | 2685 |
| 547 | Ga0268266_10110280 | 3300028379 | Bacteria | 2437 |
| 548 | Ga0268266_10177582 | 3300028379 | Bacteria | 1937 |
| 549 | Ga0268266_10325536 | 3300028379 | Bacteria | 1439 |
| 550 | Ga0268265_10565813 | 3300028380 | Bacteria | 1081 |
| 551 | Ga0268264_10142197 | 3300028381 | Bacteria | 2141 |
| 552 | Ga0268264_10500515 | 3300028381 | Bacteria | 1185 |
| 553 | Ga0268264_10887731 | 3300028381 | Bacteria | 894 |
| 554 | Ga0265337_1006052 | 3300028556 | Bacteria | 4718 |
| 555 | Ga0265326_10003632 | 3300028558 | Bacteria | 5041 |
| 556 | Ga0265319_1009562 | 3300028563 | Bacteria | 4118 |
| 557 | Ga0265334_10018461 | 3300028573 | Bacteria | 2875 |
| 558 | Ga0265318_10014529 | 3300028577 | Bacteria | 3304 |
| 559 | Ga0265323_10002008 | 3300028653 | Bacteria | 9596 |
| 560 | Ga0265336_10002276 | 3300028666 | Bacteria | 8031 |
| 561 | Ga0307517_10004833 | 3300028786 | Bacteria | 20547 |
| 562 | Ga0307517_10035440 | 3300028786 | Bacteria | 5649 |
| 563 | Ga0307517_10052355 | 3300028786 | Bacteria | 4094 |
| 564 | Ga0307517_10201312 | 3300028786 | Bacteria | 1244 |
| 565 | Ga0307515_10025331 | 3300028794 | Bacteria | 10271 |
| 566 | Ga0307515_10093890 | 3300028794 | Bacteria | 3713 |
| 567 | Ga0307515_10138928 | 3300028794 | Bacteria | 2619 |
| 568 | Ga0307515_10166938 | 3300028794 | Bacteria | 2214 |
| 569 | Ga0265338_10007046 | 3300028800 | Bacteria | 14103 |
| 570 | Ga0265324_10012696 | 3300029957 | Bacteria | 3168 |
| 571 | Ga0265330_10008271 | 3300031235 | Bacteria | 5014 |
| 572 | Ga0265330_10041431 | 3300031235 | Bacteria | 2042 |
| 573 | Ga0265330_10111848 | 3300031235 | Bacteria | 1166 |
| 574 | Ga0265332_10006592 | 3300031238 | Bacteria | 5262 |
| 575 | Ga0265332_10011731 | 3300031238 | Bacteria | 3893 |
| 576 | Ga0265328_10101343 | 3300031239 | Bacteria | 1067 |
| 577 | Ga0265325_10009944 | 3300031241 | Bacteria | 5532 |
| 578 | Ga0265340_10003690 | 3300031247 | Bacteria | 8619 |
| 579 | Ga0265340_10086993 | 3300031247 | Bacteria | 1465 |
| 580 | Ga0265340_10121365 | 3300031247 | Bacteria | 1202 |
| 581 | Ga0265339_10001505 | 3300031249 | Bacteria | 17219 |
| 582 | Ga0265316_10251612 | 3300031344 | Bacteria | 1297 |
| 583 | Ga0307513_10029357 | 3300031456 | Bacteria | 6272 |
| 584 | Ga0307513_10078873 | 3300031456 | Bacteria | 3404 |
| 585 | Ga0307513_10240593 | 3300031456 | Bacteria | 1615 |
| 586 | Ga0307509_10005920 | 3300031507 | Bacteria | 16738 |
| 587 | Ga0307509_10020362 | 3300031507 | Bacteria | 7527 |
| 588 | Ga0307509_10022911 | 3300031507 | Bacteria | 7024 |
| 589 | Ga0307509_10141416 | 3300031507 | Bacteria | 2341 |
| 590 | Ga0307509_10194200 | 3300031507 | Bacteria | 1876 |
| 591 | Ga0307509_10213959 | 3300031507 | Bacteria | 1749 |
| 592 | Ga0307408_100614320 | 3300031548 | Bacteria | 968 |
| 593 | Ga0307508_10026371 | 3300031616 | Bacteria | 5266 |
| 594 | Ga0307508_10249221 | 3300031616 | Bacteria | 1372 |
| 595 | Ga0307508_10284421 | 3300031616 | Bacteria | 1247 |
| 596 | Ga0307514_10282275 | 3300031649 | Bacteria | 949 |
| 597 | Ga0265314_10002744 | 3300031711 | Bacteria | 17602 |
| 598 | Ga0265342_10169414 | 3300031712 | Bacteria | 1202 |
| 599 | Ga0307516_10056839 | 3300031730 | Bacteria | 3813 |
| 600 | Ga0307516_10224046 | 3300031730 | Bacteria | 1588 |
| 601 | Ga0307516_10370979 | 3300031730 | Bacteria | 1094 |
| 602 | Ga0307516_10422952 | 3300031730 | Bacteria | 990 |
| 603 | Ga0307413_10055476 | 3300031824 | Bacteria | 2411 |
| 604 | Ga0307410_10109914 | 3300031852 | Bacteria | 1993 |
| 605 | Ga0307409_100489184 | 3300031995 | Bacteria | 1195 |
| 606 | Ga0307411_10504635 | 3300032005 | Bacteria | 1023 |
| 607 | Ga0307415_100069816 | 3300032126 | Bacteria | 2465 |
| 608 | Ga0307415_100306999 | 3300032126 | Bacteria | 1317 |
| 609 | Ga0307415_100798091 | 3300032126 | Bacteria | 861 |
| 610 | Ga0307510_10005755 | 3300033180 | Bacteria | 14774 |
| 611 | Ga0307510_10016732 | 3300033180 | Bacteria | 8653 |
| 612 | Ga0307510_10022493 | 3300033180 | Bacteria | 7322 |
| 613 | Ga0307510_10050890 | 3300033180 | Bacteria | 4388 |
| 614 | Ga0307510_10063819 | 3300033180 | Bacteria | 3746 |
| 615 | Ga0307510_10123392 | 3300033180 | Bacteria | 2287 |
| 616 | Ga0307510_10137260 | 3300033180 | Bacteria | 2099 |
| 617 | Ga0307510_10157707 | 3300033180 | Bacteria | 1873 |
| 618 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 619 | Ga0373950_0031985 | 3300034818 | Bacteria | 978 |
| 620 | Ga0373926_0011600 | 3300035083 | Bacteria | 2967 |
| 621 | Ga0373934_0016121 | 3300035086 | Bacteria | 2838 |
| 622 | Ga0373944_0026448 | 3300035089 | Bacteria | 1714 |
| 623 | Ga0373952_0025997 | 3300035092 | Bacteria | 1269 |
| 624 | Ga0373952_0080572 | 3300035092 | Bacteria | 830 |
| 625 | Ga0373923_0000289 | 3300035111 | Bacteria | 11095 |
| 626 | Ga0373932_0019392 | 3300035112 | Bacteria | 1772 |
| 627 | Ga0373932_0052670 | 3300035112 | Bacteria | 1213 |
| 628 | Ga0373936_0006387 | 3300035113 | Bacteria | 4442 |
| 629 | Ga0373936_0136603 | 3300035113 | Bacteria | 1056 |
| 630 | Ga0373945_0063014 | 3300035116 | Bacteria | 1387 |
| 631 | Ga0373953_0116458 | 3300035117 | Bacteria | 1133 |
| 632 | Ga0373954_0001207 | 3300035118 | Bacteria | 10376 |
| 633 | Ga0373954_0088515 | 3300035118 | Bacteria | 1485 |
| 634 | Ga0373954_0140355 | 3300035118 | Bacteria | 1178 |
| 635 | Ga0373956_0010705 | 3300035119 | Bacteria | 3765 |
| 636 | Ga0373956_0093265 | 3300035119 | Bacteria | 1391 |
| 637 | Ga0373957_0009960 | 3300035120 | Bacteria | 3125 |
| 638 | Ga0373957_0042789 | 3300035120 | Bacteria | 1710 |
| 639 | Ga0373943_0032647 | 3300035170 | Bacteria | 2475 |
| 640 | Ga0373943_0085618 | 3300035170 | Bacteria | 1624 |
| 641 | Ga0373943_0135699 | 3300035170 | Bacteria | 1321 |
| 642 | Ga0373946_0003713 | 3300035171 | Bacteria | 5411 |
| 643 | Ga0373946_0107013 | 3300035171 | Bacteria | 1261 |
| 644 | Ga0373955_0009767 | 3300035172 | Bacteria | 4508 |
| 645 | Ga0373955_0047368 | 3300035172 | Bacteria | 2327 |
| 646 | Ga0373962_0093402 | 3300035242 | Bacteria | 930 |
| 647 | Ga0373924_0012573 | 3300035410 | Bacteria | 3166 |
| 648 | Ga0373924_0061287 | 3300035410 | Bacteria | 1574 |
| 649 | Ga0373935_0000499 | 3300035692 | Bacteria | 20274 |
| 650 | Ga0373935_0068682 | 3300035692 | Bacteria | 2280 |
| 651 | Ga0373935_0397416 | 3300035692 | Bacteria | 989 |
| 652 | Ga0373927_0025153 | 3300035695 | Bacteria | 3892 |
| 653 | Ga0373927_0061213 | 3300035695 | Bacteria | 2435 |
| 654 | Ga0373933_0001914 | 3300035724 | Bacteria | 12012 |
| 655 | Ga0373947_0001481 | 3300035725 | Bacteria | 14428 |
| 656 | Ga0373947_0009460 | 3300035725 | Bacteria | 5597 |
| 657 | Ga0373947_0091243 | 3300035725 | Bacteria | 1900 |
| 658 | Ga0373947_0198789 | 3300035725 | Bacteria | 1311 |
| 659 | Ga0373947_0244977 | 3300035725 | Bacteria | 1184 |
| 660 | Ga0373947_0341882 | 3300035725 | Bacteria | 1003 |
| 661 | Ga0373937_0004047 | 3300036401 | Bacteria | 12416 |
| 662 | Ga0373937_0014169 | 3300036401 | Bacteria | 7033 |
| 663 | Ga0373937_0026809 | 3300036401 | Bacteria | 5209 |
| 664 | Ga0373937_0166521 | 3300036401 | Bacteria | 2067 |
| 665 | Ga0373937_0465599 | 3300036401 | Bacteria | 1200 |
| 666 | Ga0373925_0010291 | 3300037068 | Bacteria | 6783 |
| 667 | Ga0373925_0048830 | 3300037068 | Bacteria | 3154 |
| 668 | Ga0373925_0349009 | 3300037068 | Bacteria | 1201 |
| 669 | Ga0395899_0075081 | 3300037312 | Bacteria | 2469 |
| 670 | Ga0395900_0000851 | 3300037418 | Bacteria | 40239 |
| 671 | Ga0395900_0037891 | 3300037418 | Bacteria | 4971 |
| 672 | Ga0395900_0407528 | 3300037418 | Bacteria | 1322 |
| 673 | Ga0395900_0703045 | 3300037418 | Bacteria | 944 |
| 674 | Ga0395898_0008255 | 3300037466 | Bacteria | 11013 |
| 675 | Ga0395898_0009621 | 3300037466 | Bacteria | 10148 |
| 676 | Ga0395898_0261367 | 3300037466 | Bacteria | 1651 |
| 677 | Ga0395898_0463388 | 3300037466 | Bacteria | 1206 |
| 678 | Ga0395905_0005304 | 3300037471 | Bacteria | 13182 |
| 679 | Ga0395905_0076783 | 3300037471 | Bacteria | 3130 |
| 680 | Ga0395901_0009809 | 3300038443 | Bacteria | 9710 |
| 681 | Ga0395901_0076417 | 3300038443 | Bacteria | 3494 |
| 682 | Ga0436365_0256340 | 3300039437 | Bacteria | 1582 |
| 683 | Ga0436365_0627243 | 3300039437 | Bacteria | 2814 |
| 684 | Ga0436365_1226979 | 3300039437 | Bacteria | 1194 |
| 685 | Ga0436365_1300190 | 3300039437 | Bacteria | 2823 |
| 686 | Ga0436361_0265242 | 3300039447 | Bacteria | 3580 |
| 687 | Ga0436363_0687569 | 3300039450 | Bacteria | 1680 |
| 688 | Ga0436363_1579678 | 3300039450 | Bacteria | 2239 |
| 689 | Ga0436362_0328324 | 3300039453 | Bacteria | 3150 |
| 690 | Ga0451795_1119810 | 3300041456 | Bacteria | 1285 |
| 691 | Ga0451833_0873998 | 3300041491 | Bacteria | 1105 |
| 692 | Ga0451833_1242256 | 3300041491 | Bacteria | 1119 |
| 693 | Ga0439431_0024303 | 3300041997 | Bacteria | 1473 |
| 694 | Ga0466969_0045804 | 3300044656 | Bacteria | 2170 |
| 695 | Ga0466969_0082145 | 3300044656 | Bacteria | 1536 |
| 696 | Ga0466972_0000325 | 3300044658 | Bacteria | 26886 |
| 697 | Ga0466972_0028367 | 3300044658 | Bacteria | 2761 |
| 698 | Ga0466965_0019908 | 3300044683 | Bacteria | 3222 |
| 699 | Ga0466965_0103075 | 3300044683 | Bacteria | 1460 |
| 700 | Ga0466966_0012258 | 3300044684 | Bacteria | 5680 |
| 701 | Ga0466966_0279073 | 3300044684 | Bacteria | 1005 |
| 702 | Ga0466961_0000132 | 3300044693 | Bacteria | 49595 |
| 703 | Ga0466963_0021127 | 3300044694 | Bacteria | 4102 |
| 704 | Ga0466963_0191347 | 3300044694 | Bacteria | 1429 |
| 705 | Ga0466963_0226529 | 3300044694 | Bacteria | 1310 |
| 706 | Ga0466964_0076952 | 3300044706 | Bacteria | 1424 |
| 707 | Ga0466968_0004242 | 3300044735 | Bacteria | 5346 |
| 708 | Ga0466968_0100958 | 3300044735 | Bacteria | 1288 |
| 709 | Ga0466957_0108073 | 3300044842 | Bacteria | 1761 |
| 710 | Ga0466957_0129569 | 3300044842 | Bacteria | 1615 |
| 711 | Ga0466957_0305128 | 3300044842 | Bacteria | 1070 |
| 712 | Ga0466960_0007335 | 3300044901 | Bacteria | 4474 |
| 713 | Ga0466959_0000295 | 3300045049 | Bacteria | 29676 |
| 714 | Ga0466958_0155219 | 3300045836 | Bacteria | 1445 |
| 715 | Ga0466967_0057490 | 3300045976 | Bacteria | 3434 |
| 716 | Ga0466967_0073807 | 3300045976 | Bacteria | 3061 |
| 717 | Ga0495617_080445 | 3300046452 | Bacteria | 1067 |
| 718 | Ga0495592_0000427 | 3300046454 | Bacteria | 31839 |
| 719 | Ga0495592_0003354 | 3300046454 | Bacteria | 11465 |
| 720 | Ga0495592_0018326 | 3300046454 | Bacteria | 5322 |
| 721 | Ga0495592_0023956 | 3300046454 | Bacteria | 4643 |
| 722 | Ga0495592_0102690 | 3300046454 | Bacteria | 2035 |
| 723 | Ga0495603_0000040 | 3300046455 | Bacteria | 55056 |
| 724 | Ga0495603_0002873 | 3300046455 | Bacteria | 10184 |
| 725 | Ga0495603_0044454 | 3300046455 | Bacteria | 2650 |
| 726 | Ga0495603_0099998 | 3300046455 | Bacteria | 1693 |
| 727 | Ga0495603_0190516 | 3300046455 | Bacteria | 1186 |
| 728 | Ga0495603_0216223 | 3300046455 | Bacteria | 1106 |
| 729 | Ga0495603_0251742 | 3300046455 | Bacteria | 1017 |
| 730 | Ga0495590_0052477 | 3300046457 | Bacteria | 1424 |
| 731 | Ga0495590_0106077 | 3300046457 | Bacteria | 1001 |
| 732 | Ga0495590_0121834 | 3300046457 | Bacteria | 935 |
| 733 | Ga0495629_0000077 | 3300046459 | Bacteria | 85931 |
| 734 | Ga0495629_0000188 | 3300046459 | Bacteria | 56009 |
| 735 | Ga0495629_0023257 | 3300046459 | Bacteria | 4416 |
| 736 | Ga0495629_0035376 | 3300046459 | Bacteria | 3530 |
| 737 | Ga0495629_0203859 | 3300046459 | Bacteria | 1367 |
| 738 | Ga0495638_0013009 | 3300046460 | Bacteria | 5682 |
| 739 | Ga0495638_0015053 | 3300046460 | Bacteria | 5206 |
| 740 | Ga0495638_0067522 | 3300046460 | Bacteria | 2195 |
| 741 | Ga0495638_0090254 | 3300046460 | Bacteria | 1847 |
| 742 | Ga0495641_0056940 | 3300046461 | Bacteria | 1771 |
| 743 | Ga0495651_0000271 | 3300046462 | Bacteria | 40231 |
| 744 | Ga0495651_0023165 | 3300046462 | Bacteria | 4829 |
| 745 | Ga0495651_0023797 | 3300046462 | Bacteria | 4763 |
| 746 | Ga0495651_0094524 | 3300046462 | Bacteria | 2237 |
| 747 | Ga0495651_0221858 | 3300046462 | Bacteria | 1308 |
| 748 | Ga0495653_0004244 | 3300046463 | Bacteria | 11611 |
| 749 | Ga0495580_0003456 | 3300046472 | Bacteria | 13444 |
| 750 | Ga0495580_0004422 | 3300046472 | Bacteria | 11810 |
| 751 | Ga0495582_0000020 | 3300046473 | Bacteria | 88349 |
| 752 | Ga0495582_0116035 | 3300046473 | Bacteria | 1506 |
| 753 | Ga0495582_0178813 | 3300046473 | Bacteria | 1208 |
| 754 | Ga0495582_0339855 | 3300046473 | Bacteria | 864 |
| 755 | Ga0495639_0000011 | 3300046475 | Bacteria | 92268 |
| 756 | Ga0495639_0020094 | 3300046475 | Bacteria | 2917 |
| 757 | Ga0495639_0035199 | 3300046475 | Bacteria | 2240 |
| 758 | Ga0495639_0115148 | 3300046475 | Bacteria | 1279 |
| 759 | Ga0495639_0178164 | 3300046475 | Bacteria | 1034 |
| 760 | Ga0495662_0000229 | 3300046476 | Bacteria | 23341 |
| 761 | Ga0495664_0026796 | 3300046477 | Bacteria | 3358 |
| 762 | Ga0495664_0028905 | 3300046477 | Bacteria | 3239 |
| 763 | Ga0495664_0054228 | 3300046477 | Bacteria | 2384 |
| 764 | Ga0495584_0110989 | 3300046491 | Bacteria | 1387 |
| 765 | Ga0495594_0002423 | 3300046499 | Bacteria | 9715 |
| 766 | Ga0495594_0073656 | 3300046499 | Bacteria | 1901 |
| 767 | Ga0495594_0257420 | 3300046499 | Bacteria | 994 |
| 768 | Ga0495607_0039575 | 3300046501 | Bacteria | 2815 |
| 769 | Ga0495606_0013074 | 3300046507 | Bacteria | 6594 |
| 770 | Ga0495606_0031762 | 3300046507 | Bacteria | 3666 |
| 771 | Ga0495606_0032446 | 3300046507 | Bacteria | 3617 |
| 772 | Ga0495606_0038960 | 3300046507 | Bacteria | 3210 |
| 773 | Ga0495606_0095217 | 3300046507 | Bacteria | 1824 |
| 774 | Ga0495606_0138160 | 3300046507 | Bacteria | 1441 |
| 775 | Ga0495608_0006190 | 3300046511 | Bacteria | 8495 |
| 776 | Ga0495608_0026863 | 3300046511 | Bacteria | 3921 |
| 777 | Ga0495610_0029681 | 3300046512 | Bacteria | 2876 |
| 778 | Ga0495616_0061165 | 3300046513 | Bacteria | 1847 |
| 779 | Ga0495618_0049300 | 3300046514 | Bacteria | 2659 |
| 780 | Ga0495618_0112657 | 3300046514 | Bacteria | 1742 |
| 781 | Ga0495618_0366707 | 3300046514 | Bacteria | 885 |
| 782 | Ga0495620_0073293 | 3300046515 | Bacteria | 1396 |
| 783 | Ga0495620_0104330 | 3300046515 | Bacteria | 1128 |
| 784 | Ga0495628_0047293 | 3300046516 | Bacteria | 3414 |
| 785 | Ga0495630_0005419 | 3300046517 | Bacteria | 9006 |
| 786 | Ga0495630_0049964 | 3300046517 | Bacteria | 3129 |
| 787 | Ga0495630_0175759 | 3300046517 | Bacteria | 1632 |
| 788 | Ga0495631_0078206 | 3300046518 | Bacteria | 1428 |
| 789 | Ga0495632_0004752 | 3300046519 | Bacteria | 9159 |
| 790 | Ga0495632_0102048 | 3300046519 | Bacteria | 1351 |
| 791 | Ga0495632_0177113 | 3300046519 | Bacteria | 978 |
| 792 | Ga0495643_0024447 | 3300046522 | Bacteria | 3426 |
| 793 | Ga0495643_0063870 | 3300046522 | Bacteria | 1946 |
| 794 | Ga0495644_0049431 | 3300046523 | Bacteria | 1578 |
| 795 | Ga0495648_0068085 | 3300046524 | Bacteria | 2079 |
| 796 | Ga0495648_0068596 | 3300046524 | Bacteria | 2067 |
| 797 | Ga0495648_0151206 | 3300046524 | Bacteria | 1211 |
| 798 | Ga0495663_0047497 | 3300046525 | Bacteria | 1322 |
| 799 | Ga0495652_0004764 | 3300046529 | Bacteria | 12908 |
| 800 | Ga0495652_0055109 | 3300046529 | Bacteria | 3382 |
| 801 | Ga0495652_0059496 | 3300046529 | Bacteria | 3232 |
| 802 | Ga0495652_0295207 | 3300046529 | Bacteria | 1181 |
| 803 | Ga0495665_0000133 | 3300046531 | Bacteria | 35771 |
| 804 | Ga0495640_0010408 | 3300046533 | Bacteria | 7193 |
| 805 | Ga0495640_0031699 | 3300046533 | Bacteria | 3770 |
| 806 | Ga0495587_0044816 | 3300046536 | Bacteria | 2630 |
| 807 | Ga0495587_0076333 | 3300046536 | Bacteria | 1946 |
| 808 | Ga0495598_0009153 | 3300046537 | Bacteria | 2331 |
| 809 | Ga0495609_0064709 | 3300046538 | Bacteria | 1613 |
| 810 | Ga0495597_0012214 | 3300046542 | Bacteria | 4151 |
| 811 | Ga0495597_0057617 | 3300046542 | Bacteria | 1699 |
| 812 | Ga0495645_0008894 | 3300046543 | Bacteria | 7016 |
| 813 | Ga0495645_0013345 | 3300046543 | Bacteria | 5807 |
| 814 | Ga0495645_0037041 | 3300046543 | Bacteria | 3555 |
| 815 | Ga0495645_0261797 | 3300046543 | Bacteria | 1145 |
| 816 | Ga0495622_0006251 | 3300046557 | Bacteria | 5528 |
| 817 | Ga0495622_0008052 | 3300046557 | Bacteria | 4886 |
| 818 | Ga0495622_0037306 | 3300046557 | Bacteria | 2265 |
| 819 | Ga0495622_0085745 | 3300046557 | Bacteria | 1448 |
| 820 | Ga0495622_0170975 | 3300046557 | Bacteria | 977 |
| 821 | Ga0495633_0125707 | 3300046558 | Bacteria | 1187 |
| 822 | Ga0495667_0010094 | 3300046559 | Bacteria | 6395 |
| 823 | Ga0495668_0010958 | 3300046616 | Bacteria | 5457 |
| 824 | Ga0495668_0032597 | 3300046616 | Bacteria | 2930 |
| 825 | Ga0495668_0036598 | 3300046616 | Bacteria | 2750 |
| 826 | Ga0495668_0038869 | 3300046616 | Bacteria | 2658 |
| 827 | Ga0495668_0128180 | 3300046616 | Bacteria | 1389 |
| 828 | Ga0495634_0000402 | 3300046642 | Bacteria | 42617 |
| 829 | Ga0495634_0009196 | 3300046642 | Bacteria | 7295 |
| 830 | Ga0495634_0047380 | 3300046642 | Bacteria | 2897 |
| 831 | Ga0495634_0337562 | 3300046642 | Bacteria | 904 |
| 832 | Ga0495611_0033915 | 3300046648 | Bacteria | 2254 |
| 833 | Ga0495611_0086132 | 3300046648 | Bacteria | 1449 |
| 834 | Ga0495625_0031796 | 3300046660 | Bacteria | 3922 |
| 835 | Ga0495635_0000196 | 3300046663 | Bacteria | 38194 |
| 836 | Ga0495635_0012249 | 3300046663 | Bacteria | 6009 |
| 837 | Ga0495635_0015570 | 3300046663 | Bacteria | 5315 |
| 838 | Ga0495635_0066323 | 3300046663 | Bacteria | 2476 |
| 839 | Ga0495635_0084244 | 3300046663 | Bacteria | 2175 |
| 840 | Ga0495635_0086822 | 3300046663 | Bacteria | 2141 |
| 841 | Ga0495661_0033831 | 3300046665 | Bacteria | 3221 |
| 842 | Ga0495661_0134673 | 3300046665 | Bacteria | 1350 |
| 843 | Ga0495588_0001382 | 3300046674 | Bacteria | 10366 |
| 844 | Ga0495588_0015223 | 3300046674 | Bacteria | 3697 |
| 845 | Ga0495657_0001347 | 3300046675 | Bacteria | 21368 |
| 846 | Ga0495657_0003332 | 3300046675 | Bacteria | 13159 |
| 847 | Ga0495657_0130252 | 3300046675 | Bacteria | 1576 |
| 848 | Ga0495599_0019003 | 3300046678 | Bacteria | 4284 |
| 849 | Ga0495623_0004419 | 3300046679 | Bacteria | 9239 |
| 850 | Ga0495623_0104712 | 3300046679 | Bacteria | 1720 |
| 851 | Ga0495623_0213024 | 3300046679 | Bacteria | 1105 |
| 852 | Ga0495646_0025141 | 3300046680 | Bacteria | 3747 |
| 853 | Ga0495646_0043300 | 3300046680 | Bacteria | 2758 |
| 854 | Ga0495646_0044961 | 3300046680 | Bacteria | 2698 |
| 855 | Ga0495646_0053965 | 3300046680 | Bacteria | 2420 |
| 856 | Ga0495646_0111070 | 3300046680 | Bacteria | 1561 |
| 857 | Ga0495647_0010003 | 3300046681 | Bacteria | 3223 |
| 858 | Ga0495647_0147740 | 3300046681 | Bacteria | 1006 |
| 859 | Ga0495658_0000538 | 3300046683 | Bacteria | 20615 |
| 860 | Ga0495658_0019954 | 3300046683 | Bacteria | 3507 |
| 861 | Ga0495658_0167147 | 3300046683 | Bacteria | 1360 |
| 862 | Ga0495669_0105085 | 3300046684 | Bacteria | 1314 |
| 863 | Ga0495613_0000873 | 3300046689 | Bacteria | 23135 |
| 864 | Ga0495613_0027935 | 3300046689 | Bacteria | 4200 |
| 865 | Ga0495613_0211710 | 3300046689 | Bacteria | 1363 |
| 866 | Ga0495624_0000819 | 3300046690 | Bacteria | 24553 |
| 867 | Ga0495624_0044349 | 3300046690 | Bacteria | 2835 |
| 868 | Ga0495670_0087015 | 3300046691 | Bacteria | 1596 |
| 869 | Ga0495649_0002961 | 3300046694 | Bacteria | 11698 |
| 870 | Ga0495649_0040650 | 3300046694 | Bacteria | 2545 |
| 871 | Ga0495649_0056075 | 3300046694 | Bacteria | 2128 |
| 872 | Ga0495649_0087122 | 3300046694 | Bacteria | 1666 |
| 873 | Ga0495649_0120220 | 3300046694 | Bacteria | 1389 |
| 874 | Ga0495600_0001932 | 3300046809 | Bacteria | 11640 |
| 875 | Ga0495600_0012427 | 3300046809 | Bacteria | 5323 |
| 876 | Ga0495600_0030740 | 3300046809 | Bacteria | 3478 |
| 877 | Ga0495600_0099306 | 3300046809 | Bacteria | 1897 |
| 878 | Ga0495581_0000518 | 3300047315 | Bacteria | 19734 |
| 879 | Ga0495581_0007817 | 3300047315 | Bacteria | 6192 |
| 880 | Ga0495581_0194108 | 3300047315 | Bacteria | 1188 |
| 881 | Ga0495581_0428433 | 3300047315 | Bacteria | 771 |
| 882 | Ga0495604_0002485 | 3300047317 | Bacteria | 14722 |
| 883 | Ga0495604_0004984 | 3300047317 | Bacteria | 10513 |
| 884 | Ga0495604_0020026 | 3300047317 | Bacteria | 5346 |
| 885 | Ga0495604_0173157 | 3300047317 | Bacteria | 1516 |
| 886 | Ga0495604_0305358 | 3300047317 | Bacteria | 1068 |
| 887 | Ga0495604_0340537 | 3300047317 | Bacteria | 998 |
| 888 | Ga0495674_0001070 | 3300047319 | Bacteria | 26357 |
| 889 | Ga0495674_0013696 | 3300047319 | Bacteria | 7618 |
| 890 | Ga0495674_0041838 | 3300047319 | Bacteria | 4090 |
| 891 | Ga0495674_0066903 | 3300047319 | Bacteria | 3115 |
| 892 | Ga0495674_0141255 | 3300047319 | Bacteria | 2024 |
| 893 | Ga0495672_0012004 | 3300047320 | Bacteria | 6068 |
| 894 | Ga0495676_0033175 | 3300047321 | Bacteria | 4351 |
| 895 | Ga0495676_0072590 | 3300047321 | Bacteria | 2642 |
| 896 | Ga0495676_0080565 | 3300047321 | Bacteria | 2472 |
| 897 | Ga0495676_0175077 | 3300047321 | Bacteria | 1507 |
| 898 | Ga0495676_0206670 | 3300047321 | Bacteria | 1361 |
| 899 | Ga0495676_0214251 | 3300047321 | Bacteria | 1331 |
| 900 | Ga0495680_0001198 | 3300047322 | Bacteria | 28460 |
| 901 | Ga0495680_0013711 | 3300047322 | Bacteria | 7055 |
| 902 | Ga0495680_0114735 | 3300047322 | Bacteria | 1993 |
| 903 | Ga0495680_0189206 | 3300047322 | Bacteria | 1481 |
| 904 | Ga0495683_0021057 | 3300047323 | Bacteria | 3361 |
| 905 | Ga0495687_001232 | 3300047443 | Bacteria | 24482 |
| 906 | Ga0495687_014924 | 3300047443 | Bacteria | 3970 |
| 907 | Ga0495687_024789 | 3300047443 | Bacteria | 2845 |
| 908 | Ga0495675_0000638 | 3300047444 | Bacteria | 22292 |
| 909 | Ga0495675_0003907 | 3300047444 | Bacteria | 9025 |
| 910 | Ga0495673_0029213 | 3300047469 | Bacteria | 2604 |
| 911 | Ga0495673_0113117 | 3300047469 | Bacteria | 1083 |
| 912 | Ga0495673_0153407 | 3300047469 | Bacteria | 889 |
| 913 | Ga0495684_0000068 | 3300047471 | Bacteria | 70808 |
| 914 | Ga0495684_0025140 | 3300047471 | Bacteria | 4579 |
| 915 | Ga0495684_0063761 | 3300047471 | Bacteria | 2801 |
| 916 | Ga0495686_0057283 | 3300047472 | Bacteria | 2433 |
| 917 | Ga0495686_0082404 | 3300047472 | Bacteria | 1963 |
| 918 | Ga0495593_0000006 | 3300047673 | Bacteria | 90370 |
| 919 | Ga0495593_0007104 | 3300047673 | Bacteria | 6565 |
| 920 | Ga0495593_0158014 | 3300047673 | Bacteria | 1145 |
| 921 | Ga0495602_0001578 | 3300048088 | Bacteria | 22679 |
| 922 | Ga0495602_0029704 | 3300048088 | Bacteria | 5197 |
| 923 | Ga0495626_0067645 | 3300048091 | Bacteria | 1613 |
| 924 | Ga0496100_0033217 | 3300048903 | Bacteria | 3227 |
| 925 | Ga0496100_0066259 | 3300048903 | Bacteria | 2395 |
| 926 | Ga0496100_0564919 | 3300048903 | Bacteria | 881 |
| 927 | Ga0496101_0173551 | 3300048904 | Bacteria | 1657 |
| 928 | Ga0496101_0247703 | 3300048904 | Bacteria | 1388 |
| 929 | Ga0496101_0283463 | 3300048904 | Bacteria | 1295 |
| 930 | Ga0496102_0003559 | 3300048905 | Bacteria | 13195 |
| 931 | Ga0496102_0036626 | 3300048905 | Bacteria | 4421 |
| 932 | Ga0496102_0056022 | 3300048905 | Bacteria | 3595 |
| 933 | Ga0496102_0080549 | 3300048905 | Bacteria | 3000 |
| 934 | Ga0496102_0124233 | 3300048905 | Bacteria | 2412 |
| 935 | Ga0496103_0018401 | 3300048906 | Bacteria | 4190 |
| 936 | Ga0496103_0030094 | 3300048906 | Bacteria | 3302 |
| 937 | Ga0496104_0001744 | 3300048907 | Bacteria | 18783 |
| 938 | Ga0496104_0078243 | 3300048907 | Bacteria | 3151 |
| 939 | Ga0496104_0422288 | 3300048907 | Bacteria | 1245 |
| 940 | Ga0496105_0002142 | 3300048908 | Bacteria | 14301 |
| 941 | Ga0496105_0011609 | 3300048908 | Bacteria | 6969 |
| 942 | Ga0496105_0138852 | 3300048908 | Bacteria | 2001 |
| 943 | Ga0496105_0197579 | 3300048908 | Bacteria | 1642 |
| 944 | Ga0496106_0006841 | 3300048909 | Bacteria | 8439 |
| 945 | Ga0496106_0032859 | 3300048909 | Bacteria | 3869 |
| 946 | Ga0496106_0044275 | 3300048909 | Bacteria | 3341 |
| 947 | Ga0496107_0005103 | 3300048910 | Bacteria | 8953 |
| 948 | Ga0496107_0013020 | 3300048910 | Bacteria | 5811 |
| 949 | Ga0496107_0157111 | 3300048910 | Bacteria | 1684 |
| 950 | Ga0496107_0418635 | 3300048910 | Bacteria | 996 |
| 951 | Ga0496108_0000259 | 3300048911 | Bacteria | 45599 |
| 952 | Ga0496108_0168440 | 3300048911 | Bacteria | 1894 |
| 953 | Ga0496109_0000250 | 3300048912 | Bacteria | 51687 |
| 954 | Ga0496109_0017185 | 3300048912 | Bacteria | 6335 |
| 955 | Ga0496109_0037911 | 3300048912 | Bacteria | 4356 |
| 956 | Ga0496109_0153338 | 3300048912 | Bacteria | 2158 |
| 957 | Ga0496109_0772365 | 3300048912 | Bacteria | 899 |
| 958 | Ga0496109_0853811 | 3300048912 | Bacteria | 848 |
| 959 | Ga0496110_0037452 | 3300048913 | Bacteria | 4216 |
| 960 | Ga0496110_0080326 | 3300048913 | Bacteria | 2905 |
| 961 | Ga0496110_0465730 | 3300048913 | Bacteria | 1152 |
| 962 | Ga0496111_0020268 | 3300048914 | Bacteria | 4627 |
| 963 | Ga0496111_0176071 | 3300048914 | Bacteria | 1590 |
| 964 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 965 | Ga0496112_0042892 | 3300048915 | Bacteria | 4427 |
| 966 | Ga0496112_0047421 | 3300048915 | Bacteria | 4215 |
| 967 | Ga0496112_0052717 | 3300048915 | Bacteria | 3993 |
| 968 | Ga0496112_0082096 | 3300048915 | Bacteria | 3188 |
| 969 | Ga0496112_0094161 | 3300048915 | Bacteria | 2966 |
| 970 | Ga0496112_0158529 | 3300048915 | Bacteria | 2230 |
| 971 | Ga0496112_0180214 | 3300048915 | Bacteria | 2076 |
| 972 | Ga0496112_0259552 | 3300048915 | Bacteria | 1687 |
| 973 | Ga0496113_0029385 | 3300048916 | Bacteria | 3968 |
| 974 | Ga0496113_0036230 | 3300048916 | Bacteria | 3613 |
| 975 | Ga0496113_0059155 | 3300048916 | Bacteria | 2886 |
| 976 | Ga0496113_0081737 | 3300048916 | Bacteria | 2477 |
| 977 | Ga0496113_0106353 | 3300048916 | Bacteria | 2179 |
| 978 | Ga0496114_0053748 | 3300048917 | Bacteria | 3357 |
| 979 | Ga0496114_0135248 | 3300048917 | Bacteria | 2131 |
| 980 | Ga0496114_0143156 | 3300048917 | Bacteria | 2071 |
| 981 | Ga0496114_0225884 | 3300048917 | Bacteria | 1644 |
| 982 | Ga0496114_0512394 | 3300048917 | Bacteria | 1061 |
| 983 | Ga0496115_0003885 | 3300048918 | Bacteria | 10774 |
| 984 | Ga0496115_0015437 | 3300048918 | Bacteria | 5794 |
| 985 | Ga0496115_0040567 | 3300048918 | Bacteria | 3702 |
| 986 | Ga0496115_0067618 | 3300048918 | Bacteria | 2890 |
| 987 | Ga0496115_0129606 | 3300048918 | Bacteria | 2079 |
| 988 | Ga0496115_0276809 | 3300048918 | Bacteria | 1378 |
| 989 | Ga0496116_0001079 | 3300048919 | Bacteria | 32822 |
| 990 | Ga0496116_0027016 | 3300048919 | Bacteria | 4183 |
| 991 | Ga0496116_0251187 | 3300048919 | Bacteria | 880 |
| 992 | Ga0496117_0054193 | 3300048920 | Bacteria | 2811 |
| 993 | Ga0496117_0062441 | 3300048920 | Bacteria | 2553 |
| 994 | Ga0496117_0087241 | 3300048920 | Bacteria | 2023 |
| 995 | Ga0496117_0126045 | 3300048920 | Bacteria | 1562 |
| 996 | Ga0496118_0036913 | 3300048921 | Bacteria | 3942 |
| 997 | Ga0496118_0047345 | 3300048921 | Bacteria | 3333 |
| 998 | Ga0496118_0075692 | 3300048921 | Bacteria | 2399 |
| 999 | Ga0496118_0084124 | 3300048921 | Bacteria | 2221 |
| 1000 | Ga0496118_0156068 | 3300048921 | Bacteria | 1419 |
| 1001 | Ga0496118_0236065 | 3300048921 | Bacteria | 1051 |
| 1002 | Ga0496118_0273118 | 3300048921 | Bacteria | 946 |
| 1003 | Ga0496119_0020449 | 3300048922 | Bacteria | 4831 |
| 1004 | Ga0496119_0042028 | 3300048922 | Bacteria | 2903 |
| 1005 | Ga0496119_0113111 | 3300048922 | Bacteria | 1503 |
| 1006 | Ga0496120_0009024 | 3300048923 | Bacteria | 7126 |
| 1007 | Ga0496120_0103135 | 3300048923 | Bacteria | 1503 |
| 1008 | Ga0496121_0001488 | 3300048924 | Bacteria | 39493 |
| 1009 | Ga0496121_0002000 | 3300048924 | Bacteria | 32381 |
| 1010 | Ga0496121_0011984 | 3300048924 | Bacteria | 9533 |
| 1011 | Ga0496121_0014293 | 3300048924 | Bacteria | 8440 |
| 1012 | Ga0496121_0025495 | 3300048924 | Bacteria | 5607 |
| 1013 | Ga0496121_0031812 | 3300048924 | Bacteria | 4812 |
| 1014 | Ga0496121_0044119 | 3300048924 | Bacteria | 3851 |
| 1015 | Ga0496121_0060417 | 3300048924 | Bacteria | 3117 |
| 1016 | Ga0496121_0108498 | 3300048924 | Bacteria | 2123 |
| 1017 | Ga0496121_0108787 | 3300048924 | Bacteria | 2120 |
| 1018 | Ga0496121_0111529 | 3300048924 | Bacteria | 2085 |
| 1019 | Ga0496121_0280319 | 3300048924 | Bacteria | 1140 |
| 1020 | Ga0496121_0300571 | 3300048924 | Bacteria | 1089 |
| 1021 | Ga0496122_0073748 | 3300048925 | Bacteria | 2418 |
| 1022 | Ga0496123_0044032 | 3300048926 | Bacteria | 3056 |
| 1023 | Ga0496124_0037607 | 3300048927 | Bacteria | 4208 |
| 1024 | Ga0496124_0069807 | 3300048927 | Bacteria | 2916 |
| 1025 | Ga0496124_0221658 | 3300048927 | Bacteria | 1422 |
| 1026 | Ga0496124_0392713 | 3300048927 | Bacteria | 966 |
| 1027 | Ga0496125_0010421 | 3300048928 | Bacteria | 9405 |
| 1028 | Ga0496125_0018563 | 3300048928 | Bacteria | 6603 |
| 1029 | Ga0496125_0045725 | 3300048928 | Bacteria | 3680 |
| 1030 | Ga0496125_0048379 | 3300048928 | Bacteria | 3547 |
| 1031 | Ga0496125_0103617 | 3300048928 | Bacteria | 2087 |
| 1032 | Ga0496125_0272671 | 3300048928 | Bacteria | 1053 |
| 1033 | Ga0496125_0317897 | 3300048928 | Bacteria | 945 |
| 1034 | Ga0496126_0005288 | 3300048929 | Bacteria | 14814 |
| 1035 | Ga0496126_0005411 | 3300048929 | Bacteria | 14568 |
| 1036 | Ga0496126_0006081 | 3300048929 | Bacteria | 13538 |
| 1037 | Ga0496126_0020645 | 3300048929 | Bacteria | 6452 |
| 1038 | Ga0496126_0027556 | 3300048929 | Bacteria | 5425 |
| 1039 | Ga0496126_0032207 | 3300048929 | Bacteria | 4941 |
| 1040 | Ga0496126_0080738 | 3300048929 | Bacteria | 2877 |
| 1041 | Ga0496126_0109374 | 3300048929 | Bacteria | 2409 |
| 1042 | Ga0496126_0119862 | 3300048929 | Bacteria | 2283 |
| 1043 | Ga0496126_0122534 | 3300048929 | Bacteria | 2253 |
| 1044 | Ga0496126_0135001 | 3300048929 | Bacteria | 2129 |
| 1045 | Ga0496126_0200005 | 3300048929 | Bacteria | 1688 |
| 1046 | Ga0496126_0240653 | 3300048929 | Bacteria | 1512 |
| 1047 | Ga0496126_0247534 | 3300048929 | Bacteria | 1486 |
| 1048 | Ga0496126_0296031 | 3300048929 | Bacteria | 1337 |
| 1049 | Ga0496126_0437355 | 3300048929 | Bacteria | 1055 |
| 1050 | Ga0501032_0000392 | 3300049569 | Bacteria | 36103 |
| 1051 | Ga0501032_0205166 | 3300049569 | Bacteria | 1286 |
| 1052 | Ga0501033_0000232 | 3300049570 | Bacteria | 53703 |
| 1053 | Ga0501033_0019714 | 3300049570 | Bacteria | 5097 |
| 1054 | Ga0501034_0000704 | 3300049571 | Bacteria | 50735 |
| 1055 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 1056 | Ga0501036_0612326 | 3300049572 | Bacteria | 903 |
| 1057 | Ga0501037_0000066 | 3300049573 | Bacteria | 96723 |
| 1058 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 1059 | Ga0501038_0043211 | 3300049574 | Bacteria | 3920 |
| 1060 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 1061 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 1062 | Ga0501043_0063197 | 3300049579 | Bacteria | 2907 |
| 1063 | Ga0501046_0000147 | 3300049580 | Bacteria | 74186 |
| 1064 | Ga0501046_0152222 | 3300049580 | Bacteria | 1745 |
| 1065 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 1066 | Ga0501047_0323939 | 3300049581 | Bacteria | 1380 |
| 1067 | Ga0501048_0000460 | 3300049582 | Bacteria | 28509 |
| 1068 | Ga0501068_0000569 | 3300049584 | Bacteria | 18796 |
| 1069 | Ga0501069_0060551 | 3300049585 | Bacteria | 2113 |
| 1070 | Ga0501070_0000163 | 3300049586 | Bacteria | 60911 |
| 1071 | Ga0501070_0071782 | 3300049586 | Bacteria | 2866 |
| 1072 | Ga0501071_0108835 | 3300049587 | Bacteria | 2047 |
| 1073 | Ga0501072_0026856 | 3300049588 | Bacteria | 4492 |
| 1074 | Ga0501073_0000070 | 3300049589 | Bacteria | 63026 |
| 1075 | Ga0501076_0267228 | 3300049592 | Bacteria | 1400 |
| 1076 | Ga0501079_0132167 | 3300049741 | Bacteria | 1942 |
| 1077 | Ga0501080_0000137 | 3300049742 | Bacteria | 51355 |
| 1078 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 1079 | Ga0501035_0064059 | 3300049822 | Bacteria | 3268 |
| 1080 | Ga0501044_0000366 | 3300049823 | Bacteria | 56832 |
| 1081 | Ga0501045_0062432 | 3300049824 | Bacteria | 2734 |
| 1082 | nmdc:mga03683_73217_c1 | 3300050489 | Bacteria | 1468 |
| 1083 | nmdc:mga03n38_4598_c1 | 3300050490 | Bacteria | 4593 |
| 1084 | nmdc:mga03n38_55100_c1 | 3300050490 | Bacteria | 1790 |
| 1085 | nmdc:mga03n38_7548_c1 | 3300050490 | Bacteria | 3853 |
| 1086 | nmdc:mga00v17_128981_c1 | 3300050491 | Bacteria | 1615 |
| 1087 | nmdc:mga00v17_155175_c1 | 3300050491 | Bacteria | 1472 |
| 1088 | nmdc:mga00v17_208266_c1 | 3300050491 | Bacteria | 1265 |
| 1089 | nmdc:mga00v17_248935_c1 | 3300050491 | Bacteria | 1152 |
| 1090 | nmdc:mga00v17_63217_c1 | 3300050491 | Bacteria | 2279 |
| 1091 | nmdc:mga0yw44_225692_c1 | 3300050492 | Bacteria | 1242 |
| 1092 | nmdc:mga0yw44_277830_c1 | 3300050492 | Bacteria | 1119 |
| 1093 | nmdc:mga0yw44_292175_c1 | 3300050492 | Bacteria | 1091 |
| 1094 | nmdc:mga0yw44_5155_c1 | 3300050492 | Bacteria | 6120 |
| 1095 | nmdc:mga0yw44_51827_c1 | 3300050492 | Bacteria | 2486 |
| 1096 | nmdc:mga0k408_115683_c1 | 3300050493 | Bacteria | 1587 |
| 1097 | nmdc:mga0k408_11676_c1 | 3300050493 | Bacteria | 4788 |
| 1098 | nmdc:mga0k408_13681_c1 | 3300050493 | Bacteria | 4455 |
| 1099 | nmdc:mga0k408_60539_c1 | 3300050493 | Bacteria | 2200 |
| 1100 | nmdc:mga0k408_78691_c1 | 3300050493 | Bacteria | 1929 |
| 1101 | nmdc:mga06z11_10966_c1 | 3300050494 | Bacteria | 3887 |
| 1102 | nmdc:mga06z11_13270_c1 | 3300050494 | Bacteria | 3612 |
| 1103 | nmdc:mga06z11_22394_c1 | 3300050494 | Bacteria | 2950 |
| 1104 | nmdc:mga06z11_256435_c1 | 3300050494 | Bacteria | 1031 |
| 1105 | nmdc:mga06z11_291901_c1 | 3300050494 | Bacteria | 968 |
| 1106 | nmdc:mga06z11_47123_c1 | 3300050494 | Bacteria | 2188 |
| 1107 | nmdc:mga06z11_94523_c1 | 3300050494 | Bacteria | 1629 |
| 1108 | nmdc:mga07m45_108878_c1 | 3300050496 | Bacteria | 1595 |
| 1109 | nmdc:mga07m45_161000_c1 | 3300050496 | Bacteria | 1303 |
| 1110 | nmdc:mga07m45_1793_c1 | 3300050496 | Bacteria | 9881 |
| 1111 | nmdc:mga07m45_28416_c1 | 3300050496 | Bacteria | 3087 |
| 1112 | nmdc:mga07m45_317645_c1 | 3300050496 | Bacteria | 905 |
| 1113 | nmdc:mga07m45_40838_c1 | 3300050496 | Bacteria | 2597 |
| 1114 | nmdc:mga07m45_4531_c1 | 3300050496 | Bacteria | 6807 |
| 1115 | nmdc:mga07m45_75007_c1 | 3300050496 | Bacteria | 1100 |
| 1116 | nmdc:mga07m45_96708_c1 | 3300050496 | Bacteria | 1694 |
| 1117 | nmdc:mga08y16_10722_c1 | 3300050511 | Bacteria | 9617 |
| 1118 | nmdc:mga0n895_407573_c1 | 3300050512 | Bacteria | 1375 |
| 1119 | nmdc:mga0n895_72147_c1 | 3300050512 | Bacteria | 3425 |
| 1120 | nmdc:mga08x19_195522_c1 | 3300050514 | Bacteria | 1385 |
| 1121 | nmdc:mga0sz30_105528_c1 | 3300050516 | Bacteria | 1233 |
| 1122 | nmdc:mga0sz30_22053_c1 | 3300050516 | Bacteria | 2582 |
| 1123 | nmdc:mga0sz30_53428_c1 | 3300050516 | Bacteria | 1717 |
| 1124 | Ga0495601_0166231 | 3300053077 | Bacteria | 1442 |
| 1125 | Ga0495601_0194980 | 3300053077 | Bacteria | 1324 |
| 1126 | Ga0495601_0231003 | 3300053077 | Bacteria | 1208 |
| 1127 | Ga0495601_0246425 | 3300053077 | Bacteria | 1167 |
| 1128 | Ga0495612_0031082 | 3300053078 | Bacteria | 2152 |
| 1129 | Ga0495612_0064504 | 3300053078 | Bacteria | 1520 |
| 1130 | Ga0500610_0189067 | 3300053079 | Bacteria | 1001 |
| 1131 | Ga0500635_0001266 | 3300053080 | Bacteria | 6035 |
| 1132 | Ga0500635_0022379 | 3300053080 | Bacteria | 1959 |
| 1133 | Ga0495595_0011980 | 3300053084 | Bacteria | 3636 |
| 1134 | Ga0495595_0032357 | 3300053084 | Bacteria | 2356 |
| 1135 | Ga0495619_0000829 | 3300053085 | Bacteria | 20282 |
| 1136 | Ga0495619_0039802 | 3300053085 | Bacteria | 3070 |
| 1137 | Ga0495619_0082427 | 3300053085 | Bacteria | 2168 |
| 1138 | Ga0495619_0235638 | 3300053085 | Bacteria | 1268 |
| 1139 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 1140 | Ga0500644_0011509 | 3300053088 | Bacteria | 2419 |
| 1141 | Ga0500644_0015403 | 3300053088 | Bacteria | 2179 |
| 1142 | Ga0500581_036511 | 3300053089 | Bacteria | 2517 |
| 1143 | Ga0500647_0005637 | 3300053091 | Bacteria | 5214 |
| 1144 | Ga0500647_0043590 | 3300053091 | Bacteria | 2153 |
| 1145 | Ga0500583_0136253 | 3300053092 | Bacteria | 1219 |
| 1146 | Ga0500651_0043032 | 3300053093 | Bacteria | 2844 |
| 1147 | Ga0500651_0127694 | 3300053093 | Bacteria | 1539 |
| 1148 | Ga0500651_0136342 | 3300053093 | Bacteria | 1482 |
| 1149 | Ga0500651_0290095 | 3300053093 | Bacteria | 941 |
| 1150 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 1151 | Ga0500566_0000479 | 3300053094 | Bacteria | 22269 |
| 1152 | Ga0500566_0001303 | 3300053094 | Bacteria | 14556 |
| 1153 | Ga0500566_0007953 | 3300053094 | Bacteria | 6275 |
| 1154 | Ga0500640_011315 | 3300053095 | Bacteria | 3633 |
| 1155 | Ga0500641_0005452 | 3300053096 | Bacteria | 4510 |
| 1156 | Ga0500641_0006170 | 3300053096 | Bacteria | 4249 |
| 1157 | Ga0500641_0015386 | 3300053096 | Bacteria | 2838 |
| 1158 | Ga0500650_0011529 | 3300053098 | Bacteria | 3643 |
| 1159 | Ga0500650_0155760 | 3300053098 | Bacteria | 1055 |
| 1160 | Ga0500555_005858 | 3300053103 | Bacteria | 3486 |
| 1161 | Ga0500555_068946 | 3300053103 | Bacteria | 937 |
| 1162 | Ga0500556_0000093 | 3300053104 | Bacteria | 82933 |
| 1163 | Ga0500556_0003091 | 3300053104 | Bacteria | 4974 |
| 1164 | Ga0500556_0122895 | 3300053104 | Bacteria | 1013 |
| 1165 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1166 | Ga0500562_016831 | 3300053108 | Bacteria | 1881 |
| 1167 | Ga0500569_002246 | 3300053109 | Bacteria | 3778 |
| 1168 | Ga0500572_004209 | 3300053111 | Bacteria | 3266 |
| 1169 | Ga0500572_006775 | 3300053111 | Bacteria | 2632 |
| 1170 | Ga0500592_001027 | 3300053116 | Bacteria | 4555 |
| 1171 | Ga0500592_010923 | 3300053116 | Bacteria | 1450 |
| 1172 | Ga0500594_0010492 | 3300053118 | Bacteria | 2152 |
| 1173 | Ga0500594_0015719 | 3300053118 | Bacteria | 1830 |
| 1174 | Ga0500595_000722 | 3300053119 | Bacteria | 19637 |
| 1175 | Ga0500595_001442 | 3300053119 | Bacteria | 12692 |
| 1176 | Ga0500595_004127 | 3300053119 | Bacteria | 6589 |
| 1177 | Ga0500595_009591 | 3300053119 | Bacteria | 3899 |
| 1178 | Ga0500595_042887 | 3300053119 | Bacteria | 1444 |
| 1179 | Ga0500607_050231 | 3300053121 | Bacteria | 2223 |
| 1180 | Ga0500608_013224 | 3300053122 | Bacteria | 3651 |
| 1181 | Ga0500608_018017 | 3300053122 | Bacteria | 3216 |
| 1182 | Ga0500608_021825 | 3300053122 | Bacteria | 2962 |
| 1183 | Ga0500614_007785 | 3300053123 | Bacteria | 2263 |
| 1184 | Ga0500642_0000013 | 3300053130 | Bacteria | 197927 |
| 1185 | Ga0500642_0000114 | 3300053130 | Bacteria | 37434 |
| 1186 | Ga0500642_0057810 | 3300053130 | Bacteria | 1731 |
| 1187 | Ga0500642_0113963 | 3300053130 | Bacteria | 1263 |
| 1188 | Ga0500652_000620 | 3300053131 | Bacteria | 12220 |
| 1189 | Ga0500658_0030098 | 3300053134 | Bacteria | 2115 |
| 1190 | Ga0500559_0000200 | 3300053136 | Bacteria | 47807 |
| 1191 | Ga0500559_0001123 | 3300053136 | Bacteria | 16112 |
| 1192 | Ga0500559_0002307 | 3300053136 | Bacteria | 10015 |
| 1193 | Ga0500561_0021843 | 3300053137 | Bacteria | 1513 |
| 1194 | Ga0500568_0001875 | 3300053139 | Bacteria | 12940 |
| 1195 | Ga0500568_0033785 | 3300053139 | Bacteria | 2096 |
| 1196 | Ga0500568_0040925 | 3300053139 | Bacteria | 1864 |
| 1197 | Ga0500586_004376 | 3300053145 | Bacteria | 3448 |
| 1198 | Ga0500590_049087 | 3300053148 | Bacteria | 2148 |
| 1199 | Ga0500590_136030 | 3300053148 | Bacteria | 1130 |
| 1200 | Ga0500603_000679 | 3300053150 | Bacteria | 8287 |
| 1201 | Ga0500604_0010294 | 3300053151 | Bacteria | 2499 |
| 1202 | Ga0500616_0000288 | 3300053153 | Bacteria | 73364 |
| 1203 | Ga0500616_0062111 | 3300053153 | Bacteria | 1931 |
| 1204 | Ga0500619_013213 | 3300053154 | Bacteria | 2182 |
| 1205 | Ga0500622_0000563 | 3300053156 | Bacteria | 33995 |
| 1206 | Ga0500622_0011755 | 3300053156 | Bacteria | 4758 |
| 1207 | Ga0500622_0061186 | 3300053156 | Bacteria | 1920 |
| 1208 | Ga0500627_0090534 | 3300053158 | Bacteria | 1369 |
| 1209 | Ga0500627_0168144 | 3300053158 | Bacteria | 988 |
| 1210 | Ga0500630_001851 | 3300053159 | Bacteria | 10169 |
| 1211 | Ga0500633_0064731 | 3300053160 | Bacteria | 1293 |
| 1212 | Ga0500634_0047928 | 3300053161 | Bacteria | 2306 |
| 1213 | Ga0500638_072772 | 3300053162 | Bacteria | 1641 |
| 1214 | Ga0500638_161012 | 3300053162 | Bacteria | 988 |
| 1215 | Ga0500639_000099 | 3300053163 | Bacteria | 40200 |
| 1216 | Ga0500636_0001860 | 3300053177 | Bacteria | 11559 |
| 1217 | Ga0500636_0004209 | 3300053177 | Bacteria | 8147 |
| 1218 | Ga0500636_0058733 | 3300053177 | Bacteria | 2248 |
| 1219 | Ga0500636_0071286 | 3300053177 | Bacteria | 2015 |
| 1220 | Ga0500636_0084068 | 3300053177 | Bacteria | 1830 |
| 1221 | Ga0500636_0085612 | 3300053177 | Bacteria | 1811 |
| 1222 | Ga0500636_0101840 | 3300053177 | Bacteria | 1632 |
| 1223 | Ga0500637_0000093 | 3300053178 | Bacteria | 32051 |
| 1224 | Ga0500625_014631 | 3300053729 | Bacteria | 3628 |
| 1225 | Ga0500645_005813 | 3300053730 | Bacteria | 4481 |
| 1226 | Ga0500609_006498 | 3300053731 | Bacteria | 1593 |
| 1227 | Ga0500656_002492 | 3300053732 | Bacteria | 1668 |
| 1228 | Ga0500601_000092 | 3300053737 | Bacteria | 18784 |
| 1229 | Ga0500661_001138 | 3300055283 | Bacteria | 4964 |
| 1230 | Ga0500661_006682 | 3300055283 | Bacteria | 2148 |
| 1231 | Ga0466962_0109112 | 3300061719 | Bacteria | 1332 |
| 1232 | Ga0530510_0125737 | 3300061734 | Bacteria | 1885 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028786 | Ga0307517_10052355 | Ga0307517_100523553 | 213 |
| 2 | 3300047315 | Ga0495581_0428433 | Ga0495581_0428433_92_745 | 215 |
| 3 | 3300053093 | Ga0500651_0290095 | Ga0500651_0290095_12_701 | 227 |
| 4 | 3300014326 | Ga0157380_10001485 | Ga0157380_1000148513 | 229 |
| 5 | 3300046524 | Ga0495648_0151206 | Ga0495648_0151206_304_1002 | 230 |
| 6 | 3300003215 | JGI25153J46596_10001246 | JGI25153J46596_100012465 | 232 |
| 7 | 3300003794 | Ga0055531_10008008 | Ga0055531_100080083 | 232 |
| 8 | 3300003794 | Ga0055531_10013844 | Ga0055531_100138443 | 232 |
| 9 | 3300005262 | Ga0065165_1005514 | Ga0065165_10055143 | 232 |
| 10 | 3300006178 | Ga0075367_10083923 | Ga0075367_100839232 | 232 |
| 11 | 3300006195 | Ga0075366_10219323 | Ga0075366_102193232 | 232 |
| 12 | 3300006353 | Ga0075370_10122359 | Ga0075370_101223592 | 232 |
| 13 | 3300025295 | Ga0209564_1009950 | Ga0209564_10099502 | 232 |
| 14 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011347 | 232 |
| 15 | 3300025299 | Ga0209256_1005335 | Ga0209256_10053352 | 232 |
| 16 | 3300025302 | Ga0207426_1065167 | Ga0207426_10651672 | 232 |
| 17 | 3300025304 | Ga0209257_1006326 | Ga0209257_10063266 | 232 |
| 18 | 3300050493 | nmdc:mga0k408_60539_c1 | nmdc:mga0k408_60539_c1_1113_1895 | 232 |
| 19 | 3300053109 | Ga0500569_002246 | Ga0500569_002246_324_1106 | 232 |
| 20 | 3300005334 | Ga0068869_100220068 | Ga0068869_1002200682 | 233 |
| 21 | 3300005338 | Ga0068868_100132633 | Ga0068868_1001326332 | 233 |
| 22 | 3300005344 | Ga0070661_100219599 | Ga0070661_1002195992 | 233 |
| 23 | 3300005548 | Ga0070665_100015861 | Ga0070665_1000158612 | 233 |
| 24 | 3300005616 | Ga0068852_100115660 | Ga0068852_1001156602 | 233 |
| 25 | 3300005719 | Ga0068861_100488715 | Ga0068861_1004887152 | 233 |
| 26 | 3300005843 | Ga0068860_100358312 | Ga0068860_1003583122 | 233 |
| 27 | 3300005983 | Ga0081540_1003783 | Ga0081540_10037834 | 233 |
| 28 | 3300009098 | Ga0105245_10021491 | Ga0105245_100214913 | 233 |
| 29 | 3300009174 | Ga0105241_10613434 | Ga0105241_106134342 | 233 |
| 30 | 3300009551 | Ga0105238_10846207 | Ga0105238_108462071 | 233 |
| 31 | 3300011119 | Ga0105246_10020341 | Ga0105246_100203411 | 233 |
| 32 | 3300013296 | Ga0157374_10271655 | Ga0157374_102716552 | 233 |
| 33 | 3300013308 | Ga0157375_10058051 | Ga0157375_100580514 | 233 |
| 34 | 3300014745 | Ga0157377_10191461 | Ga0157377_101914612 | 233 |
| 35 | 3300014968 | Ga0157379_10197211 | Ga0157379_101972112 | 233 |
| 36 | 3300014969 | Ga0157376_10072632 | Ga0157376_100726322 | 233 |
| 37 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001742 | 233 |
| 38 | 3300021321 | Ga0214542_1000037 | Ga0214542_1000037127 | 233 |
| 39 | 3300021324 | Ga0214545_1000003 | Ga0214545_100000318 | 233 |
| 40 | 3300021327 | Ga0214543_1003164 | Ga0214543_100316418 | 233 |
| 41 | 3300025253 | Ga0209677_106221 | Ga0209677_1062212 | 233 |
| 42 | 3300025315 | Ga0207697_10076204 | Ga0207697_100762042 | 233 |
| 43 | 3300025901 | Ga0207688_10302558 | Ga0207688_103025582 | 233 |
| 44 | 3300025914 | Ga0207671_10441043 | Ga0207671_104410432 | 233 |
| 45 | 3300025920 | Ga0207649_10505693 | Ga0207649_105056931 | 233 |
| 46 | 3300025923 | Ga0207681_10315252 | Ga0207681_103152522 | 233 |
| 47 | 3300025960 | Ga0207651_10116934 | Ga0207651_101169342 | 233 |
| 48 | 3300026023 | Ga0207677_10197555 | Ga0207677_101975552 | 233 |
| 49 | 3300026075 | Ga0207708_10293111 | Ga0207708_102931112 | 233 |
| 50 | 3300026118 | Ga0207675_100730608 | Ga0207675_1007306082 | 233 |
| 51 | 3300026121 | Ga0207683_10008222 | Ga0207683_100082225 | 233 |
| 52 | 3300026142 | Ga0207698_10148732 | Ga0207698_101487322 | 233 |
| 53 | 3300026142 | Ga0207698_10939462 | Ga0207698_109394621 | 233 |
| 54 | 3300028379 | Ga0268266_10020256 | Ga0268266_100202565 | 233 |
| 55 | 3300028381 | Ga0268264_10142197 | Ga0268264_101421972 | 233 |
| 56 | 3300031507 | Ga0307509_10141416 | Ga0307509_101414162 | 233 |
| 57 | 3300031507 | Ga0307509_10213959 | Ga0307509_102139592 | 233 |
| 58 | 3300031730 | Ga0307516_10370979 | Ga0307516_103709792 | 233 |
| 59 | 3300032126 | Ga0307415_100069816 | Ga0307415_1000698162 | 233 |
| 60 | 3300033180 | Ga0307510_10157707 | Ga0307510_101577072 | 233 |
| 61 | 3300035725 | Ga0373947_0341882 | Ga0373947_0341882_93_875 | 233 |
| 62 | 3300044658 | Ga0466972_0000325 | Ga0466972_0000325_8475_9257 | 233 |
| 63 | 3300044683 | Ga0466965_0019908 | Ga0466965_0019908_815_1597 | 233 |
| 64 | 3300044735 | Ga0466968_0100958 | Ga0466968_0100958_413_1195 | 233 |
| 65 | 3300046455 | Ga0495603_0044454 | Ga0495603_0044454_1786_2568 | 233 |
| 66 | 3300046455 | Ga0495603_0099998 | Ga0495603_0099998_513_1295 | 233 |
| 67 | 3300046455 | Ga0495603_0216223 | Ga0495603_0216223_25_807 | 233 |
| 68 | 3300046459 | Ga0495629_0035376 | Ga0495629_0035376_2374_3156 | 233 |
| 69 | 3300046459 | Ga0495629_0203859 | Ga0495629_0203859_168_950 | 233 |
| 70 | 3300046461 | Ga0495641_0056940 | Ga0495641_0056940_394_1176 | 233 |
| 71 | 3300046473 | Ga0495582_0178813 | Ga0495582_0178813_315_1097 | 233 |
| 72 | 3300046475 | Ga0495639_0115148 | Ga0495639_0115148_453_1235 | 233 |
| 73 | 3300046491 | Ga0495584_0110989 | Ga0495584_0110989_393_1175 | 233 |
| 74 | 3300046507 | Ga0495606_0095217 | Ga0495606_0095217_909_1691 | 233 |
| 75 | 3300046507 | Ga0495606_0138160 | Ga0495606_0138160_380_1162 | 233 |
| 76 | 3300046512 | Ga0495610_0029681 | Ga0495610_0029681_382_1164 | 233 |
| 77 | 3300046518 | Ga0495631_0078206 | Ga0495631_0078206_178_960 | 233 |
| 78 | 3300046538 | Ga0495609_0064709 | Ga0495609_0064709_662_1444 | 233 |
| 79 | 3300046616 | Ga0495668_0010958 | Ga0495668_0010958_4095_4877 | 233 |
| 80 | 3300046663 | Ga0495635_0086822 | Ga0495635_0086822_283_1065 | 233 |
| 81 | 3300046684 | Ga0495669_0105085 | Ga0495669_0105085_378_1160 | 233 |
| 82 | 3300046691 | Ga0495670_0087015 | Ga0495670_0087015_785_1567 | 233 |
| 83 | 3300046694 | Ga0495649_0120220 | Ga0495649_0120220_454_1236 | 233 |
| 84 | 3300047315 | Ga0495581_0194108 | Ga0495581_0194108_43_825 | 233 |
| 85 | 3300047673 | Ga0495593_0158014 | Ga0495593_0158014_138_920 | 233 |
| 86 | 3300048903 | Ga0496100_0564919 | Ga0496100_0564919_17_799 | 233 |
| 87 | 3300048904 | Ga0496101_0173551 | Ga0496101_0173551_675_1457 | 233 |
| 88 | 3300048905 | Ga0496102_0003559 | Ga0496102_0003559_7789_8571 | 233 |
| 89 | 3300048906 | Ga0496103_0030094 | Ga0496103_0030094_1759_2541 | 233 |
| 90 | 3300048908 | Ga0496105_0011609 | Ga0496105_0011609_3472_4254 | 233 |
| 91 | 3300048909 | Ga0496106_0032859 | Ga0496106_0032859_42_824 | 233 |
| 92 | 3300048910 | Ga0496107_0013020 | Ga0496107_0013020_2029_2811 | 233 |
| 93 | 3300048911 | Ga0496108_0168440 | Ga0496108_0168440_571_1353 | 233 |
| 94 | 3300048912 | Ga0496109_0017185 | Ga0496109_0017185_2360_3142 | 233 |
| 95 | 3300048914 | Ga0496111_0020268 | Ga0496111_0020268_2115_2897 | 233 |
| 96 | 3300048915 | Ga0496112_0180214 | Ga0496112_0180214_1094_1876 | 233 |
| 97 | 3300048916 | Ga0496113_0036230 | Ga0496113_0036230_1028_1810 | 233 |
| 98 | 3300048917 | Ga0496114_0053748 | Ga0496114_0053748_1248_2030 | 233 |
| 99 | 3300048918 | Ga0496115_0003885 | Ga0496115_0003885_9972_10754 | 233 |
| 100 | 3300048918 | Ga0496115_0129606 | Ga0496115_0129606_148_930 | 233 |
| 101 | 3300048921 | Ga0496118_0273118 | Ga0496118_0273118_100_882 | 233 |
| 102 | 3300048924 | Ga0496121_0031812 | Ga0496121_0031812_2799_3581 | 233 |
| 103 | 3300048928 | Ga0496125_0272671 | Ga0496125_0272671_30_812 | 233 |
| 104 | 3300048929 | Ga0496126_0005411 | Ga0496126_0005411_2555_3337 | 233 |
| 105 | 3300048929 | Ga0496126_0109374 | Ga0496126_0109374_27_809 | 233 |
| 106 | 3300050489 | nmdc:mga03683_73217_c1 | nmdc:mga03683_73217_c1_182_964 | 233 |
| 107 | 3300050492 | nmdc:mga0yw44_277830_c1 | nmdc:mga0yw44_277830_c1_93_875 | 233 |
| 108 | 3300053080 | Ga0500635_0001266 | Ga0500635_0001266_2997_3779 | 233 |
| 109 | 3300053096 | Ga0500641_0005452 | Ga0500641_0005452_1665_2447 | 233 |
| 110 | 3300053130 | Ga0500642_0057810 | Ga0500642_0057810_509_1291 | 233 |
| 111 | 3300053137 | Ga0500561_0021843 | Ga0500561_0021843_147_929 | 233 |
| 112 | 3300053156 | Ga0500622_0061186 | Ga0500622_0061186_83_865 | 233 |
| 113 | 3300053732 | Ga0500656_002492 | Ga0500656_002492_76_858 | 233 |
| 114 | 3300005329 | Ga0070683_100005150 | Ga0070683_1000051506 | 234 |
| 115 | 3300005329 | Ga0070683_100045815 | Ga0070683_1000458153 | 234 |
| 116 | 3300005336 | Ga0070680_100014277 | Ga0070680_1000142776 | 234 |
| 117 | 3300005336 | Ga0070680_100164630 | Ga0070680_1001646301 | 234 |
| 118 | 3300005337 | Ga0070682_100080829 | Ga0070682_1000808292 | 234 |
| 119 | 3300005337 | Ga0070682_100166017 | Ga0070682_1001660172 | 234 |
| 120 | 3300005338 | Ga0068868_100118384 | Ga0068868_1001183842 | 234 |
| 121 | 3300005344 | Ga0070661_100124364 | Ga0070661_1001243642 | 234 |
| 122 | 3300005434 | Ga0070709_10295482 | Ga0070709_102954822 | 234 |
| 123 | 3300005435 | Ga0070714_100049342 | Ga0070714_1000493422 | 234 |
| 124 | 3300005436 | Ga0070713_100037885 | Ga0070713_1000378853 | 234 |
| 125 | 3300005436 | Ga0070713_100158512 | Ga0070713_1001585121 | 234 |
| 126 | 3300005458 | Ga0070681_10029417 | Ga0070681_100294172 | 234 |
| 127 | 3300005530 | Ga0070679_100079100 | Ga0070679_1000791002 | 234 |
| 128 | 3300005530 | Ga0070679_100228659 | Ga0070679_1002286592 | 234 |
| 129 | 3300005535 | Ga0070684_100003497 | Ga0070684_1000034974 | 234 |
| 130 | 3300005535 | Ga0070684_100417106 | Ga0070684_1004171062 | 234 |
| 131 | 3300005539 | Ga0068853_100459002 | Ga0068853_1004590022 | 234 |
| 132 | 3300005547 | Ga0070693_100169621 | Ga0070693_1001696212 | 234 |
| 133 | 3300005563 | Ga0068855_100051385 | Ga0068855_1000513854 | 234 |
| 134 | 3300005983 | Ga0081540_1019658 | Ga0081540_10196582 | 234 |
| 135 | 3300006237 | Ga0097621_100680899 | Ga0097621_1006808991 | 234 |
| 136 | 3300009093 | Ga0105240_10152628 | Ga0105240_101526282 | 234 |
| 137 | 3300009551 | Ga0105238_10324664 | Ga0105238_103246641 | 234 |
| 138 | 3300009553 | Ga0105249_10680109 | Ga0105249_106801092 | 234 |
| 139 | 3300010375 | Ga0105239_10031497 | Ga0105239_100314976 | 234 |
| 140 | 3300013105 | Ga0157369_10017188 | Ga0157369_100171884 | 234 |
| 141 | 3300013105 | Ga0157369_10039801 | Ga0157369_100398014 | 234 |
| 142 | 3300013307 | Ga0157372_10295020 | Ga0157372_102950202 | 234 |
| 143 | 3300022467 | Ga0224712_10168337 | Ga0224712_101683371 | 234 |
| 144 | 3300025911 | Ga0207654_10144837 | Ga0207654_101448372 | 234 |
| 145 | 3300025912 | Ga0207707_10000378 | Ga0207707_1000037824 | 234 |
| 146 | 3300025912 | Ga0207707_10080028 | Ga0207707_100800282 | 234 |
| 147 | 3300025913 | Ga0207695_10051139 | Ga0207695_100511395 | 234 |
| 148 | 3300025913 | Ga0207695_10322552 | Ga0207695_103225522 | 234 |
| 149 | 3300025914 | Ga0207671_10127093 | Ga0207671_101270932 | 234 |
| 150 | 3300025917 | Ga0207660_10081145 | Ga0207660_100811452 | 234 |
| 151 | 3300025917 | Ga0207660_10148620 | Ga0207660_101486202 | 234 |
| 152 | 3300025920 | Ga0207649_10194117 | Ga0207649_101941172 | 234 |
| 153 | 3300025921 | Ga0207652_10005634 | Ga0207652_100056342 | 234 |
| 154 | 3300025921 | Ga0207652_10205936 | Ga0207652_102059362 | 234 |
| 155 | 3300025924 | Ga0207694_10070032 | Ga0207694_100700322 | 234 |
| 156 | 3300025924 | Ga0207694_10342462 | Ga0207694_103424622 | 234 |
| 157 | 3300025924 | Ga0207694_10583105 | Ga0207694_105831052 | 234 |
| 158 | 3300025928 | Ga0207700_10013002 | Ga0207700_100130023 | 234 |
| 159 | 3300025928 | Ga0207700_10132389 | Ga0207700_101323892 | 234 |
| 160 | 3300025929 | Ga0207664_10040468 | Ga0207664_100404682 | 234 |
| 161 | 3300025944 | Ga0207661_10007635 | Ga0207661_100076357 | 234 |
| 162 | 3300025944 | Ga0207661_10347895 | Ga0207661_103478952 | 234 |
| 163 | 3300026041 | Ga0207639_10107575 | Ga0207639_101075753 | 234 |
| 164 | 3300026041 | Ga0207639_10279803 | Ga0207639_102798032 | 234 |
| 165 | 3300026067 | Ga0207678_10048644 | Ga0207678_100486443 | 234 |
| 166 | 3300026078 | Ga0207702_10088634 | Ga0207702_100886342 | 234 |
| 167 | 3300026078 | Ga0207702_10386413 | Ga0207702_103864131 | 234 |
| 168 | 3300031824 | Ga0307413_10055476 | Ga0307413_100554763 | 234 |
| 169 | 3300031852 | Ga0307410_10109914 | Ga0307410_101099142 | 234 |
| 170 | 3300032005 | Ga0307411_10504635 | Ga0307411_105046351 | 234 |
| 171 | 3300032126 | Ga0307415_100306999 | Ga0307415_1003069992 | 234 |
| 172 | 3300035120 | Ga0373957_0042789 | Ga0373957_0042789_74_856 | 234 |
| 173 | 3300037068 | Ga0373925_0349009 | Ga0373925_0349009_344_1126 | 234 |
| 174 | 3300037418 | Ga0395900_0037891 | Ga0395900_0037891_29_811 | 234 |
| 175 | 3300045976 | Ga0466967_0057490 | Ga0466967_0057490_499_1281 | 234 |
| 176 | 3300046536 | Ga0495587_0076333 | Ga0495587_0076333_833_1615 | 234 |
| 177 | 3300046680 | Ga0495646_0025141 | Ga0495646_0025141_2082_2864 | 234 |
| 178 | 3300048916 | Ga0496113_0106353 | Ga0496113_0106353_17_799 | 234 |
| 179 | 3300048924 | Ga0496121_0300571 | Ga0496121_0300571_228_1010 | 234 |
| 180 | 3300048927 | Ga0496124_0069807 | Ga0496124_0069807_47_829 | 234 |
| 181 | 3300048929 | Ga0496126_0080738 | Ga0496126_0080738_791_1573 | 234 |
| 182 | 3300048929 | Ga0496126_0200005 | Ga0496126_0200005_895_1677 | 234 |
| 183 | 3300049581 | Ga0501047_0323939 | Ga0501047_0323939_284_1066 | 234 |
| 184 | 3300049586 | Ga0501070_0071782 | Ga0501070_0071782_25_807 | 234 |
| 185 | 3300053077 | Ga0495601_0166231 | Ga0495601_0166231_222_1004 | 234 |
| 186 | 3300053096 | Ga0500641_0006170 | Ga0500641_0006170_2300_3082 | 234 |
| 187 | 3300053130 | Ga0500642_0000114 | Ga0500642_0000114_23453_24235 | 234 |
| 188 | 3300003214 | JGI25165J46597_1009845 | JGI25165J46597_10098452 | 235 |
| 189 | 3300003215 | JGI25153J46596_10001884 | JGI25153J46596_100018848 | 235 |
| 190 | 3300003215 | JGI25153J46596_10025964 | JGI25153J46596_100259642 | 235 |
| 191 | 3300005262 | Ga0065165_1004449 | Ga0065165_10044493 | 235 |
| 192 | 3300005331 | Ga0070670_100181651 | Ga0070670_1001816512 | 235 |
| 193 | 3300005347 | Ga0070668_100083103 | Ga0070668_1000831032 | 235 |
| 194 | 3300005347 | Ga0070668_100283446 | Ga0070668_1002834462 | 235 |
| 195 | 3300005347 | Ga0070668_100551240 | Ga0070668_1005512401 | 235 |
| 196 | 3300005355 | Ga0070671_100036506 | Ga0070671_1000365064 | 235 |
| 197 | 3300005455 | Ga0070663_100070451 | Ga0070663_1000704511 | 235 |
| 198 | 3300005456 | Ga0070678_100350850 | Ga0070678_1003508502 | 235 |
| 199 | 3300005458 | Ga0070681_10104881 | Ga0070681_101048812 | 235 |
| 200 | 3300005539 | Ga0068853_100203223 | Ga0068853_1002032231 | 235 |
| 201 | 3300005547 | Ga0070693_100256270 | Ga0070693_1002562702 | 235 |
| 202 | 3300005548 | Ga0070665_100147619 | Ga0070665_1001476192 | 235 |
| 203 | 3300005577 | Ga0068857_100054592 | Ga0068857_1000545922 | 235 |
| 204 | 3300005618 | Ga0068864_100349063 | Ga0068864_1003490632 | 235 |
| 205 | 3300005719 | Ga0068861_100535543 | Ga0068861_1005355432 | 235 |
| 206 | 3300005844 | Ga0068862_100131326 | Ga0068862_1001313263 | 235 |
| 207 | 3300005937 | Ga0081455_10052548 | Ga0081455_100525481 | 235 |
| 208 | 3300005983 | Ga0081540_1062976 | Ga0081540_10629762 | 235 |
| 209 | 3300005985 | Ga0081539_10094131 | Ga0081539_100941312 | 235 |
| 210 | 3300006038 | Ga0075365_10236242 | Ga0075365_102362422 | 235 |
| 211 | 3300006048 | Ga0075363_100023095 | Ga0075363_1000230951 | 235 |
| 212 | 3300006195 | Ga0075366_10013043 | Ga0075366_100130433 | 235 |
| 213 | 3300006353 | Ga0075370_10074578 | Ga0075370_100745782 | 235 |
| 214 | 3300006943 | Ga0099822_1050290 | Ga0099822_10502902 | 235 |
| 215 | 3300009093 | Ga0105240_11184085 | Ga0105240_111840851 | 235 |
| 216 | 3300009101 | Ga0105247_10389207 | Ga0105247_103892072 | 235 |
| 217 | 3300009148 | Ga0105243_10784188 | Ga0105243_107841881 | 235 |
| 218 | 3300009177 | Ga0105248_10095221 | Ga0105248_100952213 | 235 |
| 219 | 3300009545 | Ga0105237_10271117 | Ga0105237_102711172 | 235 |
| 220 | 3300009545 | Ga0105237_10480421 | Ga0105237_104804212 | 235 |
| 221 | 3300009553 | Ga0105249_10194251 | Ga0105249_101942512 | 235 |
| 222 | 3300013296 | Ga0157374_10108670 | Ga0157374_101086702 | 235 |
| 223 | 3300025261 | Ga0209233_1002356 | Ga0209233_10023567 | 235 |
| 224 | 3300025297 | Ga0209758_1000133 | Ga0209758_100013377 | 235 |
| 225 | 3300025297 | Ga0209758_1006910 | Ga0209758_10069104 | 235 |
| 226 | 3300025297 | Ga0209758_1032160 | Ga0209758_10321602 | 235 |
| 227 | 3300025302 | Ga0207426_1002396 | Ga0207426_10023964 | 235 |
| 228 | 3300025900 | Ga0207710_10097636 | Ga0207710_100976362 | 235 |
| 229 | 3300025903 | Ga0207680_10253326 | Ga0207680_102533262 | 235 |
| 230 | 3300025904 | Ga0207647_10019836 | Ga0207647_100198366 | 235 |
| 231 | 3300025913 | Ga0207695_10241625 | Ga0207695_102416252 | 235 |
| 232 | 3300025925 | Ga0207650_10206520 | Ga0207650_102065201 | 235 |
| 233 | 3300025972 | Ga0207668_10196091 | Ga0207668_101960912 | 235 |
| 234 | 3300025972 | Ga0207668_10506424 | Ga0207668_105064241 | 235 |
| 235 | 3300026035 | Ga0207703_10710473 | Ga0207703_107104732 | 235 |
| 236 | 3300026089 | Ga0207648_10636806 | Ga0207648_106368061 | 235 |
| 237 | 3300026116 | Ga0207674_10109148 | Ga0207674_101091482 | 235 |
| 238 | 3300026142 | Ga0207698_10100743 | Ga0207698_101007432 | 235 |
| 239 | 3300027296 | Ga0209389_1000014 | Ga0209389_1000014164 | 235 |
| 240 | 3300027357 | Ga0209589_1000020 | Ga0209589_1000020164 | 235 |
| 241 | 3300027361 | Ga0209489_100060 | Ga0209489_100060123 | 235 |
| 242 | 3300028379 | Ga0268266_10090253 | Ga0268266_100902532 | 235 |
| 243 | 3300031548 | Ga0307408_100614320 | Ga0307408_1006143202 | 235 |
| 244 | 3300031995 | Ga0307409_100489184 | Ga0307409_1004891842 | 235 |
| 245 | 3300032126 | Ga0307415_100798091 | Ga0307415_1007980911 | 235 |
| 246 | 3300033180 | Ga0307510_10022493 | Ga0307510_100224934 | 235 |
| 247 | 3300035092 | Ga0373952_0025997 | Ga0373952_0025997_139_921 | 235 |
| 248 | 3300044658 | Ga0466972_0028367 | Ga0466972_0028367_1924_2706 | 235 |
| 249 | 3300044735 | Ga0466968_0004242 | Ga0466968_0004242_1953_2735 | 235 |
| 250 | 3300044901 | Ga0466960_0007335 | Ga0466960_0007335_1734_2516 | 235 |
| 251 | 3300046454 | Ga0495592_0023956 | Ga0495592_0023956_1323_2105 | 235 |
| 252 | 3300046457 | Ga0495590_0106077 | Ga0495590_0106077_104_880 | 235 |
| 253 | 3300046460 | Ga0495638_0090254 | Ga0495638_0090254_423_1205 | 235 |
| 254 | 3300046462 | Ga0495651_0000271 | Ga0495651_0000271_10675_11457 | 235 |
| 255 | 3300046477 | Ga0495664_0028905 | Ga0495664_0028905_1722_2504 | 235 |
| 256 | 3300046511 | Ga0495608_0026863 | Ga0495608_0026863_927_1709 | 235 |
| 257 | 3300046514 | Ga0495618_0112657 | Ga0495618_0112657_852_1634 | 235 |
| 258 | 3300046517 | Ga0495630_0175759 | Ga0495630_0175759_425_1207 | 235 |
| 259 | 3300046519 | Ga0495632_0102048 | Ga0495632_0102048_198_980 | 235 |
| 260 | 3300046522 | Ga0495643_0024447 | Ga0495643_0024447_1718_2500 | 235 |
| 261 | 3300046523 | Ga0495644_0049431 | Ga0495644_0049431_356_1138 | 235 |
| 262 | 3300046525 | Ga0495663_0047497 | Ga0495663_0047497_340_1122 | 235 |
| 263 | 3300046529 | Ga0495652_0004764 | Ga0495652_0004764_4591_5373 | 235 |
| 264 | 3300046536 | Ga0495587_0044816 | Ga0495587_0044816_1613_2395 | 235 |
| 265 | 3300046542 | Ga0495597_0057617 | Ga0495597_0057617_879_1661 | 235 |
| 266 | 3300046543 | Ga0495645_0008894 | Ga0495645_0008894_966_1748 | 235 |
| 267 | 3300046559 | Ga0495667_0010094 | Ga0495667_0010094_2893_3675 | 235 |
| 268 | 3300046616 | Ga0495668_0032597 | Ga0495668_0032597_1366_2148 | 235 |
| 269 | 3300046642 | Ga0495634_0047380 | Ga0495634_0047380_354_1136 | 235 |
| 270 | 3300046648 | Ga0495611_0033915 | Ga0495611_0033915_17_799 | 235 |
| 271 | 3300046665 | Ga0495661_0134673 | Ga0495661_0134673_309_1091 | 235 |
| 272 | 3300046675 | Ga0495657_0003332 | Ga0495657_0003332_1281_2063 | 235 |
| 273 | 3300046678 | Ga0495599_0019003 | Ga0495599_0019003_1533_2315 | 235 |
| 274 | 3300046679 | Ga0495623_0004419 | Ga0495623_0004419_3984_4766 | 235 |
| 275 | 3300046680 | Ga0495646_0043300 | Ga0495646_0043300_1284_2066 | 235 |
| 276 | 3300046694 | Ga0495649_0087122 | Ga0495649_0087122_105_887 | 235 |
| 277 | 3300046809 | Ga0495600_0001932 | Ga0495600_0001932_8185_8967 | 235 |
| 278 | 3300047317 | Ga0495604_0002485 | Ga0495604_0002485_2228_3010 | 235 |
| 279 | 3300047319 | Ga0495674_0013696 | Ga0495674_0013696_2420_3202 | 235 |
| 280 | 3300047321 | Ga0495676_0214251 | Ga0495676_0214251_203_985 | 235 |
| 281 | 3300047322 | Ga0495680_0001198 | Ga0495680_0001198_23337_24119 | 235 |
| 282 | 3300047323 | Ga0495683_0021057 | Ga0495683_0021057_712_1494 | 235 |
| 283 | 3300047444 | Ga0495675_0003907 | Ga0495675_0003907_6778_7560 | 235 |
| 284 | 3300047469 | Ga0495673_0029213 | Ga0495673_0029213_71_853 | 235 |
| 285 | 3300047472 | Ga0495686_0057283 | Ga0495686_0057283_1460_2242 | 235 |
| 286 | 3300048088 | Ga0495602_0001578 | Ga0495602_0001578_12504_13286 | 235 |
| 287 | 3300048091 | Ga0495626_0067645 | Ga0495626_0067645_501_1283 | 235 |
| 288 | 3300048904 | Ga0496101_0247703 | Ga0496101_0247703_448_1230 | 235 |
| 289 | 3300048905 | Ga0496102_0056022 | Ga0496102_0056022_2082_2864 | 235 |
| 290 | 3300048906 | Ga0496103_0018401 | Ga0496103_0018401_2674_3456 | 235 |
| 291 | 3300048908 | Ga0496105_0197579 | Ga0496105_0197579_762_1544 | 235 |
| 292 | 3300048910 | Ga0496107_0157111 | Ga0496107_0157111_508_1290 | 235 |
| 293 | 3300048912 | Ga0496109_0037911 | Ga0496109_0037911_2688_3470 | 235 |
| 294 | 3300048915 | Ga0496112_0047421 | Ga0496112_0047421_2786_3568 | 235 |
| 295 | 3300048920 | Ga0496117_0087241 | Ga0496117_0087241_823_1605 | 235 |
| 296 | 3300048922 | Ga0496119_0042028 | Ga0496119_0042028_939_1721 | 235 |
| 297 | 3300048928 | Ga0496125_0045725 | Ga0496125_0045725_2470_3252 | 235 |
| 298 | 3300048929 | Ga0496126_0122534 | Ga0496126_0122534_441_1223 | 235 |
| 299 | 3300048929 | Ga0496126_0247534 | Ga0496126_0247534_28_810 | 235 |
| 300 | 3300049592 | Ga0501076_0267228 | Ga0501076_0267228_517_1299 | 235 |
| 301 | 3300050493 | nmdc:mga0k408_13681_c1 | nmdc:mga0k408_13681_c1_1416_2198 | 235 |
| 302 | 3300050494 | nmdc:mga06z11_256435_c1 | nmdc:mga06z11_256435_c1_239_1021 | 235 |
| 303 | 3300050494 | nmdc:mga06z11_47123_c1 | nmdc:mga06z11_47123_c1_278_1060 | 235 |
| 304 | 3300050496 | nmdc:mga07m45_108878_c1 | nmdc:mga07m45_108878_c1_293_1075 | 235 |
| 305 | 3300050516 | nmdc:mga0sz30_53428_c1 | nmdc:mga0sz30_53428_c1_577_1359 | 235 |
| 306 | 3300053079 | Ga0500610_0189067 | Ga0500610_0189067_94_876 | 235 |
| 307 | 3300053084 | Ga0495595_0032357 | Ga0495595_0032357_609_1391 | 235 |
| 308 | 3300053085 | Ga0495619_0235638 | Ga0495619_0235638_139_921 | 235 |
| 309 | 3300053087 | Ga0500643_000069 | Ga0500643_000069_82874_83656 | 235 |
| 310 | 3300053091 | Ga0500647_0005637 | Ga0500647_0005637_4192_4974 | 235 |
| 311 | 3300053093 | Ga0500651_0127694 | Ga0500651_0127694_675_1457 | 235 |
| 312 | 3300053103 | Ga0500555_005858 | Ga0500555_005858_1540_2322 | 235 |
| 313 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_59197_59979 | 235 |
| 314 | 3300053111 | Ga0500572_006775 | Ga0500572_006775_335_1117 | 235 |
| 315 | 3300053122 | Ga0500608_021825 | Ga0500608_021825_1298_2080 | 235 |
| 316 | 3300053130 | Ga0500642_0113963 | Ga0500642_0113963_92_874 | 235 |
| 317 | 3300053139 | Ga0500568_0033785 | Ga0500568_0033785_456_1238 | 235 |
| 318 | 3300053148 | Ga0500590_049087 | Ga0500590_049087_1157_1939 | 235 |
| 319 | 3300053154 | Ga0500619_013213 | Ga0500619_013213_1109_1891 | 235 |
| 320 | 3300053158 | Ga0500627_0090534 | Ga0500627_0090534_374_1156 | 235 |
| 321 | 3300053161 | Ga0500634_0047928 | Ga0500634_0047928_811_1593 | 235 |
| 322 | 3300053177 | Ga0500636_0001860 | Ga0500636_0001860_1842_2624 | 235 |
| 323 | 3300053177 | Ga0500636_0071286 | Ga0500636_0071286_983_1765 | 235 |
| 324 | 3300053729 | Ga0500625_014631 | Ga0500625_014631_306_1088 | 235 |
| 325 | 3300053731 | Ga0500609_006498 | Ga0500609_006498_380_1162 | 235 |
| 326 | 3300053737 | Ga0500601_000092 | Ga0500601_000092_6117_6899 | 235 |
| 327 | 3300055283 | Ga0500661_006682 | Ga0500661_006682_624_1406 | 235 |
| 328 | 3300061734 | Ga0530510_0125737 | Ga0530510_0125737_824_1606 | 235 |
| 329 | 3300005937 | Ga0081455_10082536 | Ga0081455_100825363 | 236 |
| 330 | 3300025302 | Ga0207426_1002137 | Ga0207426_100213714 | 236 |
| 331 | 3300026075 | Ga0207708_10168656 | Ga0207708_101686562 | 236 |
| 332 | 3300026118 | Ga0207675_100755197 | Ga0207675_1007551971 | 236 |
| 333 | 3300048924 | Ga0496121_0044119 | Ga0496121_0044119_2785_3567 | 236 |
| 334 | 3300048924 | Ga0496121_0060417 | Ga0496121_0060417_2277_3059 | 236 |
| 335 | 3300005445 | Ga0070708_100355514 | Ga0070708_1003555142 | 237 |
| 336 | 3300021384 | Ga0213876_10051082 | Ga0213876_100510822 | 237 |
| 337 | 3300039437 | Ga0436365_0627243 | Ga0436365_0627243_222_1004 | 237 |
| 338 | 3300044656 | Ga0466969_0082145 | Ga0466969_0082145_573_1355 | 237 |
| 339 | 3300044694 | Ga0466963_0021127 | Ga0466963_0021127_1585_2367 | 237 |
| 340 | 3300044694 | Ga0466963_0191347 | Ga0466963_0191347_159_941 | 237 |
| 341 | 3300044842 | Ga0466957_0108073 | Ga0466957_0108073_18_800 | 237 |
| 342 | 3300045976 | Ga0466967_0073807 | Ga0466967_0073807_2091_2873 | 237 |
| 343 | 3300047317 | Ga0495604_0173157 | Ga0495604_0173157_528_1310 | 237 |
| 344 | 3300005436 | Ga0070713_100006598 | Ga0070713_1000065984 | 238 |
| 345 | 3300005455 | Ga0070663_100047197 | Ga0070663_1000471971 | 238 |
| 346 | 3300005548 | Ga0070665_100300012 | Ga0070665_1003000122 | 238 |
| 347 | 3300005616 | Ga0068852_100597347 | Ga0068852_1005973472 | 238 |
| 348 | 3300006048 | Ga0075363_100017124 | Ga0075363_1000171243 | 238 |
| 349 | 3300006353 | Ga0075370_10044333 | Ga0075370_100443332 | 238 |
| 350 | 3300025898 | Ga0207692_10062720 | Ga0207692_100627202 | 238 |
| 351 | 3300025906 | Ga0207699_10074695 | Ga0207699_100746952 | 238 |
| 352 | 3300025928 | Ga0207700_10082107 | Ga0207700_100821071 | 238 |
| 353 | 3300025945 | Ga0207679_10208915 | Ga0207679_102089152 | 238 |
| 354 | 3300028379 | Ga0268266_10001082 | Ga0268266_100010825 | 238 |
| 355 | 3300035083 | Ga0373926_0011600 | Ga0373926_0011600_2120_2902 | 238 |
| 356 | 3300035089 | Ga0373944_0026448 | Ga0373944_0026448_72_854 | 238 |
| 357 | 3300035113 | Ga0373936_0136603 | Ga0373936_0136603_204_986 | 238 |
| 358 | 3300035117 | Ga0373953_0116458 | Ga0373953_0116458_43_825 | 238 |
| 359 | 3300035692 | Ga0373935_0068682 | Ga0373935_0068682_360_1142 | 238 |
| 360 | 3300035695 | Ga0373927_0061213 | Ga0373927_0061213_377_1159 | 238 |
| 361 | 3300035725 | Ga0373947_0091243 | Ga0373947_0091243_913_1695 | 238 |
| 362 | 3300036401 | Ga0373937_0465599 | Ga0373937_0465599_58_840 | 238 |
| 363 | 3300046472 | Ga0495580_0004422 | Ga0495580_0004422_3253_4035 | 238 |
| 364 | 3300046475 | Ga0495639_0020094 | Ga0495639_0020094_1696_2478 | 238 |
| 365 | 3300046477 | Ga0495664_0026796 | Ga0495664_0026796_777_1559 | 238 |
| 366 | 3300046514 | Ga0495618_0366707 | Ga0495618_0366707_58_840 | 238 |
| 367 | 3300046517 | Ga0495630_0049964 | Ga0495630_0049964_2198_2980 | 238 |
| 368 | 3300046529 | Ga0495652_0295207 | Ga0495652_0295207_58_840 | 238 |
| 369 | 3300046533 | Ga0495640_0031699 | Ga0495640_0031699_2511_3293 | 238 |
| 370 | 3300046642 | Ga0495634_0337562 | Ga0495634_0337562_62_844 | 238 |
| 371 | 3300046663 | Ga0495635_0066323 | Ga0495635_0066323_1652_2434 | 238 |
| 372 | 3300046683 | Ga0495658_0019954 | Ga0495658_0019954_884_1666 | 238 |
| 373 | 3300046689 | Ga0495613_0211710 | Ga0495613_0211710_376_1158 | 238 |
| 374 | 3300047315 | Ga0495581_0007817 | Ga0495581_0007817_272_1054 | 238 |
| 375 | 3300047319 | Ga0495674_0041838 | Ga0495674_0041838_1840_2622 | 238 |
| 376 | 3300047321 | Ga0495676_0080565 | Ga0495676_0080565_1330_2112 | 238 |
| 377 | 3300047471 | Ga0495684_0025140 | Ga0495684_0025140_1359_2141 | 238 |
| 378 | 3300050490 | nmdc:mga03n38_7548_c1 | nmdc:mga03n38_7548_c1_801_1583 | 238 |
| 379 | 3300050491 | nmdc:mga00v17_155175_c1 | nmdc:mga00v17_155175_c1_498_1280 | 238 |
| 380 | 3300050492 | nmdc:mga0yw44_225692_c1 | nmdc:mga0yw44_225692_c1_368_1150 | 238 |
| 381 | 3300005548 | Ga0070665_100266585 | Ga0070665_1002665852 | 239 |
| 382 | 3300009174 | Ga0105241_10034445 | Ga0105241_100344454 | 239 |
| 383 | 3300010375 | Ga0105239_10125231 | Ga0105239_101252313 | 239 |
| 384 | 3300025911 | Ga0207654_10003032 | Ga0207654_100030322 | 239 |
| 385 | 3300037418 | Ga0395900_0703045 | Ga0395900_0703045_22_804 | 239 |
| 386 | 3300039437 | Ga0436365_1300190 | Ga0436365_1300190_1322_2104 | 239 |
| 387 | 3300046457 | Ga0495590_0121834 | Ga0495590_0121834_42_824 | 239 |
| 388 | 3300046537 | Ga0495598_0009153 | Ga0495598_0009153_396_1178 | 239 |
| 389 | 3300046648 | Ga0495611_0086132 | Ga0495611_0086132_36_818 | 239 |
| 390 | 3300053092 | Ga0500583_0136253 | Ga0500583_0136253_338_1120 | 239 |
| 391 | 3300005616 | Ga0068852_100011643 | Ga0068852_1000116437 | 241 |
| 392 | 3300005718 | Ga0068866_10057771 | Ga0068866_100577712 | 241 |
| 393 | 3300009174 | Ga0105241_10028754 | Ga0105241_100287543 | 241 |
| 394 | 3300009545 | Ga0105237_10004025 | Ga0105237_1000402515 | 241 |
| 395 | 3300009553 | Ga0105249_10795402 | Ga0105249_107954022 | 241 |
| 396 | 3300010375 | Ga0105239_10088799 | Ga0105239_100887993 | 241 |
| 397 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008822 | 241 |
| 398 | 3300025914 | Ga0207671_10004403 | Ga0207671_100044037 | 241 |
| 399 | 3300025916 | Ga0207663_10006343 | Ga0207663_100063434 | 241 |
| 400 | 3300025960 | Ga0207651_10624516 | Ga0207651_106245162 | 241 |
| 401 | 3300026142 | Ga0207698_10074151 | Ga0207698_100741513 | 241 |
| 402 | 3300028794 | Ga0307515_10025331 | Ga0307515_100253316 | 241 |
| 403 | 3300048903 | Ga0496100_0033217 | Ga0496100_0033217_558_1340 | 241 |
| 404 | 3300003752 | Ga0055539_1002463 | Ga0055539_10024633 | 242 |
| 405 | 3300025253 | Ga0209677_100908 | Ga0209677_1009083 | 242 |
| 406 | 3300025261 | Ga0209233_1001449 | Ga0209233_10014493 | 242 |
| 407 | 3300025272 | Ga0209455_1005909 | Ga0209455_10059094 | 242 |
| 408 | 3300025272 | Ga0209455_1015444 | Ga0209455_10154443 | 242 |
| 409 | 3300048921 | Ga0496118_0075692 | Ga0496118_0075692_709_1491 | 242 |
| 410 | 3300048924 | Ga0496121_0011984 | Ga0496121_0011984_2241_3023 | 242 |
| 411 | 3300048924 | Ga0496121_0280319 | Ga0496121_0280319_321_1103 | 242 |
| 412 | 3300048927 | Ga0496124_0221658 | Ga0496124_0221658_364_1146 | 242 |
| 413 | 3300048929 | Ga0496126_0437355 | Ga0496126_0437355_123_905 | 242 |
| 414 | 3300053177 | Ga0500636_0058733 | Ga0500636_0058733_1061_1843 | 242 |
| 415 | 3300006881 | Ga0068865_100168730 | Ga0068865_1001687302 | 243 |
| 416 | 3300014326 | Ga0157380_10505548 | Ga0157380_105055481 | 243 |
| 417 | 3300025908 | Ga0207643_10276233 | Ga0207643_102762332 | 243 |
| 418 | 3300025942 | Ga0207689_10013133 | Ga0207689_100131334 | 243 |
| 419 | 3300005327 | Ga0070658_10160218 | Ga0070658_101602182 | 244 |
| 420 | 3300005337 | Ga0070682_100175997 | Ga0070682_1001759972 | 244 |
| 421 | 3300005344 | Ga0070661_100422026 | Ga0070661_1004220262 | 244 |
| 422 | 3300005455 | Ga0070663_100212421 | Ga0070663_1002124212 | 244 |
| 423 | 3300006038 | Ga0075365_10007730 | Ga0075365_100077303 | 244 |
| 424 | 3300025920 | Ga0207649_10364299 | Ga0207649_103642992 | 244 |
| 425 | 3300025939 | Ga0207665_10367662 | Ga0207665_103676622 | 244 |
| 426 | 3300026067 | Ga0207678_10423203 | Ga0207678_104232031 | 244 |
| 427 | 3300046460 | Ga0495638_0013009 | Ga0495638_0013009_2218_3000 | 244 |
| 428 | 3300046507 | Ga0495606_0032446 | Ga0495606_0032446_247_1029 | 244 |
| 429 | 3300046694 | Ga0495649_0040650 | Ga0495649_0040650_1431_2213 | 244 |
| 430 | 3300048913 | Ga0496110_0465730 | Ga0496110_0465730_136_918 | 244 |
| 431 | 3300048924 | Ga0496121_0108498 | Ga0496121_0108498_1318_2100 | 244 |
| 432 | 3300050492 | nmdc:mga0yw44_5155_c1 | nmdc:mga0yw44_5155_c1_4420_5202 | 244 |
| 433 | 3300053104 | Ga0500556_0003091 | Ga0500556_0003091_3864_4646 | 244 |
| 434 | 3300053108 | Ga0500562_016831 | Ga0500562_016831_743_1525 | 244 |
| 435 | 3300053116 | Ga0500592_010923 | Ga0500592_010923_210_992 | 244 |
| 436 | 3300053153 | Ga0500616_0062111 | Ga0500616_0062111_492_1274 | 244 |
| 437 | 3300053160 | Ga0500633_0064731 | Ga0500633_0064731_311_1093 | 244 |
| 438 | 3300053177 | Ga0500636_0084068 | Ga0500636_0084068_767_1549 | 245 |
| 439 | 3300028786 | Ga0307517_10004833 | Ga0307517_1000483314 | 246 |
| 440 | 3300025934 | Ga0207686_10338352 | Ga0207686_103383521 | 247 |
| 441 | 3300035170 | Ga0373943_0085618 | Ga0373943_0085618_158_940 | 247 |
| 442 | 3300035695 | Ga0373927_0025153 | Ga0373927_0025153_572_1354 | 247 |
| 443 | 3300035725 | Ga0373947_0009460 | Ga0373947_0009460_1437_2219 | 247 |
| 444 | 3300037068 | Ga0373925_0048830 | Ga0373925_0048830_43_825 | 247 |
| 445 | 3300046455 | Ga0495603_0002873 | Ga0495603_0002873_3384_4166 | 247 |
| 446 | 3300046462 | Ga0495651_0094524 | Ga0495651_0094524_989_1771 | 247 |
| 447 | 3300046475 | Ga0495639_0035199 | Ga0495639_0035199_646_1428 | 247 |
| 448 | 3300046499 | Ga0495594_0073656 | Ga0495594_0073656_605_1387 | 247 |
| 449 | 3300046681 | Ga0495647_0147740 | Ga0495647_0147740_122_904 | 247 |
| 450 | 3300046690 | Ga0495624_0044349 | Ga0495624_0044349_359_1141 | 247 |
| 451 | 3300053085 | Ga0495619_0039802 | Ga0495619_0039802_945_1727 | 247 |
| 452 | 3300048929 | Ga0496126_0027556 | Ga0496126_0027556_4657_5409 | 248 |
| 453 | 3300053077 | Ga0495601_0231003 | Ga0495601_0231003_24_794 | 248 |
| 454 | 3300053098 | Ga0500650_0155760 | Ga0500650_0155760_292_1044 | 248 |
| 455 | 3300003203 | JGI25406J46586_10003417 | JGI25406J46586_100034172 | 249 |
| 456 | 3300003215 | JGI25153J46596_10000952 | JGI25153J46596_100009523 | 249 |
| 457 | 3300005616 | Ga0068852_100251961 | Ga0068852_1002519612 | 249 |
| 458 | 3300005985 | Ga0081539_10010493 | Ga0081539_100104932 | 249 |
| 459 | 3300025297 | Ga0209758_1027721 | Ga0209758_10277212 | 249 |
| 460 | 3300033180 | Ga0307510_10005755 | Ga0307510_1000575511 | 249 |
| 461 | 3300035092 | Ga0373952_0080572 | Ga0373952_0080572_57_812 | 249 |
| 462 | 3300046452 | Ga0495617_080445 | Ga0495617_080445_12_767 | 249 |
| 463 | 3300046475 | Ga0495639_0178164 | Ga0495639_0178164_26_781 | 249 |
| 464 | 3300046499 | Ga0495594_0257420 | Ga0495594_0257420_11_766 | 249 |
| 465 | 3300048912 | Ga0496109_0853811 | Ga0496109_0853811_82_837 | 249 |
| 466 | 3300006178 | Ga0075367_10060179 | Ga0075367_100601793 | 250 |
| 467 | 3300009093 | Ga0105240_10010472 | Ga0105240_100104723 | 250 |
| 468 | 3300048905 | Ga0496102_0080549 | Ga0496102_0080549_736_1518 | 250 |
| 469 | 3300048909 | Ga0496106_0006841 | Ga0496106_0006841_5869_6651 | 250 |
| 470 | 3300048910 | Ga0496107_0005103 | Ga0496107_0005103_4659_5441 | 250 |
| 471 | 3300048911 | Ga0496108_0000259 | Ga0496108_0000259_13834_14616 | 250 |
| 472 | 3300048912 | Ga0496109_0000250 | Ga0496109_0000250_30178_30960 | 250 |
| 473 | 3300048914 | Ga0496111_0176071 | Ga0496111_0176071_529_1311 | 250 |
| 474 | 3300048915 | Ga0496112_0052717 | Ga0496112_0052717_2234_3016 | 250 |
| 475 | 3300048916 | Ga0496113_0059155 | Ga0496113_0059155_1798_2580 | 250 |
| 476 | 3300048929 | Ga0496126_0032207 | Ga0496126_0032207_1209_1991 | 250 |
| 477 | 3300044656 | Ga0466969_0045804 | Ga0466969_0045804_432_1214 | 251 |
| 478 | 3300044684 | Ga0466966_0012258 | Ga0466966_0012258_2969_3751 | 251 |
| 479 | 3300044693 | Ga0466961_0000132 | Ga0466961_0000132_35168_35950 | 251 |
| 480 | 3300045049 | Ga0466959_0000295 | Ga0466959_0000295_23878_24660 | 251 |
| 481 | 3300045836 | Ga0466958_0155219 | Ga0466958_0155219_256_1038 | 251 |
| 482 | iso_pu_bacteria | 2643221654 | 2644302816 | 251 |
| 483 | 3300003215 | JGI25153J46596_10005466 | JGI25153J46596_100054662 | 252 |
| 484 | 3300003354 | JGI25160J50197_1003726 | JGI25160J50197_10037262 | 252 |
| 485 | 3300003354 | JGI25160J50197_1006214 | JGI25160J50197_10062143 | 252 |
| 486 | 3300005347 | Ga0070668_100055398 | Ga0070668_1000553983 | 252 |
| 487 | 3300005439 | Ga0070711_100015454 | Ga0070711_1000154541 | 252 |
| 488 | 3300005578 | Ga0068854_100062848 | Ga0068854_1000628483 | 252 |
| 489 | 3300005614 | Ga0068856_100009329 | Ga0068856_1000093293 | 252 |
| 490 | 3300005842 | Ga0068858_100444685 | Ga0068858_1004446852 | 252 |
| 491 | 3300005844 | Ga0068862_100350977 | Ga0068862_1003509771 | 252 |
| 492 | 3300006038 | Ga0075365_10157441 | Ga0075365_101574412 | 252 |
| 493 | 3300006178 | Ga0075367_10405211 | Ga0075367_104052111 | 252 |
| 494 | 3300006186 | Ga0075369_10014241 | Ga0075369_100142413 | 252 |
| 495 | 3300009553 | Ga0105249_10291673 | Ga0105249_102916732 | 252 |
| 496 | 3300025295 | Ga0209564_1009146 | Ga0209564_10091463 | 252 |
| 497 | 3300025297 | Ga0209758_1001858 | Ga0209758_100185817 | 252 |
| 498 | 3300025302 | Ga0207426_1001289 | Ga0207426_10012898 | 252 |
| 499 | 3300025981 | Ga0207640_10135585 | Ga0207640_101355852 | 252 |
| 500 | 3300026078 | Ga0207702_10000779 | Ga0207702_1000077922 | 252 |
| 501 | 3300028380 | Ga0268265_10565813 | Ga0268265_105658132 | 252 |
| 502 | 3300037471 | Ga0395905_0005304 | Ga0395905_0005304_8599_9381 | 252 |
| 503 | 3300038443 | Ga0395901_0076417 | Ga0395901_0076417_119_901 | 252 |
| 504 | 3300044683 | Ga0466965_0103075 | Ga0466965_0103075_13_795 | 252 |
| 505 | 3300046507 | Ga0495606_0038960 | Ga0495606_0038960_2141_2923 | 252 |
| 506 | 3300046557 | Ga0495622_0008052 | Ga0495622_0008052_115_897 | 252 |
| 507 | 3300046674 | Ga0495588_0001382 | Ga0495588_0001382_7895_8677 | 252 |
| 508 | 3300047321 | Ga0495676_0206670 | Ga0495676_0206670_101_883 | 252 |
| 509 | 3300047469 | Ga0495673_0153407 | Ga0495673_0153407_39_821 | 252 |
| 510 | 3300048903 | Ga0496100_0066259 | Ga0496100_0066259_1032_1814 | 252 |
| 511 | 3300048905 | Ga0496102_0124233 | Ga0496102_0124233_129_911 | 252 |
| 512 | 3300048907 | Ga0496104_0078243 | Ga0496104_0078243_517_1299 | 252 |
| 513 | 3300048908 | Ga0496105_0138852 | Ga0496105_0138852_408_1190 | 252 |
| 514 | 3300048912 | Ga0496109_0153338 | Ga0496109_0153338_936_1718 | 252 |
| 515 | 3300048916 | Ga0496113_0081737 | Ga0496113_0081737_1349_2131 | 252 |
| 516 | 3300048917 | Ga0496114_0143156 | Ga0496114_0143156_457_1239 | 252 |
| 517 | 3300048919 | Ga0496116_0027016 | Ga0496116_0027016_1879_2661 | 252 |
| 518 | 3300048924 | Ga0496121_0025495 | Ga0496121_0025495_4046_4828 | 252 |
| 519 | 3300050496 | nmdc:mga07m45_317645_c1 | nmdc:mga07m45_317645_c1_91_873 | 252 |
| 520 | 3300053104 | Ga0500556_0122895 | Ga0500556_0122895_127_909 | 252 |
| 521 | 3300053119 | Ga0500595_004127 | Ga0500595_004127_2629_3411 | 252 |
| 522 | 3300053139 | Ga0500568_0040925 | Ga0500568_0040925_189_971 | 252 |
| 523 | 3300027907 | Ga0207428_10028694 | Ga0207428_100286942 | 253 |
| 524 | 3300050511 | nmdc:mga08y16_10722_c1 | nmdc:mga08y16_10722_c1_5476_6261 | 253 |
| 525 | 3300031456 | Ga0307513_10240593 | Ga0307513_102405932 | 254 |
| 526 | 3300031730 | Ga0307516_10422952 | Ga0307516_104229522 | 254 |
| 527 | iso_pu_bacteria | 2507262055 | 2507507642 | 254 |
| 528 | iso_pu_bacteria | 2508501009 | 2508541759 | 254 |
| 529 | iso_pu_bacteria | 2508501042 | 2508692697 | 254 |
| 530 | iso_pu_bacteria | 2508501128 | 2509149276 | 254 |
| 531 | iso_pu_bacteria | 2513237092 | 2513621846 | 254 |
| 532 | iso_pu_bacteria | 2513237094 | 2513636715 | 254 |
| 533 | iso_pu_bacteria | 2513237096 | 2513654112 | 254 |
| 534 | iso_pu_bacteria | 2513237098 | 2513674807 | 254 |
| 535 | iso_pu_bacteria | 2513237101 | 2513697061 | 254 |
| 536 | iso_pu_bacteria | 2513237102 | 2513701492 | 254 |
| 537 | iso_pu_bacteria | 2513237104 | 2513721273 | 254 |
| 538 | iso_pu_bacteria | 2513237137 | 2513856864 | 254 |
| 539 | iso_pu_bacteria | 2513237141 | 2513891229 | 254 |
| 540 | iso_pu_bacteria | 2513237145 | 2513918452 | 254 |
| 541 | iso_pu_bacteria | 2515154112 | 2515626095 | 254 |
| 542 | iso_pu_bacteria | 2517093001 | 2517104176 | 254 |
| 543 | iso_pu_bacteria | 2517572143 | 2517891314 | 254 |
| 544 | iso_pu_bacteria | 2524023210 | 2524471221 | 254 |
| 545 | iso_pu_bacteria | 2524023228 | 2524533480 | 254 |
| 546 | iso_pu_bacteria | 2528768022 | 2528848961 | 254 |
| 547 | iso_pu_bacteria | 2582581306 | 2585268523 | 254 |
| 548 | iso_pu_bacteria | 2602042107 | 2603857652 | 254 |
| 549 | iso_pu_bacteria | 2617270741 | 2617372748 | 254 |
| 550 | iso_pu_bacteria | 2643221723 | 2644673527 | 254 |
| 551 | iso_pu_bacteria | 2667528175 | 2671123844 | 254 |
| 552 | iso_pu_bacteria | 2721755755 | 2723843659 | 254 |
| 553 | iso_pu_bacteria | 2728368998 | 2728750025 | 254 |
| 554 | iso_pu_bacteria | 2791355196 | 2793060894 | 254 |
| 555 | iso_pu_bacteria | 2791355197 | 2793066681 | 254 |
| 556 | iso_pu_bacteria | 2791355199 | 2793083812 | 254 |
| 557 | iso_pu_bacteria | 2791355265 | 2793354427 | 254 |
| 558 | iso_pu_bacteria | 2802429603 | 2805921312 | 254 |
| 559 | iso_pu_bacteria | 2802429606 | 2805935171 | 254 |
| 560 | iso_pu_bacteria | 2816332527 | 2818236572 | 254 |
| 561 | iso_pu_bacteria | 2824600985 | 2824605245 | 254 |
| 562 | iso_pu_bacteria | 2824609381 | 2824615564 | 254 |
| 563 | iso_pu_bacteria | 2824617872 | 2824620445 | 254 |
| 564 | iso_pu_bacteria | 2824626560 | 2824628507 | 254 |
| 565 | iso_pu_bacteria | 2824635225 | 2824637207 | 254 |
| 566 | iso_pu_bacteria | 2824644064 | 2824645870 | 254 |
| 567 | iso_pu_bacteria | 2824653114 | 2824656454 | 254 |
| 568 | iso_pu_bacteria | 2824661429 | 2824666146 | 254 |
| 569 | iso_pu_bacteria | 2824679649 | 2824681716 | 254 |
| 570 | iso_pu_bacteria | 2824696289 | 2824699602 | 254 |
| 571 | iso_pu_bacteria | 2824704595 | 2824711160 | 254 |
| 572 | iso_pu_bacteria | 2824714736 | 2824723623 | 254 |
| 573 | iso_pu_bacteria | 2824723954 | 2824725600 | 254 |
| 574 | iso_pu_bacteria | 2824732956 | 2824737207 | 254 |
| 575 | iso_pu_bacteria | 2824746037 | 2824748845 | 254 |
| 576 | iso_pu_bacteria | 2824753945 | 2824756000 | 254 |
| 577 | iso_pu_bacteria | 2824763712 | 2824767538 | 254 |
| 578 | iso_pu_bacteria | 2824773399 | 2824775107 | 254 |
| 579 | iso_pu_bacteria | 2841966195 | 2841972024 | 254 |
| 580 | iso_pu_bacteria | 2842038055 | 2842040669 | 254 |
| 581 | iso_pu_bacteria | 2842045827 | 2842046385 | 254 |
| 582 | iso_pu_bacteria | 2842205361 | 2842209903 | 254 |
| 583 | iso_pu_bacteria | 2842278818 | 2842283357 | 254 |
| 584 | iso_pu_bacteria | 2842317721 | 2842320312 | 254 |
| 585 | iso_pu_bacteria | 2842402390 | 2842405942 | 254 |
| 586 | iso_pu_bacteria | 2842409023 | 2842412526 | 254 |
| 587 | iso_pu_bacteria | 2842415677 | 2842419170 | 254 |
| 588 | iso_pu_bacteria | 2844315083 | 2844320047 | 254 |
| 589 | iso_pu_bacteria | 2847930680 | 2847937341 | 254 |
| 590 | iso_pu_bacteria | 2847939898 | 2847947765 | 254 |
| 591 | iso_pu_bacteria | 2849076700 | 2849078374 | 254 |
| 592 | iso_pu_bacteria | 2857509624 | 2857512751 | 254 |
| 593 | iso_pu_bacteria | 2857524615 | 2857527019 | 254 |
| 594 | iso_pu_bacteria | 2874590934 | 2874598757 | 254 |
| 595 | iso_pu_bacteria | 2874604998 | 2874607128 | 254 |
| 596 | iso_pu_bacteria | 2874612657 | 2874614552 | 254 |
| 597 | iso_pu_bacteria | 2874620515 | 2874628099 | 254 |
| 598 | iso_pu_bacteria | 2874628541 | 2874634986 | 254 |
| 599 | iso_pu_bacteria | 2874645413 | 2874652213 | 254 |
| 600 | iso_pu_bacteria | 2876761206 | 2876771057 | 254 |
| 601 | iso_pu_bacteria | 2876771140 | 2876778796 | 254 |
| 602 | iso_pu_bacteria | 2876808645 | 2876817682 | 254 |
| 603 | iso_pu_bacteria | 2876818435 | 2876824309 | 254 |
| 604 | iso_pu_bacteria | 2879074833 | 2879082589 | 254 |
| 605 | iso_pu_bacteria | 2879083081 | 2879086642 | 254 |
| 606 | iso_pu_bacteria | 2879099564 | 2879107155 | 254 |
| 607 | iso_pu_bacteria | 2879110137 | 2879111889 | 254 |
| 608 | iso_pu_bacteria | 2879127579 | 2879131506 | 254 |
| 609 | iso_pu_bacteria | 2879142872 | 2879147952 | 254 |
| 610 | iso_pu_bacteria | 2881364244 | 2881371438 | 254 |
| 611 | iso_pu_bacteria | 2881665667 | 2881666598 | 254 |
| 612 | iso_pu_bacteria | 2885366525 | 2885369985 | 254 |
| 613 | iso_pu_bacteria | 2885374607 | 2885377047 | 254 |
| 614 | iso_pu_bacteria | 2885383462 | 2885387472 | 254 |
| 615 | iso_pu_bacteria | 2885409591 | 2885417875 | 254 |
| 616 | iso_pu_bacteria | 2888388044 | 2888392758 | 254 |
| 617 | iso_pu_bacteria | 2888419890 | 2888425603 | 254 |
| 618 | iso_pu_bacteria | 2889033259 | 2889037987 | 254 |
| 619 | iso_pu_bacteria | 2893066018 | 2893068199 | 254 |
| 620 | iso_pu_bacteria | 2903727486 | 2903730279 | 254 |
| 621 | iso_pu_bacteria | 2903768456 | 2903772193 | 254 |
| 622 | iso_pu_bacteria | 2904666416 | 2904674283 | 254 |
| 623 | iso_pu_bacteria | 2904690495 | 2904694515 | 254 |
| 624 | iso_pu_bacteria | 2904699407 | 2904701254 | 254 |
| 625 | iso_pu_bacteria | 2904711408 | 2904711955 | 254 |
| 626 | iso_pu_bacteria | 2906602504 | 2906609872 | 254 |
| 627 | iso_pu_bacteria | 2906610324 | 2906616500 | 254 |
| 628 | iso_pu_bacteria | 2906626472 | 2906629233 | 254 |
| 629 | iso_pu_bacteria | 2906635258 | 2906635271 | 254 |
| 630 | iso_pu_bacteria | 2906643746 | 2906643966 | 254 |
| 631 | iso_pu_bacteria | 2906660503 | 2906662997 | 254 |
| 632 | iso_pu_bacteria | 2908756301 | 2908759172 | 254 |
| 633 | iso_pu_bacteria | 2908775508 | 2908781192 | 254 |
| 634 | iso_pu_bacteria | 2919073203 | 2919078131 | 254 |
| 635 | iso_pu_bacteria | 2922361189 | 2922365992 | 254 |
| 636 | iso_pu_bacteria | 2922368715 | 2922372385 | 254 |
| 637 | iso_pu_bacteria | 2922386360 | 2922386845 | 254 |
| 638 | iso_pu_bacteria | 2922393267 | 2922397057 | 254 |
| 639 | iso_pu_bacteria | 2922425934 | 2922431485 | 254 |
| 640 | iso_pu_bacteria | 2929615660 | 2929621043 | 254 |
| 641 | iso_pu_bacteria | 2929624759 | 2929626126 | 254 |
| 642 | iso_pu_bacteria | 2932784394 | 2932784994 | 254 |
| 643 | iso_pu_bacteria | 2932794094 | 2932795133 | 254 |
| 644 | iso_pu_bacteria | 2932801729 | 2932805661 | 254 |
| 645 | iso_pu_bacteria | 2932809354 | 2932810028 | 254 |
| 646 | iso_pu_bacteria | 2932818245 | 2932827025 | 254 |
| 647 | iso_pu_bacteria | 2932828146 | 2932828831 | 254 |
| 648 | iso_pu_bacteria | 2933577622 | 2933583087 | 254 |
| 649 | iso_pu_bacteria | 2935608549 | 2935609848 | 254 |
| 650 | iso_pu_bacteria | 2935616580 | 2935619749 | 254 |
| 651 | iso_pu_bacteria | 2935630451 | 2935636213 | 254 |
| 652 | iso_pu_bacteria | 2935638405 | 2935638730 | 254 |
| 653 | iso_pu_bacteria | 2935648319 | 2935652121 | 254 |
| 654 | iso_pu_bacteria | 2935656913 | 2935659906 | 254 |
| 655 | iso_pu_bacteria | 2935665750 | 2935666419 | 254 |
| 656 | iso_pu_bacteria | 2935675223 | 2935676533 | 254 |
| 657 | iso_pu_bacteria | 2935684952 | 2935690794 | 254 |
| 658 | iso_pu_bacteria | 2935694250 | 2935694615 | 254 |
| 659 | iso_pu_bacteria | 2935703347 | 2935703736 | 254 |
| 660 | iso_pu_bacteria | 2935713505 | 2935718175 | 254 |
| 661 | iso_pu_bacteria | 2935722832 | 2935727844 | 254 |
| 662 | iso_pu_bacteria | 2935732158 | 2935736548 | 254 |
| 663 | iso_pu_bacteria | 2935741537 | 2935745927 | 254 |
| 664 | iso_pu_bacteria | 2935750917 | 2935756308 | 254 |
| 665 | iso_pu_bacteria | 2935760218 | 2935760588 | 254 |
| 666 | iso_pu_bacteria | 2935769743 | 2935776978 | 254 |
| 667 | iso_pu_bacteria | 2935777560 | 2935783533 | 254 |
| 668 | iso_pu_bacteria | 2935785616 | 2935792821 | 254 |
| 669 | iso_pu_bacteria | 2935793552 | 2935800831 | 254 |
| 670 | iso_pu_bacteria | 2935801545 | 2935801873 | 254 |
| 671 | iso_pu_bacteria | 2935810662 | 2935814717 | 254 |
| 672 | iso_pu_bacteria | 2935819856 | 2935823009 | 254 |
| 673 | iso_pu_bacteria | 2935827899 | 2935828224 | 254 |
| 674 | iso_pu_bacteria | 2935837841 | 2935842428 | 254 |
| 675 | iso_pu_bacteria | 2935847175 | 2935848591 | 254 |
| 676 | iso_pu_bacteria | 2935855204 | 2935857936 | 254 |
| 677 | iso_pu_bacteria | 2935864058 | 2935868722 | 254 |
| 678 | iso_pu_bacteria | 2935873716 | 2935874137 | 254 |
| 679 | iso_pu_bacteria | 2935883170 | 2935883969 | 254 |
| 680 | iso_pu_bacteria | 2935908558 | 2935909602 | 254 |
| 681 | iso_pu_bacteria | 2935916978 | 2935917327 | 254 |
| 682 | iso_pu_bacteria | 2935926038 | 2935927083 | 254 |
| 683 | iso_pu_bacteria | 2935934488 | 2935937073 | 254 |
| 684 | iso_pu_bacteria | 2935942939 | 2935944624 | 254 |
| 685 | iso_pu_bacteria | 2935951376 | 2935953061 | 254 |
| 686 | iso_pu_bacteria | 2935959822 | 2935962736 | 254 |
| 687 | iso_pu_bacteria | 2935967501 | 2935969901 | 254 |
| 688 | iso_pu_bacteria | 2935975950 | 2935976497 | 254 |
| 689 | iso_pu_bacteria | 2935984226 | 2935987050 | 254 |
| 690 | iso_pu_bacteria | 2935992306 | 2935992938 | 254 |
| 691 | iso_pu_bacteria | 2936002035 | 2936002851 | 254 |
| 692 | iso_pu_bacteria | 2936011229 | 2936014322 | 254 |
| 693 | iso_pu_bacteria | 2936019824 | 2936023838 | 254 |
| 694 | iso_pu_bacteria | 2936028420 | 2936031481 | 254 |
| 695 | iso_pu_bacteria | 2936037263 | 2936040640 | 254 |
| 696 | iso_pu_bacteria | 2936046547 | 2936049428 | 254 |
| 697 | iso_pu_bacteria | 2936055302 | 2936062178 | 254 |
| 698 | iso_pu_bacteria | 2940556831 | 2940561717 | 254 |
| 699 | iso_pu_bacteria | 2941507105 | 2941512844 | 254 |
| 700 | iso_pu_bacteria | 2941515067 | 2941520589 | 254 |
| 701 | iso_pu_bacteria | 2941523033 | 2941528603 | 254 |
| 702 | iso_pu_bacteria | 2941531003 | 2941531230 | 254 |
| 703 | iso_pu_bacteria | 2941538514 | 2941542477 | 254 |
| 704 | iso_pu_bacteria | 3005474847 | 3005481275 | 254 |
| 705 | iso_pu_bacteria | 3005483717 | 3005484775 | 254 |
| 706 | iso_pu_bacteria | 3005506211 | 3005508413 | 254 |
| 707 | iso_pu_bacteria | 3005587118 | 3005588083 | 254 |
| 708 | iso_pu_bacteria | 3005594810 | 3005600334 | 254 |
| 709 | iso_pu_bacteria | 3005710791 | 3005715826 | 254 |
| 710 | iso_pu_bacteria | 3005718088 | 3005723183 | 254 |
| 711 | iso_pu_bacteria | 8006926726 | 8006928373 | 254 |
| 712 | iso_pu_bacteria | 8006933436 | 8006939435 | 254 |
| 713 | iso_pu_bacteria | 8006964411 | 8006968777 | 254 |
| 714 | iso_pu_bacteria | 8006973647 | 8006979090 | 254 |
| 715 | iso_pu_bacteria | 8006984368 | 8006984462 | 254 |
| 716 | iso_pu_bacteria | 8006994254 | 8007000928 | 254 |
| 717 | iso_pu_bacteria | 8016511872 | 8016520638 | 254 |
| 718 | iso_pu_bacteria | 8016522445 | 8016528665 | 254 |
| 719 | iso_pu_bacteria | 8016530956 | 8016533839 | 254 |
| 720 | iso_pu_bacteria | 8016539877 | 8016547062 | 254 |
| 721 | iso_pu_bacteria | 8016548790 | 8016555058 | 254 |
| 722 | iso_pu_bacteria | 8016557553 | 8016563421 | 254 |
| 723 | iso_pu_bacteria | 8016566248 | 8016572171 | 254 |
| 724 | iso_pu_bacteria | 8016575299 | 8016576370 | 254 |
| 725 | iso_pu_bacteria | 8016583857 | 8016594369 | 254 |
| 726 | iso_pu_bacteria | 8016613128 | 8016615632 | 254 |
| 727 | iso_pu_bacteria | 8016630954 | 8016639151 | 254 |
| 728 | iso_pu_bacteria | 8017057580 | 8017064941 | 254 |
| 729 | iso_pu_bacteria | 8019530166 | 8019533612 | 254 |
| 730 | iso_pu_bacteria | 8019538911 | 8019546051 | 254 |
| 731 | iso_pu_bacteria | 8019547302 | 8019552669 | 254 |
| 732 | iso_pu_bacteria | 8019565922 | 8019575408 | 254 |
| 733 | iso_pu_bacteria | 8019576017 | 8019584319 | 254 |
| 734 | iso_pu_bacteria | 8019586578 | 8019592088 | 254 |
| 735 | iso_pu_bacteria | 8019597564 | 8019599194 | 254 |
| 736 | iso_pu_bacteria | 8019608314 | 8019609162 | 254 |
| 737 | iso_pu_bacteria | 8019619141 | 8019619830 | 254 |
| 738 | iso_pu_bacteria | 8019629233 | 8019633285 | 254 |
| 739 | iso_pu_bacteria | 8019638758 | 8019646619 | 254 |
| 740 | iso_pu_bacteria | 8019648815 | 8019649384 | 254 |
| 741 | iso_pu_bacteria | 8019659431 | 8019661155 | 254 |
| 742 | iso_pu_bacteria | 8019668869 | 8019670709 | 254 |
| 743 | iso_pu_bacteria | 8019678201 | 8019685524 | 254 |
| 744 | iso_pu_bacteria | 8019687851 | 8019691089 | 254 |
| 745 | iso_pu_bacteria | 8055742211 | 8055745094 | 254 |
| 746 | iso_pu_bacteria | 8056382006 | 8056382170 | 254 |
| 747 | iso_pu_bacteria | 8056673599 | 8056677448 | 254 |
| 748 | iso_pu_bacteria | 8056681323 | 8056684767 | 254 |
| 749 | iso_pu_bacteria | 8056689827 | 8056690770 | 254 |
| 750 | iso_pu_bacteria | 8056967851 | 8056975046 | 254 |
| 751 | 3300005331 | Ga0070670_100184441 | Ga0070670_1001844412 | 255 |
| 752 | 3300005333 | Ga0070677_10090431 | Ga0070677_100904311 | 255 |
| 753 | 3300005334 | Ga0068869_100032152 | Ga0068869_1000321522 | 255 |
| 754 | 3300005334 | Ga0068869_100186479 | Ga0068869_1001864792 | 255 |
| 755 | 3300005335 | Ga0070666_10386542 | Ga0070666_103865421 | 255 |
| 756 | 3300005338 | Ga0068868_100075518 | Ga0068868_1000755183 | 255 |
| 757 | 3300005355 | Ga0070671_100019925 | Ga0070671_1000199252 | 255 |
| 758 | 3300005355 | Ga0070671_100201753 | Ga0070671_1002017532 | 255 |
| 759 | 3300005364 | Ga0070673_100070300 | Ga0070673_1000703002 | 255 |
| 760 | 3300005367 | Ga0070667_100001599 | Ga0070667_1000015992 | 255 |
| 761 | 3300005367 | Ga0070667_100522897 | Ga0070667_1005228972 | 255 |
| 762 | 3300005445 | Ga0070708_100287046 | Ga0070708_1002870461 | 255 |
| 763 | 3300005459 | Ga0068867_100041887 | Ga0068867_1000418872 | 255 |
| 764 | 3300005467 | Ga0070706_100027803 | Ga0070706_1000278033 | 255 |
| 765 | 3300005468 | Ga0070707_100052509 | Ga0070707_1000525092 | 255 |
| 766 | 3300005471 | Ga0070698_100154623 | Ga0070698_1001546231 | 255 |
| 767 | 3300005543 | Ga0070672_100250820 | Ga0070672_1002508202 | 255 |
| 768 | 3300005548 | Ga0070665_100090850 | Ga0070665_1000908502 | 255 |
| 769 | 3300005548 | Ga0070665_100193242 | Ga0070665_1001932423 | 255 |
| 770 | 3300005563 | Ga0068855_100550684 | Ga0068855_1005506842 | 255 |
| 771 | 3300005577 | Ga0068857_100071994 | Ga0068857_1000719942 | 255 |
| 772 | 3300005577 | Ga0068857_100141781 | Ga0068857_1001417812 | 255 |
| 773 | 3300005617 | Ga0068859_100202522 | Ga0068859_1002025221 | 255 |
| 774 | 3300005618 | Ga0068864_100117766 | Ga0068864_1001177663 | 255 |
| 775 | 3300005841 | Ga0068863_100086436 | Ga0068863_1000864362 | 255 |
| 776 | 3300005843 | Ga0068860_100690660 | Ga0068860_1006906602 | 255 |
| 777 | 3300006038 | Ga0075365_10357414 | Ga0075365_103574142 | 255 |
| 778 | 3300006048 | Ga0075363_100183728 | Ga0075363_1001837282 | 255 |
| 779 | 3300006051 | Ga0075364_10085133 | Ga0075364_100851332 | 255 |
| 780 | 3300006177 | Ga0075362_10008537 | Ga0075362_100085373 | 255 |
| 781 | 3300006177 | Ga0075362_10105690 | Ga0075362_101056901 | 255 |
| 782 | 3300006178 | Ga0075367_10017795 | Ga0075367_100177952 | 255 |
| 783 | 3300006178 | Ga0075367_10025516 | Ga0075367_100255162 | 255 |
| 784 | 3300006178 | Ga0075367_10065458 | Ga0075367_100654581 | 255 |
| 785 | 3300006186 | Ga0075369_10013004 | Ga0075369_100130042 | 255 |
| 786 | 3300006195 | Ga0075366_10022723 | Ga0075366_100227232 | 255 |
| 787 | 3300006195 | Ga0075366_10028915 | Ga0075366_100289152 | 255 |
| 788 | 3300006195 | Ga0075366_10097027 | Ga0075366_100970272 | 255 |
| 789 | 3300006353 | Ga0075370_10000773 | Ga0075370_100007732 | 255 |
| 790 | 3300006353 | Ga0075370_10026104 | Ga0075370_100261043 | 255 |
| 791 | 3300006353 | Ga0075370_10040686 | Ga0075370_100406862 | 255 |
| 792 | 3300006353 | Ga0075370_10111113 | Ga0075370_101111132 | 255 |
| 793 | 3300006353 | Ga0075370_10168621 | Ga0075370_101686211 | 255 |
| 794 | 3300006358 | Ga0068871_100138832 | Ga0068871_1001388322 | 255 |
| 795 | 3300006931 | Ga0097620_100202531 | Ga0097620_1002025313 | 255 |
| 796 | 3300009093 | Ga0105240_10110255 | Ga0105240_101102553 | 255 |
| 797 | 3300009098 | Ga0105245_10074935 | Ga0105245_100749352 | 255 |
| 798 | 3300009098 | Ga0105245_10362233 | Ga0105245_103622332 | 255 |
| 799 | 3300009148 | Ga0105243_10254861 | Ga0105243_102548612 | 255 |
| 800 | 3300009148 | Ga0105243_10674557 | Ga0105243_106745572 | 255 |
| 801 | 3300009176 | Ga0105242_10539701 | Ga0105242_105397012 | 255 |
| 802 | 3300009545 | Ga0105237_10121559 | Ga0105237_101215592 | 255 |
| 803 | 3300013296 | Ga0157374_10457713 | Ga0157374_104577132 | 255 |
| 804 | 3300013297 | Ga0157378_10110756 | Ga0157378_101107562 | 255 |
| 805 | 3300013297 | Ga0157378_10215565 | Ga0157378_102155652 | 255 |
| 806 | 3300013306 | Ga0163162_10048614 | Ga0163162_100486144 | 255 |
| 807 | 3300013306 | Ga0163162_10738497 | Ga0163162_107384972 | 255 |
| 808 | 3300013308 | Ga0157375_10162251 | Ga0157375_101622512 | 255 |
| 809 | 3300013308 | Ga0157375_10207808 | Ga0157375_102078082 | 255 |
| 810 | 3300013308 | Ga0157375_10552587 | Ga0157375_105525872 | 255 |
| 811 | 3300014325 | Ga0163163_10365399 | Ga0163163_103653992 | 255 |
| 812 | 3300014968 | Ga0157379_10517438 | Ga0157379_105174382 | 255 |
| 813 | 3300014968 | Ga0157379_10560603 | Ga0157379_105606032 | 255 |
| 814 | 3300025893 | Ga0207682_10032066 | Ga0207682_100320662 | 255 |
| 815 | 3300025910 | Ga0207684_10024140 | Ga0207684_100241403 | 255 |
| 816 | 3300025913 | Ga0207695_10143916 | Ga0207695_101439162 | 255 |
| 817 | 3300025914 | Ga0207671_10065749 | Ga0207671_100657492 | 255 |
| 818 | 3300025922 | Ga0207646_10346623 | Ga0207646_103466232 | 255 |
| 819 | 3300025925 | Ga0207650_10220521 | Ga0207650_102205212 | 255 |
| 820 | 3300025927 | Ga0207687_10022826 | Ga0207687_100228262 | 255 |
| 821 | 3300025931 | Ga0207644_10038532 | Ga0207644_100385322 | 255 |
| 822 | 3300025931 | Ga0207644_10239483 | Ga0207644_102394832 | 255 |
| 823 | 3300025932 | Ga0207690_10125196 | Ga0207690_101251962 | 255 |
| 824 | 3300025933 | Ga0207706_10190586 | Ga0207706_101905861 | 255 |
| 825 | 3300025935 | Ga0207709_10064438 | Ga0207709_100644382 | 255 |
| 826 | 3300025938 | Ga0207704_10057211 | Ga0207704_100572112 | 255 |
| 827 | 3300025938 | Ga0207704_10268800 | Ga0207704_102688002 | 255 |
| 828 | 3300025940 | Ga0207691_10032277 | Ga0207691_100322774 | 255 |
| 829 | 3300025942 | Ga0207689_10043683 | Ga0207689_100436832 | 255 |
| 830 | 3300025945 | Ga0207679_10864755 | Ga0207679_108647551 | 255 |
| 831 | 3300025960 | Ga0207651_10042541 | Ga0207651_100425412 | 255 |
| 832 | 3300025986 | Ga0207658_10000701 | Ga0207658_1000070111 | 255 |
| 833 | 3300025986 | Ga0207658_10086325 | Ga0207658_100863252 | 255 |
| 834 | 3300026023 | Ga0207677_10039546 | Ga0207677_100395462 | 255 |
| 835 | 3300026089 | Ga0207648_10017982 | Ga0207648_100179825 | 255 |
| 836 | 3300026116 | Ga0207674_10028009 | Ga0207674_100280092 | 255 |
| 837 | 3300026116 | Ga0207674_10067952 | Ga0207674_100679522 | 255 |
| 838 | 3300026142 | Ga0207698_11046332 | Ga0207698_110463321 | 255 |
| 839 | 3300028379 | Ga0268266_10110280 | Ga0268266_101102803 | 255 |
| 840 | 3300028381 | Ga0268264_10500515 | Ga0268264_105005152 | 255 |
| 841 | 3300028786 | Ga0307517_10035440 | Ga0307517_100354402 | 255 |
| 842 | 3300028786 | Ga0307517_10201312 | Ga0307517_102013122 | 255 |
| 843 | 3300028794 | Ga0307515_10093890 | Ga0307515_100938903 | 255 |
| 844 | 3300028794 | Ga0307515_10138928 | Ga0307515_101389282 | 255 |
| 845 | 3300031456 | Ga0307513_10029357 | Ga0307513_100293572 | 255 |
| 846 | 3300031456 | Ga0307513_10078873 | Ga0307513_100788733 | 255 |
| 847 | 3300031507 | Ga0307509_10005920 | Ga0307509_100059207 | 255 |
| 848 | 3300031507 | Ga0307509_10020362 | Ga0307509_100203622 | 255 |
| 849 | 3300031507 | Ga0307509_10022911 | Ga0307509_100229112 | 255 |
| 850 | 3300031507 | Ga0307509_10194200 | Ga0307509_101942002 | 255 |
| 851 | 3300031616 | Ga0307508_10026371 | Ga0307508_100263711 | 255 |
| 852 | 3300031616 | Ga0307508_10249221 | Ga0307508_102492212 | 255 |
| 853 | 3300031616 | Ga0307508_10284421 | Ga0307508_102844212 | 255 |
| 854 | 3300031649 | Ga0307514_10282275 | Ga0307514_102822752 | 255 |
| 855 | 3300033180 | Ga0307510_10016732 | Ga0307510_100167327 | 255 |
| 856 | 3300033180 | Ga0307510_10123392 | Ga0307510_101233922 | 255 |
| 857 | 3300033180 | Ga0307510_10137260 | Ga0307510_101372602 | 255 |
| 858 | 3300035112 | Ga0373932_0019392 | Ga0373932_0019392_561_1334 | 255 |
| 859 | 3300035112 | Ga0373932_0052670 | Ga0373932_0052670_226_1011 | 255 |
| 860 | 3300041456 | Ga0451795_1119810 | Ga0451795_1119810_446_1216 | 255 |
| 861 | 3300041491 | Ga0451833_1242256 | Ga0451833_1242256_76_861 | 255 |
| 862 | 3300041997 | Ga0439431_0024303 | Ga0439431_0024303_197_976 | 255 |
| 863 | 3300046454 | Ga0495592_0000427 | Ga0495592_0000427_29744_30517 | 255 |
| 864 | 3300046457 | Ga0495590_0052477 | Ga0495590_0052477_549_1325 | 255 |
| 865 | 3300046460 | Ga0495638_0067522 | Ga0495638_0067522_369_1142 | 255 |
| 866 | 3300046473 | Ga0495582_0116035 | Ga0495582_0116035_124_897 | 255 |
| 867 | 3300046515 | Ga0495620_0104330 | Ga0495620_0104330_247_1026 | 255 |
| 868 | 3300046519 | Ga0495632_0004752 | Ga0495632_0004752_5032_5814 | 255 |
| 869 | 3300046542 | Ga0495597_0012214 | Ga0495597_0012214_1750_2526 | 255 |
| 870 | 3300046557 | Ga0495622_0037306 | Ga0495622_0037306_886_1659 | 255 |
| 871 | 3300046616 | Ga0495668_0036598 | Ga0495668_0036598_836_1615 | 255 |
| 872 | 3300046660 | Ga0495625_0031796 | Ga0495625_0031796_1179_1955 | 255 |
| 873 | 3300046683 | Ga0495658_0167147 | Ga0495658_0167147_434_1207 | 255 |
| 874 | 3300046694 | Ga0495649_0002961 | Ga0495649_0002961_1286_2068 | 255 |
| 875 | 3300047321 | Ga0495676_0175077 | Ga0495676_0175077_250_1023 | 255 |
| 876 | 3300047443 | Ga0495687_001232 | Ga0495687_001232_1535_2311 | 255 |
| 877 | 3300047443 | Ga0495687_014924 | Ga0495687_014924_1656_2438 | 255 |
| 878 | 3300047443 | Ga0495687_024789 | Ga0495687_024789_458_1240 | 255 |
| 879 | 3300050491 | nmdc:mga00v17_248935_c1 | nmdc:mga00v17_248935_c1_26_802 | 255 |
| 880 | 3300050493 | nmdc:mga0k408_115683_c1 | nmdc:mga0k408_115683_c1_362_1138 | 255 |
| 881 | 3300050493 | nmdc:mga0k408_11676_c1 | nmdc:mga0k408_11676_c1_3385_4161 | 255 |
| 882 | 3300050493 | nmdc:mga0k408_78691_c1 | nmdc:mga0k408_78691_c1_878_1654 | 255 |
| 883 | 3300050494 | nmdc:mga06z11_10966_c1 | nmdc:mga06z11_10966_c1_2037_2813 | 255 |
| 884 | 3300050494 | nmdc:mga06z11_94523_c1 | nmdc:mga06z11_94523_c1_771_1547 | 255 |
| 885 | 3300050496 | nmdc:mga07m45_1793_c1 | nmdc:mga07m45_1793_c1_3415_4191 | 255 |
| 886 | 3300050496 | nmdc:mga07m45_28416_c1 | nmdc:mga07m45_28416_c1_1300_2076 | 255 |
| 887 | 3300050496 | nmdc:mga07m45_40838_c1 | nmdc:mga07m45_40838_c1_315_1091 | 255 |
| 888 | 3300050496 | nmdc:mga07m45_4531_c1 | nmdc:mga07m45_4531_c1_2282_3058 | 255 |
| 889 | 3300050496 | nmdc:mga07m45_75007_c1 | nmdc:mga07m45_75007_c1_38_814 | 255 |
| 890 | 3300050496 | nmdc:mga07m45_96708_c1 | nmdc:mga07m45_96708_c1_678_1451 | 255 |
| 891 | 3300050516 | nmdc:mga0sz30_105528_c1 | nmdc:mga0sz30_105528_c1_256_1032 | 255 |
| 892 | 3300053088 | Ga0500644_0011509 | Ga0500644_0011509_1131_1904 | 255 |
| 893 | 3300053093 | Ga0500651_0136342 | Ga0500651_0136342_308_1081 | 255 |
| 894 | 3300053134 | Ga0500658_0030098 | Ga0500658_0030098_399_1181 | 255 |
| 895 | 3300053136 | Ga0500559_0000200 | Ga0500559_0000200_40260_41033 | 255 |
| 896 | 3300053156 | Ga0500622_0011755 | Ga0500622_0011755_2465_3238 | 255 |
| 897 | 3300053177 | Ga0500636_0101840 | Ga0500636_0101840_490_1263 | 255 |
| 898 | 3300053093 | Ga0500651_0043032 | Ga0500651_0043032_863_1642 | 257 |
| 899 | 3300053118 | Ga0500594_0015719 | Ga0500594_0015719_981_1760 | 257 |
| 900 | 3300053119 | Ga0500595_001442 | Ga0500595_001442_6808_7587 | 257 |
| 901 | 3300002987 | JGI25159J45721_1000071 | JGI25159J45721_100007140 | 258 |
| 902 | 3300002987 | JGI25159J45721_1000191 | JGI25159J45721_100019112 | 258 |
| 903 | 3300003215 | JGI25153J46596_10059954 | JGI25153J46596_100599541 | 258 |
| 904 | 3300003354 | JGI25160J50197_1000162 | JGI25160J50197_100016223 | 258 |
| 905 | 3300003374 | JGI25161J50226_1000988 | JGI25161J50226_10009888 | 258 |
| 906 | 3300003659 | JGI25404J52841_10007977 | JGI25404J52841_100079772 | 258 |
| 907 | 3300003659 | JGI25404J52841_10026367 | JGI25404J52841_100263672 | 258 |
| 908 | 3300003775 | Ga0055524_1022659 | Ga0055524_10226591 | 258 |
| 909 | 3300003781 | Ga0055536_1000667 | Ga0055536_10006675 | 258 |
| 910 | 3300003792 | Ga0055540_1021009 | Ga0055540_10210092 | 258 |
| 911 | 3300003794 | Ga0055531_10011656 | Ga0055531_100116562 | 258 |
| 912 | 3300004625 | Ga0055543_1019666 | Ga0055543_10196662 | 258 |
| 913 | 3300005262 | Ga0065165_1000535 | Ga0065165_100053523 | 258 |
| 914 | 3300005262 | Ga0065165_1004595 | Ga0065165_10045953 | 258 |
| 915 | 3300005329 | Ga0070683_100083116 | Ga0070683_1000831163 | 258 |
| 916 | 3300005330 | Ga0070690_100231860 | Ga0070690_1002318602 | 258 |
| 917 | 3300005336 | Ga0070680_100276688 | Ga0070680_1002766882 | 258 |
| 918 | 3300005339 | Ga0070660_100047303 | Ga0070660_1000473032 | 258 |
| 919 | 3300005339 | Ga0070660_100130249 | Ga0070660_1001302492 | 258 |
| 920 | 3300005339 | Ga0070660_100379673 | Ga0070660_1003796732 | 258 |
| 921 | 3300005341 | Ga0070691_10077070 | Ga0070691_100770702 | 258 |
| 922 | 3300005345 | Ga0070692_10222391 | Ga0070692_102223911 | 258 |
| 923 | 3300005347 | Ga0070668_100037793 | Ga0070668_1000377932 | 258 |
| 924 | 3300005356 | Ga0070674_100158026 | Ga0070674_1001580261 | 258 |
| 925 | 3300005364 | Ga0070673_100153388 | Ga0070673_1001533882 | 258 |
| 926 | 3300005434 | Ga0070709_10000900 | Ga0070709_100009002 | 258 |
| 927 | 3300005434 | Ga0070709_10012197 | Ga0070709_100121974 | 258 |
| 928 | 3300005434 | Ga0070709_10016286 | Ga0070709_100162863 | 258 |
| 929 | 3300005435 | Ga0070714_100037902 | Ga0070714_1000379022 | 258 |
| 930 | 3300005435 | Ga0070714_100039125 | Ga0070714_1000391252 | 258 |
| 931 | 3300005435 | Ga0070714_100043651 | Ga0070714_1000436513 | 258 |
| 932 | 3300005435 | Ga0070714_100169252 | Ga0070714_1001692522 | 258 |
| 933 | 3300005435 | Ga0070714_100223183 | Ga0070714_1002231832 | 258 |
| 934 | 3300005435 | Ga0070714_100468964 | Ga0070714_1004689641 | 258 |
| 935 | 3300005436 | Ga0070713_100003714 | Ga0070713_1000037145 | 258 |
| 936 | 3300005436 | Ga0070713_100024687 | Ga0070713_1000246874 | 258 |
| 937 | 3300005436 | Ga0070713_100153428 | Ga0070713_1001534282 | 258 |
| 938 | 3300005436 | Ga0070713_100340318 | Ga0070713_1003403182 | 258 |
| 939 | 3300005437 | Ga0070710_10000221 | Ga0070710_1000022126 | 258 |
| 940 | 3300005437 | Ga0070710_10002129 | Ga0070710_100021292 | 258 |
| 941 | 3300005437 | Ga0070710_10093835 | Ga0070710_100938352 | 258 |
| 942 | 3300005439 | Ga0070711_100002818 | Ga0070711_1000028185 | 258 |
| 943 | 3300005439 | Ga0070711_100011819 | Ga0070711_1000118192 | 258 |
| 944 | 3300005439 | Ga0070711_100015227 | Ga0070711_1000152274 | 258 |
| 945 | 3300005455 | Ga0070663_100026611 | Ga0070663_1000266114 | 258 |
| 946 | 3300005455 | Ga0070663_100264491 | Ga0070663_1002644912 | 258 |
| 947 | 3300005456 | Ga0070678_100156643 | Ga0070678_1001566432 | 258 |
| 948 | 3300005456 | Ga0070678_100249071 | Ga0070678_1002490712 | 258 |
| 949 | 3300005457 | Ga0070662_100472113 | Ga0070662_1004721132 | 258 |
| 950 | 3300005468 | Ga0070707_100799645 | Ga0070707_1007996451 | 258 |
| 951 | 3300005535 | Ga0070684_100065035 | Ga0070684_1000650353 | 258 |
| 952 | 3300005539 | Ga0068853_100055518 | Ga0068853_1000555184 | 258 |
| 953 | 3300005548 | Ga0070665_100043157 | Ga0070665_1000431573 | 258 |
| 954 | 3300005563 | Ga0068855_100121344 | Ga0068855_1001213443 | 258 |
| 955 | 3300005563 | Ga0068855_100171911 | Ga0068855_1001719112 | 258 |
| 956 | 3300005563 | Ga0068855_100286719 | Ga0068855_1002867192 | 258 |
| 957 | 3300005577 | Ga0068857_100013693 | Ga0068857_1000136934 | 258 |
| 958 | 3300005578 | Ga0068854_100382872 | Ga0068854_1003828722 | 258 |
| 959 | 3300005614 | Ga0068856_100036241 | Ga0068856_1000362415 | 258 |
| 960 | 3300005614 | Ga0068856_100724103 | Ga0068856_1007241032 | 258 |
| 961 | 3300005718 | Ga0068866_10011069 | Ga0068866_100110692 | 258 |
| 962 | 3300005719 | Ga0068861_100036398 | Ga0068861_1000363982 | 258 |
| 963 | 3300005834 | Ga0068851_10035787 | Ga0068851_100357872 | 258 |
| 964 | 3300005842 | Ga0068858_100550879 | Ga0068858_1005508791 | 258 |
| 965 | 3300005937 | Ga0081455_10031043 | Ga0081455_100310433 | 258 |
| 966 | 3300005937 | Ga0081455_10099099 | Ga0081455_100990993 | 258 |
| 967 | 3300005981 | Ga0081538_10069547 | Ga0081538_100695472 | 258 |
| 968 | 3300005983 | Ga0081540_1000884 | Ga0081540_10008844 | 258 |
| 969 | 3300005983 | Ga0081540_1004220 | Ga0081540_10042206 | 258 |
| 970 | 3300005983 | Ga0081540_1005132 | Ga0081540_10051323 | 258 |
| 971 | 3300005983 | Ga0081540_1012953 | Ga0081540_10129533 | 258 |
| 972 | 3300005983 | Ga0081540_1014508 | Ga0081540_10145085 | 258 |
| 973 | 3300005983 | Ga0081540_1021814 | Ga0081540_10218142 | 258 |
| 974 | 3300005983 | Ga0081540_1025835 | Ga0081540_10258353 | 258 |
| 975 | 3300005985 | Ga0081539_10006229 | Ga0081539_100062298 | 258 |
| 976 | 3300006028 | Ga0070717_10003635 | Ga0070717_100036358 | 258 |
| 977 | 3300006028 | Ga0070717_10005810 | Ga0070717_100058104 | 258 |
| 978 | 3300006028 | Ga0070717_10292098 | Ga0070717_102920982 | 258 |
| 979 | 3300006038 | Ga0075365_10010419 | Ga0075365_100104191 | 258 |
| 980 | 3300006038 | Ga0075365_10520866 | Ga0075365_105208661 | 258 |
| 981 | 3300006048 | Ga0075363_100016000 | Ga0075363_1000160003 | 258 |
| 982 | 3300006051 | Ga0075364_10009798 | Ga0075364_100097985 | 258 |
| 983 | 3300006051 | Ga0075364_10178494 | Ga0075364_101784942 | 258 |
| 984 | 3300006163 | Ga0070715_10001911 | Ga0070715_100019114 | 258 |
| 985 | 3300006173 | Ga0070716_100001730 | Ga0070716_1000017305 | 258 |
| 986 | 3300006173 | Ga0070716_100039266 | Ga0070716_1000392662 | 258 |
| 987 | 3300006175 | Ga0070712_100021309 | Ga0070712_1000213093 | 258 |
| 988 | 3300006175 | Ga0070712_100022055 | Ga0070712_1000220553 | 258 |
| 989 | 3300006175 | Ga0070712_100139414 | Ga0070712_1001394142 | 258 |
| 990 | 3300006178 | Ga0075367_10002035 | Ga0075367_100020357 | 258 |
| 991 | 3300006178 | Ga0075367_10035016 | Ga0075367_100350163 | 258 |
| 992 | 3300006178 | Ga0075367_10106264 | Ga0075367_101062642 | 258 |
| 993 | 3300006186 | Ga0075369_10004785 | Ga0075369_100047852 | 258 |
| 994 | 3300006871 | Ga0075434_100043289 | Ga0075434_1000432893 | 258 |
| 995 | 3300006881 | Ga0068865_100157826 | Ga0068865_1001578262 | 258 |
| 996 | 3300006914 | Ga0075436_100117404 | Ga0075436_1001174042 | 258 |
| 997 | 3300006941 | Ga0099825_1046449 | Ga0099825_10464492 | 258 |
| 998 | 3300006942 | Ga0099824_1013115 | Ga0099824_10131153 | 258 |
| 999 | 3300006943 | Ga0099822_1000072 | Ga0099822_100007250 | 258 |
| 1000 | 3300006944 | Ga0099823_1106656 | Ga0099823_11066561 | 258 |
| 1001 | 3300007265 | Ga0099794_10086065 | Ga0099794_100860652 | 258 |
| 1002 | 3300009093 | Ga0105240_10030277 | Ga0105240_100302773 | 258 |
| 1003 | 3300009093 | Ga0105240_10052653 | Ga0105240_100526533 | 258 |
| 1004 | 3300009098 | Ga0105245_10573276 | Ga0105245_105732762 | 258 |
| 1005 | 3300009098 | Ga0105245_10815845 | Ga0105245_108158452 | 258 |
| 1006 | 3300009147 | Ga0114129_11234225 | Ga0114129_112342251 | 258 |
| 1007 | 3300009174 | Ga0105241_10161360 | Ga0105241_101613602 | 258 |
| 1008 | 3300009176 | Ga0105242_10280153 | Ga0105242_102801532 | 258 |
| 1009 | 3300009545 | Ga0105237_10547947 | Ga0105237_105479472 | 258 |
| 1010 | 3300009551 | Ga0105238_10464430 | Ga0105238_104644302 | 258 |
| 1011 | 3300009551 | Ga0105238_10509255 | Ga0105238_105092551 | 258 |
| 1012 | 3300009551 | Ga0105238_10637057 | Ga0105238_106370572 | 258 |
| 1013 | 3300009551 | Ga0105238_10925623 | Ga0105238_109256231 | 258 |
| 1014 | 3300010159 | Ga0099796_10052412 | Ga0099796_100524122 | 258 |
| 1015 | 3300010375 | Ga0105239_10224672 | Ga0105239_102246722 | 258 |
| 1016 | 3300010375 | Ga0105239_10725714 | Ga0105239_107257142 | 258 |
| 1017 | 3300013100 | Ga0157373_10070722 | Ga0157373_100707222 | 258 |
| 1018 | 3300013104 | Ga0157370_10511429 | Ga0157370_105114291 | 258 |
| 1019 | 3300013105 | Ga0157369_10104094 | Ga0157369_101040942 | 258 |
| 1020 | 3300013105 | Ga0157369_10279232 | Ga0157369_102792322 | 258 |
| 1021 | 3300013297 | Ga0157378_10490499 | Ga0157378_104904992 | 258 |
| 1022 | 3300014326 | Ga0157380_10436727 | Ga0157380_104367272 | 258 |
| 1023 | 3300014497 | Ga0182008_10086411 | Ga0182008_100864112 | 258 |
| 1024 | 3300014969 | Ga0157376_10148203 | Ga0157376_101482032 | 258 |
| 1025 | 3300014969 | Ga0157376_10596002 | Ga0157376_105960021 | 258 |
| 1026 | 3300017792 | Ga0163161_10184790 | Ga0163161_101847902 | 258 |
| 1027 | 3300021361 | Ga0213872_10076914 | Ga0213872_100769142 | 258 |
| 1028 | 3300021377 | Ga0213874_10068795 | Ga0213874_100687951 | 258 |
| 1029 | 3300025208 | Ga0209436_101866 | Ga0209436_1018662 | 258 |
| 1030 | 3300025254 | Ga0209148_1000699 | Ga0209148_100069925 | 258 |
| 1031 | 3300025261 | Ga0209233_1011713 | Ga0209233_10117132 | 258 |
| 1032 | 3300025261 | Ga0209233_1012838 | Ga0209233_10128382 | 258 |
| 1033 | 3300025272 | Ga0209455_1004211 | Ga0209455_10042112 | 258 |
| 1034 | 3300025284 | Ga0209130_1000147 | Ga0209130_100014744 | 258 |
| 1035 | 3300025292 | Ga0209676_1001620 | Ga0209676_10016202 | 258 |
| 1036 | 3300025294 | Ga0209025_1000240 | Ga0209025_100024043 | 258 |
| 1037 | 3300025295 | Ga0209564_1001127 | Ga0209564_100112713 | 258 |
| 1038 | 3300025295 | Ga0209564_1015362 | Ga0209564_10153623 | 258 |
| 1039 | 3300025297 | Ga0209758_1002537 | Ga0209758_100253714 | 258 |
| 1040 | 3300025297 | Ga0209758_1011139 | Ga0209758_10111396 | 258 |
| 1041 | 3300025298 | Ga0209050_1014213 | Ga0209050_10142132 | 258 |
| 1042 | 3300025299 | Ga0209256_1001569 | Ga0209256_10015694 | 258 |
| 1043 | 3300025302 | Ga0207426_1000267 | Ga0207426_100026775 | 258 |
| 1044 | 3300025303 | Ga0209051_1008485 | Ga0209051_10084852 | 258 |
| 1045 | 3300025304 | Ga0209257_1002116 | Ga0209257_100211623 | 258 |
| 1046 | 3300025315 | Ga0207697_10035020 | Ga0207697_100350202 | 258 |
| 1047 | 3300025321 | Ga0207656_10015273 | Ga0207656_100152733 | 258 |
| 1048 | 3300025893 | Ga0207682_10049223 | Ga0207682_100492232 | 258 |
| 1049 | 3300025898 | Ga0207692_10000364 | Ga0207692_1000036413 | 258 |
| 1050 | 3300025898 | Ga0207692_10003951 | Ga0207692_100039514 | 258 |
| 1051 | 3300025898 | Ga0207692_10005642 | Ga0207692_100056423 | 258 |
| 1052 | 3300025904 | Ga0207647_10238473 | Ga0207647_102384732 | 258 |
| 1053 | 3300025906 | Ga0207699_10000319 | Ga0207699_1000031912 | 258 |
| 1054 | 3300025906 | Ga0207699_10002988 | Ga0207699_100029886 | 258 |
| 1055 | 3300025906 | Ga0207699_10020623 | Ga0207699_100206233 | 258 |
| 1056 | 3300025906 | Ga0207699_10440202 | Ga0207699_104402021 | 258 |
| 1057 | 3300025911 | Ga0207654_10082507 | Ga0207654_100825072 | 258 |
| 1058 | 3300025912 | Ga0207707_10018699 | Ga0207707_100186993 | 258 |
| 1059 | 3300025912 | Ga0207707_10031747 | Ga0207707_100317474 | 258 |
| 1060 | 3300025912 | Ga0207707_10419105 | Ga0207707_104191052 | 258 |
| 1061 | 3300025913 | Ga0207695_10048138 | Ga0207695_100481383 | 258 |
| 1062 | 3300025913 | Ga0207695_10158677 | Ga0207695_101586772 | 258 |
| 1063 | 3300025915 | Ga0207693_10007176 | Ga0207693_100071765 | 258 |
| 1064 | 3300025915 | Ga0207693_10043239 | Ga0207693_100432393 | 258 |
| 1065 | 3300025915 | Ga0207693_10098517 | Ga0207693_100985172 | 258 |
| 1066 | 3300025916 | Ga0207663_10000417 | Ga0207663_1000041713 | 258 |
| 1067 | 3300025916 | Ga0207663_10015030 | Ga0207663_100150303 | 258 |
| 1068 | 3300025916 | Ga0207663_10039890 | Ga0207663_100398903 | 258 |
| 1069 | 3300025917 | Ga0207660_10003159 | Ga0207660_100031592 | 258 |
| 1070 | 3300025917 | Ga0207660_10091050 | Ga0207660_100910502 | 258 |
| 1071 | 3300025918 | Ga0207662_10134864 | Ga0207662_101348641 | 258 |
| 1072 | 3300025919 | Ga0207657_10001107 | Ga0207657_1000110715 | 258 |
| 1073 | 3300025919 | Ga0207657_10004372 | Ga0207657_1000437214 | 258 |
| 1074 | 3300025919 | Ga0207657_10108304 | Ga0207657_101083042 | 258 |
| 1075 | 3300025919 | Ga0207657_10334546 | Ga0207657_103345462 | 258 |
| 1076 | 3300025920 | Ga0207649_10379229 | Ga0207649_103792292 | 258 |
| 1077 | 3300025921 | Ga0207652_10020624 | Ga0207652_100206243 | 258 |
| 1078 | 3300025921 | Ga0207652_10186135 | Ga0207652_101861351 | 258 |
| 1079 | 3300025922 | Ga0207646_10454260 | Ga0207646_104542602 | 258 |
| 1080 | 3300025923 | Ga0207681_10483934 | Ga0207681_104839341 | 258 |
| 1081 | 3300025924 | Ga0207694_10019080 | Ga0207694_100190803 | 258 |
| 1082 | 3300025924 | Ga0207694_10321180 | Ga0207694_103211802 | 258 |
| 1083 | 3300025928 | Ga0207700_10095530 | Ga0207700_100955302 | 258 |
| 1084 | 3300025928 | Ga0207700_10120873 | Ga0207700_101208732 | 258 |
| 1085 | 3300025928 | Ga0207700_10139247 | Ga0207700_101392472 | 258 |
| 1086 | 3300025928 | Ga0207700_10245489 | Ga0207700_102454891 | 258 |
| 1087 | 3300025929 | Ga0207664_10059002 | Ga0207664_100590022 | 258 |
| 1088 | 3300025929 | Ga0207664_10107641 | Ga0207664_101076412 | 258 |
| 1089 | 3300025929 | Ga0207664_10272313 | Ga0207664_102723131 | 258 |
| 1090 | 3300025929 | Ga0207664_10388327 | Ga0207664_103883272 | 258 |
| 1091 | 3300025932 | Ga0207690_10266891 | Ga0207690_102668912 | 258 |
| 1092 | 3300025933 | Ga0207706_10013484 | Ga0207706_100134842 | 258 |
| 1093 | 3300025934 | Ga0207686_10354493 | Ga0207686_103544932 | 258 |
| 1094 | 3300025939 | Ga0207665_10000190 | Ga0207665_1000019010 | 258 |
| 1095 | 3300025939 | Ga0207665_10016066 | Ga0207665_100160663 | 258 |
| 1096 | 3300025939 | Ga0207665_10212063 | Ga0207665_102120631 | 258 |
| 1097 | 3300025939 | Ga0207665_10510225 | Ga0207665_105102251 | 258 |
| 1098 | 3300025944 | Ga0207661_10013657 | Ga0207661_100136572 | 258 |
| 1099 | 3300025949 | Ga0207667_10005778 | Ga0207667_1000577813 | 258 |
| 1100 | 3300025949 | Ga0207667_10483827 | Ga0207667_104838272 | 258 |
| 1101 | 3300025961 | Ga0207712_10049315 | Ga0207712_100493152 | 258 |
| 1102 | 3300025972 | Ga0207668_10061439 | Ga0207668_100614393 | 258 |
| 1103 | 3300025986 | Ga0207658_10145331 | Ga0207658_101453312 | 258 |
| 1104 | 3300026035 | Ga0207703_10616397 | Ga0207703_106163971 | 258 |
| 1105 | 3300026041 | Ga0207639_10275252 | Ga0207639_102752521 | 258 |
| 1106 | 3300026041 | Ga0207639_10378559 | Ga0207639_103785592 | 258 |
| 1107 | 3300026041 | Ga0207639_10671936 | Ga0207639_106719362 | 258 |
| 1108 | 3300026067 | Ga0207678_10064676 | Ga0207678_100646762 | 258 |
| 1109 | 3300026067 | Ga0207678_10068316 | Ga0207678_100683164 | 258 |
| 1110 | 3300026089 | Ga0207648_10124804 | Ga0207648_101248042 | 258 |
| 1111 | 3300026116 | Ga0207674_10046213 | Ga0207674_100462133 | 258 |
| 1112 | 3300026116 | Ga0207674_10604412 | Ga0207674_106044121 | 258 |
| 1113 | 3300026118 | Ga0207675_100161090 | Ga0207675_1001610902 | 258 |
| 1114 | 3300026118 | Ga0207675_100685017 | Ga0207675_1006850171 | 258 |
| 1115 | 3300026121 | Ga0207683_10031453 | Ga0207683_100314532 | 258 |
| 1116 | 3300026121 | Ga0207683_10049770 | Ga0207683_100497702 | 258 |
| 1117 | 3300026121 | Ga0207683_10209554 | Ga0207683_102095542 | 258 |
| 1118 | 3300026142 | Ga0207698_10916551 | Ga0207698_109165511 | 258 |
| 1119 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001134 | 258 |
| 1120 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011193 | 258 |
| 1121 | 3300027361 | Ga0209489_100012 | Ga0209489_100012193 | 258 |
| 1122 | 3300027361 | Ga0209489_100612 | Ga0209489_10061214 | 258 |
| 1123 | 3300027363 | Ga0209700_100007 | Ga0209700_100007291 | 258 |
| 1124 | 3300027363 | Ga0209700_100019 | Ga0209700_100019193 | 258 |
| 1125 | 3300028379 | Ga0268266_10018792 | Ga0268266_100187923 | 258 |
| 1126 | 3300028379 | Ga0268266_10177582 | Ga0268266_101775822 | 258 |
| 1127 | 3300028379 | Ga0268266_10325536 | Ga0268266_103255362 | 258 |
| 1128 | 3300028381 | Ga0268264_10887731 | Ga0268264_108877312 | 258 |
| 1129 | 3300028556 | Ga0265337_1006052 | Ga0265337_10060524 | 258 |
| 1130 | 3300028558 | Ga0265326_10003632 | Ga0265326_100036322 | 258 |
| 1131 | 3300028563 | Ga0265319_1009562 | Ga0265319_10095624 | 258 |
| 1132 | 3300028573 | Ga0265334_10018461 | Ga0265334_100184612 | 258 |
| 1133 | 3300028577 | Ga0265318_10014529 | Ga0265318_100145292 | 258 |
| 1134 | 3300028653 | Ga0265323_10002008 | Ga0265323_100020089 | 258 |
| 1135 | 3300028666 | Ga0265336_10002276 | Ga0265336_100022762 | 258 |
| 1136 | 3300028794 | Ga0307515_10166938 | Ga0307515_101669382 | 258 |
| 1137 | 3300028800 | Ga0265338_10007046 | Ga0265338_100070465 | 258 |
| 1138 | 3300029957 | Ga0265324_10012696 | Ga0265324_100126962 | 258 |
| 1139 | 3300031235 | Ga0265330_10008271 | Ga0265330_100082716 | 258 |
| 1140 | 3300031235 | Ga0265330_10041431 | Ga0265330_100414312 | 258 |
| 1141 | 3300031235 | Ga0265330_10111848 | Ga0265330_101118481 | 258 |
| 1142 | 3300031238 | Ga0265332_10006592 | Ga0265332_100065924 | 258 |
| 1143 | 3300031238 | Ga0265332_10011731 | Ga0265332_100117312 | 258 |
| 1144 | 3300031239 | Ga0265328_10101343 | Ga0265328_101013432 | 258 |
| 1145 | 3300031241 | Ga0265325_10009944 | Ga0265325_100099442 | 258 |
| 1146 | 3300031247 | Ga0265340_10003690 | Ga0265340_100036902 | 258 |
| 1147 | 3300031247 | Ga0265340_10086993 | Ga0265340_100869932 | 258 |
| 1148 | 3300031247 | Ga0265340_10121365 | Ga0265340_101213651 | 258 |
| 1149 | 3300031249 | Ga0265339_10001505 | Ga0265339_100015053 | 258 |
| 1150 | 3300031344 | Ga0265316_10251612 | Ga0265316_102516122 | 258 |
| 1151 | 3300031711 | Ga0265314_10002744 | Ga0265314_100027445 | 258 |
| 1152 | 3300031712 | Ga0265342_10169414 | Ga0265342_101694141 | 258 |
| 1153 | 3300031730 | Ga0307516_10056839 | Ga0307516_100568393 | 258 |
| 1154 | 3300031730 | Ga0307516_10224046 | Ga0307516_102240462 | 258 |
| 1155 | 3300033180 | Ga0307510_10050890 | Ga0307510_100508903 | 258 |
| 1156 | 3300033180 | Ga0307510_10063819 | Ga0307510_100638192 | 258 |
| 1157 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002111 | 258 |
| 1158 | 3300034818 | Ga0373950_0031985 | Ga0373950_0031985_64_846 | 258 |
| 1159 | 3300035086 | Ga0373934_0016121 | Ga0373934_0016121_1862_2644 | 258 |
| 1160 | 3300035111 | Ga0373923_0000289 | Ga0373923_0000289_6996_7790 | 258 |
| 1161 | 3300035113 | Ga0373936_0006387 | Ga0373936_0006387_688_1470 | 258 |
| 1162 | 3300035116 | Ga0373945_0063014 | Ga0373945_0063014_432_1214 | 258 |
| 1163 | 3300035118 | Ga0373954_0001207 | Ga0373954_0001207_924_1718 | 258 |
| 1164 | 3300035118 | Ga0373954_0088515 | Ga0373954_0088515_684_1466 | 258 |
| 1165 | 3300035118 | Ga0373954_0140355 | Ga0373954_0140355_28_810 | 258 |
| 1166 | 3300035119 | Ga0373956_0010705 | Ga0373956_0010705_769_1551 | 258 |
| 1167 | 3300035119 | Ga0373956_0093265 | Ga0373956_0093265_384_1166 | 258 |
| 1168 | 3300035120 | Ga0373957_0009960 | Ga0373957_0009960_2138_2932 | 258 |
| 1169 | 3300035170 | Ga0373943_0032647 | Ga0373943_0032647_311_1093 | 258 |
| 1170 | 3300035170 | Ga0373943_0135699 | Ga0373943_0135699_98_880 | 258 |
| 1171 | 3300035171 | Ga0373946_0003713 | Ga0373946_0003713_1874_2656 | 258 |
| 1172 | 3300035171 | Ga0373946_0107013 | Ga0373946_0107013_440_1222 | 258 |
| 1173 | 3300035172 | Ga0373955_0009767 | Ga0373955_0009767_3559_4341 | 258 |
| 1174 | 3300035172 | Ga0373955_0047368 | Ga0373955_0047368_795_1577 | 258 |
| 1175 | 3300035242 | Ga0373962_0093402 | Ga0373962_0093402_67_849 | 258 |
| 1176 | 3300035410 | Ga0373924_0012573 | Ga0373924_0012573_1613_2395 | 258 |
| 1177 | 3300035410 | Ga0373924_0061287 | Ga0373924_0061287_255_1037 | 258 |
| 1178 | 3300035692 | Ga0373935_0000499 | Ga0373935_0000499_19154_19936 | 258 |
| 1179 | 3300035692 | Ga0373935_0397416 | Ga0373935_0397416_73_855 | 258 |
| 1180 | 3300035724 | Ga0373933_0001914 | Ga0373933_0001914_9263_10045 | 258 |
| 1181 | 3300035725 | Ga0373947_0001481 | Ga0373947_0001481_12206_12988 | 258 |
| 1182 | 3300035725 | Ga0373947_0198789 | Ga0373947_0198789_142_924 | 258 |
| 1183 | 3300035725 | Ga0373947_0244977 | Ga0373947_0244977_237_1037 | 258 |
| 1184 | 3300036401 | Ga0373937_0004047 | Ga0373937_0004047_3672_4454 | 258 |
| 1185 | 3300036401 | Ga0373937_0014169 | Ga0373937_0014169_1448_2230 | 258 |
| 1186 | 3300036401 | Ga0373937_0026809 | Ga0373937_0026809_596_1378 | 258 |
| 1187 | 3300036401 | Ga0373937_0166521 | Ga0373937_0166521_427_1209 | 258 |
| 1188 | 3300037068 | Ga0373925_0010291 | Ga0373925_0010291_3289_4071 | 258 |
| 1189 | 3300037312 | Ga0395899_0075081 | Ga0395899_0075081_1423_2205 | 258 |
| 1190 | 3300037418 | Ga0395900_0000851 | Ga0395900_0000851_23383_24165 | 258 |
| 1191 | 3300037418 | Ga0395900_0407528 | Ga0395900_0407528_325_1116 | 258 |
| 1192 | 3300037466 | Ga0395898_0008255 | Ga0395898_0008255_9409_10191 | 258 |
| 1193 | 3300037466 | Ga0395898_0009621 | Ga0395898_0009621_67_849 | 258 |
| 1194 | 3300037466 | Ga0395898_0261367 | Ga0395898_0261367_455_1237 | 258 |
| 1195 | 3300037466 | Ga0395898_0463388 | Ga0395898_0463388_256_1047 | 258 |
| 1196 | 3300037471 | Ga0395905_0076783 | Ga0395905_0076783_1836_2618 | 258 |
| 1197 | 3300038443 | Ga0395901_0009809 | Ga0395901_0009809_1629_2411 | 258 |
| 1198 | 3300039437 | Ga0436365_0256340 | Ga0436365_0256340_252_1034 | 258 |
| 1199 | 3300039437 | Ga0436365_1226979 | Ga0436365_1226979_113_895 | 258 |
| 1200 | 3300039447 | Ga0436361_0265242 | Ga0436361_0265242_977_1759 | 258 |
| 1201 | 3300039450 | Ga0436363_0687569 | Ga0436363_0687569_589_1371 | 258 |
| 1202 | 3300039450 | Ga0436363_1579678 | Ga0436363_1579678_280_1080 | 258 |
| 1203 | 3300039453 | Ga0436362_0328324 | Ga0436362_0328324_2323_3105 | 258 |
| 1204 | 3300041491 | Ga0451833_0873998 | Ga0451833_0873998_113_895 | 258 |
| 1205 | 3300044684 | Ga0466966_0279073 | Ga0466966_0279073_108_890 | 258 |
| 1206 | 3300044694 | Ga0466963_0226529 | Ga0466963_0226529_121_903 | 258 |
| 1207 | 3300044706 | Ga0466964_0076952 | Ga0466964_0076952_316_1098 | 258 |
| 1208 | 3300044842 | Ga0466957_0129569 | Ga0466957_0129569_609_1391 | 258 |
| 1209 | 3300044842 | Ga0466957_0305128 | Ga0466957_0305128_159_935 | 258 |
| 1210 | 3300046454 | Ga0495592_0003354 | Ga0495592_0003354_630_1412 | 258 |
| 1211 | 3300046454 | Ga0495592_0018326 | Ga0495592_0018326_1777_2559 | 258 |
| 1212 | 3300046454 | Ga0495592_0102690 | Ga0495592_0102690_330_1112 | 258 |
| 1213 | 3300046455 | Ga0495603_0000040 | Ga0495603_0000040_4795_5577 | 258 |
| 1214 | 3300046455 | Ga0495603_0190516 | Ga0495603_0190516_15_797 | 258 |
| 1215 | 3300046455 | Ga0495603_0251742 | Ga0495603_0251742_22_804 | 258 |
| 1216 | 3300046459 | Ga0495629_0000077 | Ga0495629_0000077_724_1506 | 258 |
| 1217 | 3300046459 | Ga0495629_0000188 | Ga0495629_0000188_33713_34495 | 258 |
| 1218 | 3300046459 | Ga0495629_0023257 | Ga0495629_0023257_3142_3924 | 258 |
| 1219 | 3300046460 | Ga0495638_0015053 | Ga0495638_0015053_3287_4069 | 258 |
| 1220 | 3300046462 | Ga0495651_0023165 | Ga0495651_0023165_3705_4487 | 258 |
| 1221 | 3300046462 | Ga0495651_0023797 | Ga0495651_0023797_1940_2722 | 258 |
| 1222 | 3300046462 | Ga0495651_0221858 | Ga0495651_0221858_63_845 | 258 |
| 1223 | 3300046463 | Ga0495653_0004244 | Ga0495653_0004244_8980_9762 | 258 |
| 1224 | 3300046472 | Ga0495580_0003456 | Ga0495580_0003456_7573_8355 | 258 |
| 1225 | 3300046473 | Ga0495582_0000020 | Ga0495582_0000020_68238_69020 | 258 |
| 1226 | 3300046473 | Ga0495582_0339855 | Ga0495582_0339855_34_816 | 258 |
| 1227 | 3300046475 | Ga0495639_0000011 | Ga0495639_0000011_60886_61668 | 258 |
| 1228 | 3300046476 | Ga0495662_0000229 | Ga0495662_0000229_17472_18254 | 258 |
| 1229 | 3300046477 | Ga0495664_0054228 | Ga0495664_0054228_123_905 | 258 |
| 1230 | 3300046499 | Ga0495594_0002423 | Ga0495594_0002423_397_1179 | 258 |
| 1231 | 3300046501 | Ga0495607_0039575 | Ga0495607_0039575_548_1330 | 258 |
| 1232 | 3300046507 | Ga0495606_0013074 | Ga0495606_0013074_3844_4626 | 258 |
| 1233 | 3300046507 | Ga0495606_0031762 | Ga0495606_0031762_235_1017 | 258 |
| 1234 | 3300046511 | Ga0495608_0006190 | Ga0495608_0006190_723_1517 | 258 |
| 1235 | 3300046513 | Ga0495616_0061165 | Ga0495616_0061165_542_1324 | 258 |
| 1236 | 3300046514 | Ga0495618_0049300 | Ga0495618_0049300_1720_2502 | 258 |
| 1237 | 3300046515 | Ga0495620_0073293 | Ga0495620_0073293_305_1087 | 258 |
| 1238 | 3300046516 | Ga0495628_0047293 | Ga0495628_0047293_945_1727 | 258 |
| 1239 | 3300046517 | Ga0495630_0005419 | Ga0495630_0005419_1913_2695 | 258 |
| 1240 | 3300046519 | Ga0495632_0177113 | Ga0495632_0177113_19_801 | 258 |
| 1241 | 3300046522 | Ga0495643_0063870 | Ga0495643_0063870_586_1368 | 258 |
| 1242 | 3300046524 | Ga0495648_0068085 | Ga0495648_0068085_745_1527 | 258 |
| 1243 | 3300046524 | Ga0495648_0068596 | Ga0495648_0068596_495_1277 | 258 |
| 1244 | 3300046529 | Ga0495652_0055109 | Ga0495652_0055109_751_1533 | 258 |
| 1245 | 3300046529 | Ga0495652_0059496 | Ga0495652_0059496_832_1614 | 258 |
| 1246 | 3300046531 | Ga0495665_0000133 | Ga0495665_0000133_29014_29796 | 258 |
| 1247 | 3300046533 | Ga0495640_0010408 | Ga0495640_0010408_2003_2785 | 258 |
| 1248 | 3300046543 | Ga0495645_0013345 | Ga0495645_0013345_1201_1983 | 258 |
| 1249 | 3300046543 | Ga0495645_0037041 | Ga0495645_0037041_2251_3033 | 258 |
| 1250 | 3300046543 | Ga0495645_0261797 | Ga0495645_0261797_70_852 | 258 |
| 1251 | 3300046557 | Ga0495622_0006251 | Ga0495622_0006251_414_1196 | 258 |
| 1252 | 3300046557 | Ga0495622_0085745 | Ga0495622_0085745_52_834 | 258 |
| 1253 | 3300046557 | Ga0495622_0170975 | Ga0495622_0170975_57_839 | 258 |
| 1254 | 3300046558 | Ga0495633_0125707 | Ga0495633_0125707_338_1120 | 258 |
| 1255 | 3300046616 | Ga0495668_0038869 | Ga0495668_0038869_857_1639 | 258 |
| 1256 | 3300046616 | Ga0495668_0128180 | Ga0495668_0128180_276_1058 | 258 |
| 1257 | 3300046642 | Ga0495634_0000402 | Ga0495634_0000402_28704_29486 | 258 |
| 1258 | 3300046642 | Ga0495634_0009196 | Ga0495634_0009196_4531_5325 | 258 |
| 1259 | 3300046663 | Ga0495635_0000196 | Ga0495635_0000196_742_1536 | 258 |
| 1260 | 3300046663 | Ga0495635_0012249 | Ga0495635_0012249_3254_4036 | 258 |
| 1261 | 3300046663 | Ga0495635_0015570 | Ga0495635_0015570_1311_2093 | 258 |
| 1262 | 3300046663 | Ga0495635_0084244 | Ga0495635_0084244_836_1618 | 258 |
| 1263 | 3300046665 | Ga0495661_0033831 | Ga0495661_0033831_625_1407 | 258 |
| 1264 | 3300046674 | Ga0495588_0015223 | Ga0495588_0015223_2031_2813 | 258 |
| 1265 | 3300046675 | Ga0495657_0001347 | Ga0495657_0001347_701_1495 | 258 |
| 1266 | 3300046675 | Ga0495657_0130252 | Ga0495657_0130252_726_1508 | 258 |
| 1267 | 3300046679 | Ga0495623_0104712 | Ga0495623_0104712_493_1275 | 258 |
| 1268 | 3300046679 | Ga0495623_0213024 | Ga0495623_0213024_65_847 | 258 |
| 1269 | 3300046680 | Ga0495646_0044961 | Ga0495646_0044961_1173_1955 | 258 |
| 1270 | 3300046680 | Ga0495646_0053965 | Ga0495646_0053965_552_1334 | 258 |
| 1271 | 3300046680 | Ga0495646_0111070 | Ga0495646_0111070_255_1037 | 258 |
| 1272 | 3300046681 | Ga0495647_0010003 | Ga0495647_0010003_327_1109 | 258 |
| 1273 | 3300046683 | Ga0495658_0000538 | Ga0495658_0000538_16222_17004 | 258 |
| 1274 | 3300046689 | Ga0495613_0000873 | Ga0495613_0000873_7635_8417 | 258 |
| 1275 | 3300046689 | Ga0495613_0027935 | Ga0495613_0027935_485_1267 | 258 |
| 1276 | 3300046690 | Ga0495624_0000819 | Ga0495624_0000819_19549_20331 | 258 |
| 1277 | 3300046694 | Ga0495649_0056075 | Ga0495649_0056075_56_838 | 258 |
| 1278 | 3300046809 | Ga0495600_0012427 | Ga0495600_0012427_3817_4599 | 258 |
| 1279 | 3300046809 | Ga0495600_0030740 | Ga0495600_0030740_975_1757 | 258 |
| 1280 | 3300046809 | Ga0495600_0099306 | Ga0495600_0099306_559_1341 | 258 |
| 1281 | 3300047315 | Ga0495581_0000518 | Ga0495581_0000518_15674_16456 | 258 |
| 1282 | 3300047317 | Ga0495604_0004984 | Ga0495604_0004984_9105_9887 | 258 |
| 1283 | 3300047317 | Ga0495604_0020026 | Ga0495604_0020026_748_1530 | 258 |
| 1284 | 3300047317 | Ga0495604_0305358 | Ga0495604_0305358_116_898 | 258 |
| 1285 | 3300047317 | Ga0495604_0340537 | Ga0495604_0340537_155_937 | 258 |
| 1286 | 3300047319 | Ga0495674_0001070 | Ga0495674_0001070_19513_20295 | 258 |
| 1287 | 3300047319 | Ga0495674_0066903 | Ga0495674_0066903_176_958 | 258 |
| 1288 | 3300047319 | Ga0495674_0141255 | Ga0495674_0141255_517_1299 | 258 |
| 1289 | 3300047320 | Ga0495672_0012004 | Ga0495672_0012004_3455_4237 | 258 |
| 1290 | 3300047321 | Ga0495676_0033175 | Ga0495676_0033175_3352_4134 | 258 |
| 1291 | 3300047321 | Ga0495676_0072590 | Ga0495676_0072590_1498_2280 | 258 |
| 1292 | 3300047322 | Ga0495680_0013711 | Ga0495680_0013711_3469_4263 | 258 |
| 1293 | 3300047322 | Ga0495680_0114735 | Ga0495680_0114735_644_1426 | 258 |
| 1294 | 3300047322 | Ga0495680_0189206 | Ga0495680_0189206_397_1179 | 258 |
| 1295 | 3300047444 | Ga0495675_0000638 | Ga0495675_0000638_533_1315 | 258 |
| 1296 | 3300047469 | Ga0495673_0113117 | Ga0495673_0113117_15_797 | 258 |
| 1297 | 3300047471 | Ga0495684_0000068 | Ga0495684_0000068_61541_62335 | 258 |
| 1298 | 3300047471 | Ga0495684_0063761 | Ga0495684_0063761_1670_2452 | 258 |
| 1299 | 3300047472 | Ga0495686_0082404 | Ga0495686_0082404_144_926 | 258 |
| 1300 | 3300047673 | Ga0495593_0000006 | Ga0495593_0000006_14869_15651 | 258 |
| 1301 | 3300047673 | Ga0495593_0007104 | Ga0495593_0007104_3724_4506 | 258 |
| 1302 | 3300048088 | Ga0495602_0029704 | Ga0495602_0029704_641_1423 | 258 |
| 1303 | 3300048904 | Ga0496101_0283463 | Ga0496101_0283463_282_1064 | 258 |
| 1304 | 3300048905 | Ga0496102_0036626 | Ga0496102_0036626_1823_2605 | 258 |
| 1305 | 3300048907 | Ga0496104_0001744 | Ga0496104_0001744_7374_8156 | 258 |
| 1306 | 3300048907 | Ga0496104_0422288 | Ga0496104_0422288_396_1178 | 258 |
| 1307 | 3300048908 | Ga0496105_0002142 | Ga0496105_0002142_185_967 | 258 |
| 1308 | 3300048909 | Ga0496106_0044275 | Ga0496106_0044275_1882_2664 | 258 |
| 1309 | 3300048910 | Ga0496107_0418635 | Ga0496107_0418635_32_814 | 258 |
| 1310 | 3300048912 | Ga0496109_0772365 | Ga0496109_0772365_90_872 | 258 |
| 1311 | 3300048913 | Ga0496110_0037452 | Ga0496110_0037452_1415_2197 | 258 |
| 1312 | 3300048913 | Ga0496110_0080326 | Ga0496110_0080326_663_1445 | 258 |
| 1313 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_182949_183731 | 258 |
| 1314 | 3300048915 | Ga0496112_0042892 | Ga0496112_0042892_790_1572 | 258 |
| 1315 | 3300048915 | Ga0496112_0082096 | Ga0496112_0082096_1339_2121 | 258 |
| 1316 | 3300048915 | Ga0496112_0094161 | Ga0496112_0094161_1758_2540 | 258 |
| 1317 | 3300048915 | Ga0496112_0158529 | Ga0496112_0158529_1171_1953 | 258 |
| 1318 | 3300048915 | Ga0496112_0259552 | Ga0496112_0259552_186_968 | 258 |
| 1319 | 3300048916 | Ga0496113_0029385 | Ga0496113_0029385_1370_2152 | 258 |
| 1320 | 3300048917 | Ga0496114_0135248 | Ga0496114_0135248_400_1182 | 258 |
| 1321 | 3300048917 | Ga0496114_0225884 | Ga0496114_0225884_354_1136 | 258 |
| 1322 | 3300048917 | Ga0496114_0512394 | Ga0496114_0512394_189_971 | 258 |
| 1323 | 3300048918 | Ga0496115_0015437 | Ga0496115_0015437_321_1103 | 258 |
| 1324 | 3300048918 | Ga0496115_0040567 | Ga0496115_0040567_2897_3679 | 258 |
| 1325 | 3300048918 | Ga0496115_0067618 | Ga0496115_0067618_1705_2487 | 258 |
| 1326 | 3300048918 | Ga0496115_0276809 | Ga0496115_0276809_375_1157 | 258 |
| 1327 | 3300048919 | Ga0496116_0001079 | Ga0496116_0001079_10772_11554 | 258 |
| 1328 | 3300048919 | Ga0496116_0251187 | Ga0496116_0251187_22_804 | 258 |
| 1329 | 3300048920 | Ga0496117_0054193 | Ga0496117_0054193_1297_2079 | 258 |
| 1330 | 3300048920 | Ga0496117_0062441 | Ga0496117_0062441_1303_2088 | 258 |
| 1331 | 3300048920 | Ga0496117_0126045 | Ga0496117_0126045_348_1130 | 258 |
| 1332 | 3300048921 | Ga0496118_0036913 | Ga0496118_0036913_364_1146 | 258 |
| 1333 | 3300048921 | Ga0496118_0047345 | Ga0496118_0047345_1490_2272 | 258 |
| 1334 | 3300048921 | Ga0496118_0084124 | Ga0496118_0084124_1352_2134 | 258 |
| 1335 | 3300048921 | Ga0496118_0156068 | Ga0496118_0156068_97_879 | 258 |
| 1336 | 3300048921 | Ga0496118_0236065 | Ga0496118_0236065_44_826 | 258 |
| 1337 | 3300048922 | Ga0496119_0020449 | Ga0496119_0020449_2991_3773 | 258 |
| 1338 | 3300048922 | Ga0496119_0113111 | Ga0496119_0113111_352_1134 | 258 |
| 1339 | 3300048923 | Ga0496120_0009024 | Ga0496120_0009024_5606_6388 | 258 |
| 1340 | 3300048923 | Ga0496120_0103135 | Ga0496120_0103135_15_797 | 258 |
| 1341 | 3300048924 | Ga0496121_0001488 | Ga0496121_0001488_2107_2889 | 258 |
| 1342 | 3300048924 | Ga0496121_0002000 | Ga0496121_0002000_3375_4157 | 258 |
| 1343 | 3300048924 | Ga0496121_0014293 | Ga0496121_0014293_842_1627 | 258 |
| 1344 | 3300048924 | Ga0496121_0108787 | Ga0496121_0108787_1027_1809 | 258 |
| 1345 | 3300048924 | Ga0496121_0111529 | Ga0496121_0111529_477_1259 | 258 |
| 1346 | 3300048925 | Ga0496122_0073748 | Ga0496122_0073748_772_1554 | 258 |
| 1347 | 3300048926 | Ga0496123_0044032 | Ga0496123_0044032_1795_2577 | 258 |
| 1348 | 3300048927 | Ga0496124_0037607 | Ga0496124_0037607_323_1105 | 258 |
| 1349 | 3300048927 | Ga0496124_0392713 | Ga0496124_0392713_168_950 | 258 |
| 1350 | 3300048928 | Ga0496125_0010421 | Ga0496125_0010421_5916_6698 | 258 |
| 1351 | 3300048928 | Ga0496125_0018563 | Ga0496125_0018563_4632_5414 | 258 |
| 1352 | 3300048928 | Ga0496125_0048379 | Ga0496125_0048379_1449_2231 | 258 |
| 1353 | 3300048928 | Ga0496125_0103617 | Ga0496125_0103617_1155_1937 | 258 |
| 1354 | 3300048928 | Ga0496125_0317897 | Ga0496125_0317897_102_884 | 258 |
| 1355 | 3300048929 | Ga0496126_0005288 | Ga0496126_0005288_5552_6334 | 258 |
| 1356 | 3300048929 | Ga0496126_0006081 | Ga0496126_0006081_2197_2979 | 258 |
| 1357 | 3300048929 | Ga0496126_0020645 | Ga0496126_0020645_451_1233 | 258 |
| 1358 | 3300048929 | Ga0496126_0119862 | Ga0496126_0119862_1412_2194 | 258 |
| 1359 | 3300048929 | Ga0496126_0135001 | Ga0496126_0135001_1298_2083 | 258 |
| 1360 | 3300048929 | Ga0496126_0240653 | Ga0496126_0240653_162_944 | 258 |
| 1361 | 3300048929 | Ga0496126_0296031 | Ga0496126_0296031_301_1083 | 258 |
| 1362 | 3300049569 | Ga0501032_0000392 | Ga0501032_0000392_13922_14716 | 258 |
| 1363 | 3300049569 | Ga0501032_0205166 | Ga0501032_0205166_40_831 | 258 |
| 1364 | 3300049570 | Ga0501033_0000232 | Ga0501033_0000232_42173_42967 | 258 |
| 1365 | 3300049570 | Ga0501033_0019714 | Ga0501033_0019714_3756_4547 | 258 |
| 1366 | 3300049571 | Ga0501034_0000704 | Ga0501034_0000704_38064_38858 | 258 |
| 1367 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_189456_190250 | 258 |
| 1368 | 3300049572 | Ga0501036_0612326 | Ga0501036_0612326_49_840 | 258 |
| 1369 | 3300049573 | Ga0501037_0000066 | Ga0501037_0000066_83695_84489 | 258 |
| 1370 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_49751_50545 | 258 |
| 1371 | 3300049574 | Ga0501038_0043211 | Ga0501038_0043211_2336_3127 | 258 |
| 1372 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_61941_62735 | 258 |
| 1373 | 3300049579 | Ga0501043_0000036 | Ga0501043_0000036_93634_94428 | 258 |
| 1374 | 3300049579 | Ga0501043_0063197 | Ga0501043_0063197_1182_1973 | 258 |
| 1375 | 3300049580 | Ga0501046_0000147 | Ga0501046_0000147_45394_46188 | 258 |
| 1376 | 3300049580 | Ga0501046_0152222 | Ga0501046_0152222_441_1232 | 258 |
| 1377 | 3300049581 | Ga0501047_0000209 | Ga0501047_0000209_20671_21465 | 258 |
| 1378 | 3300049582 | Ga0501048_0000460 | Ga0501048_0000460_2714_3508 | 258 |
| 1379 | 3300049584 | Ga0501068_0000569 | Ga0501068_0000569_16944_17738 | 258 |
| 1380 | 3300049585 | Ga0501069_0060551 | Ga0501069_0060551_979_1773 | 258 |
| 1381 | 3300049586 | Ga0501070_0000163 | Ga0501070_0000163_45717_46511 | 258 |
| 1382 | 3300049587 | Ga0501071_0108835 | Ga0501071_0108835_1090_1884 | 258 |
| 1383 | 3300049588 | Ga0501072_0026856 | Ga0501072_0026856_2136_2930 | 258 |
| 1384 | 3300049589 | Ga0501073_0000070 | Ga0501073_0000070_9909_10703 | 258 |
| 1385 | 3300049741 | Ga0501079_0132167 | Ga0501079_0132167_569_1363 | 258 |
| 1386 | 3300049742 | Ga0501080_0000137 | Ga0501080_0000137_11250_12044 | 258 |
| 1387 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_3924_4718 | 258 |
| 1388 | 3300049822 | Ga0501035_0064059 | Ga0501035_0064059_59_850 | 258 |
| 1389 | 3300049823 | Ga0501044_0000366 | Ga0501044_0000366_44890_45684 | 258 |
| 1390 | 3300049824 | Ga0501045_0062432 | Ga0501045_0062432_1917_2711 | 258 |
| 1391 | 3300050490 | nmdc:mga03n38_4598_c1 | nmdc:mga03n38_4598_c1_1351_2130 | 258 |
| 1392 | 3300050490 | nmdc:mga03n38_55100_c1 | nmdc:mga03n38_55100_c1_470_1252 | 258 |
| 1393 | 3300050491 | nmdc:mga00v17_128981_c1 | nmdc:mga00v17_128981_c1_87_866 | 258 |
| 1394 | 3300050491 | nmdc:mga00v17_208266_c1 | nmdc:mga00v17_208266_c1_379_1161 | 258 |
| 1395 | 3300050491 | nmdc:mga00v17_63217_c1 | nmdc:mga00v17_63217_c1_1200_1982 | 258 |
| 1396 | 3300050492 | nmdc:mga0yw44_292175_c1 | nmdc:mga0yw44_292175_c1_128_907 | 258 |
| 1397 | 3300050492 | nmdc:mga0yw44_51827_c1 | nmdc:mga0yw44_51827_c1_1260_2042 | 258 |
| 1398 | 3300050494 | nmdc:mga06z11_13270_c1 | nmdc:mga06z11_13270_c1_1334_2113 | 258 |
| 1399 | 3300050494 | nmdc:mga06z11_22394_c1 | nmdc:mga06z11_22394_c1_765_1544 | 258 |
| 1400 | 3300050494 | nmdc:mga06z11_291901_c1 | nmdc:mga06z11_291901_c1_60_842 | 258 |
| 1401 | 3300050496 | nmdc:mga07m45_161000_c1 | nmdc:mga07m45_161000_c1_441_1220 | 258 |
| 1402 | 3300050512 | nmdc:mga0n895_407573_c1 | nmdc:mga0n895_407573_c1_150_932 | 258 |
| 1403 | 3300050512 | nmdc:mga0n895_72147_c1 | nmdc:mga0n895_72147_c1_1201_1983 | 258 |
| 1404 | 3300050514 | nmdc:mga08x19_195522_c1 | nmdc:mga08x19_195522_c1_295_1077 | 258 |
| 1405 | 3300050516 | nmdc:mga0sz30_22053_c1 | nmdc:mga0sz30_22053_c1_1137_1919 | 258 |
| 1406 | 3300053077 | Ga0495601_0194980 | Ga0495601_0194980_239_1021 | 258 |
| 1407 | 3300053077 | Ga0495601_0246425 | Ga0495601_0246425_340_1122 | 258 |
| 1408 | 3300053078 | Ga0495612_0031082 | Ga0495612_0031082_1253_2035 | 258 |
| 1409 | 3300053078 | Ga0495612_0064504 | Ga0495612_0064504_371_1153 | 258 |
| 1410 | 3300053080 | Ga0500635_0022379 | Ga0500635_0022379_626_1408 | 258 |
| 1411 | 3300053084 | Ga0495595_0011980 | Ga0495595_0011980_321_1115 | 258 |
| 1412 | 3300053085 | Ga0495619_0000829 | Ga0495619_0000829_7696_8490 | 258 |
| 1413 | 3300053085 | Ga0495619_0082427 | Ga0495619_0082427_734_1516 | 258 |
| 1414 | 3300053088 | Ga0500644_0015403 | Ga0500644_0015403_55_837 | 258 |
| 1415 | 3300053089 | Ga0500581_036511 | Ga0500581_036511_1550_2332 | 258 |
| 1416 | 3300053091 | Ga0500647_0043590 | Ga0500647_0043590_926_1708 | 258 |
| 1417 | 3300053094 | Ga0500566_0000043 | Ga0500566_0000043_1824_2606 | 258 |
| 1418 | 3300053094 | Ga0500566_0000479 | Ga0500566_0000479_12644_13426 | 258 |
| 1419 | 3300053094 | Ga0500566_0001303 | Ga0500566_0001303_1059_1841 | 258 |
| 1420 | 3300053094 | Ga0500566_0007953 | Ga0500566_0007953_5126_5908 | 258 |
| 1421 | 3300053095 | Ga0500640_011315 | Ga0500640_011315_2489_3271 | 258 |
| 1422 | 3300053096 | Ga0500641_0015386 | Ga0500641_0015386_1701_2483 | 258 |
| 1423 | 3300053098 | Ga0500650_0011529 | Ga0500650_0011529_342_1124 | 258 |
| 1424 | 3300053103 | Ga0500555_068946 | Ga0500555_068946_80_862 | 258 |
| 1425 | 3300053104 | Ga0500556_0000093 | Ga0500556_0000093_12892_13674 | 258 |
| 1426 | 3300053111 | Ga0500572_004209 | Ga0500572_004209_323_1105 | 258 |
| 1427 | 3300053116 | Ga0500592_001027 | Ga0500592_001027_2484_3266 | 258 |
| 1428 | 3300053118 | Ga0500594_0010492 | Ga0500594_0010492_497_1279 | 258 |
| 1429 | 3300053119 | Ga0500595_000722 | Ga0500595_000722_5731_6516 | 258 |
| 1430 | 3300053119 | Ga0500595_009591 | Ga0500595_009591_159_941 | 258 |
| 1431 | 3300053119 | Ga0500595_042887 | Ga0500595_042887_342_1124 | 258 |
| 1432 | 3300053121 | Ga0500607_050231 | Ga0500607_050231_881_1663 | 258 |
| 1433 | 3300053122 | Ga0500608_013224 | Ga0500608_013224_988_1770 | 258 |
| 1434 | 3300053122 | Ga0500608_018017 | Ga0500608_018017_857_1639 | 258 |
| 1435 | 3300053123 | Ga0500614_007785 | Ga0500614_007785_1091_1873 | 258 |
| 1436 | 3300053130 | Ga0500642_0000013 | Ga0500642_0000013_60377_61159 | 258 |
| 1437 | 3300053131 | Ga0500652_000620 | Ga0500652_000620_674_1456 | 258 |
| 1438 | 3300053136 | Ga0500559_0001123 | Ga0500559_0001123_14352_15134 | 258 |
| 1439 | 3300053136 | Ga0500559_0002307 | Ga0500559_0002307_1952_2734 | 258 |
| 1440 | 3300053139 | Ga0500568_0001875 | Ga0500568_0001875_9210_9992 | 258 |
| 1441 | 3300053145 | Ga0500586_004376 | Ga0500586_004376_380_1162 | 258 |
| 1442 | 3300053148 | Ga0500590_136030 | Ga0500590_136030_19_801 | 258 |
| 1443 | 3300053150 | Ga0500603_000679 | Ga0500603_000679_341_1123 | 258 |
| 1444 | 3300053151 | Ga0500604_0010294 | Ga0500604_0010294_1671_2453 | 258 |
| 1445 | 3300053153 | Ga0500616_0000288 | Ga0500616_0000288_13357_14139 | 258 |
| 1446 | 3300053156 | Ga0500622_0000563 | Ga0500622_0000563_15520_16302 | 258 |
| 1447 | 3300053158 | Ga0500627_0168144 | Ga0500627_0168144_92_874 | 258 |
| 1448 | 3300053159 | Ga0500630_001851 | Ga0500630_001851_1851_2633 | 258 |
| 1449 | 3300053162 | Ga0500638_072772 | Ga0500638_072772_520_1302 | 258 |
| 1450 | 3300053162 | Ga0500638_161012 | Ga0500638_161012_39_821 | 258 |
| 1451 | 3300053163 | Ga0500639_000099 | Ga0500639_000099_27451_28233 | 258 |
| 1452 | 3300053177 | Ga0500636_0004209 | Ga0500636_0004209_4117_4899 | 258 |
| 1453 | 3300053177 | Ga0500636_0085612 | Ga0500636_0085612_925_1707 | 258 |
| 1454 | 3300053178 | Ga0500637_0000093 | Ga0500637_0000093_29342_30124 | 258 |
| 1455 | 3300053730 | Ga0500645_005813 | Ga0500645_005813_3465_4247 | 258 |
| 1456 | 3300055283 | Ga0500661_001138 | Ga0500661_001138_2395_3177 | 258 |
| 1457 | 3300061719 | Ga0466962_0109112 | Ga0466962_0109112_365_1147 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ngf-assembly1.cif.gz_A | crystal structure of ap endonuclease, family 2 from brucella melitensis | 0.9694 | 1 | 256 |
| 1k77-assembly1.cif.gz_A | crystal structure of ec1530, a putative oxygenase from escherichia coli | 0.9597 | 1 | 255 |
| 1k77-assembly1.cif.gz_A | crystal structure of ec1530, a putative oxygenase from escherichia coli | 0.9452 | 1 | 255 |
| 2zvr-assembly1.cif.gz_B | crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima | 0.8142 | 4 | 255 |
| 7ero-assembly1.cif.gz_C | crystal structure of d-allulose 3-epimerase with d-allulose from agrobacterium sp. sul3 | 0.7998 | 1 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30147_1_258_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9628 | 1 | 255 | 3.20.20.150 |
| 1k77A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.951 | 2 | 255 | 3.20.20.150 |
| af_Q7T3H9_4_269_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9461 | 3 | 258 | 3.20.20.150 |
| 1k77A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9365 | 2 | 255 | 3.20.20.150 |
| af_P36951_1_261_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9357 | 1 | 256 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257PN09-F1-model_v4 | Hydroxypyruvate isomerase | 0.989 | 1 | 206 |
GO:0008903
GO:0046487 |
| AF-W6RKC7-F1-model_v4 | Hydroxypyruvate isomerase (EC 5.3.1.22) | 0.987 | 1 | 258 |
GO:0008903
GO:0046487 |
| AF-A0A7V8KK36-F1-model_v4 | deleted | 0.9863 | 1 | 228 |
|
| AF-A0A528FMZ6-F1-model_v4 | Hydroxypyruvate isomerase | 0.9859 | 1 | 102 |
GO:0008903
GO:0046487 |
| AF-A0A844W977-F1-model_v4 | deleted | 0.9853 | 11 | 163 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar