F494093

General Info

Members Datasets Scaffolds Average Seq Length
1457 712 1232 252

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100184441|Ga0070670_1001844412
Length 261
Sequence MPRFAANLTMLFTELPFLDRFDAAAKAGFTAVEFLFPYAYSVADLKQRLSANRLELVLHNLPAGDWDAGERGIACLPDRVAEFRDGVARAIDYASALGAPQVNCLAGKVAAGVSDDVLRDTFVGNLRFAAAALQRANIRLLIEPINTFDIPGFYLNRTAQALAIIDEVGSDNLFVQYDIYHAQRMEGELIATMTKQLARIGHIQLADNPGRNEPGTGEIHYDNVFKALDRIGYAGWIGCEYKPATTTEAGLGWLERARRTA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
22 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
25 2643221723 Ensifer sp. Root278 Isolate Unclassified
26 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2791355265 Rhizobium sp. H4 Isolate Nodule
33 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
34 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
55 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
56 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
57 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
58 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
59 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
60 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
61 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
62 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
69 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
70 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
71 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
72 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
73 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
74 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
77 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
94 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
95 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
98 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
99 2904699407
100 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
101 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
102 2906610324
103 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
104 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
105 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
106 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
107 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
108 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
109 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
110 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
111 2922368715
112 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
113 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
114 2922425934
115 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
116 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
117 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
118 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
119 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
120 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
121 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
122 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
123 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
124 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
125 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
126 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
127 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
128 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
129 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
130 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
131 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
132 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
133 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
134 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
135 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
136 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
137 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
138 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
139 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
140 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
141 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
142 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
143 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
144 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
145 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
146 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
147 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
148 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
149 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
150 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
151 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
152 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
153 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
154 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
155 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
156 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
157 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
158 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
159 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
160 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
161 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
162 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
163 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
164 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
165 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
166 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
167 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
168 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
169 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
170 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
171 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
172 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
173 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
174 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
175 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
176 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
177 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
178 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
179 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
180 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
181 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
182 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
183 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
184 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
185 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
186 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
187 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
188 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
189 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
190 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
191 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
192 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
193 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
194 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
195 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
196 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
201 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
202 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
203 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
204 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
205 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
206 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
207 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
210 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
211 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
212 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
213 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
214 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
215 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
216 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
217 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
218 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
219 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
220 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
221 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
222 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
223 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
224 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
225 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
226 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
227 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
228 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
229 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
230 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
231 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
232 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
236 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
237 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
238 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
239 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
240 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
241 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
242 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
247 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
248 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
249 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
250 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
251 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
252 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
253 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
254 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
255 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
256 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
257 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
260 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
261 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
262 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
263 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
264 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
265 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
266 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
267 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
268 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
269 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
270 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
271 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
272 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
273 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
276 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
277 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
278 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
279 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
280 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
281 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
282 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
283 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
284 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
285 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
286 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
287 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
288 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
289 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
290 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
291 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
292 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
293 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
294 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
295 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
296 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
297 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
298 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
299 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
300 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
301 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
302 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
303 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
304 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
305 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
309 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
310 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
311 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
312 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
313 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
314 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
315 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
316 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
318 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
325 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
327 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
330 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
390 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
391 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
392 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
393 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
394 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
398 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
399 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
400 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
401 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
402 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
403 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
404 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
405 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
406 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
407 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
408 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
409 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
410 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
411 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
412 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
413 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
414 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
415 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
416 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
417 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
418 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
419 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
420 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
421 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
422 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
423 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
424 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
425 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
426 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
427 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
428 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
429 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
430 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
431 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
432 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
433 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
434 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
435 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
436 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
437 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
438 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
439 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
440 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
441 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
442 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
443 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
444 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
445 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
446 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
447 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
448 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
449 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
450 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
451 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
452 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
453 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
454 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
455 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
456 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
457 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
458 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
459 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
460 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
461 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
462 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
463 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
464 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
465 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
466 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
467 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
468 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
469 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
470 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
471 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
472 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
473 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
474 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
475 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
476 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
477 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
478 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
479 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
480 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
481 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
482 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
483 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
484 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
485 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
488 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
489 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
490 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
491 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
492 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
493 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
494 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
495 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
496 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
497 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
498 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
499 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
500 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
501 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
502 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
503 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
504 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
505 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
506 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
507 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
508 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
509 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
510 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
511 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
512 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
513 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
514 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
515 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
516 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
517 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
518 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
519 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
520 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
521 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
522 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
523 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
524 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
525 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
526 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
527 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
528 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
529 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
530 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
531 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
532 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
533 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
534 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
535 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
536 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
537 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
538 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
539 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
540 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
541 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
542 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
543 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
544 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
545 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
546 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
547 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
548 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
549 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
550 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
551 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
552 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
553 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
554 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
555 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
556 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
557 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
558 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
559 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
560 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
561 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
562 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
563 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
564 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
565 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
566 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
567 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
568 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
569 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
570 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
571 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
572 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
573 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
574 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
575 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
576 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
577 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
578 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
579 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
580 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
581 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
582 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
585 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
594 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
595 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
596 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
597 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
598 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
599 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
600 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
601 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
602 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
605 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
606 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
607 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
608 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
609 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
610 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
611 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
612 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
613 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
614 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
615 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
616 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
617 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
618 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
619 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
620 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
621 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
622 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
623 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
624 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
625 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
626 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
627 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
628 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
629 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
630 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
631 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
632 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
633 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
634 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
635 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
636 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
637 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
638 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
639 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
640 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
641 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
642 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
643 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
644 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
645 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
646 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
647 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
648 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
649 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
650 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
651 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
652 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
653 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
654 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
655 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
656 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
657 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
658 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
659 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
660 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
661 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
662 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
663 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
664 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
665 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
666 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
667 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
668 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
669 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
670 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
671 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
672 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
673 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
674 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
675 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
676 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
677 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
678 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
679 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
680 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
681 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
682 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
683 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
684 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
685 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
686 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
687 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
688 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
689 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
690 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
691 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
692 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
693 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
694 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
695 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
696 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
697 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
698 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
699 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
700 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
701 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
702 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
703 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
704 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
705 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
706 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
707 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
708 8056382006 Rhizobium croatiense 13T Isolate Nodule
709 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
710 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
711 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
712 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.78
Metatranscriptomes 0.07
Isolates 15.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.13
Nodule 12.29
Rhizoplane 4.67
Rhizosphere 55.53
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000071 3300002987 Bacteria 48764
2 JGI25159J45721_1000191 3300002987 Bacteria 28445
3 JGI25406J46586_10003417 3300003203 Bacteria 7474
4 JGI25165J46597_1009845 3300003214 Bacteria 1418
5 JGI25153J46596_10000952 3300003215 Bacteria 17565
6 JGI25153J46596_10001246 3300003215 Bacteria 15361
7 JGI25153J46596_10001884 3300003215 Bacteria 12431
8 JGI25153J46596_10005466 3300003215 Bacteria 6654
9 JGI25153J46596_10025964 3300003215 Bacteria 2083
10 JGI25153J46596_10059954 3300003215 Bacteria 1039
11 JGI25160J50197_1000162 3300003354 Bacteria 57595
12 JGI25160J50197_1003726 3300003354 Bacteria 6720
13 JGI25160J50197_1006214 3300003354 Bacteria 4860
14 JGI25161J50226_1000988 3300003374 Bacteria 10020
15 JGI25404J52841_10007977 3300003659 Bacteria 2247
16 JGI25404J52841_10026367 3300003659 Bacteria 1251
17 Ga0055539_1002463 3300003752 Bacteria 2813
18 Ga0055524_1022659 3300003775 Bacteria 2045
19 Ga0055536_1000667 3300003781 Bacteria 23117
20 Ga0055540_1021009 3300003792 Bacteria 1709
21 Ga0055531_10008008 3300003794 Bacteria 5651
22 Ga0055531_10011656 3300003794 Bacteria 4212
23 Ga0055531_10013844 3300003794 Bacteria 3688
24 Ga0055543_1019666 3300004625 Bacteria 1247
25 Ga0065165_1000535 3300005262 Bacteria 57606
26 Ga0065165_1004449 3300005262 Bacteria 8687
27 Ga0065165_1004595 3300005262 Bacteria 8409
28 Ga0065165_1005514 3300005262 Bacteria 7075
29 Ga0070658_10160218 3300005327 Bacteria 1887
30 Ga0070683_100005150 3300005329 Bacteria 10876
31 Ga0070683_100045815 3300005329 Bacteria 4037
32 Ga0070683_100083116 3300005329 Bacteria 2999
33 Ga0070690_100231860 3300005330 Bacteria 1298
34 Ga0070670_100181651 3300005331 Bacteria 1827
35 Ga0070670_100184441 3300005331 Bacteria 1812
36 Ga0070677_10090431 3300005333 Bacteria 1330
37 Ga0068869_100032152 3300005334 Bacteria 3696
38 Ga0068869_100186479 3300005334 Bacteria 1629
39 Ga0068869_100220068 3300005334 Bacteria 1504
40 Ga0070666_10386542 3300005335 Bacteria 1005
41 Ga0070680_100014277 3300005336 Bacteria 6203
42 Ga0070680_100164630 3300005336 Bacteria 1864
43 Ga0070680_100276688 3300005336 Bacteria 1422
44 Ga0070682_100080829 3300005337 Bacteria 2103
45 Ga0070682_100166017 3300005337 Bacteria 1530
46 Ga0070682_100175997 3300005337 Bacteria 1491
47 Ga0068868_100075518 3300005338 Bacteria 2693
48 Ga0068868_100118384 3300005338 Bacteria 2159
49 Ga0068868_100132633 3300005338 Bacteria 2040
50 Ga0070660_100047303 3300005339 Bacteria 3300
51 Ga0070660_100130249 3300005339 Bacteria 2012
52 Ga0070660_100379673 3300005339 Bacteria 1166
53 Ga0070691_10077070 3300005341 Bacteria 1626
54 Ga0070661_100124364 3300005344 Bacteria 1934
55 Ga0070661_100219599 3300005344 Bacteria 1457
56 Ga0070661_100422026 3300005344 Bacteria 1057
57 Ga0070692_10222391 3300005345 Bacteria 1117
58 Ga0070668_100037793 3300005347 Bacteria 3688
59 Ga0070668_100055398 3300005347 Bacteria 3060
60 Ga0070668_100083103 3300005347 Bacteria 2513
61 Ga0070668_100283446 3300005347 Bacteria 1385
62 Ga0070668_100551240 3300005347 Bacteria 1003
63 Ga0070671_100019925 3300005355 Bacteria 5464
64 Ga0070671_100036506 3300005355 Bacteria 4075
65 Ga0070671_100201753 3300005355 Bacteria 1687
66 Ga0070674_100158026 3300005356 Bacteria 1717
67 Ga0070673_100070300 3300005364 Bacteria 2808
68 Ga0070673_100153388 3300005364 Bacteria 1953
69 Ga0070667_100001599 3300005367 Bacteria 20262
70 Ga0070667_100522897 3300005367 Bacteria 1089
71 Ga0070709_10000900 3300005434 Bacteria 16554
72 Ga0070709_10012197 3300005434 Bacteria 4806
73 Ga0070709_10016286 3300005434 Bacteria 4242
74 Ga0070709_10295482 3300005434 Bacteria 1182
75 Ga0070714_100037902 3300005435 Bacteria 4053
76 Ga0070714_100039125 3300005435 Bacteria 3991
77 Ga0070714_100043651 3300005435 Bacteria 3793
78 Ga0070714_100049342 3300005435 Bacteria 3582
79 Ga0070714_100169252 3300005435 Bacteria 1982
80 Ga0070714_100223183 3300005435 Bacteria 1733
81 Ga0070714_100468964 3300005435 Bacteria 1198
82 Ga0070713_100003714 3300005436 Bacteria 10103
83 Ga0070713_100006598 3300005436 Bacteria 8063
84 Ga0070713_100024687 3300005436 Bacteria 4688
85 Ga0070713_100037885 3300005436 Bacteria 3901
86 Ga0070713_100153428 3300005436 Bacteria 2051
87 Ga0070713_100158512 3300005436 Bacteria 2019
88 Ga0070713_100340318 3300005436 Bacteria 1390
89 Ga0070710_10000221 3300005437 Bacteria 26514
90 Ga0070710_10002129 3300005437 Bacteria 9383
91 Ga0070710_10093835 3300005437 Bacteria 1775
92 Ga0070711_100002818 3300005439 Bacteria 9977
93 Ga0070711_100011819 3300005439 Bacteria 5432
94 Ga0070711_100015227 3300005439 Bacteria 4865
95 Ga0070711_100015454 3300005439 Bacteria 4832
96 Ga0070708_100287046 3300005445 Bacteria 1549
97 Ga0070708_100355514 3300005445 Bacteria 1380
98 Ga0070663_100026611 3300005455 Bacteria 3920
99 Ga0070663_100047197 3300005455 Bacteria 3051
100 Ga0070663_100070451 3300005455 Bacteria 2543
101 Ga0070663_100212421 3300005455 Bacteria 1516
102 Ga0070663_100264491 3300005455 Bacteria 1365
103 Ga0070678_100156643 3300005456 Bacteria 1841
104 Ga0070678_100249071 3300005456 Bacteria 1489
105 Ga0070678_100350850 3300005456 Bacteria 1269
106 Ga0070662_100472113 3300005457 Bacteria 1043
107 Ga0070681_10029417 3300005458 Bacteria 5517
108 Ga0070681_10104881 3300005458 Bacteria 2769
109 Ga0068867_100041887 3300005459 Bacteria 3346
110 Ga0070706_100027803 3300005467 Bacteria 5202
111 Ga0070707_100052509 3300005468 Bacteria 3908
112 Ga0070707_100799645 3300005468 Bacteria 907
113 Ga0070698_100154623 3300005471 Bacteria 2239
114 Ga0070679_100079100 3300005530 Bacteria 3277
115 Ga0070679_100228659 3300005530 Bacteria 1820
116 Ga0070684_100003497 3300005535 Bacteria 11794
117 Ga0070684_100065035 3300005535 Bacteria 3200
118 Ga0070684_100417106 3300005535 Bacteria 1239
119 Ga0068853_100055518 3300005539 Bacteria 3414
120 Ga0068853_100203223 3300005539 Bacteria 1803
121 Ga0068853_100459002 3300005539 Bacteria 1199
122 Ga0070672_100250820 3300005543 Bacteria 1491
123 Ga0070693_100169621 3300005547 Bacteria 1397
124 Ga0070693_100256270 3300005547 Bacteria 1162
125 Ga0070665_100015861 3300005548 Bacteria 7564
126 Ga0070665_100043157 3300005548 Bacteria 4532
127 Ga0070665_100090850 3300005548 Bacteria 3059
128 Ga0070665_100147619 3300005548 Bacteria 2354
129 Ga0070665_100193242 3300005548 Bacteria 2036
130 Ga0070665_100266585 3300005548 Bacteria 1714
131 Ga0070665_100300012 3300005548 Bacteria 1609
132 Ga0068855_100051385 3300005563 Bacteria 4856
133 Ga0068855_100121344 3300005563 Bacteria 2991
134 Ga0068855_100171911 3300005563 Bacteria 2454
135 Ga0068855_100286719 3300005563 Bacteria 1826
136 Ga0068855_100550684 3300005563 Bacteria 1249
137 Ga0068857_100013693 3300005577 Bacteria 7068
138 Ga0068857_100054592 3300005577 Bacteria 3546
139 Ga0068857_100071994 3300005577 Bacteria 3080
140 Ga0068857_100141781 3300005577 Bacteria 2172
141 Ga0068854_100062848 3300005578 Bacteria 2694
142 Ga0068854_100382872 3300005578 Bacteria 1160
143 Ga0068856_100009329 3300005614 Bacteria 9530
144 Ga0068856_100036241 3300005614 Bacteria 4836
145 Ga0068856_100724103 3300005614 Bacteria 1015
146 Ga0068852_100011643 3300005616 Bacteria 6635
147 Ga0068852_100115660 3300005616 Bacteria 2446
148 Ga0068852_100251961 3300005616 Bacteria 1692
149 Ga0068852_100597347 3300005616 Bacteria 1108
150 Ga0068859_100202522 3300005617 Bacteria 2070
151 Ga0068864_100117766 3300005618 Bacteria 2371
152 Ga0068864_100349063 3300005618 Bacteria 1395
153 Ga0068866_10011069 3300005718 Bacteria 3888
154 Ga0068866_10057771 3300005718 Bacteria 2001
155 Ga0068861_100036398 3300005719 Bacteria 3652
156 Ga0068861_100488715 3300005719 Bacteria 1110
157 Ga0068861_100535543 3300005719 Bacteria 1064
158 Ga0068851_10035787 3300005834 Bacteria 2484
159 Ga0068863_100086436 3300005841 Bacteria 2971
160 Ga0068858_100444685 3300005842 Bacteria 1249
161 Ga0068858_100550879 3300005842 Bacteria 1116
162 Ga0068860_100358312 3300005843 Bacteria 1437
163 Ga0068860_100690660 3300005843 Bacteria 1030
164 Ga0068862_100131326 3300005844 Bacteria 2215
165 Ga0068862_100350977 3300005844 Bacteria 1369
166 Ga0081455_10031043 3300005937 Bacteria 4842
167 Ga0081455_10052548 3300005937 Bacteria 3487
168 Ga0081455_10082536 3300005937 Bacteria 2629
169 Ga0081455_10099099 3300005937 Bacteria 2345
170 Ga0081538_10069547 3300005981 Bacteria 1949
171 Ga0081540_1000884 3300005983 Bacteria 27058
172 Ga0081540_1003783 3300005983 Bacteria 11839
173 Ga0081540_1004220 3300005983 Bacteria 11042
174 Ga0081540_1005132 3300005983 Bacteria 9811
175 Ga0081540_1012953 3300005983 Bacteria 5449
176 Ga0081540_1014508 3300005983 Bacteria 5041
177 Ga0081540_1019658 3300005983 Bacteria 4094
178 Ga0081540_1021814 3300005983 Bacteria 3799
179 Ga0081540_1025835 3300005983 Bacteria 3368
180 Ga0081540_1062976 3300005983 Bacteria 1758
181 Ga0081539_10006229 3300005985 Bacteria 11559
182 Ga0081539_10010493 3300005985 Bacteria 7513
183 Ga0081539_10094131 3300005985 Bacteria 1542
184 Ga0070717_10003635 3300006028 Bacteria 11063
185 Ga0070717_10005810 3300006028 Bacteria 9034
186 Ga0070717_10292098 3300006028 Bacteria 1447
187 Ga0075365_10007730 3300006038 Bacteria 6051
188 Ga0075365_10010419 3300006038 Bacteria 5414
189 Ga0075365_10157441 3300006038 Bacteria 1581
190 Ga0075365_10236242 3300006038 Bacteria 1284
191 Ga0075365_10357414 3300006038 Bacteria 1030
192 Ga0075365_10520866 3300006038 Bacteria 841
193 Ga0075363_100016000 3300006048 Bacteria 3699
194 Ga0075363_100017124 3300006048 Bacteria 3588
195 Ga0075363_100023095 3300006048 Bacteria 3149
196 Ga0075363_100183728 3300006048 Bacteria 1190
197 Ga0075364_10009798 3300006051 Bacteria 5761
198 Ga0075364_10085133 3300006051 Bacteria 2093
199 Ga0075364_10178494 3300006051 Bacteria 1436
200 Ga0070715_10001911 3300006163 Bacteria 6264
201 Ga0070716_100001730 3300006173 Bacteria 9850
202 Ga0070716_100039266 3300006173 Bacteria 2627
203 Ga0070712_100021309 3300006175 Bacteria 4256
204 Ga0070712_100022055 3300006175 Bacteria 4190
205 Ga0070712_100139414 3300006175 Bacteria 1848
206 Ga0075362_10008537 3300006177 Bacteria 3922
207 Ga0075362_10105690 3300006177 Bacteria 1321
208 Ga0075367_10002035 3300006178 Bacteria 9046
209 Ga0075367_10017795 3300006178 Bacteria 3907
210 Ga0075367_10025516 3300006178 Bacteria 3343
211 Ga0075367_10035016 3300006178 Bacteria 2904
212 Ga0075367_10060179 3300006178 Bacteria 2264
213 Ga0075367_10065458 3300006178 Bacteria 2176
214 Ga0075367_10083923 3300006178 Bacteria 1931
215 Ga0075367_10106264 3300006178 Bacteria 1720
216 Ga0075367_10405211 3300006178 Bacteria 863
217 Ga0075369_10004785 3300006186 Bacteria 5033
218 Ga0075369_10013004 3300006186 Bacteria 3294
219 Ga0075369_10014241 3300006186 Bacteria 3173
220 Ga0075366_10013043 3300006195 Bacteria 4726
221 Ga0075366_10022723 3300006195 Bacteria 3651
222 Ga0075366_10028915 3300006195 Bacteria 3254
223 Ga0075366_10097027 3300006195 Bacteria 1767
224 Ga0075366_10219323 3300006195 Bacteria 1159
225 Ga0097621_100680899 3300006237 Bacteria 945
226 Ga0075370_10000773 3300006353 Bacteria 12813
227 Ga0075370_10026104 3300006353 Bacteria 3233
228 Ga0075370_10040686 3300006353 Bacteria 2622
229 Ga0075370_10044333 3300006353 Bacteria 2514
230 Ga0075370_10074578 3300006353 Bacteria 1944
231 Ga0075370_10111113 3300006353 Bacteria 1592
232 Ga0075370_10122359 3300006353 Bacteria 1515
233 Ga0075370_10168621 3300006353 Bacteria 1286
234 Ga0068871_100138832 3300006358 Bacteria 2065
235 Ga0075434_100043289 3300006871 Bacteria 4465
236 Ga0068865_100157826 3300006881 Bacteria 1727
237 Ga0068865_100168730 3300006881 Bacteria 1676
238 Ga0075436_100117404 3300006914 Bacteria 1860
239 Ga0097620_100202531 3300006931 Bacteria 2070
240 Ga0099825_1046449 3300006941 Bacteria 1056
241 Ga0099824_1013115 3300006942 Bacteria 8742
242 Ga0099822_1000072 3300006943 Bacteria 55118
243 Ga0099822_1050290 3300006943 Bacteria 1757
244 Ga0099823_1106656 3300006944 Bacteria 810
245 Ga0099794_10086065 3300007265 Bacteria 1556
246 Ga0105240_10010472 3300009093 Bacteria 13035
247 Ga0105240_10030277 3300009093 Bacteria 7034
248 Ga0105240_10052653 3300009093 Bacteria 5114
249 Ga0105240_10110255 3300009093 Bacteria 3331
250 Ga0105240_10152628 3300009093 Bacteria 2749
251 Ga0105240_11184085 3300009093 Bacteria 810
252 Ga0105245_10021491 3300009098 Bacteria 5662
253 Ga0105245_10074935 3300009098 Bacteria 3080
254 Ga0105245_10362233 3300009098 Bacteria 1439
255 Ga0105245_10573276 3300009098 Bacteria 1153
256 Ga0105245_10815845 3300009098 Bacteria 971
257 Ga0105247_10389207 3300009101 Bacteria 990
258 Ga0114129_11234225 3300009147 Bacteria 929
259 Ga0105243_10254861 3300009148 Bacteria 1568
260 Ga0105243_10674557 3300009148 Bacteria 1004
261 Ga0105243_10784188 3300009148 Bacteria 938
262 Ga0105241_10028754 3300009174 Bacteria 4143
263 Ga0105241_10034445 3300009174 Bacteria 3804
264 Ga0105241_10161360 3300009174 Bacteria 1843
265 Ga0105241_10613434 3300009174 Bacteria 984
266 Ga0105242_10280153 3300009176 Bacteria 1514
267 Ga0105242_10539701 3300009176 Bacteria 1116
268 Ga0105248_10095221 3300009177 Bacteria 3352
269 Ga0105237_10004025 3300009545 Bacteria 17170
270 Ga0105237_10121559 3300009545 Bacteria 2606
271 Ga0105237_10271117 3300009545 Bacteria 1700
272 Ga0105237_10480421 3300009545 Bacteria 1249
273 Ga0105237_10547947 3300009545 Bacteria 1163
274 Ga0105238_10324664 3300009551 Bacteria 1525
275 Ga0105238_10464430 3300009551 Bacteria 1264
276 Ga0105238_10509255 3300009551 Bacteria 1205
277 Ga0105238_10637057 3300009551 Bacteria 1075
278 Ga0105238_10846207 3300009551 Bacteria 932
279 Ga0105238_10925623 3300009551 Bacteria 891
280 Ga0105249_10194251 3300009553 Bacteria 1983
281 Ga0105249_10291673 3300009553 Bacteria 1633
282 Ga0105249_10680109 3300009553 Bacteria 1088
283 Ga0105249_10795402 3300009553 Bacteria 1010
284 Ga0099796_10052412 3300010159 Bacteria 1421
285 Ga0105239_10031497 3300010375 Bacteria 5831
286 Ga0105239_10088799 3300010375 Bacteria 3408
287 Ga0105239_10125231 3300010375 Bacteria 2855
288 Ga0105239_10224672 3300010375 Bacteria 2106
289 Ga0105239_10725714 3300010375 Bacteria 1137
290 Ga0105246_10020341 3300011119 Bacteria 4255
291 Ga0157373_10070722 3300013100 Bacteria 2466
292 Ga0157370_10511429 3300013104 Bacteria 1102
293 Ga0157369_10017188 3300013105 Bacteria 8128
294 Ga0157369_10039801 3300013105 Bacteria 5136
295 Ga0157369_10104094 3300013105 Bacteria 3023
296 Ga0157369_10279232 3300013105 Bacteria 1740
297 Ga0157374_10108670 3300013296 Bacteria 2666
298 Ga0157374_10271655 3300013296 Bacteria 1672
299 Ga0157374_10457713 3300013296 Bacteria 1278
300 Ga0157378_10110756 3300013297 Bacteria 2517
301 Ga0157378_10215565 3300013297 Bacteria 1822
302 Ga0157378_10490499 3300013297 Bacteria 1226
303 Ga0163162_10048614 3300013306 Bacteria 4250
304 Ga0163162_10738497 3300013306 Bacteria 1104
305 Ga0157372_10295020 3300013307 Bacteria 1886
306 Ga0157375_10058051 3300013308 Bacteria 3827
307 Ga0157375_10162251 3300013308 Bacteria 2377
308 Ga0157375_10207808 3300013308 Bacteria 2114
309 Ga0157375_10552587 3300013308 Bacteria 1313
310 Ga0163163_10365399 3300014325 Bacteria 1500
311 Ga0157380_10001485 3300014326 Bacteria 15341
312 Ga0157380_10436727 3300014326 Bacteria 1253
313 Ga0157380_10505548 3300014326 Bacteria 1175
314 Ga0182008_10086411 3300014497 Bacteria 1545
315 Ga0157377_10191461 3300014745 Bacteria 1293
316 Ga0157379_10197211 3300014968 Bacteria 1820
317 Ga0157379_10517438 3300014968 Bacteria 1107
318 Ga0157379_10560603 3300014968 Bacteria 1064
319 Ga0157376_10072632 3300014969 Bacteria 2927
320 Ga0157376_10148203 3300014969 Bacteria 2113
321 Ga0157376_10596002 3300014969 Bacteria 1099
322 Ga0163161_10184790 3300017792 Bacteria 1600
323 Ga0214544_1000001 3300021320 Bacteria 783667
324 Ga0214542_1000037 3300021321 Bacteria 159256
325 Ga0214545_1000003 3300021324 Bacteria 720274
326 Ga0214543_1003164 3300021327 Bacteria 32141
327 Ga0213872_10076914 3300021361 Bacteria 1501
328 Ga0213874_10068795 3300021377 Bacteria 1125
329 Ga0213876_10051082 3300021384 Bacteria 2185
330 Ga0224712_10168337 3300022467 Bacteria 981
331 Ga0209436_101866 3300025208 Bacteria 6829
332 Ga0209677_100908 3300025253 Bacteria 14482
333 Ga0209677_106221 3300025253 Bacteria 2883
334 Ga0209148_1000699 3300025254 Bacteria 27192
335 Ga0209233_1001449 3300025261 Bacteria 9377
336 Ga0209233_1002356 3300025261 Bacteria 7030
337 Ga0209233_1011713 3300025261 Bacteria 2575
338 Ga0209233_1012838 3300025261 Bacteria 2412
339 Ga0209455_1004211 3300025272 Bacteria 4798
340 Ga0209455_1005909 3300025272 Bacteria 3696
341 Ga0209455_1015444 3300025272 Bacteria 1678
342 Ga0209130_1000147 3300025284 Bacteria 109796
343 Ga0209676_1001620 3300025292 Bacteria 19915
344 Ga0209025_1000240 3300025294 Bacteria 128397
345 Ga0209564_1001127 3300025295 Bacteria 31429
346 Ga0209564_1009146 3300025295 Bacteria 4764
347 Ga0209564_1009950 3300025295 Bacteria 4446
348 Ga0209564_1015362 3300025295 Bacteria 3120
349 Ga0209758_1000011 3300025297 Bacteria 1049685
350 Ga0209758_1000133 3300025297 Bacteria 182442
351 Ga0209758_1001858 3300025297 Bacteria 23145
352 Ga0209758_1002537 3300025297 Bacteria 18401
353 Ga0209758_1006910 3300025297 Bacteria 7926
354 Ga0209758_1011139 3300025297 Bacteria 5252
355 Ga0209758_1027721 3300025297 Bacteria 2414
356 Ga0209758_1032160 3300025297 Bacteria 2136
357 Ga0209050_1014213 3300025298 Bacteria 3452
358 Ga0209256_1001569 3300025299 Bacteria 22476
359 Ga0209256_1005335 3300025299 Bacteria 7472
360 Ga0207426_1000267 3300025302 Bacteria 109797
361 Ga0207426_1001289 3300025302 Bacteria 21656
362 Ga0207426_1002137 3300025302 Bacteria 13493
363 Ga0207426_1002396 3300025302 Bacteria 12077
364 Ga0207426_1065167 3300025302 Bacteria 1034
365 Ga0209051_1008485 3300025303 Bacteria 5428
366 Ga0209257_1002116 3300025304 Bacteria 20743
367 Ga0209257_1006326 3300025304 Bacteria 7704
368 Ga0207697_10035020 3300025315 Bacteria 2055
369 Ga0207697_10076204 3300025315 Bacteria 1409
370 Ga0207656_10015273 3300025321 Bacteria 2970
371 Ga0207682_10032066 3300025893 Bacteria 2111
372 Ga0207682_10049223 3300025893 Bacteria 1739
373 Ga0207692_10000364 3300025898 Bacteria 15516
374 Ga0207692_10003951 3300025898 Bacteria 5821
375 Ga0207692_10005642 3300025898 Bacteria 5026
376 Ga0207692_10062720 3300025898 Bacteria 1930
377 Ga0207710_10097636 3300025900 Bacteria 1382
378 Ga0207688_10302558 3300025901 Bacteria 978
379 Ga0207680_10253326 3300025903 Bacteria 1216
380 Ga0207647_10019836 3300025904 Bacteria 4515
381 Ga0207647_10238473 3300025904 Bacteria 1045
382 Ga0207699_10000319 3300025906 Bacteria 25750
383 Ga0207699_10002988 3300025906 Bacteria 8041
384 Ga0207699_10020623 3300025906 Bacteria 3537
385 Ga0207699_10074695 3300025906 Bacteria 2083
386 Ga0207699_10440202 3300025906 Bacteria 934
387 Ga0207643_10276233 3300025908 Bacteria 1041
388 Ga0207684_10024140 3300025910 Bacteria 5187
389 Ga0207654_10003032 3300025911 Bacteria 8518
390 Ga0207654_10082507 3300025911 Bacteria 1939
391 Ga0207654_10144837 3300025911 Bacteria 1519
392 Ga0207707_10000378 3300025912 Bacteria 46582
393 Ga0207707_10018699 3300025912 Bacteria 6043
394 Ga0207707_10031747 3300025912 Bacteria 4623
395 Ga0207707_10080028 3300025912 Bacteria 2853
396 Ga0207707_10419105 3300025912 Bacteria 1148
397 Ga0207695_10000008 3300025913 Bacteria 1058268
398 Ga0207695_10048138 3300025913 Bacteria 4505
399 Ga0207695_10051139 3300025913 Bacteria 4341
400 Ga0207695_10143916 3300025913 Bacteria 2330
401 Ga0207695_10158677 3300025913 Bacteria 2195
402 Ga0207695_10241625 3300025913 Bacteria 1707
403 Ga0207695_10322552 3300025913 Bacteria 1434
404 Ga0207671_10004403 3300025914 Bacteria 13492
405 Ga0207671_10065749 3300025914 Bacteria 2698
406 Ga0207671_10127093 3300025914 Bacteria 1954
407 Ga0207671_10441043 3300025914 Bacteria 1037
408 Ga0207693_10007176 3300025915 Bacteria 9179
409 Ga0207693_10043239 3300025915 Bacteria 3545
410 Ga0207693_10098517 3300025915 Bacteria 2292
411 Ga0207663_10000417 3300025916 Bacteria 18473
412 Ga0207663_10006343 3300025916 Bacteria 6044
413 Ga0207663_10015030 3300025916 Bacteria 4259
414 Ga0207663_10039890 3300025916 Bacteria 2849
415 Ga0207660_10003159 3300025917 Bacteria 10789
416 Ga0207660_10081145 3300025917 Bacteria 2383
417 Ga0207660_10091050 3300025917 Bacteria 2261
418 Ga0207660_10148620 3300025917 Bacteria 1798
419 Ga0207662_10134864 3300025918 Bacteria 1560
420 Ga0207657_10001107 3300025919 Bacteria 28599
421 Ga0207657_10004372 3300025919 Bacteria 14956
422 Ga0207657_10108304 3300025919 Bacteria 2297
423 Ga0207657_10334546 3300025919 Bacteria 1196
424 Ga0207649_10194117 3300025920 Bacteria 1430
425 Ga0207649_10364299 3300025920 Bacteria 1073
426 Ga0207649_10379229 3300025920 Bacteria 1053
427 Ga0207649_10505693 3300025920 Bacteria 919
428 Ga0207652_10005634 3300025921 Bacteria 10161
429 Ga0207652_10020624 3300025921 Bacteria 5431
430 Ga0207652_10186135 3300025921 Bacteria 1867
431 Ga0207652_10205936 3300025921 Bacteria 1771
432 Ga0207646_10346623 3300025922 Bacteria 1342
433 Ga0207646_10454260 3300025922 Bacteria 1156
434 Ga0207681_10315252 3300025923 Bacteria 1242
435 Ga0207681_10483934 3300025923 Bacteria 1011
436 Ga0207694_10019080 3300025924 Bacteria 5183
437 Ga0207694_10070032 3300025924 Bacteria 2740
438 Ga0207694_10321180 3300025924 Bacteria 1278
439 Ga0207694_10342462 3300025924 Bacteria 1236
440 Ga0207694_10583105 3300025924 Bacteria 940
441 Ga0207650_10206520 3300025925 Bacteria 1576
442 Ga0207650_10220521 3300025925 Bacteria 1526
443 Ga0207687_10022826 3300025927 Bacteria 4167
444 Ga0207700_10013002 3300025928 Bacteria 5395
445 Ga0207700_10082107 3300025928 Bacteria 2519
446 Ga0207700_10095530 3300025928 Bacteria 2358
447 Ga0207700_10120873 3300025928 Bacteria 2123
448 Ga0207700_10132389 3300025928 Bacteria 2038
449 Ga0207700_10139247 3300025928 Bacteria 1992
450 Ga0207700_10245489 3300025928 Bacteria 1528
451 Ga0207664_10040468 3300025929 Bacteria 3625
452 Ga0207664_10059002 3300025929 Bacteria 3055
453 Ga0207664_10107641 3300025929 Bacteria 2313
454 Ga0207664_10272313 3300025929 Bacteria 1483
455 Ga0207664_10388327 3300025929 Bacteria 1240
456 Ga0207644_10038532 3300025931 Bacteria 3368
457 Ga0207644_10239483 3300025931 Bacteria 1444
458 Ga0207690_10125196 3300025932 Bacteria 1873
459 Ga0207690_10266891 3300025932 Bacteria 1328
460 Ga0207706_10013484 3300025933 Bacteria 7428
461 Ga0207706_10190586 3300025933 Bacteria 1800
462 Ga0207686_10338352 3300025934 Bacteria 1129
463 Ga0207686_10354493 3300025934 Bacteria 1105
464 Ga0207709_10064438 3300025935 Bacteria 2301
465 Ga0207704_10057211 3300025938 Bacteria 2394
466 Ga0207704_10268800 3300025938 Bacteria 1290
467 Ga0207665_10000190 3300025939 Bacteria 41515
468 Ga0207665_10016066 3300025939 Bacteria 4916
469 Ga0207665_10212063 3300025939 Bacteria 1415
470 Ga0207665_10367662 3300025939 Bacteria 1089
471 Ga0207665_10510225 3300025939 Bacteria 930
472 Ga0207691_10032277 3300025940 Bacteria 4883
473 Ga0207689_10013133 3300025942 Bacteria 7068
474 Ga0207689_10043683 3300025942 Bacteria 3705
475 Ga0207661_10007635 3300025944 Bacteria 7690
476 Ga0207661_10013657 3300025944 Bacteria 5930
477 Ga0207661_10347895 3300025944 Bacteria 1337
478 Ga0207679_10208915 3300025945 Bacteria 1636
479 Ga0207679_10864755 3300025945 Bacteria 826
480 Ga0207667_10005778 3300025949 Bacteria 15094
481 Ga0207667_10483827 3300025949 Bacteria 1256
482 Ga0207651_10042541 3300025960 Bacteria 3024
483 Ga0207651_10116934 3300025960 Bacteria 2014
484 Ga0207651_10624516 3300025960 Bacteria 944
485 Ga0207712_10049315 3300025961 Bacteria 2933
486 Ga0207668_10061439 3300025972 Bacteria 2642
487 Ga0207668_10196091 3300025972 Bacteria 1604
488 Ga0207668_10506424 3300025972 Bacteria 1039
489 Ga0207640_10135585 3300025981 Bacteria 1786
490 Ga0207658_10000701 3300025986 Bacteria 29053
491 Ga0207658_10086325 3300025986 Bacteria 2420
492 Ga0207658_10145331 3300025986 Bacteria 1925
493 Ga0207677_10039546 3300026023 Bacteria 3102
494 Ga0207677_10197555 3300026023 Bacteria 1596
495 Ga0207703_10616397 3300026035 Bacteria 1027
496 Ga0207703_10710473 3300026035 Bacteria 956
497 Ga0207639_10107575 3300026041 Bacteria 2265
498 Ga0207639_10275252 3300026041 Bacteria 1478
499 Ga0207639_10279803 3300026041 Bacteria 1467
500 Ga0207639_10378559 3300026041 Bacteria 1270
501 Ga0207639_10671936 3300026041 Bacteria 959
502 Ga0207678_10048644 3300026067 Bacteria 3665
503 Ga0207678_10064676 3300026067 Bacteria 3142
504 Ga0207678_10068316 3300026067 Bacteria 3050
505 Ga0207678_10423203 3300026067 Bacteria 1155
506 Ga0207708_10168656 3300026075 Bacteria 1732
507 Ga0207708_10293111 3300026075 Bacteria 1321
508 Ga0207702_10000779 3300026078 Bacteria 33703
509 Ga0207702_10088634 3300026078 Bacteria 2704
510 Ga0207702_10386413 3300026078 Bacteria 1347
511 Ga0207648_10017982 3300026089 Bacteria 6409
512 Ga0207648_10124804 3300026089 Bacteria 2264
513 Ga0207648_10636806 3300026089 Bacteria 985
514 Ga0207674_10028009 3300026116 Bacteria 5954
515 Ga0207674_10046213 3300026116 Bacteria 4472
516 Ga0207674_10067952 3300026116 Bacteria 3587
517 Ga0207674_10109148 3300026116 Bacteria 2743
518 Ga0207674_10604412 3300026116 Bacteria 1059
519 Ga0207675_100161090 3300026118 Bacteria 2140
520 Ga0207675_100685017 3300026118 Bacteria 1033
521 Ga0207675_100730608 3300026118 Bacteria 1000
522 Ga0207675_100755197 3300026118 Bacteria 984
523 Ga0207683_10008222 3300026121 Bacteria 8926
524 Ga0207683_10031453 3300026121 Bacteria 4606
525 Ga0207683_10049770 3300026121 Bacteria 3669
526 Ga0207683_10209554 3300026121 Bacteria 1774
527 Ga0207698_10074151 3300026142 Bacteria 2713
528 Ga0207698_10100743 3300026142 Bacteria 2394
529 Ga0207698_10148732 3300026142 Bacteria 2029
530 Ga0207698_10916551 3300026142 Bacteria 884
531 Ga0207698_10939462 3300026142 Bacteria 873
532 Ga0207698_11046332 3300026142 Bacteria 828
533 Ga0209389_1000001 3300027296 Bacteria 463799
534 Ga0209389_1000014 3300027296 Bacteria 188621
535 Ga0209589_1000011 3300027357 Bacteria 236981
536 Ga0209589_1000020 3300027357 Bacteria 188617
537 Ga0209489_100012 3300027361 Bacteria 236981
538 Ga0209489_100060 3300027361 Bacteria 147091
539 Ga0209489_100612 3300027361 Bacteria 69168
540 Ga0209700_100007 3300027363 Bacteria 454608
541 Ga0209700_100019 3300027363 Bacteria 236981
542 Ga0207428_10028694 3300027907 Bacteria 4620
543 Ga0268266_10001082 3300028379 Bacteria 34140
544 Ga0268266_10018792 3300028379 Bacteria 5889
545 Ga0268266_10020256 3300028379 Bacteria 5671
546 Ga0268266_10090253 3300028379 Bacteria 2685
547 Ga0268266_10110280 3300028379 Bacteria 2437
548 Ga0268266_10177582 3300028379 Bacteria 1937
549 Ga0268266_10325536 3300028379 Bacteria 1439
550 Ga0268265_10565813 3300028380 Bacteria 1081
551 Ga0268264_10142197 3300028381 Bacteria 2141
552 Ga0268264_10500515 3300028381 Bacteria 1185
553 Ga0268264_10887731 3300028381 Bacteria 894
554 Ga0265337_1006052 3300028556 Bacteria 4718
555 Ga0265326_10003632 3300028558 Bacteria 5041
556 Ga0265319_1009562 3300028563 Bacteria 4118
557 Ga0265334_10018461 3300028573 Bacteria 2875
558 Ga0265318_10014529 3300028577 Bacteria 3304
559 Ga0265323_10002008 3300028653 Bacteria 9596
560 Ga0265336_10002276 3300028666 Bacteria 8031
561 Ga0307517_10004833 3300028786 Bacteria 20547
562 Ga0307517_10035440 3300028786 Bacteria 5649
563 Ga0307517_10052355 3300028786 Bacteria 4094
564 Ga0307517_10201312 3300028786 Bacteria 1244
565 Ga0307515_10025331 3300028794 Bacteria 10271
566 Ga0307515_10093890 3300028794 Bacteria 3713
567 Ga0307515_10138928 3300028794 Bacteria 2619
568 Ga0307515_10166938 3300028794 Bacteria 2214
569 Ga0265338_10007046 3300028800 Bacteria 14103
570 Ga0265324_10012696 3300029957 Bacteria 3168
571 Ga0265330_10008271 3300031235 Bacteria 5014
572 Ga0265330_10041431 3300031235 Bacteria 2042
573 Ga0265330_10111848 3300031235 Bacteria 1166
574 Ga0265332_10006592 3300031238 Bacteria 5262
575 Ga0265332_10011731 3300031238 Bacteria 3893
576 Ga0265328_10101343 3300031239 Bacteria 1067
577 Ga0265325_10009944 3300031241 Bacteria 5532
578 Ga0265340_10003690 3300031247 Bacteria 8619
579 Ga0265340_10086993 3300031247 Bacteria 1465
580 Ga0265340_10121365 3300031247 Bacteria 1202
581 Ga0265339_10001505 3300031249 Bacteria 17219
582 Ga0265316_10251612 3300031344 Bacteria 1297
583 Ga0307513_10029357 3300031456 Bacteria 6272
584 Ga0307513_10078873 3300031456 Bacteria 3404
585 Ga0307513_10240593 3300031456 Bacteria 1615
586 Ga0307509_10005920 3300031507 Bacteria 16738
587 Ga0307509_10020362 3300031507 Bacteria 7527
588 Ga0307509_10022911 3300031507 Bacteria 7024
589 Ga0307509_10141416 3300031507 Bacteria 2341
590 Ga0307509_10194200 3300031507 Bacteria 1876
591 Ga0307509_10213959 3300031507 Bacteria 1749
592 Ga0307408_100614320 3300031548 Bacteria 968
593 Ga0307508_10026371 3300031616 Bacteria 5266
594 Ga0307508_10249221 3300031616 Bacteria 1372
595 Ga0307508_10284421 3300031616 Bacteria 1247
596 Ga0307514_10282275 3300031649 Bacteria 949
597 Ga0265314_10002744 3300031711 Bacteria 17602
598 Ga0265342_10169414 3300031712 Bacteria 1202
599 Ga0307516_10056839 3300031730 Bacteria 3813
600 Ga0307516_10224046 3300031730 Bacteria 1588
601 Ga0307516_10370979 3300031730 Bacteria 1094
602 Ga0307516_10422952 3300031730 Bacteria 990
603 Ga0307413_10055476 3300031824 Bacteria 2411
604 Ga0307410_10109914 3300031852 Bacteria 1993
605 Ga0307409_100489184 3300031995 Bacteria 1195
606 Ga0307411_10504635 3300032005 Bacteria 1023
607 Ga0307415_100069816 3300032126 Bacteria 2465
608 Ga0307415_100306999 3300032126 Bacteria 1317
609 Ga0307415_100798091 3300032126 Bacteria 861
610 Ga0307510_10005755 3300033180 Bacteria 14774
611 Ga0307510_10016732 3300033180 Bacteria 8653
612 Ga0307510_10022493 3300033180 Bacteria 7322
613 Ga0307510_10050890 3300033180 Bacteria 4388
614 Ga0307510_10063819 3300033180 Bacteria 3746
615 Ga0307510_10123392 3300033180 Bacteria 2287
616 Ga0307510_10137260 3300033180 Bacteria 2099
617 Ga0307510_10157707 3300033180 Bacteria 1873
618 Ga0315911_1000002 3300033442 Bacteria 926833
619 Ga0373950_0031985 3300034818 Bacteria 978
620 Ga0373926_0011600 3300035083 Bacteria 2967
621 Ga0373934_0016121 3300035086 Bacteria 2838
622 Ga0373944_0026448 3300035089 Bacteria 1714
623 Ga0373952_0025997 3300035092 Bacteria 1269
624 Ga0373952_0080572 3300035092 Bacteria 830
625 Ga0373923_0000289 3300035111 Bacteria 11095
626 Ga0373932_0019392 3300035112 Bacteria 1772
627 Ga0373932_0052670 3300035112 Bacteria 1213
628 Ga0373936_0006387 3300035113 Bacteria 4442
629 Ga0373936_0136603 3300035113 Bacteria 1056
630 Ga0373945_0063014 3300035116 Bacteria 1387
631 Ga0373953_0116458 3300035117 Bacteria 1133
632 Ga0373954_0001207 3300035118 Bacteria 10376
633 Ga0373954_0088515 3300035118 Bacteria 1485
634 Ga0373954_0140355 3300035118 Bacteria 1178
635 Ga0373956_0010705 3300035119 Bacteria 3765
636 Ga0373956_0093265 3300035119 Bacteria 1391
637 Ga0373957_0009960 3300035120 Bacteria 3125
638 Ga0373957_0042789 3300035120 Bacteria 1710
639 Ga0373943_0032647 3300035170 Bacteria 2475
640 Ga0373943_0085618 3300035170 Bacteria 1624
641 Ga0373943_0135699 3300035170 Bacteria 1321
642 Ga0373946_0003713 3300035171 Bacteria 5411
643 Ga0373946_0107013 3300035171 Bacteria 1261
644 Ga0373955_0009767 3300035172 Bacteria 4508
645 Ga0373955_0047368 3300035172 Bacteria 2327
646 Ga0373962_0093402 3300035242 Bacteria 930
647 Ga0373924_0012573 3300035410 Bacteria 3166
648 Ga0373924_0061287 3300035410 Bacteria 1574
649 Ga0373935_0000499 3300035692 Bacteria 20274
650 Ga0373935_0068682 3300035692 Bacteria 2280
651 Ga0373935_0397416 3300035692 Bacteria 989
652 Ga0373927_0025153 3300035695 Bacteria 3892
653 Ga0373927_0061213 3300035695 Bacteria 2435
654 Ga0373933_0001914 3300035724 Bacteria 12012
655 Ga0373947_0001481 3300035725 Bacteria 14428
656 Ga0373947_0009460 3300035725 Bacteria 5597
657 Ga0373947_0091243 3300035725 Bacteria 1900
658 Ga0373947_0198789 3300035725 Bacteria 1311
659 Ga0373947_0244977 3300035725 Bacteria 1184
660 Ga0373947_0341882 3300035725 Bacteria 1003
661 Ga0373937_0004047 3300036401 Bacteria 12416
662 Ga0373937_0014169 3300036401 Bacteria 7033
663 Ga0373937_0026809 3300036401 Bacteria 5209
664 Ga0373937_0166521 3300036401 Bacteria 2067
665 Ga0373937_0465599 3300036401 Bacteria 1200
666 Ga0373925_0010291 3300037068 Bacteria 6783
667 Ga0373925_0048830 3300037068 Bacteria 3154
668 Ga0373925_0349009 3300037068 Bacteria 1201
669 Ga0395899_0075081 3300037312 Bacteria 2469
670 Ga0395900_0000851 3300037418 Bacteria 40239
671 Ga0395900_0037891 3300037418 Bacteria 4971
672 Ga0395900_0407528 3300037418 Bacteria 1322
673 Ga0395900_0703045 3300037418 Bacteria 944
674 Ga0395898_0008255 3300037466 Bacteria 11013
675 Ga0395898_0009621 3300037466 Bacteria 10148
676 Ga0395898_0261367 3300037466 Bacteria 1651
677 Ga0395898_0463388 3300037466 Bacteria 1206
678 Ga0395905_0005304 3300037471 Bacteria 13182
679 Ga0395905_0076783 3300037471 Bacteria 3130
680 Ga0395901_0009809 3300038443 Bacteria 9710
681 Ga0395901_0076417 3300038443 Bacteria 3494
682 Ga0436365_0256340 3300039437 Bacteria 1582
683 Ga0436365_0627243 3300039437 Bacteria 2814
684 Ga0436365_1226979 3300039437 Bacteria 1194
685 Ga0436365_1300190 3300039437 Bacteria 2823
686 Ga0436361_0265242 3300039447 Bacteria 3580
687 Ga0436363_0687569 3300039450 Bacteria 1680
688 Ga0436363_1579678 3300039450 Bacteria 2239
689 Ga0436362_0328324 3300039453 Bacteria 3150
690 Ga0451795_1119810 3300041456 Bacteria 1285
691 Ga0451833_0873998 3300041491 Bacteria 1105
692 Ga0451833_1242256 3300041491 Bacteria 1119
693 Ga0439431_0024303 3300041997 Bacteria 1473
694 Ga0466969_0045804 3300044656 Bacteria 2170
695 Ga0466969_0082145 3300044656 Bacteria 1536
696 Ga0466972_0000325 3300044658 Bacteria 26886
697 Ga0466972_0028367 3300044658 Bacteria 2761
698 Ga0466965_0019908 3300044683 Bacteria 3222
699 Ga0466965_0103075 3300044683 Bacteria 1460
700 Ga0466966_0012258 3300044684 Bacteria 5680
701 Ga0466966_0279073 3300044684 Bacteria 1005
702 Ga0466961_0000132 3300044693 Bacteria 49595
703 Ga0466963_0021127 3300044694 Bacteria 4102
704 Ga0466963_0191347 3300044694 Bacteria 1429
705 Ga0466963_0226529 3300044694 Bacteria 1310
706 Ga0466964_0076952 3300044706 Bacteria 1424
707 Ga0466968_0004242 3300044735 Bacteria 5346
708 Ga0466968_0100958 3300044735 Bacteria 1288
709 Ga0466957_0108073 3300044842 Bacteria 1761
710 Ga0466957_0129569 3300044842 Bacteria 1615
711 Ga0466957_0305128 3300044842 Bacteria 1070
712 Ga0466960_0007335 3300044901 Bacteria 4474
713 Ga0466959_0000295 3300045049 Bacteria 29676
714 Ga0466958_0155219 3300045836 Bacteria 1445
715 Ga0466967_0057490 3300045976 Bacteria 3434
716 Ga0466967_0073807 3300045976 Bacteria 3061
717 Ga0495617_080445 3300046452 Bacteria 1067
718 Ga0495592_0000427 3300046454 Bacteria 31839
719 Ga0495592_0003354 3300046454 Bacteria 11465
720 Ga0495592_0018326 3300046454 Bacteria 5322
721 Ga0495592_0023956 3300046454 Bacteria 4643
722 Ga0495592_0102690 3300046454 Bacteria 2035
723 Ga0495603_0000040 3300046455 Bacteria 55056
724 Ga0495603_0002873 3300046455 Bacteria 10184
725 Ga0495603_0044454 3300046455 Bacteria 2650
726 Ga0495603_0099998 3300046455 Bacteria 1693
727 Ga0495603_0190516 3300046455 Bacteria 1186
728 Ga0495603_0216223 3300046455 Bacteria 1106
729 Ga0495603_0251742 3300046455 Bacteria 1017
730 Ga0495590_0052477 3300046457 Bacteria 1424
731 Ga0495590_0106077 3300046457 Bacteria 1001
732 Ga0495590_0121834 3300046457 Bacteria 935
733 Ga0495629_0000077 3300046459 Bacteria 85931
734 Ga0495629_0000188 3300046459 Bacteria 56009
735 Ga0495629_0023257 3300046459 Bacteria 4416
736 Ga0495629_0035376 3300046459 Bacteria 3530
737 Ga0495629_0203859 3300046459 Bacteria 1367
738 Ga0495638_0013009 3300046460 Bacteria 5682
739 Ga0495638_0015053 3300046460 Bacteria 5206
740 Ga0495638_0067522 3300046460 Bacteria 2195
741 Ga0495638_0090254 3300046460 Bacteria 1847
742 Ga0495641_0056940 3300046461 Bacteria 1771
743 Ga0495651_0000271 3300046462 Bacteria 40231
744 Ga0495651_0023165 3300046462 Bacteria 4829
745 Ga0495651_0023797 3300046462 Bacteria 4763
746 Ga0495651_0094524 3300046462 Bacteria 2237
747 Ga0495651_0221858 3300046462 Bacteria 1308
748 Ga0495653_0004244 3300046463 Bacteria 11611
749 Ga0495580_0003456 3300046472 Bacteria 13444
750 Ga0495580_0004422 3300046472 Bacteria 11810
751 Ga0495582_0000020 3300046473 Bacteria 88349
752 Ga0495582_0116035 3300046473 Bacteria 1506
753 Ga0495582_0178813 3300046473 Bacteria 1208
754 Ga0495582_0339855 3300046473 Bacteria 864
755 Ga0495639_0000011 3300046475 Bacteria 92268
756 Ga0495639_0020094 3300046475 Bacteria 2917
757 Ga0495639_0035199 3300046475 Bacteria 2240
758 Ga0495639_0115148 3300046475 Bacteria 1279
759 Ga0495639_0178164 3300046475 Bacteria 1034
760 Ga0495662_0000229 3300046476 Bacteria 23341
761 Ga0495664_0026796 3300046477 Bacteria 3358
762 Ga0495664_0028905 3300046477 Bacteria 3239
763 Ga0495664_0054228 3300046477 Bacteria 2384
764 Ga0495584_0110989 3300046491 Bacteria 1387
765 Ga0495594_0002423 3300046499 Bacteria 9715
766 Ga0495594_0073656 3300046499 Bacteria 1901
767 Ga0495594_0257420 3300046499 Bacteria 994
768 Ga0495607_0039575 3300046501 Bacteria 2815
769 Ga0495606_0013074 3300046507 Bacteria 6594
770 Ga0495606_0031762 3300046507 Bacteria 3666
771 Ga0495606_0032446 3300046507 Bacteria 3617
772 Ga0495606_0038960 3300046507 Bacteria 3210
773 Ga0495606_0095217 3300046507 Bacteria 1824
774 Ga0495606_0138160 3300046507 Bacteria 1441
775 Ga0495608_0006190 3300046511 Bacteria 8495
776 Ga0495608_0026863 3300046511 Bacteria 3921
777 Ga0495610_0029681 3300046512 Bacteria 2876
778 Ga0495616_0061165 3300046513 Bacteria 1847
779 Ga0495618_0049300 3300046514 Bacteria 2659
780 Ga0495618_0112657 3300046514 Bacteria 1742
781 Ga0495618_0366707 3300046514 Bacteria 885
782 Ga0495620_0073293 3300046515 Bacteria 1396
783 Ga0495620_0104330 3300046515 Bacteria 1128
784 Ga0495628_0047293 3300046516 Bacteria 3414
785 Ga0495630_0005419 3300046517 Bacteria 9006
786 Ga0495630_0049964 3300046517 Bacteria 3129
787 Ga0495630_0175759 3300046517 Bacteria 1632
788 Ga0495631_0078206 3300046518 Bacteria 1428
789 Ga0495632_0004752 3300046519 Bacteria 9159
790 Ga0495632_0102048 3300046519 Bacteria 1351
791 Ga0495632_0177113 3300046519 Bacteria 978
792 Ga0495643_0024447 3300046522 Bacteria 3426
793 Ga0495643_0063870 3300046522 Bacteria 1946
794 Ga0495644_0049431 3300046523 Bacteria 1578
795 Ga0495648_0068085 3300046524 Bacteria 2079
796 Ga0495648_0068596 3300046524 Bacteria 2067
797 Ga0495648_0151206 3300046524 Bacteria 1211
798 Ga0495663_0047497 3300046525 Bacteria 1322
799 Ga0495652_0004764 3300046529 Bacteria 12908
800 Ga0495652_0055109 3300046529 Bacteria 3382
801 Ga0495652_0059496 3300046529 Bacteria 3232
802 Ga0495652_0295207 3300046529 Bacteria 1181
803 Ga0495665_0000133 3300046531 Bacteria 35771
804 Ga0495640_0010408 3300046533 Bacteria 7193
805 Ga0495640_0031699 3300046533 Bacteria 3770
806 Ga0495587_0044816 3300046536 Bacteria 2630
807 Ga0495587_0076333 3300046536 Bacteria 1946
808 Ga0495598_0009153 3300046537 Bacteria 2331
809 Ga0495609_0064709 3300046538 Bacteria 1613
810 Ga0495597_0012214 3300046542 Bacteria 4151
811 Ga0495597_0057617 3300046542 Bacteria 1699
812 Ga0495645_0008894 3300046543 Bacteria 7016
813 Ga0495645_0013345 3300046543 Bacteria 5807
814 Ga0495645_0037041 3300046543 Bacteria 3555
815 Ga0495645_0261797 3300046543 Bacteria 1145
816 Ga0495622_0006251 3300046557 Bacteria 5528
817 Ga0495622_0008052 3300046557 Bacteria 4886
818 Ga0495622_0037306 3300046557 Bacteria 2265
819 Ga0495622_0085745 3300046557 Bacteria 1448
820 Ga0495622_0170975 3300046557 Bacteria 977
821 Ga0495633_0125707 3300046558 Bacteria 1187
822 Ga0495667_0010094 3300046559 Bacteria 6395
823 Ga0495668_0010958 3300046616 Bacteria 5457
824 Ga0495668_0032597 3300046616 Bacteria 2930
825 Ga0495668_0036598 3300046616 Bacteria 2750
826 Ga0495668_0038869 3300046616 Bacteria 2658
827 Ga0495668_0128180 3300046616 Bacteria 1389
828 Ga0495634_0000402 3300046642 Bacteria 42617
829 Ga0495634_0009196 3300046642 Bacteria 7295
830 Ga0495634_0047380 3300046642 Bacteria 2897
831 Ga0495634_0337562 3300046642 Bacteria 904
832 Ga0495611_0033915 3300046648 Bacteria 2254
833 Ga0495611_0086132 3300046648 Bacteria 1449
834 Ga0495625_0031796 3300046660 Bacteria 3922
835 Ga0495635_0000196 3300046663 Bacteria 38194
836 Ga0495635_0012249 3300046663 Bacteria 6009
837 Ga0495635_0015570 3300046663 Bacteria 5315
838 Ga0495635_0066323 3300046663 Bacteria 2476
839 Ga0495635_0084244 3300046663 Bacteria 2175
840 Ga0495635_0086822 3300046663 Bacteria 2141
841 Ga0495661_0033831 3300046665 Bacteria 3221
842 Ga0495661_0134673 3300046665 Bacteria 1350
843 Ga0495588_0001382 3300046674 Bacteria 10366
844 Ga0495588_0015223 3300046674 Bacteria 3697
845 Ga0495657_0001347 3300046675 Bacteria 21368
846 Ga0495657_0003332 3300046675 Bacteria 13159
847 Ga0495657_0130252 3300046675 Bacteria 1576
848 Ga0495599_0019003 3300046678 Bacteria 4284
849 Ga0495623_0004419 3300046679 Bacteria 9239
850 Ga0495623_0104712 3300046679 Bacteria 1720
851 Ga0495623_0213024 3300046679 Bacteria 1105
852 Ga0495646_0025141 3300046680 Bacteria 3747
853 Ga0495646_0043300 3300046680 Bacteria 2758
854 Ga0495646_0044961 3300046680 Bacteria 2698
855 Ga0495646_0053965 3300046680 Bacteria 2420
856 Ga0495646_0111070 3300046680 Bacteria 1561
857 Ga0495647_0010003 3300046681 Bacteria 3223
858 Ga0495647_0147740 3300046681 Bacteria 1006
859 Ga0495658_0000538 3300046683 Bacteria 20615
860 Ga0495658_0019954 3300046683 Bacteria 3507
861 Ga0495658_0167147 3300046683 Bacteria 1360
862 Ga0495669_0105085 3300046684 Bacteria 1314
863 Ga0495613_0000873 3300046689 Bacteria 23135
864 Ga0495613_0027935 3300046689 Bacteria 4200
865 Ga0495613_0211710 3300046689 Bacteria 1363
866 Ga0495624_0000819 3300046690 Bacteria 24553
867 Ga0495624_0044349 3300046690 Bacteria 2835
868 Ga0495670_0087015 3300046691 Bacteria 1596
869 Ga0495649_0002961 3300046694 Bacteria 11698
870 Ga0495649_0040650 3300046694 Bacteria 2545
871 Ga0495649_0056075 3300046694 Bacteria 2128
872 Ga0495649_0087122 3300046694 Bacteria 1666
873 Ga0495649_0120220 3300046694 Bacteria 1389
874 Ga0495600_0001932 3300046809 Bacteria 11640
875 Ga0495600_0012427 3300046809 Bacteria 5323
876 Ga0495600_0030740 3300046809 Bacteria 3478
877 Ga0495600_0099306 3300046809 Bacteria 1897
878 Ga0495581_0000518 3300047315 Bacteria 19734
879 Ga0495581_0007817 3300047315 Bacteria 6192
880 Ga0495581_0194108 3300047315 Bacteria 1188
881 Ga0495581_0428433 3300047315 Bacteria 771
882 Ga0495604_0002485 3300047317 Bacteria 14722
883 Ga0495604_0004984 3300047317 Bacteria 10513
884 Ga0495604_0020026 3300047317 Bacteria 5346
885 Ga0495604_0173157 3300047317 Bacteria 1516
886 Ga0495604_0305358 3300047317 Bacteria 1068
887 Ga0495604_0340537 3300047317 Bacteria 998
888 Ga0495674_0001070 3300047319 Bacteria 26357
889 Ga0495674_0013696 3300047319 Bacteria 7618
890 Ga0495674_0041838 3300047319 Bacteria 4090
891 Ga0495674_0066903 3300047319 Bacteria 3115
892 Ga0495674_0141255 3300047319 Bacteria 2024
893 Ga0495672_0012004 3300047320 Bacteria 6068
894 Ga0495676_0033175 3300047321 Bacteria 4351
895 Ga0495676_0072590 3300047321 Bacteria 2642
896 Ga0495676_0080565 3300047321 Bacteria 2472
897 Ga0495676_0175077 3300047321 Bacteria 1507
898 Ga0495676_0206670 3300047321 Bacteria 1361
899 Ga0495676_0214251 3300047321 Bacteria 1331
900 Ga0495680_0001198 3300047322 Bacteria 28460
901 Ga0495680_0013711 3300047322 Bacteria 7055
902 Ga0495680_0114735 3300047322 Bacteria 1993
903 Ga0495680_0189206 3300047322 Bacteria 1481
904 Ga0495683_0021057 3300047323 Bacteria 3361
905 Ga0495687_001232 3300047443 Bacteria 24482
906 Ga0495687_014924 3300047443 Bacteria 3970
907 Ga0495687_024789 3300047443 Bacteria 2845
908 Ga0495675_0000638 3300047444 Bacteria 22292
909 Ga0495675_0003907 3300047444 Bacteria 9025
910 Ga0495673_0029213 3300047469 Bacteria 2604
911 Ga0495673_0113117 3300047469 Bacteria 1083
912 Ga0495673_0153407 3300047469 Bacteria 889
913 Ga0495684_0000068 3300047471 Bacteria 70808
914 Ga0495684_0025140 3300047471 Bacteria 4579
915 Ga0495684_0063761 3300047471 Bacteria 2801
916 Ga0495686_0057283 3300047472 Bacteria 2433
917 Ga0495686_0082404 3300047472 Bacteria 1963
918 Ga0495593_0000006 3300047673 Bacteria 90370
919 Ga0495593_0007104 3300047673 Bacteria 6565
920 Ga0495593_0158014 3300047673 Bacteria 1145
921 Ga0495602_0001578 3300048088 Bacteria 22679
922 Ga0495602_0029704 3300048088 Bacteria 5197
923 Ga0495626_0067645 3300048091 Bacteria 1613
924 Ga0496100_0033217 3300048903 Bacteria 3227
925 Ga0496100_0066259 3300048903 Bacteria 2395
926 Ga0496100_0564919 3300048903 Bacteria 881
927 Ga0496101_0173551 3300048904 Bacteria 1657
928 Ga0496101_0247703 3300048904 Bacteria 1388
929 Ga0496101_0283463 3300048904 Bacteria 1295
930 Ga0496102_0003559 3300048905 Bacteria 13195
931 Ga0496102_0036626 3300048905 Bacteria 4421
932 Ga0496102_0056022 3300048905 Bacteria 3595
933 Ga0496102_0080549 3300048905 Bacteria 3000
934 Ga0496102_0124233 3300048905 Bacteria 2412
935 Ga0496103_0018401 3300048906 Bacteria 4190
936 Ga0496103_0030094 3300048906 Bacteria 3302
937 Ga0496104_0001744 3300048907 Bacteria 18783
938 Ga0496104_0078243 3300048907 Bacteria 3151
939 Ga0496104_0422288 3300048907 Bacteria 1245
940 Ga0496105_0002142 3300048908 Bacteria 14301
941 Ga0496105_0011609 3300048908 Bacteria 6969
942 Ga0496105_0138852 3300048908 Bacteria 2001
943 Ga0496105_0197579 3300048908 Bacteria 1642
944 Ga0496106_0006841 3300048909 Bacteria 8439
945 Ga0496106_0032859 3300048909 Bacteria 3869
946 Ga0496106_0044275 3300048909 Bacteria 3341
947 Ga0496107_0005103 3300048910 Bacteria 8953
948 Ga0496107_0013020 3300048910 Bacteria 5811
949 Ga0496107_0157111 3300048910 Bacteria 1684
950 Ga0496107_0418635 3300048910 Bacteria 996
951 Ga0496108_0000259 3300048911 Bacteria 45599
952 Ga0496108_0168440 3300048911 Bacteria 1894
953 Ga0496109_0000250 3300048912 Bacteria 51687
954 Ga0496109_0017185 3300048912 Bacteria 6335
955 Ga0496109_0037911 3300048912 Bacteria 4356
956 Ga0496109_0153338 3300048912 Bacteria 2158
957 Ga0496109_0772365 3300048912 Bacteria 899
958 Ga0496109_0853811 3300048912 Bacteria 848
959 Ga0496110_0037452 3300048913 Bacteria 4216
960 Ga0496110_0080326 3300048913 Bacteria 2905
961 Ga0496110_0465730 3300048913 Bacteria 1152
962 Ga0496111_0020268 3300048914 Bacteria 4627
963 Ga0496111_0176071 3300048914 Bacteria 1590
964 Ga0496112_0000017 3300048915 Bacteria 191284
965 Ga0496112_0042892 3300048915 Bacteria 4427
966 Ga0496112_0047421 3300048915 Bacteria 4215
967 Ga0496112_0052717 3300048915 Bacteria 3993
968 Ga0496112_0082096 3300048915 Bacteria 3188
969 Ga0496112_0094161 3300048915 Bacteria 2966
970 Ga0496112_0158529 3300048915 Bacteria 2230
971 Ga0496112_0180214 3300048915 Bacteria 2076
972 Ga0496112_0259552 3300048915 Bacteria 1687
973 Ga0496113_0029385 3300048916 Bacteria 3968
974 Ga0496113_0036230 3300048916 Bacteria 3613
975 Ga0496113_0059155 3300048916 Bacteria 2886
976 Ga0496113_0081737 3300048916 Bacteria 2477
977 Ga0496113_0106353 3300048916 Bacteria 2179
978 Ga0496114_0053748 3300048917 Bacteria 3357
979 Ga0496114_0135248 3300048917 Bacteria 2131
980 Ga0496114_0143156 3300048917 Bacteria 2071
981 Ga0496114_0225884 3300048917 Bacteria 1644
982 Ga0496114_0512394 3300048917 Bacteria 1061
983 Ga0496115_0003885 3300048918 Bacteria 10774
984 Ga0496115_0015437 3300048918 Bacteria 5794
985 Ga0496115_0040567 3300048918 Bacteria 3702
986 Ga0496115_0067618 3300048918 Bacteria 2890
987 Ga0496115_0129606 3300048918 Bacteria 2079
988 Ga0496115_0276809 3300048918 Bacteria 1378
989 Ga0496116_0001079 3300048919 Bacteria 32822
990 Ga0496116_0027016 3300048919 Bacteria 4183
991 Ga0496116_0251187 3300048919 Bacteria 880
992 Ga0496117_0054193 3300048920 Bacteria 2811
993 Ga0496117_0062441 3300048920 Bacteria 2553
994 Ga0496117_0087241 3300048920 Bacteria 2023
995 Ga0496117_0126045 3300048920 Bacteria 1562
996 Ga0496118_0036913 3300048921 Bacteria 3942
997 Ga0496118_0047345 3300048921 Bacteria 3333
998 Ga0496118_0075692 3300048921 Bacteria 2399
999 Ga0496118_0084124 3300048921 Bacteria 2221
1000 Ga0496118_0156068 3300048921 Bacteria 1419
1001 Ga0496118_0236065 3300048921 Bacteria 1051
1002 Ga0496118_0273118 3300048921 Bacteria 946
1003 Ga0496119_0020449 3300048922 Bacteria 4831
1004 Ga0496119_0042028 3300048922 Bacteria 2903
1005 Ga0496119_0113111 3300048922 Bacteria 1503
1006 Ga0496120_0009024 3300048923 Bacteria 7126
1007 Ga0496120_0103135 3300048923 Bacteria 1503
1008 Ga0496121_0001488 3300048924 Bacteria 39493
1009 Ga0496121_0002000 3300048924 Bacteria 32381
1010 Ga0496121_0011984 3300048924 Bacteria 9533
1011 Ga0496121_0014293 3300048924 Bacteria 8440
1012 Ga0496121_0025495 3300048924 Bacteria 5607
1013 Ga0496121_0031812 3300048924 Bacteria 4812
1014 Ga0496121_0044119 3300048924 Bacteria 3851
1015 Ga0496121_0060417 3300048924 Bacteria 3117
1016 Ga0496121_0108498 3300048924 Bacteria 2123
1017 Ga0496121_0108787 3300048924 Bacteria 2120
1018 Ga0496121_0111529 3300048924 Bacteria 2085
1019 Ga0496121_0280319 3300048924 Bacteria 1140
1020 Ga0496121_0300571 3300048924 Bacteria 1089
1021 Ga0496122_0073748 3300048925 Bacteria 2418
1022 Ga0496123_0044032 3300048926 Bacteria 3056
1023 Ga0496124_0037607 3300048927 Bacteria 4208
1024 Ga0496124_0069807 3300048927 Bacteria 2916
1025 Ga0496124_0221658 3300048927 Bacteria 1422
1026 Ga0496124_0392713 3300048927 Bacteria 966
1027 Ga0496125_0010421 3300048928 Bacteria 9405
1028 Ga0496125_0018563 3300048928 Bacteria 6603
1029 Ga0496125_0045725 3300048928 Bacteria 3680
1030 Ga0496125_0048379 3300048928 Bacteria 3547
1031 Ga0496125_0103617 3300048928 Bacteria 2087
1032 Ga0496125_0272671 3300048928 Bacteria 1053
1033 Ga0496125_0317897 3300048928 Bacteria 945
1034 Ga0496126_0005288 3300048929 Bacteria 14814
1035 Ga0496126_0005411 3300048929 Bacteria 14568
1036 Ga0496126_0006081 3300048929 Bacteria 13538
1037 Ga0496126_0020645 3300048929 Bacteria 6452
1038 Ga0496126_0027556 3300048929 Bacteria 5425
1039 Ga0496126_0032207 3300048929 Bacteria 4941
1040 Ga0496126_0080738 3300048929 Bacteria 2877
1041 Ga0496126_0109374 3300048929 Bacteria 2409
1042 Ga0496126_0119862 3300048929 Bacteria 2283
1043 Ga0496126_0122534 3300048929 Bacteria 2253
1044 Ga0496126_0135001 3300048929 Bacteria 2129
1045 Ga0496126_0200005 3300048929 Bacteria 1688
1046 Ga0496126_0240653 3300048929 Bacteria 1512
1047 Ga0496126_0247534 3300048929 Bacteria 1486
1048 Ga0496126_0296031 3300048929 Bacteria 1337
1049 Ga0496126_0437355 3300048929 Bacteria 1055
1050 Ga0501032_0000392 3300049569 Bacteria 36103
1051 Ga0501032_0205166 3300049569 Bacteria 1286
1052 Ga0501033_0000232 3300049570 Bacteria 53703
1053 Ga0501033_0019714 3300049570 Bacteria 5097
1054 Ga0501034_0000704 3300049571 Bacteria 50735
1055 Ga0501036_0000007 3300049572 Bacteria 240500
1056 Ga0501036_0612326 3300049572 Bacteria 903
1057 Ga0501037_0000066 3300049573 Bacteria 96723
1058 Ga0501038_0000026 3300049574 Bacteria 146493
1059 Ga0501038_0043211 3300049574 Bacteria 3920
1060 Ga0501039_0000005 3300049575 Bacteria 295471
1061 Ga0501043_0000036 3300049579 Bacteria 132959
1062 Ga0501043_0063197 3300049579 Bacteria 2907
1063 Ga0501046_0000147 3300049580 Bacteria 74186
1064 Ga0501046_0152222 3300049580 Bacteria 1745
1065 Ga0501047_0000209 3300049581 Bacteria 70658
1066 Ga0501047_0323939 3300049581 Bacteria 1380
1067 Ga0501048_0000460 3300049582 Bacteria 28509
1068 Ga0501068_0000569 3300049584 Bacteria 18796
1069 Ga0501069_0060551 3300049585 Bacteria 2113
1070 Ga0501070_0000163 3300049586 Bacteria 60911
1071 Ga0501070_0071782 3300049586 Bacteria 2866
1072 Ga0501071_0108835 3300049587 Bacteria 2047
1073 Ga0501072_0026856 3300049588 Bacteria 4492
1074 Ga0501073_0000070 3300049589 Bacteria 63026
1075 Ga0501076_0267228 3300049592 Bacteria 1400
1076 Ga0501079_0132167 3300049741 Bacteria 1942
1077 Ga0501080_0000137 3300049742 Bacteria 51355
1078 Ga0501035_0000016 3300049822 Bacteria 243412
1079 Ga0501035_0064059 3300049822 Bacteria 3268
1080 Ga0501044_0000366 3300049823 Bacteria 56832
1081 Ga0501045_0062432 3300049824 Bacteria 2734
1082 nmdc:mga03683_73217_c1 3300050489 Bacteria 1468
1083 nmdc:mga03n38_4598_c1 3300050490 Bacteria 4593
1084 nmdc:mga03n38_55100_c1 3300050490 Bacteria 1790
1085 nmdc:mga03n38_7548_c1 3300050490 Bacteria 3853
1086 nmdc:mga00v17_128981_c1 3300050491 Bacteria 1615
1087 nmdc:mga00v17_155175_c1 3300050491 Bacteria 1472
1088 nmdc:mga00v17_208266_c1 3300050491 Bacteria 1265
1089 nmdc:mga00v17_248935_c1 3300050491 Bacteria 1152
1090 nmdc:mga00v17_63217_c1 3300050491 Bacteria 2279
1091 nmdc:mga0yw44_225692_c1 3300050492 Bacteria 1242
1092 nmdc:mga0yw44_277830_c1 3300050492 Bacteria 1119
1093 nmdc:mga0yw44_292175_c1 3300050492 Bacteria 1091
1094 nmdc:mga0yw44_5155_c1 3300050492 Bacteria 6120
1095 nmdc:mga0yw44_51827_c1 3300050492 Bacteria 2486
1096 nmdc:mga0k408_115683_c1 3300050493 Bacteria 1587
1097 nmdc:mga0k408_11676_c1 3300050493 Bacteria 4788
1098 nmdc:mga0k408_13681_c1 3300050493 Bacteria 4455
1099 nmdc:mga0k408_60539_c1 3300050493 Bacteria 2200
1100 nmdc:mga0k408_78691_c1 3300050493 Bacteria 1929
1101 nmdc:mga06z11_10966_c1 3300050494 Bacteria 3887
1102 nmdc:mga06z11_13270_c1 3300050494 Bacteria 3612
1103 nmdc:mga06z11_22394_c1 3300050494 Bacteria 2950
1104 nmdc:mga06z11_256435_c1 3300050494 Bacteria 1031
1105 nmdc:mga06z11_291901_c1 3300050494 Bacteria 968
1106 nmdc:mga06z11_47123_c1 3300050494 Bacteria 2188
1107 nmdc:mga06z11_94523_c1 3300050494 Bacteria 1629
1108 nmdc:mga07m45_108878_c1 3300050496 Bacteria 1595
1109 nmdc:mga07m45_161000_c1 3300050496 Bacteria 1303
1110 nmdc:mga07m45_1793_c1 3300050496 Bacteria 9881
1111 nmdc:mga07m45_28416_c1 3300050496 Bacteria 3087
1112 nmdc:mga07m45_317645_c1 3300050496 Bacteria 905
1113 nmdc:mga07m45_40838_c1 3300050496 Bacteria 2597
1114 nmdc:mga07m45_4531_c1 3300050496 Bacteria 6807
1115 nmdc:mga07m45_75007_c1 3300050496 Bacteria 1100
1116 nmdc:mga07m45_96708_c1 3300050496 Bacteria 1694
1117 nmdc:mga08y16_10722_c1 3300050511 Bacteria 9617
1118 nmdc:mga0n895_407573_c1 3300050512 Bacteria 1375
1119 nmdc:mga0n895_72147_c1 3300050512 Bacteria 3425
1120 nmdc:mga08x19_195522_c1 3300050514 Bacteria 1385
1121 nmdc:mga0sz30_105528_c1 3300050516 Bacteria 1233
1122 nmdc:mga0sz30_22053_c1 3300050516 Bacteria 2582
1123 nmdc:mga0sz30_53428_c1 3300050516 Bacteria 1717
1124 Ga0495601_0166231 3300053077 Bacteria 1442
1125 Ga0495601_0194980 3300053077 Bacteria 1324
1126 Ga0495601_0231003 3300053077 Bacteria 1208
1127 Ga0495601_0246425 3300053077 Bacteria 1167
1128 Ga0495612_0031082 3300053078 Bacteria 2152
1129 Ga0495612_0064504 3300053078 Bacteria 1520
1130 Ga0500610_0189067 3300053079 Bacteria 1001
1131 Ga0500635_0001266 3300053080 Bacteria 6035
1132 Ga0500635_0022379 3300053080 Bacteria 1959
1133 Ga0495595_0011980 3300053084 Bacteria 3636
1134 Ga0495595_0032357 3300053084 Bacteria 2356
1135 Ga0495619_0000829 3300053085 Bacteria 20282
1136 Ga0495619_0039802 3300053085 Bacteria 3070
1137 Ga0495619_0082427 3300053085 Bacteria 2168
1138 Ga0495619_0235638 3300053085 Bacteria 1268
1139 Ga0500643_000069 3300053087 Bacteria 116366
1140 Ga0500644_0011509 3300053088 Bacteria 2419
1141 Ga0500644_0015403 3300053088 Bacteria 2179
1142 Ga0500581_036511 3300053089 Bacteria 2517
1143 Ga0500647_0005637 3300053091 Bacteria 5214
1144 Ga0500647_0043590 3300053091 Bacteria 2153
1145 Ga0500583_0136253 3300053092 Bacteria 1219
1146 Ga0500651_0043032 3300053093 Bacteria 2844
1147 Ga0500651_0127694 3300053093 Bacteria 1539
1148 Ga0500651_0136342 3300053093 Bacteria 1482
1149 Ga0500651_0290095 3300053093 Bacteria 941
1150 Ga0500566_0000043 3300053094 Bacteria 62755
1151 Ga0500566_0000479 3300053094 Bacteria 22269
1152 Ga0500566_0001303 3300053094 Bacteria 14556
1153 Ga0500566_0007953 3300053094 Bacteria 6275
1154 Ga0500640_011315 3300053095 Bacteria 3633
1155 Ga0500641_0005452 3300053096 Bacteria 4510
1156 Ga0500641_0006170 3300053096 Bacteria 4249
1157 Ga0500641_0015386 3300053096 Bacteria 2838
1158 Ga0500650_0011529 3300053098 Bacteria 3643
1159 Ga0500650_0155760 3300053098 Bacteria 1055
1160 Ga0500555_005858 3300053103 Bacteria 3486
1161 Ga0500555_068946 3300053103 Bacteria 937
1162 Ga0500556_0000093 3300053104 Bacteria 82933
1163 Ga0500556_0003091 3300053104 Bacteria 4974
1164 Ga0500556_0122895 3300053104 Bacteria 1013
1165 Ga0500557_000003 3300053105 Bacteria 228429
1166 Ga0500562_016831 3300053108 Bacteria 1881
1167 Ga0500569_002246 3300053109 Bacteria 3778
1168 Ga0500572_004209 3300053111 Bacteria 3266
1169 Ga0500572_006775 3300053111 Bacteria 2632
1170 Ga0500592_001027 3300053116 Bacteria 4555
1171 Ga0500592_010923 3300053116 Bacteria 1450
1172 Ga0500594_0010492 3300053118 Bacteria 2152
1173 Ga0500594_0015719 3300053118 Bacteria 1830
1174 Ga0500595_000722 3300053119 Bacteria 19637
1175 Ga0500595_001442 3300053119 Bacteria 12692
1176 Ga0500595_004127 3300053119 Bacteria 6589
1177 Ga0500595_009591 3300053119 Bacteria 3899
1178 Ga0500595_042887 3300053119 Bacteria 1444
1179 Ga0500607_050231 3300053121 Bacteria 2223
1180 Ga0500608_013224 3300053122 Bacteria 3651
1181 Ga0500608_018017 3300053122 Bacteria 3216
1182 Ga0500608_021825 3300053122 Bacteria 2962
1183 Ga0500614_007785 3300053123 Bacteria 2263
1184 Ga0500642_0000013 3300053130 Bacteria 197927
1185 Ga0500642_0000114 3300053130 Bacteria 37434
1186 Ga0500642_0057810 3300053130 Bacteria 1731
1187 Ga0500642_0113963 3300053130 Bacteria 1263
1188 Ga0500652_000620 3300053131 Bacteria 12220
1189 Ga0500658_0030098 3300053134 Bacteria 2115
1190 Ga0500559_0000200 3300053136 Bacteria 47807
1191 Ga0500559_0001123 3300053136 Bacteria 16112
1192 Ga0500559_0002307 3300053136 Bacteria 10015
1193 Ga0500561_0021843 3300053137 Bacteria 1513
1194 Ga0500568_0001875 3300053139 Bacteria 12940
1195 Ga0500568_0033785 3300053139 Bacteria 2096
1196 Ga0500568_0040925 3300053139 Bacteria 1864
1197 Ga0500586_004376 3300053145 Bacteria 3448
1198 Ga0500590_049087 3300053148 Bacteria 2148
1199 Ga0500590_136030 3300053148 Bacteria 1130
1200 Ga0500603_000679 3300053150 Bacteria 8287
1201 Ga0500604_0010294 3300053151 Bacteria 2499
1202 Ga0500616_0000288 3300053153 Bacteria 73364
1203 Ga0500616_0062111 3300053153 Bacteria 1931
1204 Ga0500619_013213 3300053154 Bacteria 2182
1205 Ga0500622_0000563 3300053156 Bacteria 33995
1206 Ga0500622_0011755 3300053156 Bacteria 4758
1207 Ga0500622_0061186 3300053156 Bacteria 1920
1208 Ga0500627_0090534 3300053158 Bacteria 1369
1209 Ga0500627_0168144 3300053158 Bacteria 988
1210 Ga0500630_001851 3300053159 Bacteria 10169
1211 Ga0500633_0064731 3300053160 Bacteria 1293
1212 Ga0500634_0047928 3300053161 Bacteria 2306
1213 Ga0500638_072772 3300053162 Bacteria 1641
1214 Ga0500638_161012 3300053162 Bacteria 988
1215 Ga0500639_000099 3300053163 Bacteria 40200
1216 Ga0500636_0001860 3300053177 Bacteria 11559
1217 Ga0500636_0004209 3300053177 Bacteria 8147
1218 Ga0500636_0058733 3300053177 Bacteria 2248
1219 Ga0500636_0071286 3300053177 Bacteria 2015
1220 Ga0500636_0084068 3300053177 Bacteria 1830
1221 Ga0500636_0085612 3300053177 Bacteria 1811
1222 Ga0500636_0101840 3300053177 Bacteria 1632
1223 Ga0500637_0000093 3300053178 Bacteria 32051
1224 Ga0500625_014631 3300053729 Bacteria 3628
1225 Ga0500645_005813 3300053730 Bacteria 4481
1226 Ga0500609_006498 3300053731 Bacteria 1593
1227 Ga0500656_002492 3300053732 Bacteria 1668
1228 Ga0500601_000092 3300053737 Bacteria 18784
1229 Ga0500661_001138 3300055283 Bacteria 4964
1230 Ga0500661_006682 3300055283 Bacteria 2148
1231 Ga0466962_0109112 3300061719 Bacteria 1332
1232 Ga0530510_0125737 3300061734 Bacteria 1885

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028786 Ga0307517_10052355 Ga0307517_100523553 213
2 3300047315 Ga0495581_0428433 Ga0495581_0428433_92_745 215
3 3300053093 Ga0500651_0290095 Ga0500651_0290095_12_701 227
4 3300014326 Ga0157380_10001485 Ga0157380_1000148513 229
5 3300046524 Ga0495648_0151206 Ga0495648_0151206_304_1002 230
6 3300003215 JGI25153J46596_10001246 JGI25153J46596_100012465 232
7 3300003794 Ga0055531_10008008 Ga0055531_100080083 232
8 3300003794 Ga0055531_10013844 Ga0055531_100138443 232
9 3300005262 Ga0065165_1005514 Ga0065165_10055143 232
10 3300006178 Ga0075367_10083923 Ga0075367_100839232 232
11 3300006195 Ga0075366_10219323 Ga0075366_102193232 232
12 3300006353 Ga0075370_10122359 Ga0075370_101223592 232
13 3300025295 Ga0209564_1009950 Ga0209564_10099502 232
14 3300025297 Ga0209758_1000011 Ga0209758_1000011347 232
15 3300025299 Ga0209256_1005335 Ga0209256_10053352 232
16 3300025302 Ga0207426_1065167 Ga0207426_10651672 232
17 3300025304 Ga0209257_1006326 Ga0209257_10063266 232
18 3300050493 nmdc:mga0k408_60539_c1 nmdc:mga0k408_60539_c1_1113_1895 232
19 3300053109 Ga0500569_002246 Ga0500569_002246_324_1106 232
20 3300005334 Ga0068869_100220068 Ga0068869_1002200682 233
21 3300005338 Ga0068868_100132633 Ga0068868_1001326332 233
22 3300005344 Ga0070661_100219599 Ga0070661_1002195992 233
23 3300005548 Ga0070665_100015861 Ga0070665_1000158612 233
24 3300005616 Ga0068852_100115660 Ga0068852_1001156602 233
25 3300005719 Ga0068861_100488715 Ga0068861_1004887152 233
26 3300005843 Ga0068860_100358312 Ga0068860_1003583122 233
27 3300005983 Ga0081540_1003783 Ga0081540_10037834 233
28 3300009098 Ga0105245_10021491 Ga0105245_100214913 233
29 3300009174 Ga0105241_10613434 Ga0105241_106134342 233
30 3300009551 Ga0105238_10846207 Ga0105238_108462071 233
31 3300011119 Ga0105246_10020341 Ga0105246_100203411 233
32 3300013296 Ga0157374_10271655 Ga0157374_102716552 233
33 3300013308 Ga0157375_10058051 Ga0157375_100580514 233
34 3300014745 Ga0157377_10191461 Ga0157377_101914612 233
35 3300014968 Ga0157379_10197211 Ga0157379_101972112 233
36 3300014969 Ga0157376_10072632 Ga0157376_100726322 233
37 3300021320 Ga0214544_1000001 Ga0214544_1000001742 233
38 3300021321 Ga0214542_1000037 Ga0214542_1000037127 233
39 3300021324 Ga0214545_1000003 Ga0214545_100000318 233
40 3300021327 Ga0214543_1003164 Ga0214543_100316418 233
41 3300025253 Ga0209677_106221 Ga0209677_1062212 233
42 3300025315 Ga0207697_10076204 Ga0207697_100762042 233
43 3300025901 Ga0207688_10302558 Ga0207688_103025582 233
44 3300025914 Ga0207671_10441043 Ga0207671_104410432 233
45 3300025920 Ga0207649_10505693 Ga0207649_105056931 233
46 3300025923 Ga0207681_10315252 Ga0207681_103152522 233
47 3300025960 Ga0207651_10116934 Ga0207651_101169342 233
48 3300026023 Ga0207677_10197555 Ga0207677_101975552 233
49 3300026075 Ga0207708_10293111 Ga0207708_102931112 233
50 3300026118 Ga0207675_100730608 Ga0207675_1007306082 233
51 3300026121 Ga0207683_10008222 Ga0207683_100082225 233
52 3300026142 Ga0207698_10148732 Ga0207698_101487322 233
53 3300026142 Ga0207698_10939462 Ga0207698_109394621 233
54 3300028379 Ga0268266_10020256 Ga0268266_100202565 233
55 3300028381 Ga0268264_10142197 Ga0268264_101421972 233
56 3300031507 Ga0307509_10141416 Ga0307509_101414162 233
57 3300031507 Ga0307509_10213959 Ga0307509_102139592 233
58 3300031730 Ga0307516_10370979 Ga0307516_103709792 233
59 3300032126 Ga0307415_100069816 Ga0307415_1000698162 233
60 3300033180 Ga0307510_10157707 Ga0307510_101577072 233
61 3300035725 Ga0373947_0341882 Ga0373947_0341882_93_875 233
62 3300044658 Ga0466972_0000325 Ga0466972_0000325_8475_9257 233
63 3300044683 Ga0466965_0019908 Ga0466965_0019908_815_1597 233
64 3300044735 Ga0466968_0100958 Ga0466968_0100958_413_1195 233
65 3300046455 Ga0495603_0044454 Ga0495603_0044454_1786_2568 233
66 3300046455 Ga0495603_0099998 Ga0495603_0099998_513_1295 233
67 3300046455 Ga0495603_0216223 Ga0495603_0216223_25_807 233
68 3300046459 Ga0495629_0035376 Ga0495629_0035376_2374_3156 233
69 3300046459 Ga0495629_0203859 Ga0495629_0203859_168_950 233
70 3300046461 Ga0495641_0056940 Ga0495641_0056940_394_1176 233
71 3300046473 Ga0495582_0178813 Ga0495582_0178813_315_1097 233
72 3300046475 Ga0495639_0115148 Ga0495639_0115148_453_1235 233
73 3300046491 Ga0495584_0110989 Ga0495584_0110989_393_1175 233
74 3300046507 Ga0495606_0095217 Ga0495606_0095217_909_1691 233
75 3300046507 Ga0495606_0138160 Ga0495606_0138160_380_1162 233
76 3300046512 Ga0495610_0029681 Ga0495610_0029681_382_1164 233
77 3300046518 Ga0495631_0078206 Ga0495631_0078206_178_960 233
78 3300046538 Ga0495609_0064709 Ga0495609_0064709_662_1444 233
79 3300046616 Ga0495668_0010958 Ga0495668_0010958_4095_4877 233
80 3300046663 Ga0495635_0086822 Ga0495635_0086822_283_1065 233
81 3300046684 Ga0495669_0105085 Ga0495669_0105085_378_1160 233
82 3300046691 Ga0495670_0087015 Ga0495670_0087015_785_1567 233
83 3300046694 Ga0495649_0120220 Ga0495649_0120220_454_1236 233
84 3300047315 Ga0495581_0194108 Ga0495581_0194108_43_825 233
85 3300047673 Ga0495593_0158014 Ga0495593_0158014_138_920 233
86 3300048903 Ga0496100_0564919 Ga0496100_0564919_17_799 233
87 3300048904 Ga0496101_0173551 Ga0496101_0173551_675_1457 233
88 3300048905 Ga0496102_0003559 Ga0496102_0003559_7789_8571 233
89 3300048906 Ga0496103_0030094 Ga0496103_0030094_1759_2541 233
90 3300048908 Ga0496105_0011609 Ga0496105_0011609_3472_4254 233
91 3300048909 Ga0496106_0032859 Ga0496106_0032859_42_824 233
92 3300048910 Ga0496107_0013020 Ga0496107_0013020_2029_2811 233
93 3300048911 Ga0496108_0168440 Ga0496108_0168440_571_1353 233
94 3300048912 Ga0496109_0017185 Ga0496109_0017185_2360_3142 233
95 3300048914 Ga0496111_0020268 Ga0496111_0020268_2115_2897 233
96 3300048915 Ga0496112_0180214 Ga0496112_0180214_1094_1876 233
97 3300048916 Ga0496113_0036230 Ga0496113_0036230_1028_1810 233
98 3300048917 Ga0496114_0053748 Ga0496114_0053748_1248_2030 233
99 3300048918 Ga0496115_0003885 Ga0496115_0003885_9972_10754 233
100 3300048918 Ga0496115_0129606 Ga0496115_0129606_148_930 233
101 3300048921 Ga0496118_0273118 Ga0496118_0273118_100_882 233
102 3300048924 Ga0496121_0031812 Ga0496121_0031812_2799_3581 233
103 3300048928 Ga0496125_0272671 Ga0496125_0272671_30_812 233
104 3300048929 Ga0496126_0005411 Ga0496126_0005411_2555_3337 233
105 3300048929 Ga0496126_0109374 Ga0496126_0109374_27_809 233
106 3300050489 nmdc:mga03683_73217_c1 nmdc:mga03683_73217_c1_182_964 233
107 3300050492 nmdc:mga0yw44_277830_c1 nmdc:mga0yw44_277830_c1_93_875 233
108 3300053080 Ga0500635_0001266 Ga0500635_0001266_2997_3779 233
109 3300053096 Ga0500641_0005452 Ga0500641_0005452_1665_2447 233
110 3300053130 Ga0500642_0057810 Ga0500642_0057810_509_1291 233
111 3300053137 Ga0500561_0021843 Ga0500561_0021843_147_929 233
112 3300053156 Ga0500622_0061186 Ga0500622_0061186_83_865 233
113 3300053732 Ga0500656_002492 Ga0500656_002492_76_858 233
114 3300005329 Ga0070683_100005150 Ga0070683_1000051506 234
115 3300005329 Ga0070683_100045815 Ga0070683_1000458153 234
116 3300005336 Ga0070680_100014277 Ga0070680_1000142776 234
117 3300005336 Ga0070680_100164630 Ga0070680_1001646301 234
118 3300005337 Ga0070682_100080829 Ga0070682_1000808292 234
119 3300005337 Ga0070682_100166017 Ga0070682_1001660172 234
120 3300005338 Ga0068868_100118384 Ga0068868_1001183842 234
121 3300005344 Ga0070661_100124364 Ga0070661_1001243642 234
122 3300005434 Ga0070709_10295482 Ga0070709_102954822 234
123 3300005435 Ga0070714_100049342 Ga0070714_1000493422 234
124 3300005436 Ga0070713_100037885 Ga0070713_1000378853 234
125 3300005436 Ga0070713_100158512 Ga0070713_1001585121 234
126 3300005458 Ga0070681_10029417 Ga0070681_100294172 234
127 3300005530 Ga0070679_100079100 Ga0070679_1000791002 234
128 3300005530 Ga0070679_100228659 Ga0070679_1002286592 234
129 3300005535 Ga0070684_100003497 Ga0070684_1000034974 234
130 3300005535 Ga0070684_100417106 Ga0070684_1004171062 234
131 3300005539 Ga0068853_100459002 Ga0068853_1004590022 234
132 3300005547 Ga0070693_100169621 Ga0070693_1001696212 234
133 3300005563 Ga0068855_100051385 Ga0068855_1000513854 234
134 3300005983 Ga0081540_1019658 Ga0081540_10196582 234
135 3300006237 Ga0097621_100680899 Ga0097621_1006808991 234
136 3300009093 Ga0105240_10152628 Ga0105240_101526282 234
137 3300009551 Ga0105238_10324664 Ga0105238_103246641 234
138 3300009553 Ga0105249_10680109 Ga0105249_106801092 234
139 3300010375 Ga0105239_10031497 Ga0105239_100314976 234
140 3300013105 Ga0157369_10017188 Ga0157369_100171884 234
141 3300013105 Ga0157369_10039801 Ga0157369_100398014 234
142 3300013307 Ga0157372_10295020 Ga0157372_102950202 234
143 3300022467 Ga0224712_10168337 Ga0224712_101683371 234
144 3300025911 Ga0207654_10144837 Ga0207654_101448372 234
145 3300025912 Ga0207707_10000378 Ga0207707_1000037824 234
146 3300025912 Ga0207707_10080028 Ga0207707_100800282 234
147 3300025913 Ga0207695_10051139 Ga0207695_100511395 234
148 3300025913 Ga0207695_10322552 Ga0207695_103225522 234
149 3300025914 Ga0207671_10127093 Ga0207671_101270932 234
150 3300025917 Ga0207660_10081145 Ga0207660_100811452 234
151 3300025917 Ga0207660_10148620 Ga0207660_101486202 234
152 3300025920 Ga0207649_10194117 Ga0207649_101941172 234
153 3300025921 Ga0207652_10005634 Ga0207652_100056342 234
154 3300025921 Ga0207652_10205936 Ga0207652_102059362 234
155 3300025924 Ga0207694_10070032 Ga0207694_100700322 234
156 3300025924 Ga0207694_10342462 Ga0207694_103424622 234
157 3300025924 Ga0207694_10583105 Ga0207694_105831052 234
158 3300025928 Ga0207700_10013002 Ga0207700_100130023 234
159 3300025928 Ga0207700_10132389 Ga0207700_101323892 234
160 3300025929 Ga0207664_10040468 Ga0207664_100404682 234
161 3300025944 Ga0207661_10007635 Ga0207661_100076357 234
162 3300025944 Ga0207661_10347895 Ga0207661_103478952 234
163 3300026041 Ga0207639_10107575 Ga0207639_101075753 234
164 3300026041 Ga0207639_10279803 Ga0207639_102798032 234
165 3300026067 Ga0207678_10048644 Ga0207678_100486443 234
166 3300026078 Ga0207702_10088634 Ga0207702_100886342 234
167 3300026078 Ga0207702_10386413 Ga0207702_103864131 234
168 3300031824 Ga0307413_10055476 Ga0307413_100554763 234
169 3300031852 Ga0307410_10109914 Ga0307410_101099142 234
170 3300032005 Ga0307411_10504635 Ga0307411_105046351 234
171 3300032126 Ga0307415_100306999 Ga0307415_1003069992 234
172 3300035120 Ga0373957_0042789 Ga0373957_0042789_74_856 234
173 3300037068 Ga0373925_0349009 Ga0373925_0349009_344_1126 234
174 3300037418 Ga0395900_0037891 Ga0395900_0037891_29_811 234
175 3300045976 Ga0466967_0057490 Ga0466967_0057490_499_1281 234
176 3300046536 Ga0495587_0076333 Ga0495587_0076333_833_1615 234
177 3300046680 Ga0495646_0025141 Ga0495646_0025141_2082_2864 234
178 3300048916 Ga0496113_0106353 Ga0496113_0106353_17_799 234
179 3300048924 Ga0496121_0300571 Ga0496121_0300571_228_1010 234
180 3300048927 Ga0496124_0069807 Ga0496124_0069807_47_829 234
181 3300048929 Ga0496126_0080738 Ga0496126_0080738_791_1573 234
182 3300048929 Ga0496126_0200005 Ga0496126_0200005_895_1677 234
183 3300049581 Ga0501047_0323939 Ga0501047_0323939_284_1066 234
184 3300049586 Ga0501070_0071782 Ga0501070_0071782_25_807 234
185 3300053077 Ga0495601_0166231 Ga0495601_0166231_222_1004 234
186 3300053096 Ga0500641_0006170 Ga0500641_0006170_2300_3082 234
187 3300053130 Ga0500642_0000114 Ga0500642_0000114_23453_24235 234
188 3300003214 JGI25165J46597_1009845 JGI25165J46597_10098452 235
189 3300003215 JGI25153J46596_10001884 JGI25153J46596_100018848 235
190 3300003215 JGI25153J46596_10025964 JGI25153J46596_100259642 235
191 3300005262 Ga0065165_1004449 Ga0065165_10044493 235
192 3300005331 Ga0070670_100181651 Ga0070670_1001816512 235
193 3300005347 Ga0070668_100083103 Ga0070668_1000831032 235
194 3300005347 Ga0070668_100283446 Ga0070668_1002834462 235
195 3300005347 Ga0070668_100551240 Ga0070668_1005512401 235
196 3300005355 Ga0070671_100036506 Ga0070671_1000365064 235
197 3300005455 Ga0070663_100070451 Ga0070663_1000704511 235
198 3300005456 Ga0070678_100350850 Ga0070678_1003508502 235
199 3300005458 Ga0070681_10104881 Ga0070681_101048812 235
200 3300005539 Ga0068853_100203223 Ga0068853_1002032231 235
201 3300005547 Ga0070693_100256270 Ga0070693_1002562702 235
202 3300005548 Ga0070665_100147619 Ga0070665_1001476192 235
203 3300005577 Ga0068857_100054592 Ga0068857_1000545922 235
204 3300005618 Ga0068864_100349063 Ga0068864_1003490632 235
205 3300005719 Ga0068861_100535543 Ga0068861_1005355432 235
206 3300005844 Ga0068862_100131326 Ga0068862_1001313263 235
207 3300005937 Ga0081455_10052548 Ga0081455_100525481 235
208 3300005983 Ga0081540_1062976 Ga0081540_10629762 235
209 3300005985 Ga0081539_10094131 Ga0081539_100941312 235
210 3300006038 Ga0075365_10236242 Ga0075365_102362422 235
211 3300006048 Ga0075363_100023095 Ga0075363_1000230951 235
212 3300006195 Ga0075366_10013043 Ga0075366_100130433 235
213 3300006353 Ga0075370_10074578 Ga0075370_100745782 235
214 3300006943 Ga0099822_1050290 Ga0099822_10502902 235
215 3300009093 Ga0105240_11184085 Ga0105240_111840851 235
216 3300009101 Ga0105247_10389207 Ga0105247_103892072 235
217 3300009148 Ga0105243_10784188 Ga0105243_107841881 235
218 3300009177 Ga0105248_10095221 Ga0105248_100952213 235
219 3300009545 Ga0105237_10271117 Ga0105237_102711172 235
220 3300009545 Ga0105237_10480421 Ga0105237_104804212 235
221 3300009553 Ga0105249_10194251 Ga0105249_101942512 235
222 3300013296 Ga0157374_10108670 Ga0157374_101086702 235
223 3300025261 Ga0209233_1002356 Ga0209233_10023567 235
224 3300025297 Ga0209758_1000133 Ga0209758_100013377 235
225 3300025297 Ga0209758_1006910 Ga0209758_10069104 235
226 3300025297 Ga0209758_1032160 Ga0209758_10321602 235
227 3300025302 Ga0207426_1002396 Ga0207426_10023964 235
228 3300025900 Ga0207710_10097636 Ga0207710_100976362 235
229 3300025903 Ga0207680_10253326 Ga0207680_102533262 235
230 3300025904 Ga0207647_10019836 Ga0207647_100198366 235
231 3300025913 Ga0207695_10241625 Ga0207695_102416252 235
232 3300025925 Ga0207650_10206520 Ga0207650_102065201 235
233 3300025972 Ga0207668_10196091 Ga0207668_101960912 235
234 3300025972 Ga0207668_10506424 Ga0207668_105064241 235
235 3300026035 Ga0207703_10710473 Ga0207703_107104732 235
236 3300026089 Ga0207648_10636806 Ga0207648_106368061 235
237 3300026116 Ga0207674_10109148 Ga0207674_101091482 235
238 3300026142 Ga0207698_10100743 Ga0207698_101007432 235
239 3300027296 Ga0209389_1000014 Ga0209389_1000014164 235
240 3300027357 Ga0209589_1000020 Ga0209589_1000020164 235
241 3300027361 Ga0209489_100060 Ga0209489_100060123 235
242 3300028379 Ga0268266_10090253 Ga0268266_100902532 235
243 3300031548 Ga0307408_100614320 Ga0307408_1006143202 235
244 3300031995 Ga0307409_100489184 Ga0307409_1004891842 235
245 3300032126 Ga0307415_100798091 Ga0307415_1007980911 235
246 3300033180 Ga0307510_10022493 Ga0307510_100224934 235
247 3300035092 Ga0373952_0025997 Ga0373952_0025997_139_921 235
248 3300044658 Ga0466972_0028367 Ga0466972_0028367_1924_2706 235
249 3300044735 Ga0466968_0004242 Ga0466968_0004242_1953_2735 235
250 3300044901 Ga0466960_0007335 Ga0466960_0007335_1734_2516 235
251 3300046454 Ga0495592_0023956 Ga0495592_0023956_1323_2105 235
252 3300046457 Ga0495590_0106077 Ga0495590_0106077_104_880 235
253 3300046460 Ga0495638_0090254 Ga0495638_0090254_423_1205 235
254 3300046462 Ga0495651_0000271 Ga0495651_0000271_10675_11457 235
255 3300046477 Ga0495664_0028905 Ga0495664_0028905_1722_2504 235
256 3300046511 Ga0495608_0026863 Ga0495608_0026863_927_1709 235
257 3300046514 Ga0495618_0112657 Ga0495618_0112657_852_1634 235
258 3300046517 Ga0495630_0175759 Ga0495630_0175759_425_1207 235
259 3300046519 Ga0495632_0102048 Ga0495632_0102048_198_980 235
260 3300046522 Ga0495643_0024447 Ga0495643_0024447_1718_2500 235
261 3300046523 Ga0495644_0049431 Ga0495644_0049431_356_1138 235
262 3300046525 Ga0495663_0047497 Ga0495663_0047497_340_1122 235
263 3300046529 Ga0495652_0004764 Ga0495652_0004764_4591_5373 235
264 3300046536 Ga0495587_0044816 Ga0495587_0044816_1613_2395 235
265 3300046542 Ga0495597_0057617 Ga0495597_0057617_879_1661 235
266 3300046543 Ga0495645_0008894 Ga0495645_0008894_966_1748 235
267 3300046559 Ga0495667_0010094 Ga0495667_0010094_2893_3675 235
268 3300046616 Ga0495668_0032597 Ga0495668_0032597_1366_2148 235
269 3300046642 Ga0495634_0047380 Ga0495634_0047380_354_1136 235
270 3300046648 Ga0495611_0033915 Ga0495611_0033915_17_799 235
271 3300046665 Ga0495661_0134673 Ga0495661_0134673_309_1091 235
272 3300046675 Ga0495657_0003332 Ga0495657_0003332_1281_2063 235
273 3300046678 Ga0495599_0019003 Ga0495599_0019003_1533_2315 235
274 3300046679 Ga0495623_0004419 Ga0495623_0004419_3984_4766 235
275 3300046680 Ga0495646_0043300 Ga0495646_0043300_1284_2066 235
276 3300046694 Ga0495649_0087122 Ga0495649_0087122_105_887 235
277 3300046809 Ga0495600_0001932 Ga0495600_0001932_8185_8967 235
278 3300047317 Ga0495604_0002485 Ga0495604_0002485_2228_3010 235
279 3300047319 Ga0495674_0013696 Ga0495674_0013696_2420_3202 235
280 3300047321 Ga0495676_0214251 Ga0495676_0214251_203_985 235
281 3300047322 Ga0495680_0001198 Ga0495680_0001198_23337_24119 235
282 3300047323 Ga0495683_0021057 Ga0495683_0021057_712_1494 235
283 3300047444 Ga0495675_0003907 Ga0495675_0003907_6778_7560 235
284 3300047469 Ga0495673_0029213 Ga0495673_0029213_71_853 235
285 3300047472 Ga0495686_0057283 Ga0495686_0057283_1460_2242 235
286 3300048088 Ga0495602_0001578 Ga0495602_0001578_12504_13286 235
287 3300048091 Ga0495626_0067645 Ga0495626_0067645_501_1283 235
288 3300048904 Ga0496101_0247703 Ga0496101_0247703_448_1230 235
289 3300048905 Ga0496102_0056022 Ga0496102_0056022_2082_2864 235
290 3300048906 Ga0496103_0018401 Ga0496103_0018401_2674_3456 235
291 3300048908 Ga0496105_0197579 Ga0496105_0197579_762_1544 235
292 3300048910 Ga0496107_0157111 Ga0496107_0157111_508_1290 235
293 3300048912 Ga0496109_0037911 Ga0496109_0037911_2688_3470 235
294 3300048915 Ga0496112_0047421 Ga0496112_0047421_2786_3568 235
295 3300048920 Ga0496117_0087241 Ga0496117_0087241_823_1605 235
296 3300048922 Ga0496119_0042028 Ga0496119_0042028_939_1721 235
297 3300048928 Ga0496125_0045725 Ga0496125_0045725_2470_3252 235
298 3300048929 Ga0496126_0122534 Ga0496126_0122534_441_1223 235
299 3300048929 Ga0496126_0247534 Ga0496126_0247534_28_810 235
300 3300049592 Ga0501076_0267228 Ga0501076_0267228_517_1299 235
301 3300050493 nmdc:mga0k408_13681_c1 nmdc:mga0k408_13681_c1_1416_2198 235
302 3300050494 nmdc:mga06z11_256435_c1 nmdc:mga06z11_256435_c1_239_1021 235
303 3300050494 nmdc:mga06z11_47123_c1 nmdc:mga06z11_47123_c1_278_1060 235
304 3300050496 nmdc:mga07m45_108878_c1 nmdc:mga07m45_108878_c1_293_1075 235
305 3300050516 nmdc:mga0sz30_53428_c1 nmdc:mga0sz30_53428_c1_577_1359 235
306 3300053079 Ga0500610_0189067 Ga0500610_0189067_94_876 235
307 3300053084 Ga0495595_0032357 Ga0495595_0032357_609_1391 235
308 3300053085 Ga0495619_0235638 Ga0495619_0235638_139_921 235
309 3300053087 Ga0500643_000069 Ga0500643_000069_82874_83656 235
310 3300053091 Ga0500647_0005637 Ga0500647_0005637_4192_4974 235
311 3300053093 Ga0500651_0127694 Ga0500651_0127694_675_1457 235
312 3300053103 Ga0500555_005858 Ga0500555_005858_1540_2322 235
313 3300053105 Ga0500557_000003 Ga0500557_000003_59197_59979 235
314 3300053111 Ga0500572_006775 Ga0500572_006775_335_1117 235
315 3300053122 Ga0500608_021825 Ga0500608_021825_1298_2080 235
316 3300053130 Ga0500642_0113963 Ga0500642_0113963_92_874 235
317 3300053139 Ga0500568_0033785 Ga0500568_0033785_456_1238 235
318 3300053148 Ga0500590_049087 Ga0500590_049087_1157_1939 235
319 3300053154 Ga0500619_013213 Ga0500619_013213_1109_1891 235
320 3300053158 Ga0500627_0090534 Ga0500627_0090534_374_1156 235
321 3300053161 Ga0500634_0047928 Ga0500634_0047928_811_1593 235
322 3300053177 Ga0500636_0001860 Ga0500636_0001860_1842_2624 235
323 3300053177 Ga0500636_0071286 Ga0500636_0071286_983_1765 235
324 3300053729 Ga0500625_014631 Ga0500625_014631_306_1088 235
325 3300053731 Ga0500609_006498 Ga0500609_006498_380_1162 235
326 3300053737 Ga0500601_000092 Ga0500601_000092_6117_6899 235
327 3300055283 Ga0500661_006682 Ga0500661_006682_624_1406 235
328 3300061734 Ga0530510_0125737 Ga0530510_0125737_824_1606 235
329 3300005937 Ga0081455_10082536 Ga0081455_100825363 236
330 3300025302 Ga0207426_1002137 Ga0207426_100213714 236
331 3300026075 Ga0207708_10168656 Ga0207708_101686562 236
332 3300026118 Ga0207675_100755197 Ga0207675_1007551971 236
333 3300048924 Ga0496121_0044119 Ga0496121_0044119_2785_3567 236
334 3300048924 Ga0496121_0060417 Ga0496121_0060417_2277_3059 236
335 3300005445 Ga0070708_100355514 Ga0070708_1003555142 237
336 3300021384 Ga0213876_10051082 Ga0213876_100510822 237
337 3300039437 Ga0436365_0627243 Ga0436365_0627243_222_1004 237
338 3300044656 Ga0466969_0082145 Ga0466969_0082145_573_1355 237
339 3300044694 Ga0466963_0021127 Ga0466963_0021127_1585_2367 237
340 3300044694 Ga0466963_0191347 Ga0466963_0191347_159_941 237
341 3300044842 Ga0466957_0108073 Ga0466957_0108073_18_800 237
342 3300045976 Ga0466967_0073807 Ga0466967_0073807_2091_2873 237
343 3300047317 Ga0495604_0173157 Ga0495604_0173157_528_1310 237
344 3300005436 Ga0070713_100006598 Ga0070713_1000065984 238
345 3300005455 Ga0070663_100047197 Ga0070663_1000471971 238
346 3300005548 Ga0070665_100300012 Ga0070665_1003000122 238
347 3300005616 Ga0068852_100597347 Ga0068852_1005973472 238
348 3300006048 Ga0075363_100017124 Ga0075363_1000171243 238
349 3300006353 Ga0075370_10044333 Ga0075370_100443332 238
350 3300025898 Ga0207692_10062720 Ga0207692_100627202 238
351 3300025906 Ga0207699_10074695 Ga0207699_100746952 238
352 3300025928 Ga0207700_10082107 Ga0207700_100821071 238
353 3300025945 Ga0207679_10208915 Ga0207679_102089152 238
354 3300028379 Ga0268266_10001082 Ga0268266_100010825 238
355 3300035083 Ga0373926_0011600 Ga0373926_0011600_2120_2902 238
356 3300035089 Ga0373944_0026448 Ga0373944_0026448_72_854 238
357 3300035113 Ga0373936_0136603 Ga0373936_0136603_204_986 238
358 3300035117 Ga0373953_0116458 Ga0373953_0116458_43_825 238
359 3300035692 Ga0373935_0068682 Ga0373935_0068682_360_1142 238
360 3300035695 Ga0373927_0061213 Ga0373927_0061213_377_1159 238
361 3300035725 Ga0373947_0091243 Ga0373947_0091243_913_1695 238
362 3300036401 Ga0373937_0465599 Ga0373937_0465599_58_840 238
363 3300046472 Ga0495580_0004422 Ga0495580_0004422_3253_4035 238
364 3300046475 Ga0495639_0020094 Ga0495639_0020094_1696_2478 238
365 3300046477 Ga0495664_0026796 Ga0495664_0026796_777_1559 238
366 3300046514 Ga0495618_0366707 Ga0495618_0366707_58_840 238
367 3300046517 Ga0495630_0049964 Ga0495630_0049964_2198_2980 238
368 3300046529 Ga0495652_0295207 Ga0495652_0295207_58_840 238
369 3300046533 Ga0495640_0031699 Ga0495640_0031699_2511_3293 238
370 3300046642 Ga0495634_0337562 Ga0495634_0337562_62_844 238
371 3300046663 Ga0495635_0066323 Ga0495635_0066323_1652_2434 238
372 3300046683 Ga0495658_0019954 Ga0495658_0019954_884_1666 238
373 3300046689 Ga0495613_0211710 Ga0495613_0211710_376_1158 238
374 3300047315 Ga0495581_0007817 Ga0495581_0007817_272_1054 238
375 3300047319 Ga0495674_0041838 Ga0495674_0041838_1840_2622 238
376 3300047321 Ga0495676_0080565 Ga0495676_0080565_1330_2112 238
377 3300047471 Ga0495684_0025140 Ga0495684_0025140_1359_2141 238
378 3300050490 nmdc:mga03n38_7548_c1 nmdc:mga03n38_7548_c1_801_1583 238
379 3300050491 nmdc:mga00v17_155175_c1 nmdc:mga00v17_155175_c1_498_1280 238
380 3300050492 nmdc:mga0yw44_225692_c1 nmdc:mga0yw44_225692_c1_368_1150 238
381 3300005548 Ga0070665_100266585 Ga0070665_1002665852 239
382 3300009174 Ga0105241_10034445 Ga0105241_100344454 239
383 3300010375 Ga0105239_10125231 Ga0105239_101252313 239
384 3300025911 Ga0207654_10003032 Ga0207654_100030322 239
385 3300037418 Ga0395900_0703045 Ga0395900_0703045_22_804 239
386 3300039437 Ga0436365_1300190 Ga0436365_1300190_1322_2104 239
387 3300046457 Ga0495590_0121834 Ga0495590_0121834_42_824 239
388 3300046537 Ga0495598_0009153 Ga0495598_0009153_396_1178 239
389 3300046648 Ga0495611_0086132 Ga0495611_0086132_36_818 239
390 3300053092 Ga0500583_0136253 Ga0500583_0136253_338_1120 239
391 3300005616 Ga0068852_100011643 Ga0068852_1000116437 241
392 3300005718 Ga0068866_10057771 Ga0068866_100577712 241
393 3300009174 Ga0105241_10028754 Ga0105241_100287543 241
394 3300009545 Ga0105237_10004025 Ga0105237_1000402515 241
395 3300009553 Ga0105249_10795402 Ga0105249_107954022 241
396 3300010375 Ga0105239_10088799 Ga0105239_100887993 241
397 3300025913 Ga0207695_10000008 Ga0207695_10000008822 241
398 3300025914 Ga0207671_10004403 Ga0207671_100044037 241
399 3300025916 Ga0207663_10006343 Ga0207663_100063434 241
400 3300025960 Ga0207651_10624516 Ga0207651_106245162 241
401 3300026142 Ga0207698_10074151 Ga0207698_100741513 241
402 3300028794 Ga0307515_10025331 Ga0307515_100253316 241
403 3300048903 Ga0496100_0033217 Ga0496100_0033217_558_1340 241
404 3300003752 Ga0055539_1002463 Ga0055539_10024633 242
405 3300025253 Ga0209677_100908 Ga0209677_1009083 242
406 3300025261 Ga0209233_1001449 Ga0209233_10014493 242
407 3300025272 Ga0209455_1005909 Ga0209455_10059094 242
408 3300025272 Ga0209455_1015444 Ga0209455_10154443 242
409 3300048921 Ga0496118_0075692 Ga0496118_0075692_709_1491 242
410 3300048924 Ga0496121_0011984 Ga0496121_0011984_2241_3023 242
411 3300048924 Ga0496121_0280319 Ga0496121_0280319_321_1103 242
412 3300048927 Ga0496124_0221658 Ga0496124_0221658_364_1146 242
413 3300048929 Ga0496126_0437355 Ga0496126_0437355_123_905 242
414 3300053177 Ga0500636_0058733 Ga0500636_0058733_1061_1843 242
415 3300006881 Ga0068865_100168730 Ga0068865_1001687302 243
416 3300014326 Ga0157380_10505548 Ga0157380_105055481 243
417 3300025908 Ga0207643_10276233 Ga0207643_102762332 243
418 3300025942 Ga0207689_10013133 Ga0207689_100131334 243
419 3300005327 Ga0070658_10160218 Ga0070658_101602182 244
420 3300005337 Ga0070682_100175997 Ga0070682_1001759972 244
421 3300005344 Ga0070661_100422026 Ga0070661_1004220262 244
422 3300005455 Ga0070663_100212421 Ga0070663_1002124212 244
423 3300006038 Ga0075365_10007730 Ga0075365_100077303 244
424 3300025920 Ga0207649_10364299 Ga0207649_103642992 244
425 3300025939 Ga0207665_10367662 Ga0207665_103676622 244
426 3300026067 Ga0207678_10423203 Ga0207678_104232031 244
427 3300046460 Ga0495638_0013009 Ga0495638_0013009_2218_3000 244
428 3300046507 Ga0495606_0032446 Ga0495606_0032446_247_1029 244
429 3300046694 Ga0495649_0040650 Ga0495649_0040650_1431_2213 244
430 3300048913 Ga0496110_0465730 Ga0496110_0465730_136_918 244
431 3300048924 Ga0496121_0108498 Ga0496121_0108498_1318_2100 244
432 3300050492 nmdc:mga0yw44_5155_c1 nmdc:mga0yw44_5155_c1_4420_5202 244
433 3300053104 Ga0500556_0003091 Ga0500556_0003091_3864_4646 244
434 3300053108 Ga0500562_016831 Ga0500562_016831_743_1525 244
435 3300053116 Ga0500592_010923 Ga0500592_010923_210_992 244
436 3300053153 Ga0500616_0062111 Ga0500616_0062111_492_1274 244
437 3300053160 Ga0500633_0064731 Ga0500633_0064731_311_1093 244
438 3300053177 Ga0500636_0084068 Ga0500636_0084068_767_1549 245
439 3300028786 Ga0307517_10004833 Ga0307517_1000483314 246
440 3300025934 Ga0207686_10338352 Ga0207686_103383521 247
441 3300035170 Ga0373943_0085618 Ga0373943_0085618_158_940 247
442 3300035695 Ga0373927_0025153 Ga0373927_0025153_572_1354 247
443 3300035725 Ga0373947_0009460 Ga0373947_0009460_1437_2219 247
444 3300037068 Ga0373925_0048830 Ga0373925_0048830_43_825 247
445 3300046455 Ga0495603_0002873 Ga0495603_0002873_3384_4166 247
446 3300046462 Ga0495651_0094524 Ga0495651_0094524_989_1771 247
447 3300046475 Ga0495639_0035199 Ga0495639_0035199_646_1428 247
448 3300046499 Ga0495594_0073656 Ga0495594_0073656_605_1387 247
449 3300046681 Ga0495647_0147740 Ga0495647_0147740_122_904 247
450 3300046690 Ga0495624_0044349 Ga0495624_0044349_359_1141 247
451 3300053085 Ga0495619_0039802 Ga0495619_0039802_945_1727 247
452 3300048929 Ga0496126_0027556 Ga0496126_0027556_4657_5409 248
453 3300053077 Ga0495601_0231003 Ga0495601_0231003_24_794 248
454 3300053098 Ga0500650_0155760 Ga0500650_0155760_292_1044 248
455 3300003203 JGI25406J46586_10003417 JGI25406J46586_100034172 249
456 3300003215 JGI25153J46596_10000952 JGI25153J46596_100009523 249
457 3300005616 Ga0068852_100251961 Ga0068852_1002519612 249
458 3300005985 Ga0081539_10010493 Ga0081539_100104932 249
459 3300025297 Ga0209758_1027721 Ga0209758_10277212 249
460 3300033180 Ga0307510_10005755 Ga0307510_1000575511 249
461 3300035092 Ga0373952_0080572 Ga0373952_0080572_57_812 249
462 3300046452 Ga0495617_080445 Ga0495617_080445_12_767 249
463 3300046475 Ga0495639_0178164 Ga0495639_0178164_26_781 249
464 3300046499 Ga0495594_0257420 Ga0495594_0257420_11_766 249
465 3300048912 Ga0496109_0853811 Ga0496109_0853811_82_837 249
466 3300006178 Ga0075367_10060179 Ga0075367_100601793 250
467 3300009093 Ga0105240_10010472 Ga0105240_100104723 250
468 3300048905 Ga0496102_0080549 Ga0496102_0080549_736_1518 250
469 3300048909 Ga0496106_0006841 Ga0496106_0006841_5869_6651 250
470 3300048910 Ga0496107_0005103 Ga0496107_0005103_4659_5441 250
471 3300048911 Ga0496108_0000259 Ga0496108_0000259_13834_14616 250
472 3300048912 Ga0496109_0000250 Ga0496109_0000250_30178_30960 250
473 3300048914 Ga0496111_0176071 Ga0496111_0176071_529_1311 250
474 3300048915 Ga0496112_0052717 Ga0496112_0052717_2234_3016 250
475 3300048916 Ga0496113_0059155 Ga0496113_0059155_1798_2580 250
476 3300048929 Ga0496126_0032207 Ga0496126_0032207_1209_1991 250
477 3300044656 Ga0466969_0045804 Ga0466969_0045804_432_1214 251
478 3300044684 Ga0466966_0012258 Ga0466966_0012258_2969_3751 251
479 3300044693 Ga0466961_0000132 Ga0466961_0000132_35168_35950 251
480 3300045049 Ga0466959_0000295 Ga0466959_0000295_23878_24660 251
481 3300045836 Ga0466958_0155219 Ga0466958_0155219_256_1038 251
482 iso_pu_bacteria 2643221654 2644302816 251
483 3300003215 JGI25153J46596_10005466 JGI25153J46596_100054662 252
484 3300003354 JGI25160J50197_1003726 JGI25160J50197_10037262 252
485 3300003354 JGI25160J50197_1006214 JGI25160J50197_10062143 252
486 3300005347 Ga0070668_100055398 Ga0070668_1000553983 252
487 3300005439 Ga0070711_100015454 Ga0070711_1000154541 252
488 3300005578 Ga0068854_100062848 Ga0068854_1000628483 252
489 3300005614 Ga0068856_100009329 Ga0068856_1000093293 252
490 3300005842 Ga0068858_100444685 Ga0068858_1004446852 252
491 3300005844 Ga0068862_100350977 Ga0068862_1003509771 252
492 3300006038 Ga0075365_10157441 Ga0075365_101574412 252
493 3300006178 Ga0075367_10405211 Ga0075367_104052111 252
494 3300006186 Ga0075369_10014241 Ga0075369_100142413 252
495 3300009553 Ga0105249_10291673 Ga0105249_102916732 252
496 3300025295 Ga0209564_1009146 Ga0209564_10091463 252
497 3300025297 Ga0209758_1001858 Ga0209758_100185817 252
498 3300025302 Ga0207426_1001289 Ga0207426_10012898 252
499 3300025981 Ga0207640_10135585 Ga0207640_101355852 252
500 3300026078 Ga0207702_10000779 Ga0207702_1000077922 252
501 3300028380 Ga0268265_10565813 Ga0268265_105658132 252
502 3300037471 Ga0395905_0005304 Ga0395905_0005304_8599_9381 252
503 3300038443 Ga0395901_0076417 Ga0395901_0076417_119_901 252
504 3300044683 Ga0466965_0103075 Ga0466965_0103075_13_795 252
505 3300046507 Ga0495606_0038960 Ga0495606_0038960_2141_2923 252
506 3300046557 Ga0495622_0008052 Ga0495622_0008052_115_897 252
507 3300046674 Ga0495588_0001382 Ga0495588_0001382_7895_8677 252
508 3300047321 Ga0495676_0206670 Ga0495676_0206670_101_883 252
509 3300047469 Ga0495673_0153407 Ga0495673_0153407_39_821 252
510 3300048903 Ga0496100_0066259 Ga0496100_0066259_1032_1814 252
511 3300048905 Ga0496102_0124233 Ga0496102_0124233_129_911 252
512 3300048907 Ga0496104_0078243 Ga0496104_0078243_517_1299 252
513 3300048908 Ga0496105_0138852 Ga0496105_0138852_408_1190 252
514 3300048912 Ga0496109_0153338 Ga0496109_0153338_936_1718 252
515 3300048916 Ga0496113_0081737 Ga0496113_0081737_1349_2131 252
516 3300048917 Ga0496114_0143156 Ga0496114_0143156_457_1239 252
517 3300048919 Ga0496116_0027016 Ga0496116_0027016_1879_2661 252
518 3300048924 Ga0496121_0025495 Ga0496121_0025495_4046_4828 252
519 3300050496 nmdc:mga07m45_317645_c1 nmdc:mga07m45_317645_c1_91_873 252
520 3300053104 Ga0500556_0122895 Ga0500556_0122895_127_909 252
521 3300053119 Ga0500595_004127 Ga0500595_004127_2629_3411 252
522 3300053139 Ga0500568_0040925 Ga0500568_0040925_189_971 252
523 3300027907 Ga0207428_10028694 Ga0207428_100286942 253
524 3300050511 nmdc:mga08y16_10722_c1 nmdc:mga08y16_10722_c1_5476_6261 253
525 3300031456 Ga0307513_10240593 Ga0307513_102405932 254
526 3300031730 Ga0307516_10422952 Ga0307516_104229522 254
527 iso_pu_bacteria 2507262055 2507507642 254
528 iso_pu_bacteria 2508501009 2508541759 254
529 iso_pu_bacteria 2508501042 2508692697 254
530 iso_pu_bacteria 2508501128 2509149276 254
531 iso_pu_bacteria 2513237092 2513621846 254
532 iso_pu_bacteria 2513237094 2513636715 254
533 iso_pu_bacteria 2513237096 2513654112 254
534 iso_pu_bacteria 2513237098 2513674807 254
535 iso_pu_bacteria 2513237101 2513697061 254
536 iso_pu_bacteria 2513237102 2513701492 254
537 iso_pu_bacteria 2513237104 2513721273 254
538 iso_pu_bacteria 2513237137 2513856864 254
539 iso_pu_bacteria 2513237141 2513891229 254
540 iso_pu_bacteria 2513237145 2513918452 254
541 iso_pu_bacteria 2515154112 2515626095 254
542 iso_pu_bacteria 2517093001 2517104176 254
543 iso_pu_bacteria 2517572143 2517891314 254
544 iso_pu_bacteria 2524023210 2524471221 254
545 iso_pu_bacteria 2524023228 2524533480 254
546 iso_pu_bacteria 2528768022 2528848961 254
547 iso_pu_bacteria 2582581306 2585268523 254
548 iso_pu_bacteria 2602042107 2603857652 254
549 iso_pu_bacteria 2617270741 2617372748 254
550 iso_pu_bacteria 2643221723 2644673527 254
551 iso_pu_bacteria 2667528175 2671123844 254
552 iso_pu_bacteria 2721755755 2723843659 254
553 iso_pu_bacteria 2728368998 2728750025 254
554 iso_pu_bacteria 2791355196 2793060894 254
555 iso_pu_bacteria 2791355197 2793066681 254
556 iso_pu_bacteria 2791355199 2793083812 254
557 iso_pu_bacteria 2791355265 2793354427 254
558 iso_pu_bacteria 2802429603 2805921312 254
559 iso_pu_bacteria 2802429606 2805935171 254
560 iso_pu_bacteria 2816332527 2818236572 254
561 iso_pu_bacteria 2824600985 2824605245 254
562 iso_pu_bacteria 2824609381 2824615564 254
563 iso_pu_bacteria 2824617872 2824620445 254
564 iso_pu_bacteria 2824626560 2824628507 254
565 iso_pu_bacteria 2824635225 2824637207 254
566 iso_pu_bacteria 2824644064 2824645870 254
567 iso_pu_bacteria 2824653114 2824656454 254
568 iso_pu_bacteria 2824661429 2824666146 254
569 iso_pu_bacteria 2824679649 2824681716 254
570 iso_pu_bacteria 2824696289 2824699602 254
571 iso_pu_bacteria 2824704595 2824711160 254
572 iso_pu_bacteria 2824714736 2824723623 254
573 iso_pu_bacteria 2824723954 2824725600 254
574 iso_pu_bacteria 2824732956 2824737207 254
575 iso_pu_bacteria 2824746037 2824748845 254
576 iso_pu_bacteria 2824753945 2824756000 254
577 iso_pu_bacteria 2824763712 2824767538 254
578 iso_pu_bacteria 2824773399 2824775107 254
579 iso_pu_bacteria 2841966195 2841972024 254
580 iso_pu_bacteria 2842038055 2842040669 254
581 iso_pu_bacteria 2842045827 2842046385 254
582 iso_pu_bacteria 2842205361 2842209903 254
583 iso_pu_bacteria 2842278818 2842283357 254
584 iso_pu_bacteria 2842317721 2842320312 254
585 iso_pu_bacteria 2842402390 2842405942 254
586 iso_pu_bacteria 2842409023 2842412526 254
587 iso_pu_bacteria 2842415677 2842419170 254
588 iso_pu_bacteria 2844315083 2844320047 254
589 iso_pu_bacteria 2847930680 2847937341 254
590 iso_pu_bacteria 2847939898 2847947765 254
591 iso_pu_bacteria 2849076700 2849078374 254
592 iso_pu_bacteria 2857509624 2857512751 254
593 iso_pu_bacteria 2857524615 2857527019 254
594 iso_pu_bacteria 2874590934 2874598757 254
595 iso_pu_bacteria 2874604998 2874607128 254
596 iso_pu_bacteria 2874612657 2874614552 254
597 iso_pu_bacteria 2874620515 2874628099 254
598 iso_pu_bacteria 2874628541 2874634986 254
599 iso_pu_bacteria 2874645413 2874652213 254
600 iso_pu_bacteria 2876761206 2876771057 254
601 iso_pu_bacteria 2876771140 2876778796 254
602 iso_pu_bacteria 2876808645 2876817682 254
603 iso_pu_bacteria 2876818435 2876824309 254
604 iso_pu_bacteria 2879074833 2879082589 254
605 iso_pu_bacteria 2879083081 2879086642 254
606 iso_pu_bacteria 2879099564 2879107155 254
607 iso_pu_bacteria 2879110137 2879111889 254
608 iso_pu_bacteria 2879127579 2879131506 254
609 iso_pu_bacteria 2879142872 2879147952 254
610 iso_pu_bacteria 2881364244 2881371438 254
611 iso_pu_bacteria 2881665667 2881666598 254
612 iso_pu_bacteria 2885366525 2885369985 254
613 iso_pu_bacteria 2885374607 2885377047 254
614 iso_pu_bacteria 2885383462 2885387472 254
615 iso_pu_bacteria 2885409591 2885417875 254
616 iso_pu_bacteria 2888388044 2888392758 254
617 iso_pu_bacteria 2888419890 2888425603 254
618 iso_pu_bacteria 2889033259 2889037987 254
619 iso_pu_bacteria 2893066018 2893068199 254
620 iso_pu_bacteria 2903727486 2903730279 254
621 iso_pu_bacteria 2903768456 2903772193 254
622 iso_pu_bacteria 2904666416 2904674283 254
623 iso_pu_bacteria 2904690495 2904694515 254
624 iso_pu_bacteria 2904699407 2904701254 254
625 iso_pu_bacteria 2904711408 2904711955 254
626 iso_pu_bacteria 2906602504 2906609872 254
627 iso_pu_bacteria 2906610324 2906616500 254
628 iso_pu_bacteria 2906626472 2906629233 254
629 iso_pu_bacteria 2906635258 2906635271 254
630 iso_pu_bacteria 2906643746 2906643966 254
631 iso_pu_bacteria 2906660503 2906662997 254
632 iso_pu_bacteria 2908756301 2908759172 254
633 iso_pu_bacteria 2908775508 2908781192 254
634 iso_pu_bacteria 2919073203 2919078131 254
635 iso_pu_bacteria 2922361189 2922365992 254
636 iso_pu_bacteria 2922368715 2922372385 254
637 iso_pu_bacteria 2922386360 2922386845 254
638 iso_pu_bacteria 2922393267 2922397057 254
639 iso_pu_bacteria 2922425934 2922431485 254
640 iso_pu_bacteria 2929615660 2929621043 254
641 iso_pu_bacteria 2929624759 2929626126 254
642 iso_pu_bacteria 2932784394 2932784994 254
643 iso_pu_bacteria 2932794094 2932795133 254
644 iso_pu_bacteria 2932801729 2932805661 254
645 iso_pu_bacteria 2932809354 2932810028 254
646 iso_pu_bacteria 2932818245 2932827025 254
647 iso_pu_bacteria 2932828146 2932828831 254
648 iso_pu_bacteria 2933577622 2933583087 254
649 iso_pu_bacteria 2935608549 2935609848 254
650 iso_pu_bacteria 2935616580 2935619749 254
651 iso_pu_bacteria 2935630451 2935636213 254
652 iso_pu_bacteria 2935638405 2935638730 254
653 iso_pu_bacteria 2935648319 2935652121 254
654 iso_pu_bacteria 2935656913 2935659906 254
655 iso_pu_bacteria 2935665750 2935666419 254
656 iso_pu_bacteria 2935675223 2935676533 254
657 iso_pu_bacteria 2935684952 2935690794 254
658 iso_pu_bacteria 2935694250 2935694615 254
659 iso_pu_bacteria 2935703347 2935703736 254
660 iso_pu_bacteria 2935713505 2935718175 254
661 iso_pu_bacteria 2935722832 2935727844 254
662 iso_pu_bacteria 2935732158 2935736548 254
663 iso_pu_bacteria 2935741537 2935745927 254
664 iso_pu_bacteria 2935750917 2935756308 254
665 iso_pu_bacteria 2935760218 2935760588 254
666 iso_pu_bacteria 2935769743 2935776978 254
667 iso_pu_bacteria 2935777560 2935783533 254
668 iso_pu_bacteria 2935785616 2935792821 254
669 iso_pu_bacteria 2935793552 2935800831 254
670 iso_pu_bacteria 2935801545 2935801873 254
671 iso_pu_bacteria 2935810662 2935814717 254
672 iso_pu_bacteria 2935819856 2935823009 254
673 iso_pu_bacteria 2935827899 2935828224 254
674 iso_pu_bacteria 2935837841 2935842428 254
675 iso_pu_bacteria 2935847175 2935848591 254
676 iso_pu_bacteria 2935855204 2935857936 254
677 iso_pu_bacteria 2935864058 2935868722 254
678 iso_pu_bacteria 2935873716 2935874137 254
679 iso_pu_bacteria 2935883170 2935883969 254
680 iso_pu_bacteria 2935908558 2935909602 254
681 iso_pu_bacteria 2935916978 2935917327 254
682 iso_pu_bacteria 2935926038 2935927083 254
683 iso_pu_bacteria 2935934488 2935937073 254
684 iso_pu_bacteria 2935942939 2935944624 254
685 iso_pu_bacteria 2935951376 2935953061 254
686 iso_pu_bacteria 2935959822 2935962736 254
687 iso_pu_bacteria 2935967501 2935969901 254
688 iso_pu_bacteria 2935975950 2935976497 254
689 iso_pu_bacteria 2935984226 2935987050 254
690 iso_pu_bacteria 2935992306 2935992938 254
691 iso_pu_bacteria 2936002035 2936002851 254
692 iso_pu_bacteria 2936011229 2936014322 254
693 iso_pu_bacteria 2936019824 2936023838 254
694 iso_pu_bacteria 2936028420 2936031481 254
695 iso_pu_bacteria 2936037263 2936040640 254
696 iso_pu_bacteria 2936046547 2936049428 254
697 iso_pu_bacteria 2936055302 2936062178 254
698 iso_pu_bacteria 2940556831 2940561717 254
699 iso_pu_bacteria 2941507105 2941512844 254
700 iso_pu_bacteria 2941515067 2941520589 254
701 iso_pu_bacteria 2941523033 2941528603 254
702 iso_pu_bacteria 2941531003 2941531230 254
703 iso_pu_bacteria 2941538514 2941542477 254
704 iso_pu_bacteria 3005474847 3005481275 254
705 iso_pu_bacteria 3005483717 3005484775 254
706 iso_pu_bacteria 3005506211 3005508413 254
707 iso_pu_bacteria 3005587118 3005588083 254
708 iso_pu_bacteria 3005594810 3005600334 254
709 iso_pu_bacteria 3005710791 3005715826 254
710 iso_pu_bacteria 3005718088 3005723183 254
711 iso_pu_bacteria 8006926726 8006928373 254
712 iso_pu_bacteria 8006933436 8006939435 254
713 iso_pu_bacteria 8006964411 8006968777 254
714 iso_pu_bacteria 8006973647 8006979090 254
715 iso_pu_bacteria 8006984368 8006984462 254
716 iso_pu_bacteria 8006994254 8007000928 254
717 iso_pu_bacteria 8016511872 8016520638 254
718 iso_pu_bacteria 8016522445 8016528665 254
719 iso_pu_bacteria 8016530956 8016533839 254
720 iso_pu_bacteria 8016539877 8016547062 254
721 iso_pu_bacteria 8016548790 8016555058 254
722 iso_pu_bacteria 8016557553 8016563421 254
723 iso_pu_bacteria 8016566248 8016572171 254
724 iso_pu_bacteria 8016575299 8016576370 254
725 iso_pu_bacteria 8016583857 8016594369 254
726 iso_pu_bacteria 8016613128 8016615632 254
727 iso_pu_bacteria 8016630954 8016639151 254
728 iso_pu_bacteria 8017057580 8017064941 254
729 iso_pu_bacteria 8019530166 8019533612 254
730 iso_pu_bacteria 8019538911 8019546051 254
731 iso_pu_bacteria 8019547302 8019552669 254
732 iso_pu_bacteria 8019565922 8019575408 254
733 iso_pu_bacteria 8019576017 8019584319 254
734 iso_pu_bacteria 8019586578 8019592088 254
735 iso_pu_bacteria 8019597564 8019599194 254
736 iso_pu_bacteria 8019608314 8019609162 254
737 iso_pu_bacteria 8019619141 8019619830 254
738 iso_pu_bacteria 8019629233 8019633285 254
739 iso_pu_bacteria 8019638758 8019646619 254
740 iso_pu_bacteria 8019648815 8019649384 254
741 iso_pu_bacteria 8019659431 8019661155 254
742 iso_pu_bacteria 8019668869 8019670709 254
743 iso_pu_bacteria 8019678201 8019685524 254
744 iso_pu_bacteria 8019687851 8019691089 254
745 iso_pu_bacteria 8055742211 8055745094 254
746 iso_pu_bacteria 8056382006 8056382170 254
747 iso_pu_bacteria 8056673599 8056677448 254
748 iso_pu_bacteria 8056681323 8056684767 254
749 iso_pu_bacteria 8056689827 8056690770 254
750 iso_pu_bacteria 8056967851 8056975046 254
751 3300005331 Ga0070670_100184441 Ga0070670_1001844412 255
752 3300005333 Ga0070677_10090431 Ga0070677_100904311 255
753 3300005334 Ga0068869_100032152 Ga0068869_1000321522 255
754 3300005334 Ga0068869_100186479 Ga0068869_1001864792 255
755 3300005335 Ga0070666_10386542 Ga0070666_103865421 255
756 3300005338 Ga0068868_100075518 Ga0068868_1000755183 255
757 3300005355 Ga0070671_100019925 Ga0070671_1000199252 255
758 3300005355 Ga0070671_100201753 Ga0070671_1002017532 255
759 3300005364 Ga0070673_100070300 Ga0070673_1000703002 255
760 3300005367 Ga0070667_100001599 Ga0070667_1000015992 255
761 3300005367 Ga0070667_100522897 Ga0070667_1005228972 255
762 3300005445 Ga0070708_100287046 Ga0070708_1002870461 255
763 3300005459 Ga0068867_100041887 Ga0068867_1000418872 255
764 3300005467 Ga0070706_100027803 Ga0070706_1000278033 255
765 3300005468 Ga0070707_100052509 Ga0070707_1000525092 255
766 3300005471 Ga0070698_100154623 Ga0070698_1001546231 255
767 3300005543 Ga0070672_100250820 Ga0070672_1002508202 255
768 3300005548 Ga0070665_100090850 Ga0070665_1000908502 255
769 3300005548 Ga0070665_100193242 Ga0070665_1001932423 255
770 3300005563 Ga0068855_100550684 Ga0068855_1005506842 255
771 3300005577 Ga0068857_100071994 Ga0068857_1000719942 255
772 3300005577 Ga0068857_100141781 Ga0068857_1001417812 255
773 3300005617 Ga0068859_100202522 Ga0068859_1002025221 255
774 3300005618 Ga0068864_100117766 Ga0068864_1001177663 255
775 3300005841 Ga0068863_100086436 Ga0068863_1000864362 255
776 3300005843 Ga0068860_100690660 Ga0068860_1006906602 255
777 3300006038 Ga0075365_10357414 Ga0075365_103574142 255
778 3300006048 Ga0075363_100183728 Ga0075363_1001837282 255
779 3300006051 Ga0075364_10085133 Ga0075364_100851332 255
780 3300006177 Ga0075362_10008537 Ga0075362_100085373 255
781 3300006177 Ga0075362_10105690 Ga0075362_101056901 255
782 3300006178 Ga0075367_10017795 Ga0075367_100177952 255
783 3300006178 Ga0075367_10025516 Ga0075367_100255162 255
784 3300006178 Ga0075367_10065458 Ga0075367_100654581 255
785 3300006186 Ga0075369_10013004 Ga0075369_100130042 255
786 3300006195 Ga0075366_10022723 Ga0075366_100227232 255
787 3300006195 Ga0075366_10028915 Ga0075366_100289152 255
788 3300006195 Ga0075366_10097027 Ga0075366_100970272 255
789 3300006353 Ga0075370_10000773 Ga0075370_100007732 255
790 3300006353 Ga0075370_10026104 Ga0075370_100261043 255
791 3300006353 Ga0075370_10040686 Ga0075370_100406862 255
792 3300006353 Ga0075370_10111113 Ga0075370_101111132 255
793 3300006353 Ga0075370_10168621 Ga0075370_101686211 255
794 3300006358 Ga0068871_100138832 Ga0068871_1001388322 255
795 3300006931 Ga0097620_100202531 Ga0097620_1002025313 255
796 3300009093 Ga0105240_10110255 Ga0105240_101102553 255
797 3300009098 Ga0105245_10074935 Ga0105245_100749352 255
798 3300009098 Ga0105245_10362233 Ga0105245_103622332 255
799 3300009148 Ga0105243_10254861 Ga0105243_102548612 255
800 3300009148 Ga0105243_10674557 Ga0105243_106745572 255
801 3300009176 Ga0105242_10539701 Ga0105242_105397012 255
802 3300009545 Ga0105237_10121559 Ga0105237_101215592 255
803 3300013296 Ga0157374_10457713 Ga0157374_104577132 255
804 3300013297 Ga0157378_10110756 Ga0157378_101107562 255
805 3300013297 Ga0157378_10215565 Ga0157378_102155652 255
806 3300013306 Ga0163162_10048614 Ga0163162_100486144 255
807 3300013306 Ga0163162_10738497 Ga0163162_107384972 255
808 3300013308 Ga0157375_10162251 Ga0157375_101622512 255
809 3300013308 Ga0157375_10207808 Ga0157375_102078082 255
810 3300013308 Ga0157375_10552587 Ga0157375_105525872 255
811 3300014325 Ga0163163_10365399 Ga0163163_103653992 255
812 3300014968 Ga0157379_10517438 Ga0157379_105174382 255
813 3300014968 Ga0157379_10560603 Ga0157379_105606032 255
814 3300025893 Ga0207682_10032066 Ga0207682_100320662 255
815 3300025910 Ga0207684_10024140 Ga0207684_100241403 255
816 3300025913 Ga0207695_10143916 Ga0207695_101439162 255
817 3300025914 Ga0207671_10065749 Ga0207671_100657492 255
818 3300025922 Ga0207646_10346623 Ga0207646_103466232 255
819 3300025925 Ga0207650_10220521 Ga0207650_102205212 255
820 3300025927 Ga0207687_10022826 Ga0207687_100228262 255
821 3300025931 Ga0207644_10038532 Ga0207644_100385322 255
822 3300025931 Ga0207644_10239483 Ga0207644_102394832 255
823 3300025932 Ga0207690_10125196 Ga0207690_101251962 255
824 3300025933 Ga0207706_10190586 Ga0207706_101905861 255
825 3300025935 Ga0207709_10064438 Ga0207709_100644382 255
826 3300025938 Ga0207704_10057211 Ga0207704_100572112 255
827 3300025938 Ga0207704_10268800 Ga0207704_102688002 255
828 3300025940 Ga0207691_10032277 Ga0207691_100322774 255
829 3300025942 Ga0207689_10043683 Ga0207689_100436832 255
830 3300025945 Ga0207679_10864755 Ga0207679_108647551 255
831 3300025960 Ga0207651_10042541 Ga0207651_100425412 255
832 3300025986 Ga0207658_10000701 Ga0207658_1000070111 255
833 3300025986 Ga0207658_10086325 Ga0207658_100863252 255
834 3300026023 Ga0207677_10039546 Ga0207677_100395462 255
835 3300026089 Ga0207648_10017982 Ga0207648_100179825 255
836 3300026116 Ga0207674_10028009 Ga0207674_100280092 255
837 3300026116 Ga0207674_10067952 Ga0207674_100679522 255
838 3300026142 Ga0207698_11046332 Ga0207698_110463321 255
839 3300028379 Ga0268266_10110280 Ga0268266_101102803 255
840 3300028381 Ga0268264_10500515 Ga0268264_105005152 255
841 3300028786 Ga0307517_10035440 Ga0307517_100354402 255
842 3300028786 Ga0307517_10201312 Ga0307517_102013122 255
843 3300028794 Ga0307515_10093890 Ga0307515_100938903 255
844 3300028794 Ga0307515_10138928 Ga0307515_101389282 255
845 3300031456 Ga0307513_10029357 Ga0307513_100293572 255
846 3300031456 Ga0307513_10078873 Ga0307513_100788733 255
847 3300031507 Ga0307509_10005920 Ga0307509_100059207 255
848 3300031507 Ga0307509_10020362 Ga0307509_100203622 255
849 3300031507 Ga0307509_10022911 Ga0307509_100229112 255
850 3300031507 Ga0307509_10194200 Ga0307509_101942002 255
851 3300031616 Ga0307508_10026371 Ga0307508_100263711 255
852 3300031616 Ga0307508_10249221 Ga0307508_102492212 255
853 3300031616 Ga0307508_10284421 Ga0307508_102844212 255
854 3300031649 Ga0307514_10282275 Ga0307514_102822752 255
855 3300033180 Ga0307510_10016732 Ga0307510_100167327 255
856 3300033180 Ga0307510_10123392 Ga0307510_101233922 255
857 3300033180 Ga0307510_10137260 Ga0307510_101372602 255
858 3300035112 Ga0373932_0019392 Ga0373932_0019392_561_1334 255
859 3300035112 Ga0373932_0052670 Ga0373932_0052670_226_1011 255
860 3300041456 Ga0451795_1119810 Ga0451795_1119810_446_1216 255
861 3300041491 Ga0451833_1242256 Ga0451833_1242256_76_861 255
862 3300041997 Ga0439431_0024303 Ga0439431_0024303_197_976 255
863 3300046454 Ga0495592_0000427 Ga0495592_0000427_29744_30517 255
864 3300046457 Ga0495590_0052477 Ga0495590_0052477_549_1325 255
865 3300046460 Ga0495638_0067522 Ga0495638_0067522_369_1142 255
866 3300046473 Ga0495582_0116035 Ga0495582_0116035_124_897 255
867 3300046515 Ga0495620_0104330 Ga0495620_0104330_247_1026 255
868 3300046519 Ga0495632_0004752 Ga0495632_0004752_5032_5814 255
869 3300046542 Ga0495597_0012214 Ga0495597_0012214_1750_2526 255
870 3300046557 Ga0495622_0037306 Ga0495622_0037306_886_1659 255
871 3300046616 Ga0495668_0036598 Ga0495668_0036598_836_1615 255
872 3300046660 Ga0495625_0031796 Ga0495625_0031796_1179_1955 255
873 3300046683 Ga0495658_0167147 Ga0495658_0167147_434_1207 255
874 3300046694 Ga0495649_0002961 Ga0495649_0002961_1286_2068 255
875 3300047321 Ga0495676_0175077 Ga0495676_0175077_250_1023 255
876 3300047443 Ga0495687_001232 Ga0495687_001232_1535_2311 255
877 3300047443 Ga0495687_014924 Ga0495687_014924_1656_2438 255
878 3300047443 Ga0495687_024789 Ga0495687_024789_458_1240 255
879 3300050491 nmdc:mga00v17_248935_c1 nmdc:mga00v17_248935_c1_26_802 255
880 3300050493 nmdc:mga0k408_115683_c1 nmdc:mga0k408_115683_c1_362_1138 255
881 3300050493 nmdc:mga0k408_11676_c1 nmdc:mga0k408_11676_c1_3385_4161 255
882 3300050493 nmdc:mga0k408_78691_c1 nmdc:mga0k408_78691_c1_878_1654 255
883 3300050494 nmdc:mga06z11_10966_c1 nmdc:mga06z11_10966_c1_2037_2813 255
884 3300050494 nmdc:mga06z11_94523_c1 nmdc:mga06z11_94523_c1_771_1547 255
885 3300050496 nmdc:mga07m45_1793_c1 nmdc:mga07m45_1793_c1_3415_4191 255
886 3300050496 nmdc:mga07m45_28416_c1 nmdc:mga07m45_28416_c1_1300_2076 255
887 3300050496 nmdc:mga07m45_40838_c1 nmdc:mga07m45_40838_c1_315_1091 255
888 3300050496 nmdc:mga07m45_4531_c1 nmdc:mga07m45_4531_c1_2282_3058 255
889 3300050496 nmdc:mga07m45_75007_c1 nmdc:mga07m45_75007_c1_38_814 255
890 3300050496 nmdc:mga07m45_96708_c1 nmdc:mga07m45_96708_c1_678_1451 255
891 3300050516 nmdc:mga0sz30_105528_c1 nmdc:mga0sz30_105528_c1_256_1032 255
892 3300053088 Ga0500644_0011509 Ga0500644_0011509_1131_1904 255
893 3300053093 Ga0500651_0136342 Ga0500651_0136342_308_1081 255
894 3300053134 Ga0500658_0030098 Ga0500658_0030098_399_1181 255
895 3300053136 Ga0500559_0000200 Ga0500559_0000200_40260_41033 255
896 3300053156 Ga0500622_0011755 Ga0500622_0011755_2465_3238 255
897 3300053177 Ga0500636_0101840 Ga0500636_0101840_490_1263 255
898 3300053093 Ga0500651_0043032 Ga0500651_0043032_863_1642 257
899 3300053118 Ga0500594_0015719 Ga0500594_0015719_981_1760 257
900 3300053119 Ga0500595_001442 Ga0500595_001442_6808_7587 257
901 3300002987 JGI25159J45721_1000071 JGI25159J45721_100007140 258
902 3300002987 JGI25159J45721_1000191 JGI25159J45721_100019112 258
903 3300003215 JGI25153J46596_10059954 JGI25153J46596_100599541 258
904 3300003354 JGI25160J50197_1000162 JGI25160J50197_100016223 258
905 3300003374 JGI25161J50226_1000988 JGI25161J50226_10009888 258
906 3300003659 JGI25404J52841_10007977 JGI25404J52841_100079772 258
907 3300003659 JGI25404J52841_10026367 JGI25404J52841_100263672 258
908 3300003775 Ga0055524_1022659 Ga0055524_10226591 258
909 3300003781 Ga0055536_1000667 Ga0055536_10006675 258
910 3300003792 Ga0055540_1021009 Ga0055540_10210092 258
911 3300003794 Ga0055531_10011656 Ga0055531_100116562 258
912 3300004625 Ga0055543_1019666 Ga0055543_10196662 258
913 3300005262 Ga0065165_1000535 Ga0065165_100053523 258
914 3300005262 Ga0065165_1004595 Ga0065165_10045953 258
915 3300005329 Ga0070683_100083116 Ga0070683_1000831163 258
916 3300005330 Ga0070690_100231860 Ga0070690_1002318602 258
917 3300005336 Ga0070680_100276688 Ga0070680_1002766882 258
918 3300005339 Ga0070660_100047303 Ga0070660_1000473032 258
919 3300005339 Ga0070660_100130249 Ga0070660_1001302492 258
920 3300005339 Ga0070660_100379673 Ga0070660_1003796732 258
921 3300005341 Ga0070691_10077070 Ga0070691_100770702 258
922 3300005345 Ga0070692_10222391 Ga0070692_102223911 258
923 3300005347 Ga0070668_100037793 Ga0070668_1000377932 258
924 3300005356 Ga0070674_100158026 Ga0070674_1001580261 258
925 3300005364 Ga0070673_100153388 Ga0070673_1001533882 258
926 3300005434 Ga0070709_10000900 Ga0070709_100009002 258
927 3300005434 Ga0070709_10012197 Ga0070709_100121974 258
928 3300005434 Ga0070709_10016286 Ga0070709_100162863 258
929 3300005435 Ga0070714_100037902 Ga0070714_1000379022 258
930 3300005435 Ga0070714_100039125 Ga0070714_1000391252 258
931 3300005435 Ga0070714_100043651 Ga0070714_1000436513 258
932 3300005435 Ga0070714_100169252 Ga0070714_1001692522 258
933 3300005435 Ga0070714_100223183 Ga0070714_1002231832 258
934 3300005435 Ga0070714_100468964 Ga0070714_1004689641 258
935 3300005436 Ga0070713_100003714 Ga0070713_1000037145 258
936 3300005436 Ga0070713_100024687 Ga0070713_1000246874 258
937 3300005436 Ga0070713_100153428 Ga0070713_1001534282 258
938 3300005436 Ga0070713_100340318 Ga0070713_1003403182 258
939 3300005437 Ga0070710_10000221 Ga0070710_1000022126 258
940 3300005437 Ga0070710_10002129 Ga0070710_100021292 258
941 3300005437 Ga0070710_10093835 Ga0070710_100938352 258
942 3300005439 Ga0070711_100002818 Ga0070711_1000028185 258
943 3300005439 Ga0070711_100011819 Ga0070711_1000118192 258
944 3300005439 Ga0070711_100015227 Ga0070711_1000152274 258
945 3300005455 Ga0070663_100026611 Ga0070663_1000266114 258
946 3300005455 Ga0070663_100264491 Ga0070663_1002644912 258
947 3300005456 Ga0070678_100156643 Ga0070678_1001566432 258
948 3300005456 Ga0070678_100249071 Ga0070678_1002490712 258
949 3300005457 Ga0070662_100472113 Ga0070662_1004721132 258
950 3300005468 Ga0070707_100799645 Ga0070707_1007996451 258
951 3300005535 Ga0070684_100065035 Ga0070684_1000650353 258
952 3300005539 Ga0068853_100055518 Ga0068853_1000555184 258
953 3300005548 Ga0070665_100043157 Ga0070665_1000431573 258
954 3300005563 Ga0068855_100121344 Ga0068855_1001213443 258
955 3300005563 Ga0068855_100171911 Ga0068855_1001719112 258
956 3300005563 Ga0068855_100286719 Ga0068855_1002867192 258
957 3300005577 Ga0068857_100013693 Ga0068857_1000136934 258
958 3300005578 Ga0068854_100382872 Ga0068854_1003828722 258
959 3300005614 Ga0068856_100036241 Ga0068856_1000362415 258
960 3300005614 Ga0068856_100724103 Ga0068856_1007241032 258
961 3300005718 Ga0068866_10011069 Ga0068866_100110692 258
962 3300005719 Ga0068861_100036398 Ga0068861_1000363982 258
963 3300005834 Ga0068851_10035787 Ga0068851_100357872 258
964 3300005842 Ga0068858_100550879 Ga0068858_1005508791 258
965 3300005937 Ga0081455_10031043 Ga0081455_100310433 258
966 3300005937 Ga0081455_10099099 Ga0081455_100990993 258
967 3300005981 Ga0081538_10069547 Ga0081538_100695472 258
968 3300005983 Ga0081540_1000884 Ga0081540_10008844 258
969 3300005983 Ga0081540_1004220 Ga0081540_10042206 258
970 3300005983 Ga0081540_1005132 Ga0081540_10051323 258
971 3300005983 Ga0081540_1012953 Ga0081540_10129533 258
972 3300005983 Ga0081540_1014508 Ga0081540_10145085 258
973 3300005983 Ga0081540_1021814 Ga0081540_10218142 258
974 3300005983 Ga0081540_1025835 Ga0081540_10258353 258
975 3300005985 Ga0081539_10006229 Ga0081539_100062298 258
976 3300006028 Ga0070717_10003635 Ga0070717_100036358 258
977 3300006028 Ga0070717_10005810 Ga0070717_100058104 258
978 3300006028 Ga0070717_10292098 Ga0070717_102920982 258
979 3300006038 Ga0075365_10010419 Ga0075365_100104191 258
980 3300006038 Ga0075365_10520866 Ga0075365_105208661 258
981 3300006048 Ga0075363_100016000 Ga0075363_1000160003 258
982 3300006051 Ga0075364_10009798 Ga0075364_100097985 258
983 3300006051 Ga0075364_10178494 Ga0075364_101784942 258
984 3300006163 Ga0070715_10001911 Ga0070715_100019114 258
985 3300006173 Ga0070716_100001730 Ga0070716_1000017305 258
986 3300006173 Ga0070716_100039266 Ga0070716_1000392662 258
987 3300006175 Ga0070712_100021309 Ga0070712_1000213093 258
988 3300006175 Ga0070712_100022055 Ga0070712_1000220553 258
989 3300006175 Ga0070712_100139414 Ga0070712_1001394142 258
990 3300006178 Ga0075367_10002035 Ga0075367_100020357 258
991 3300006178 Ga0075367_10035016 Ga0075367_100350163 258
992 3300006178 Ga0075367_10106264 Ga0075367_101062642 258
993 3300006186 Ga0075369_10004785 Ga0075369_100047852 258
994 3300006871 Ga0075434_100043289 Ga0075434_1000432893 258
995 3300006881 Ga0068865_100157826 Ga0068865_1001578262 258
996 3300006914 Ga0075436_100117404 Ga0075436_1001174042 258
997 3300006941 Ga0099825_1046449 Ga0099825_10464492 258
998 3300006942 Ga0099824_1013115 Ga0099824_10131153 258
999 3300006943 Ga0099822_1000072 Ga0099822_100007250 258
1000 3300006944 Ga0099823_1106656 Ga0099823_11066561 258
1001 3300007265 Ga0099794_10086065 Ga0099794_100860652 258
1002 3300009093 Ga0105240_10030277 Ga0105240_100302773 258
1003 3300009093 Ga0105240_10052653 Ga0105240_100526533 258
1004 3300009098 Ga0105245_10573276 Ga0105245_105732762 258
1005 3300009098 Ga0105245_10815845 Ga0105245_108158452 258
1006 3300009147 Ga0114129_11234225 Ga0114129_112342251 258
1007 3300009174 Ga0105241_10161360 Ga0105241_101613602 258
1008 3300009176 Ga0105242_10280153 Ga0105242_102801532 258
1009 3300009545 Ga0105237_10547947 Ga0105237_105479472 258
1010 3300009551 Ga0105238_10464430 Ga0105238_104644302 258
1011 3300009551 Ga0105238_10509255 Ga0105238_105092551 258
1012 3300009551 Ga0105238_10637057 Ga0105238_106370572 258
1013 3300009551 Ga0105238_10925623 Ga0105238_109256231 258
1014 3300010159 Ga0099796_10052412 Ga0099796_100524122 258
1015 3300010375 Ga0105239_10224672 Ga0105239_102246722 258
1016 3300010375 Ga0105239_10725714 Ga0105239_107257142 258
1017 3300013100 Ga0157373_10070722 Ga0157373_100707222 258
1018 3300013104 Ga0157370_10511429 Ga0157370_105114291 258
1019 3300013105 Ga0157369_10104094 Ga0157369_101040942 258
1020 3300013105 Ga0157369_10279232 Ga0157369_102792322 258
1021 3300013297 Ga0157378_10490499 Ga0157378_104904992 258
1022 3300014326 Ga0157380_10436727 Ga0157380_104367272 258
1023 3300014497 Ga0182008_10086411 Ga0182008_100864112 258
1024 3300014969 Ga0157376_10148203 Ga0157376_101482032 258
1025 3300014969 Ga0157376_10596002 Ga0157376_105960021 258
1026 3300017792 Ga0163161_10184790 Ga0163161_101847902 258
1027 3300021361 Ga0213872_10076914 Ga0213872_100769142 258
1028 3300021377 Ga0213874_10068795 Ga0213874_100687951 258
1029 3300025208 Ga0209436_101866 Ga0209436_1018662 258
1030 3300025254 Ga0209148_1000699 Ga0209148_100069925 258
1031 3300025261 Ga0209233_1011713 Ga0209233_10117132 258
1032 3300025261 Ga0209233_1012838 Ga0209233_10128382 258
1033 3300025272 Ga0209455_1004211 Ga0209455_10042112 258
1034 3300025284 Ga0209130_1000147 Ga0209130_100014744 258
1035 3300025292 Ga0209676_1001620 Ga0209676_10016202 258
1036 3300025294 Ga0209025_1000240 Ga0209025_100024043 258
1037 3300025295 Ga0209564_1001127 Ga0209564_100112713 258
1038 3300025295 Ga0209564_1015362 Ga0209564_10153623 258
1039 3300025297 Ga0209758_1002537 Ga0209758_100253714 258
1040 3300025297 Ga0209758_1011139 Ga0209758_10111396 258
1041 3300025298 Ga0209050_1014213 Ga0209050_10142132 258
1042 3300025299 Ga0209256_1001569 Ga0209256_10015694 258
1043 3300025302 Ga0207426_1000267 Ga0207426_100026775 258
1044 3300025303 Ga0209051_1008485 Ga0209051_10084852 258
1045 3300025304 Ga0209257_1002116 Ga0209257_100211623 258
1046 3300025315 Ga0207697_10035020 Ga0207697_100350202 258
1047 3300025321 Ga0207656_10015273 Ga0207656_100152733 258
1048 3300025893 Ga0207682_10049223 Ga0207682_100492232 258
1049 3300025898 Ga0207692_10000364 Ga0207692_1000036413 258
1050 3300025898 Ga0207692_10003951 Ga0207692_100039514 258
1051 3300025898 Ga0207692_10005642 Ga0207692_100056423 258
1052 3300025904 Ga0207647_10238473 Ga0207647_102384732 258
1053 3300025906 Ga0207699_10000319 Ga0207699_1000031912 258
1054 3300025906 Ga0207699_10002988 Ga0207699_100029886 258
1055 3300025906 Ga0207699_10020623 Ga0207699_100206233 258
1056 3300025906 Ga0207699_10440202 Ga0207699_104402021 258
1057 3300025911 Ga0207654_10082507 Ga0207654_100825072 258
1058 3300025912 Ga0207707_10018699 Ga0207707_100186993 258
1059 3300025912 Ga0207707_10031747 Ga0207707_100317474 258
1060 3300025912 Ga0207707_10419105 Ga0207707_104191052 258
1061 3300025913 Ga0207695_10048138 Ga0207695_100481383 258
1062 3300025913 Ga0207695_10158677 Ga0207695_101586772 258
1063 3300025915 Ga0207693_10007176 Ga0207693_100071765 258
1064 3300025915 Ga0207693_10043239 Ga0207693_100432393 258
1065 3300025915 Ga0207693_10098517 Ga0207693_100985172 258
1066 3300025916 Ga0207663_10000417 Ga0207663_1000041713 258
1067 3300025916 Ga0207663_10015030 Ga0207663_100150303 258
1068 3300025916 Ga0207663_10039890 Ga0207663_100398903 258
1069 3300025917 Ga0207660_10003159 Ga0207660_100031592 258
1070 3300025917 Ga0207660_10091050 Ga0207660_100910502 258
1071 3300025918 Ga0207662_10134864 Ga0207662_101348641 258
1072 3300025919 Ga0207657_10001107 Ga0207657_1000110715 258
1073 3300025919 Ga0207657_10004372 Ga0207657_1000437214 258
1074 3300025919 Ga0207657_10108304 Ga0207657_101083042 258
1075 3300025919 Ga0207657_10334546 Ga0207657_103345462 258
1076 3300025920 Ga0207649_10379229 Ga0207649_103792292 258
1077 3300025921 Ga0207652_10020624 Ga0207652_100206243 258
1078 3300025921 Ga0207652_10186135 Ga0207652_101861351 258
1079 3300025922 Ga0207646_10454260 Ga0207646_104542602 258
1080 3300025923 Ga0207681_10483934 Ga0207681_104839341 258
1081 3300025924 Ga0207694_10019080 Ga0207694_100190803 258
1082 3300025924 Ga0207694_10321180 Ga0207694_103211802 258
1083 3300025928 Ga0207700_10095530 Ga0207700_100955302 258
1084 3300025928 Ga0207700_10120873 Ga0207700_101208732 258
1085 3300025928 Ga0207700_10139247 Ga0207700_101392472 258
1086 3300025928 Ga0207700_10245489 Ga0207700_102454891 258
1087 3300025929 Ga0207664_10059002 Ga0207664_100590022 258
1088 3300025929 Ga0207664_10107641 Ga0207664_101076412 258
1089 3300025929 Ga0207664_10272313 Ga0207664_102723131 258
1090 3300025929 Ga0207664_10388327 Ga0207664_103883272 258
1091 3300025932 Ga0207690_10266891 Ga0207690_102668912 258
1092 3300025933 Ga0207706_10013484 Ga0207706_100134842 258
1093 3300025934 Ga0207686_10354493 Ga0207686_103544932 258
1094 3300025939 Ga0207665_10000190 Ga0207665_1000019010 258
1095 3300025939 Ga0207665_10016066 Ga0207665_100160663 258
1096 3300025939 Ga0207665_10212063 Ga0207665_102120631 258
1097 3300025939 Ga0207665_10510225 Ga0207665_105102251 258
1098 3300025944 Ga0207661_10013657 Ga0207661_100136572 258
1099 3300025949 Ga0207667_10005778 Ga0207667_1000577813 258
1100 3300025949 Ga0207667_10483827 Ga0207667_104838272 258
1101 3300025961 Ga0207712_10049315 Ga0207712_100493152 258
1102 3300025972 Ga0207668_10061439 Ga0207668_100614393 258
1103 3300025986 Ga0207658_10145331 Ga0207658_101453312 258
1104 3300026035 Ga0207703_10616397 Ga0207703_106163971 258
1105 3300026041 Ga0207639_10275252 Ga0207639_102752521 258
1106 3300026041 Ga0207639_10378559 Ga0207639_103785592 258
1107 3300026041 Ga0207639_10671936 Ga0207639_106719362 258
1108 3300026067 Ga0207678_10064676 Ga0207678_100646762 258
1109 3300026067 Ga0207678_10068316 Ga0207678_100683164 258
1110 3300026089 Ga0207648_10124804 Ga0207648_101248042 258
1111 3300026116 Ga0207674_10046213 Ga0207674_100462133 258
1112 3300026116 Ga0207674_10604412 Ga0207674_106044121 258
1113 3300026118 Ga0207675_100161090 Ga0207675_1001610902 258
1114 3300026118 Ga0207675_100685017 Ga0207675_1006850171 258
1115 3300026121 Ga0207683_10031453 Ga0207683_100314532 258
1116 3300026121 Ga0207683_10049770 Ga0207683_100497702 258
1117 3300026121 Ga0207683_10209554 Ga0207683_102095542 258
1118 3300026142 Ga0207698_10916551 Ga0207698_109165511 258
1119 3300027296 Ga0209389_1000001 Ga0209389_1000001134 258
1120 3300027357 Ga0209589_1000011 Ga0209589_1000011193 258
1121 3300027361 Ga0209489_100012 Ga0209489_100012193 258
1122 3300027361 Ga0209489_100612 Ga0209489_10061214 258
1123 3300027363 Ga0209700_100007 Ga0209700_100007291 258
1124 3300027363 Ga0209700_100019 Ga0209700_100019193 258
1125 3300028379 Ga0268266_10018792 Ga0268266_100187923 258
1126 3300028379 Ga0268266_10177582 Ga0268266_101775822 258
1127 3300028379 Ga0268266_10325536 Ga0268266_103255362 258
1128 3300028381 Ga0268264_10887731 Ga0268264_108877312 258
1129 3300028556 Ga0265337_1006052 Ga0265337_10060524 258
1130 3300028558 Ga0265326_10003632 Ga0265326_100036322 258
1131 3300028563 Ga0265319_1009562 Ga0265319_10095624 258
1132 3300028573 Ga0265334_10018461 Ga0265334_100184612 258
1133 3300028577 Ga0265318_10014529 Ga0265318_100145292 258
1134 3300028653 Ga0265323_10002008 Ga0265323_100020089 258
1135 3300028666 Ga0265336_10002276 Ga0265336_100022762 258
1136 3300028794 Ga0307515_10166938 Ga0307515_101669382 258
1137 3300028800 Ga0265338_10007046 Ga0265338_100070465 258
1138 3300029957 Ga0265324_10012696 Ga0265324_100126962 258
1139 3300031235 Ga0265330_10008271 Ga0265330_100082716 258
1140 3300031235 Ga0265330_10041431 Ga0265330_100414312 258
1141 3300031235 Ga0265330_10111848 Ga0265330_101118481 258
1142 3300031238 Ga0265332_10006592 Ga0265332_100065924 258
1143 3300031238 Ga0265332_10011731 Ga0265332_100117312 258
1144 3300031239 Ga0265328_10101343 Ga0265328_101013432 258
1145 3300031241 Ga0265325_10009944 Ga0265325_100099442 258
1146 3300031247 Ga0265340_10003690 Ga0265340_100036902 258
1147 3300031247 Ga0265340_10086993 Ga0265340_100869932 258
1148 3300031247 Ga0265340_10121365 Ga0265340_101213651 258
1149 3300031249 Ga0265339_10001505 Ga0265339_100015053 258
1150 3300031344 Ga0265316_10251612 Ga0265316_102516122 258
1151 3300031711 Ga0265314_10002744 Ga0265314_100027445 258
1152 3300031712 Ga0265342_10169414 Ga0265342_101694141 258
1153 3300031730 Ga0307516_10056839 Ga0307516_100568393 258
1154 3300031730 Ga0307516_10224046 Ga0307516_102240462 258
1155 3300033180 Ga0307510_10050890 Ga0307510_100508903 258
1156 3300033180 Ga0307510_10063819 Ga0307510_100638192 258
1157 3300033442 Ga0315911_1000002 Ga0315911_1000002111 258
1158 3300034818 Ga0373950_0031985 Ga0373950_0031985_64_846 258
1159 3300035086 Ga0373934_0016121 Ga0373934_0016121_1862_2644 258
1160 3300035111 Ga0373923_0000289 Ga0373923_0000289_6996_7790 258
1161 3300035113 Ga0373936_0006387 Ga0373936_0006387_688_1470 258
1162 3300035116 Ga0373945_0063014 Ga0373945_0063014_432_1214 258
1163 3300035118 Ga0373954_0001207 Ga0373954_0001207_924_1718 258
1164 3300035118 Ga0373954_0088515 Ga0373954_0088515_684_1466 258
1165 3300035118 Ga0373954_0140355 Ga0373954_0140355_28_810 258
1166 3300035119 Ga0373956_0010705 Ga0373956_0010705_769_1551 258
1167 3300035119 Ga0373956_0093265 Ga0373956_0093265_384_1166 258
1168 3300035120 Ga0373957_0009960 Ga0373957_0009960_2138_2932 258
1169 3300035170 Ga0373943_0032647 Ga0373943_0032647_311_1093 258
1170 3300035170 Ga0373943_0135699 Ga0373943_0135699_98_880 258
1171 3300035171 Ga0373946_0003713 Ga0373946_0003713_1874_2656 258
1172 3300035171 Ga0373946_0107013 Ga0373946_0107013_440_1222 258
1173 3300035172 Ga0373955_0009767 Ga0373955_0009767_3559_4341 258
1174 3300035172 Ga0373955_0047368 Ga0373955_0047368_795_1577 258
1175 3300035242 Ga0373962_0093402 Ga0373962_0093402_67_849 258
1176 3300035410 Ga0373924_0012573 Ga0373924_0012573_1613_2395 258
1177 3300035410 Ga0373924_0061287 Ga0373924_0061287_255_1037 258
1178 3300035692 Ga0373935_0000499 Ga0373935_0000499_19154_19936 258
1179 3300035692 Ga0373935_0397416 Ga0373935_0397416_73_855 258
1180 3300035724 Ga0373933_0001914 Ga0373933_0001914_9263_10045 258
1181 3300035725 Ga0373947_0001481 Ga0373947_0001481_12206_12988 258
1182 3300035725 Ga0373947_0198789 Ga0373947_0198789_142_924 258
1183 3300035725 Ga0373947_0244977 Ga0373947_0244977_237_1037 258
1184 3300036401 Ga0373937_0004047 Ga0373937_0004047_3672_4454 258
1185 3300036401 Ga0373937_0014169 Ga0373937_0014169_1448_2230 258
1186 3300036401 Ga0373937_0026809 Ga0373937_0026809_596_1378 258
1187 3300036401 Ga0373937_0166521 Ga0373937_0166521_427_1209 258
1188 3300037068 Ga0373925_0010291 Ga0373925_0010291_3289_4071 258
1189 3300037312 Ga0395899_0075081 Ga0395899_0075081_1423_2205 258
1190 3300037418 Ga0395900_0000851 Ga0395900_0000851_23383_24165 258
1191 3300037418 Ga0395900_0407528 Ga0395900_0407528_325_1116 258
1192 3300037466 Ga0395898_0008255 Ga0395898_0008255_9409_10191 258
1193 3300037466 Ga0395898_0009621 Ga0395898_0009621_67_849 258
1194 3300037466 Ga0395898_0261367 Ga0395898_0261367_455_1237 258
1195 3300037466 Ga0395898_0463388 Ga0395898_0463388_256_1047 258
1196 3300037471 Ga0395905_0076783 Ga0395905_0076783_1836_2618 258
1197 3300038443 Ga0395901_0009809 Ga0395901_0009809_1629_2411 258
1198 3300039437 Ga0436365_0256340 Ga0436365_0256340_252_1034 258
1199 3300039437 Ga0436365_1226979 Ga0436365_1226979_113_895 258
1200 3300039447 Ga0436361_0265242 Ga0436361_0265242_977_1759 258
1201 3300039450 Ga0436363_0687569 Ga0436363_0687569_589_1371 258
1202 3300039450 Ga0436363_1579678 Ga0436363_1579678_280_1080 258
1203 3300039453 Ga0436362_0328324 Ga0436362_0328324_2323_3105 258
1204 3300041491 Ga0451833_0873998 Ga0451833_0873998_113_895 258
1205 3300044684 Ga0466966_0279073 Ga0466966_0279073_108_890 258
1206 3300044694 Ga0466963_0226529 Ga0466963_0226529_121_903 258
1207 3300044706 Ga0466964_0076952 Ga0466964_0076952_316_1098 258
1208 3300044842 Ga0466957_0129569 Ga0466957_0129569_609_1391 258
1209 3300044842 Ga0466957_0305128 Ga0466957_0305128_159_935 258
1210 3300046454 Ga0495592_0003354 Ga0495592_0003354_630_1412 258
1211 3300046454 Ga0495592_0018326 Ga0495592_0018326_1777_2559 258
1212 3300046454 Ga0495592_0102690 Ga0495592_0102690_330_1112 258
1213 3300046455 Ga0495603_0000040 Ga0495603_0000040_4795_5577 258
1214 3300046455 Ga0495603_0190516 Ga0495603_0190516_15_797 258
1215 3300046455 Ga0495603_0251742 Ga0495603_0251742_22_804 258
1216 3300046459 Ga0495629_0000077 Ga0495629_0000077_724_1506 258
1217 3300046459 Ga0495629_0000188 Ga0495629_0000188_33713_34495 258
1218 3300046459 Ga0495629_0023257 Ga0495629_0023257_3142_3924 258
1219 3300046460 Ga0495638_0015053 Ga0495638_0015053_3287_4069 258
1220 3300046462 Ga0495651_0023165 Ga0495651_0023165_3705_4487 258
1221 3300046462 Ga0495651_0023797 Ga0495651_0023797_1940_2722 258
1222 3300046462 Ga0495651_0221858 Ga0495651_0221858_63_845 258
1223 3300046463 Ga0495653_0004244 Ga0495653_0004244_8980_9762 258
1224 3300046472 Ga0495580_0003456 Ga0495580_0003456_7573_8355 258
1225 3300046473 Ga0495582_0000020 Ga0495582_0000020_68238_69020 258
1226 3300046473 Ga0495582_0339855 Ga0495582_0339855_34_816 258
1227 3300046475 Ga0495639_0000011 Ga0495639_0000011_60886_61668 258
1228 3300046476 Ga0495662_0000229 Ga0495662_0000229_17472_18254 258
1229 3300046477 Ga0495664_0054228 Ga0495664_0054228_123_905 258
1230 3300046499 Ga0495594_0002423 Ga0495594_0002423_397_1179 258
1231 3300046501 Ga0495607_0039575 Ga0495607_0039575_548_1330 258
1232 3300046507 Ga0495606_0013074 Ga0495606_0013074_3844_4626 258
1233 3300046507 Ga0495606_0031762 Ga0495606_0031762_235_1017 258
1234 3300046511 Ga0495608_0006190 Ga0495608_0006190_723_1517 258
1235 3300046513 Ga0495616_0061165 Ga0495616_0061165_542_1324 258
1236 3300046514 Ga0495618_0049300 Ga0495618_0049300_1720_2502 258
1237 3300046515 Ga0495620_0073293 Ga0495620_0073293_305_1087 258
1238 3300046516 Ga0495628_0047293 Ga0495628_0047293_945_1727 258
1239 3300046517 Ga0495630_0005419 Ga0495630_0005419_1913_2695 258
1240 3300046519 Ga0495632_0177113 Ga0495632_0177113_19_801 258
1241 3300046522 Ga0495643_0063870 Ga0495643_0063870_586_1368 258
1242 3300046524 Ga0495648_0068085 Ga0495648_0068085_745_1527 258
1243 3300046524 Ga0495648_0068596 Ga0495648_0068596_495_1277 258
1244 3300046529 Ga0495652_0055109 Ga0495652_0055109_751_1533 258
1245 3300046529 Ga0495652_0059496 Ga0495652_0059496_832_1614 258
1246 3300046531 Ga0495665_0000133 Ga0495665_0000133_29014_29796 258
1247 3300046533 Ga0495640_0010408 Ga0495640_0010408_2003_2785 258
1248 3300046543 Ga0495645_0013345 Ga0495645_0013345_1201_1983 258
1249 3300046543 Ga0495645_0037041 Ga0495645_0037041_2251_3033 258
1250 3300046543 Ga0495645_0261797 Ga0495645_0261797_70_852 258
1251 3300046557 Ga0495622_0006251 Ga0495622_0006251_414_1196 258
1252 3300046557 Ga0495622_0085745 Ga0495622_0085745_52_834 258
1253 3300046557 Ga0495622_0170975 Ga0495622_0170975_57_839 258
1254 3300046558 Ga0495633_0125707 Ga0495633_0125707_338_1120 258
1255 3300046616 Ga0495668_0038869 Ga0495668_0038869_857_1639 258
1256 3300046616 Ga0495668_0128180 Ga0495668_0128180_276_1058 258
1257 3300046642 Ga0495634_0000402 Ga0495634_0000402_28704_29486 258
1258 3300046642 Ga0495634_0009196 Ga0495634_0009196_4531_5325 258
1259 3300046663 Ga0495635_0000196 Ga0495635_0000196_742_1536 258
1260 3300046663 Ga0495635_0012249 Ga0495635_0012249_3254_4036 258
1261 3300046663 Ga0495635_0015570 Ga0495635_0015570_1311_2093 258
1262 3300046663 Ga0495635_0084244 Ga0495635_0084244_836_1618 258
1263 3300046665 Ga0495661_0033831 Ga0495661_0033831_625_1407 258
1264 3300046674 Ga0495588_0015223 Ga0495588_0015223_2031_2813 258
1265 3300046675 Ga0495657_0001347 Ga0495657_0001347_701_1495 258
1266 3300046675 Ga0495657_0130252 Ga0495657_0130252_726_1508 258
1267 3300046679 Ga0495623_0104712 Ga0495623_0104712_493_1275 258
1268 3300046679 Ga0495623_0213024 Ga0495623_0213024_65_847 258
1269 3300046680 Ga0495646_0044961 Ga0495646_0044961_1173_1955 258
1270 3300046680 Ga0495646_0053965 Ga0495646_0053965_552_1334 258
1271 3300046680 Ga0495646_0111070 Ga0495646_0111070_255_1037 258
1272 3300046681 Ga0495647_0010003 Ga0495647_0010003_327_1109 258
1273 3300046683 Ga0495658_0000538 Ga0495658_0000538_16222_17004 258
1274 3300046689 Ga0495613_0000873 Ga0495613_0000873_7635_8417 258
1275 3300046689 Ga0495613_0027935 Ga0495613_0027935_485_1267 258
1276 3300046690 Ga0495624_0000819 Ga0495624_0000819_19549_20331 258
1277 3300046694 Ga0495649_0056075 Ga0495649_0056075_56_838 258
1278 3300046809 Ga0495600_0012427 Ga0495600_0012427_3817_4599 258
1279 3300046809 Ga0495600_0030740 Ga0495600_0030740_975_1757 258
1280 3300046809 Ga0495600_0099306 Ga0495600_0099306_559_1341 258
1281 3300047315 Ga0495581_0000518 Ga0495581_0000518_15674_16456 258
1282 3300047317 Ga0495604_0004984 Ga0495604_0004984_9105_9887 258
1283 3300047317 Ga0495604_0020026 Ga0495604_0020026_748_1530 258
1284 3300047317 Ga0495604_0305358 Ga0495604_0305358_116_898 258
1285 3300047317 Ga0495604_0340537 Ga0495604_0340537_155_937 258
1286 3300047319 Ga0495674_0001070 Ga0495674_0001070_19513_20295 258
1287 3300047319 Ga0495674_0066903 Ga0495674_0066903_176_958 258
1288 3300047319 Ga0495674_0141255 Ga0495674_0141255_517_1299 258
1289 3300047320 Ga0495672_0012004 Ga0495672_0012004_3455_4237 258
1290 3300047321 Ga0495676_0033175 Ga0495676_0033175_3352_4134 258
1291 3300047321 Ga0495676_0072590 Ga0495676_0072590_1498_2280 258
1292 3300047322 Ga0495680_0013711 Ga0495680_0013711_3469_4263 258
1293 3300047322 Ga0495680_0114735 Ga0495680_0114735_644_1426 258
1294 3300047322 Ga0495680_0189206 Ga0495680_0189206_397_1179 258
1295 3300047444 Ga0495675_0000638 Ga0495675_0000638_533_1315 258
1296 3300047469 Ga0495673_0113117 Ga0495673_0113117_15_797 258
1297 3300047471 Ga0495684_0000068 Ga0495684_0000068_61541_62335 258
1298 3300047471 Ga0495684_0063761 Ga0495684_0063761_1670_2452 258
1299 3300047472 Ga0495686_0082404 Ga0495686_0082404_144_926 258
1300 3300047673 Ga0495593_0000006 Ga0495593_0000006_14869_15651 258
1301 3300047673 Ga0495593_0007104 Ga0495593_0007104_3724_4506 258
1302 3300048088 Ga0495602_0029704 Ga0495602_0029704_641_1423 258
1303 3300048904 Ga0496101_0283463 Ga0496101_0283463_282_1064 258
1304 3300048905 Ga0496102_0036626 Ga0496102_0036626_1823_2605 258
1305 3300048907 Ga0496104_0001744 Ga0496104_0001744_7374_8156 258
1306 3300048907 Ga0496104_0422288 Ga0496104_0422288_396_1178 258
1307 3300048908 Ga0496105_0002142 Ga0496105_0002142_185_967 258
1308 3300048909 Ga0496106_0044275 Ga0496106_0044275_1882_2664 258
1309 3300048910 Ga0496107_0418635 Ga0496107_0418635_32_814 258
1310 3300048912 Ga0496109_0772365 Ga0496109_0772365_90_872 258
1311 3300048913 Ga0496110_0037452 Ga0496110_0037452_1415_2197 258
1312 3300048913 Ga0496110_0080326 Ga0496110_0080326_663_1445 258
1313 3300048915 Ga0496112_0000017 Ga0496112_0000017_182949_183731 258
1314 3300048915 Ga0496112_0042892 Ga0496112_0042892_790_1572 258
1315 3300048915 Ga0496112_0082096 Ga0496112_0082096_1339_2121 258
1316 3300048915 Ga0496112_0094161 Ga0496112_0094161_1758_2540 258
1317 3300048915 Ga0496112_0158529 Ga0496112_0158529_1171_1953 258
1318 3300048915 Ga0496112_0259552 Ga0496112_0259552_186_968 258
1319 3300048916 Ga0496113_0029385 Ga0496113_0029385_1370_2152 258
1320 3300048917 Ga0496114_0135248 Ga0496114_0135248_400_1182 258
1321 3300048917 Ga0496114_0225884 Ga0496114_0225884_354_1136 258
1322 3300048917 Ga0496114_0512394 Ga0496114_0512394_189_971 258
1323 3300048918 Ga0496115_0015437 Ga0496115_0015437_321_1103 258
1324 3300048918 Ga0496115_0040567 Ga0496115_0040567_2897_3679 258
1325 3300048918 Ga0496115_0067618 Ga0496115_0067618_1705_2487 258
1326 3300048918 Ga0496115_0276809 Ga0496115_0276809_375_1157 258
1327 3300048919 Ga0496116_0001079 Ga0496116_0001079_10772_11554 258
1328 3300048919 Ga0496116_0251187 Ga0496116_0251187_22_804 258
1329 3300048920 Ga0496117_0054193 Ga0496117_0054193_1297_2079 258
1330 3300048920 Ga0496117_0062441 Ga0496117_0062441_1303_2088 258
1331 3300048920 Ga0496117_0126045 Ga0496117_0126045_348_1130 258
1332 3300048921 Ga0496118_0036913 Ga0496118_0036913_364_1146 258
1333 3300048921 Ga0496118_0047345 Ga0496118_0047345_1490_2272 258
1334 3300048921 Ga0496118_0084124 Ga0496118_0084124_1352_2134 258
1335 3300048921 Ga0496118_0156068 Ga0496118_0156068_97_879 258
1336 3300048921 Ga0496118_0236065 Ga0496118_0236065_44_826 258
1337 3300048922 Ga0496119_0020449 Ga0496119_0020449_2991_3773 258
1338 3300048922 Ga0496119_0113111 Ga0496119_0113111_352_1134 258
1339 3300048923 Ga0496120_0009024 Ga0496120_0009024_5606_6388 258
1340 3300048923 Ga0496120_0103135 Ga0496120_0103135_15_797 258
1341 3300048924 Ga0496121_0001488 Ga0496121_0001488_2107_2889 258
1342 3300048924 Ga0496121_0002000 Ga0496121_0002000_3375_4157 258
1343 3300048924 Ga0496121_0014293 Ga0496121_0014293_842_1627 258
1344 3300048924 Ga0496121_0108787 Ga0496121_0108787_1027_1809 258
1345 3300048924 Ga0496121_0111529 Ga0496121_0111529_477_1259 258
1346 3300048925 Ga0496122_0073748 Ga0496122_0073748_772_1554 258
1347 3300048926 Ga0496123_0044032 Ga0496123_0044032_1795_2577 258
1348 3300048927 Ga0496124_0037607 Ga0496124_0037607_323_1105 258
1349 3300048927 Ga0496124_0392713 Ga0496124_0392713_168_950 258
1350 3300048928 Ga0496125_0010421 Ga0496125_0010421_5916_6698 258
1351 3300048928 Ga0496125_0018563 Ga0496125_0018563_4632_5414 258
1352 3300048928 Ga0496125_0048379 Ga0496125_0048379_1449_2231 258
1353 3300048928 Ga0496125_0103617 Ga0496125_0103617_1155_1937 258
1354 3300048928 Ga0496125_0317897 Ga0496125_0317897_102_884 258
1355 3300048929 Ga0496126_0005288 Ga0496126_0005288_5552_6334 258
1356 3300048929 Ga0496126_0006081 Ga0496126_0006081_2197_2979 258
1357 3300048929 Ga0496126_0020645 Ga0496126_0020645_451_1233 258
1358 3300048929 Ga0496126_0119862 Ga0496126_0119862_1412_2194 258
1359 3300048929 Ga0496126_0135001 Ga0496126_0135001_1298_2083 258
1360 3300048929 Ga0496126_0240653 Ga0496126_0240653_162_944 258
1361 3300048929 Ga0496126_0296031 Ga0496126_0296031_301_1083 258
1362 3300049569 Ga0501032_0000392 Ga0501032_0000392_13922_14716 258
1363 3300049569 Ga0501032_0205166 Ga0501032_0205166_40_831 258
1364 3300049570 Ga0501033_0000232 Ga0501033_0000232_42173_42967 258
1365 3300049570 Ga0501033_0019714 Ga0501033_0019714_3756_4547 258
1366 3300049571 Ga0501034_0000704 Ga0501034_0000704_38064_38858 258
1367 3300049572 Ga0501036_0000007 Ga0501036_0000007_189456_190250 258
1368 3300049572 Ga0501036_0612326 Ga0501036_0612326_49_840 258
1369 3300049573 Ga0501037_0000066 Ga0501037_0000066_83695_84489 258
1370 3300049574 Ga0501038_0000026 Ga0501038_0000026_49751_50545 258
1371 3300049574 Ga0501038_0043211 Ga0501038_0043211_2336_3127 258
1372 3300049575 Ga0501039_0000005 Ga0501039_0000005_61941_62735 258
1373 3300049579 Ga0501043_0000036 Ga0501043_0000036_93634_94428 258
1374 3300049579 Ga0501043_0063197 Ga0501043_0063197_1182_1973 258
1375 3300049580 Ga0501046_0000147 Ga0501046_0000147_45394_46188 258
1376 3300049580 Ga0501046_0152222 Ga0501046_0152222_441_1232 258
1377 3300049581 Ga0501047_0000209 Ga0501047_0000209_20671_21465 258
1378 3300049582 Ga0501048_0000460 Ga0501048_0000460_2714_3508 258
1379 3300049584 Ga0501068_0000569 Ga0501068_0000569_16944_17738 258
1380 3300049585 Ga0501069_0060551 Ga0501069_0060551_979_1773 258
1381 3300049586 Ga0501070_0000163 Ga0501070_0000163_45717_46511 258
1382 3300049587 Ga0501071_0108835 Ga0501071_0108835_1090_1884 258
1383 3300049588 Ga0501072_0026856 Ga0501072_0026856_2136_2930 258
1384 3300049589 Ga0501073_0000070 Ga0501073_0000070_9909_10703 258
1385 3300049741 Ga0501079_0132167 Ga0501079_0132167_569_1363 258
1386 3300049742 Ga0501080_0000137 Ga0501080_0000137_11250_12044 258
1387 3300049822 Ga0501035_0000016 Ga0501035_0000016_3924_4718 258
1388 3300049822 Ga0501035_0064059 Ga0501035_0064059_59_850 258
1389 3300049823 Ga0501044_0000366 Ga0501044_0000366_44890_45684 258
1390 3300049824 Ga0501045_0062432 Ga0501045_0062432_1917_2711 258
1391 3300050490 nmdc:mga03n38_4598_c1 nmdc:mga03n38_4598_c1_1351_2130 258
1392 3300050490 nmdc:mga03n38_55100_c1 nmdc:mga03n38_55100_c1_470_1252 258
1393 3300050491 nmdc:mga00v17_128981_c1 nmdc:mga00v17_128981_c1_87_866 258
1394 3300050491 nmdc:mga00v17_208266_c1 nmdc:mga00v17_208266_c1_379_1161 258
1395 3300050491 nmdc:mga00v17_63217_c1 nmdc:mga00v17_63217_c1_1200_1982 258
1396 3300050492 nmdc:mga0yw44_292175_c1 nmdc:mga0yw44_292175_c1_128_907 258
1397 3300050492 nmdc:mga0yw44_51827_c1 nmdc:mga0yw44_51827_c1_1260_2042 258
1398 3300050494 nmdc:mga06z11_13270_c1 nmdc:mga06z11_13270_c1_1334_2113 258
1399 3300050494 nmdc:mga06z11_22394_c1 nmdc:mga06z11_22394_c1_765_1544 258
1400 3300050494 nmdc:mga06z11_291901_c1 nmdc:mga06z11_291901_c1_60_842 258
1401 3300050496 nmdc:mga07m45_161000_c1 nmdc:mga07m45_161000_c1_441_1220 258
1402 3300050512 nmdc:mga0n895_407573_c1 nmdc:mga0n895_407573_c1_150_932 258
1403 3300050512 nmdc:mga0n895_72147_c1 nmdc:mga0n895_72147_c1_1201_1983 258
1404 3300050514 nmdc:mga08x19_195522_c1 nmdc:mga08x19_195522_c1_295_1077 258
1405 3300050516 nmdc:mga0sz30_22053_c1 nmdc:mga0sz30_22053_c1_1137_1919 258
1406 3300053077 Ga0495601_0194980 Ga0495601_0194980_239_1021 258
1407 3300053077 Ga0495601_0246425 Ga0495601_0246425_340_1122 258
1408 3300053078 Ga0495612_0031082 Ga0495612_0031082_1253_2035 258
1409 3300053078 Ga0495612_0064504 Ga0495612_0064504_371_1153 258
1410 3300053080 Ga0500635_0022379 Ga0500635_0022379_626_1408 258
1411 3300053084 Ga0495595_0011980 Ga0495595_0011980_321_1115 258
1412 3300053085 Ga0495619_0000829 Ga0495619_0000829_7696_8490 258
1413 3300053085 Ga0495619_0082427 Ga0495619_0082427_734_1516 258
1414 3300053088 Ga0500644_0015403 Ga0500644_0015403_55_837 258
1415 3300053089 Ga0500581_036511 Ga0500581_036511_1550_2332 258
1416 3300053091 Ga0500647_0043590 Ga0500647_0043590_926_1708 258
1417 3300053094 Ga0500566_0000043 Ga0500566_0000043_1824_2606 258
1418 3300053094 Ga0500566_0000479 Ga0500566_0000479_12644_13426 258
1419 3300053094 Ga0500566_0001303 Ga0500566_0001303_1059_1841 258
1420 3300053094 Ga0500566_0007953 Ga0500566_0007953_5126_5908 258
1421 3300053095 Ga0500640_011315 Ga0500640_011315_2489_3271 258
1422 3300053096 Ga0500641_0015386 Ga0500641_0015386_1701_2483 258
1423 3300053098 Ga0500650_0011529 Ga0500650_0011529_342_1124 258
1424 3300053103 Ga0500555_068946 Ga0500555_068946_80_862 258
1425 3300053104 Ga0500556_0000093 Ga0500556_0000093_12892_13674 258
1426 3300053111 Ga0500572_004209 Ga0500572_004209_323_1105 258
1427 3300053116 Ga0500592_001027 Ga0500592_001027_2484_3266 258
1428 3300053118 Ga0500594_0010492 Ga0500594_0010492_497_1279 258
1429 3300053119 Ga0500595_000722 Ga0500595_000722_5731_6516 258
1430 3300053119 Ga0500595_009591 Ga0500595_009591_159_941 258
1431 3300053119 Ga0500595_042887 Ga0500595_042887_342_1124 258
1432 3300053121 Ga0500607_050231 Ga0500607_050231_881_1663 258
1433 3300053122 Ga0500608_013224 Ga0500608_013224_988_1770 258
1434 3300053122 Ga0500608_018017 Ga0500608_018017_857_1639 258
1435 3300053123 Ga0500614_007785 Ga0500614_007785_1091_1873 258
1436 3300053130 Ga0500642_0000013 Ga0500642_0000013_60377_61159 258
1437 3300053131 Ga0500652_000620 Ga0500652_000620_674_1456 258
1438 3300053136 Ga0500559_0001123 Ga0500559_0001123_14352_15134 258
1439 3300053136 Ga0500559_0002307 Ga0500559_0002307_1952_2734 258
1440 3300053139 Ga0500568_0001875 Ga0500568_0001875_9210_9992 258
1441 3300053145 Ga0500586_004376 Ga0500586_004376_380_1162 258
1442 3300053148 Ga0500590_136030 Ga0500590_136030_19_801 258
1443 3300053150 Ga0500603_000679 Ga0500603_000679_341_1123 258
1444 3300053151 Ga0500604_0010294 Ga0500604_0010294_1671_2453 258
1445 3300053153 Ga0500616_0000288 Ga0500616_0000288_13357_14139 258
1446 3300053156 Ga0500622_0000563 Ga0500622_0000563_15520_16302 258
1447 3300053158 Ga0500627_0168144 Ga0500627_0168144_92_874 258
1448 3300053159 Ga0500630_001851 Ga0500630_001851_1851_2633 258
1449 3300053162 Ga0500638_072772 Ga0500638_072772_520_1302 258
1450 3300053162 Ga0500638_161012 Ga0500638_161012_39_821 258
1451 3300053163 Ga0500639_000099 Ga0500639_000099_27451_28233 258
1452 3300053177 Ga0500636_0004209 Ga0500636_0004209_4117_4899 258
1453 3300053177 Ga0500636_0085612 Ga0500636_0085612_925_1707 258
1454 3300053178 Ga0500637_0000093 Ga0500637_0000093_29342_30124 258
1455 3300053730 Ga0500645_005813 Ga0500645_005813_3465_4247 258
1456 3300055283 Ga0500661_001138 Ga0500661_001138_2395_3177 258
1457 3300061719 Ga0466962_0109112 Ga0466962_0109112_365_1147 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

21

257

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9694 1 256
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9597 1 255
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9452 1 255
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8142 4 255
7ero-assembly1.cif.gz_C crystal structure of d-allulose 3-epimerase with d-allulose from agrobacterium sp. sul3 0.7998 1 255
ID Description Score Start End Superfamily
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9628 1 255 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.951 2 255 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9461 3 258 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9365 2 255 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9357 1 256 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A257PN09-F1-model_v4 Hydroxypyruvate isomerase 0.989 1 206 GO:0008903
GO:0046487
AF-W6RKC7-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.987 1 258 GO:0008903
GO:0046487
AF-A0A7V8KK36-F1-model_v4 deleted 0.9863 1 228
AF-A0A528FMZ6-F1-model_v4 Hydroxypyruvate isomerase 0.9859 1 102 GO:0008903
GO:0046487
AF-A0A844W977-F1-model_v4 deleted 0.9853 11 163

Feature Viewer

pLDDT pTM Quality
93.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map