F494091

General Info

Members Datasets Scaffolds Average Seq Length
1456 493 1456 124

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0371742|Ga0495647_0371742_171_623
Length 150
Sequence MCSRRWVSASASGCEGDAMNHPEDPVIPAEAGDGEPPPNRVMLPTLETPTLTKAELAELLFERLGLNKRESKDMVEAFFDLIHATLVSGDDVKMSGFGNFNIRRKAPRPGRNPRTGEAIPIKARNVVTFHASHKLKGVVQGDIPPEEEFE

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
112 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
113 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
114 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
115 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
275 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
276 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
280 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
283 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
286 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
289 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
290 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
293 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
294 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
295 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
299 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
300 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
301 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
302 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
303 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
304 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
305 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
306 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
309 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
312 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
313 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
316 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
322 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
329 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
330 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
331 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
369 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
370 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
371 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
372 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
373 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
387 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
388 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
389 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
390 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
406 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
407 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
408 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
409 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
410 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
411 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
412 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
420 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
421 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
422 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
423 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
424 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
425 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
426 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
427 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
428 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
429 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
430 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
431 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
432 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
435 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
436 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
437 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
438 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
439 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
440 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
441 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
442 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
446 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
454 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
455 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
456 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
457 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
458 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
459 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
463 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
464 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
465 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
466 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
467 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
468 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
469 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
470 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
471 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
472 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
473 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
474 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
475 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
476 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
477 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
478 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
479 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
480 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
481 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
482 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
483 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
484 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
485 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
486 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
490 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
493 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.55
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.53
Nodule 0.14
Rhizoplane 3.98
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 5.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1036228 3300002155 Bacteria 677
2 JGI25150J39212_1006308 3300002774 Bacteria 2457
3 JGI25153J46596_10009043 3300003215 Bacteria 4682
4 JGI25153J46596_10030106 3300003215 Bacteria 1853
5 rootH1_10062755 3300003316 Bacteria 1416
6 rootH2_10019535 3300003320 Bacteria 3072
7 rootL2_10003847 3300003322 Bacteria 35009
8 rootL2_10005851 3300003322 Bacteria 11114
9 rootH1_10023641 3300003316 Bacteria 1142
10 rootH1_10023641 3300003323 Bacteria 1358
11 rootH1_10108114 3300003323 Bacteria 1001
12 JGI26145J50221_1002180 3300003371 Bacteria 1539
13 Ga0055526_1001112 3300003771 Bacteria 19553
14 Ga0055530_10058995 3300003791 Bacteria 862
15 Ga0055540_1022368 3300003792 Bacteria 1618
16 Ga0055540_1112627 3300003792 Bacteria 501
17 Ga0055531_10001930 3300003794 Bacteria 14509
18 Ga0055531_10046861 3300003794 Bacteria 1183
19 Ga0055543_1002155 3300004625 Bacteria 6796
20 Ga0065165_1000184 3300005262 Bacteria 109539
21 Ga0065165_1006209 3300005262 Bacteria 6370
22 Ga0065715_10121665 3300005293 Bacteria 2223
23 Ga0065715_10195151 3300005293 Bacteria 1392
24 Ga0065715_10493371 3300005293 Bacteria 786
25 Ga0065707_10082794 3300005295 Bacteria 12061
26 Ga0065707_10327756 3300005295 Bacteria 939
27 Ga0065707_10422887 3300005295 Bacteria 829
28 Ga0065707_10568002 3300005295 Bacteria 706
29 Ga0070658_10085385 3300005327 Bacteria 2596
30 Ga0070658_10255739 3300005327 Bacteria 1486
31 Ga0070658_10560847 3300005327 Bacteria 989
32 Ga0070676_10002035 3300005328 Bacteria 10267
33 Ga0070676_10088789 3300005328 Bacteria 1889
34 Ga0070676_10151549 3300005328 Bacteria 1485
35 Ga0070676_10167278 3300005328 Bacteria 1420
36 Ga0070676_10443337 3300005328 Bacteria 911
37 Ga0070676_11619813 3300005328 Bacteria 500
38 Ga0070683_100049615 3300005329 Bacteria 3883
39 Ga0070683_101356018 3300005329 Bacteria 683
40 Ga0070690_100016127 3300005330 Bacteria 4469
41 Ga0070690_100020915 3300005330 Bacteria 3991
42 Ga0070670_100001136 3300005331 Bacteria 21141
43 Ga0070670_100020708 3300005331 Bacteria 5656
44 Ga0070670_100034250 3300005331 Bacteria 4371
45 Ga0070670_100065307 3300005331 Bacteria 3123
46 Ga0070670_100379370 3300005331 Bacteria 1245
47 Ga0070670_100417662 3300005331 Bacteria 1186
48 Ga0070670_100842064 3300005331 Bacteria 830
49 Ga0070670_101220447 3300005331 Bacteria 687
50 Ga0070670_101945992 3300005331 Bacteria 541
51 Ga0070670_102100816 3300005331 Bacteria 520
52 Ga0070677_10046190 3300005333 Bacteria 1740
53 Ga0070677_10051350 3300005333 Bacteria 1668
54 Ga0070677_10140396 3300005333 Bacteria 1113
55 Ga0070677_10558075 3300005333 Bacteria 629
56 Ga0068869_100003616 3300005334 Bacteria 9485
57 Ga0068869_100013951 3300005334 Bacteria 5359
58 Ga0068869_100084261 3300005334 Bacteria 2379
59 Ga0068869_100138200 3300005334 Bacteria 1879
60 Ga0068869_100230986 3300005334 Bacteria 1470
61 Ga0070666_10051060 3300005335 Bacteria 2783
62 Ga0070666_10058891 3300005335 Bacteria 2598
63 Ga0070666_10402295 3300005335 Bacteria 984
64 Ga0070666_10542382 3300005335 Bacteria 845
65 Ga0070666_10799652 3300005335 Bacteria 694
66 Ga0070680_100656390 3300005336 Bacteria 902
67 Ga0070682_100040490 3300005337 Bacteria 2868
68 Ga0070682_101024262 3300005337 Bacteria 687
69 Ga0068868_100000818 3300005338 Bacteria 21090
70 Ga0068868_100014677 3300005338 Bacteria 5777
71 Ga0068868_100019252 3300005338 Bacteria 5113
72 Ga0068868_100035823 3300005338 Bacteria 3838
73 Ga0068868_100132399 3300005338 Bacteria 2041
74 Ga0068868_100193168 3300005338 Bacteria 1694
75 Ga0068868_100327318 3300005338 Bacteria 1307
76 Ga0068868_100542579 3300005338 Bacteria 1024
77 Ga0068868_101203844 3300005338 Bacteria 700
78 Ga0070660_100046927 3300005339 Bacteria 3312
79 Ga0070660_100168309 3300005339 Bacteria 1769
80 Ga0070660_100822386 3300005339 Bacteria 782
81 Ga0070689_100147818 3300005340 Bacteria 1894
82 Ga0070689_100391053 3300005340 Bacteria 1174
83 Ga0070689_102135811 3300005340 Bacteria 513
84 Ga0070691_10912387 3300005341 Bacteria 543
85 Ga0070687_101180020 3300005343 Bacteria 563
86 Ga0070661_100000791 3300005344 Bacteria 22707
87 Ga0070661_100020436 3300005344 Bacteria 4721
88 Ga0070661_100061356 3300005344 Bacteria 2759
89 Ga0070661_100084411 3300005344 Bacteria 2346
90 Ga0070661_100309400 3300005344 Bacteria 1231
91 Ga0070661_101008793 3300005344 Bacteria 691
92 Ga0070668_100050350 3300005347 Bacteria 3207
93 Ga0070668_100367400 3300005347 Bacteria 1221
94 Ga0070668_101635463 3300005347 Bacteria 590
95 Ga0070669_100119297 3300005353 Bacteria 2010
96 Ga0070669_100124487 3300005353 Bacteria 1971
97 Ga0070669_100391317 3300005353 Bacteria 1135
98 Ga0070669_100527011 3300005353 Bacteria 983
99 Ga0070669_100579569 3300005353 Bacteria 938
100 Ga0070669_100636036 3300005353 Bacteria 896
101 Ga0070675_100000269 3300005354 Bacteria 34213
102 Ga0070675_100001006 3300005354 Bacteria 20229
103 Ga0070675_100001473 3300005354 Bacteria 17347
104 Ga0070675_100004442 3300005354 Bacteria 10691
105 Ga0070675_100034940 3300005354 Bacteria 4082
106 Ga0070675_100067143 3300005354 Bacteria 2967
107 Ga0070675_100130871 3300005354 Bacteria 2138
108 Ga0070675_100149834 3300005354 Bacteria 1999
109 Ga0070675_100851828 3300005354 Bacteria 834
110 Ga0070675_101266567 3300005354 Bacteria 679
111 Ga0070671_100021062 3300005355 Bacteria 5322
112 Ga0070671_100025141 3300005355 Bacteria 4883
113 Ga0070671_100054032 3300005355 Bacteria 3338
114 Ga0070671_100056765 3300005355 Bacteria 3258
115 Ga0070671_100109545 3300005355 Bacteria 2319
116 Ga0070671_100232448 3300005355 Bacteria 1564
117 Ga0070671_100350208 3300005355 Bacteria 1260
118 Ga0070671_100496619 3300005355 Bacteria 1049
119 Ga0070671_100697473 3300005355 Bacteria 880
120 Ga0070671_101263473 3300005355 Bacteria 651
121 Ga0070674_100011798 3300005356 Bacteria 5334
122 Ga0070674_100013715 3300005356 Bacteria 5016
123 Ga0070674_100026145 3300005356 Bacteria 3808
124 Ga0070674_100155833 3300005356 Bacteria 1728
125 Ga0070674_100224261 3300005356 Bacteria 1464
126 Ga0070674_100232817 3300005356 Bacteria 1438
127 Ga0070674_100235016 3300005356 Bacteria 1432
128 Ga0070674_100255810 3300005356 Bacteria 1377
129 Ga0070674_100486718 3300005356 Bacteria 1025
130 Ga0070674_102072756 3300005356 Bacteria 518
131 Ga0070673_100008559 3300005364 Bacteria 6809
132 Ga0070673_100071365 3300005364 Bacteria 2790
133 Ga0070673_100075952 3300005364 Bacteria 2711
134 Ga0070673_100240978 3300005364 Bacteria 1572
135 Ga0070673_100274092 3300005364 Bacteria 1478
136 Ga0070673_100481228 3300005364 Bacteria 1120
137 Ga0070673_100796000 3300005364 Bacteria 873
138 Ga0070688_100284908 3300005365 Bacteria 1189
139 Ga0070688_100445952 3300005365 Bacteria 967
140 Ga0070659_100000451 3300005366 Bacteria 30634
141 Ga0070659_100010741 3300005366 Bacteria 6748
142 Ga0070659_100010749 3300005366 Bacteria 6746
143 Ga0070659_100076710 3300005366 Bacteria 2664
144 Ga0070659_101845862 3300005366 Bacteria 542
145 Ga0070667_100003333 3300005367 Bacteria 13717
146 Ga0070667_100023446 3300005367 Bacteria 5120
147 Ga0070667_100069129 3300005367 Bacteria 3005
148 Ga0070667_100087470 3300005367 Bacteria 2674
149 Ga0070667_100107798 3300005367 Bacteria 2412
150 Ga0070667_100109237 3300005367 Bacteria 2397
151 Ga0070667_100576390 3300005367 Bacteria 1036
152 Ga0070667_100751731 3300005367 Bacteria 904
153 Ga0070667_100763566 3300005367 Bacteria 897
154 Ga0070667_100893616 3300005367 Bacteria 827
155 Ga0070667_102045404 3300005367 Bacteria 539
156 Ga0070701_10883299 3300005438 Bacteria 616
157 Ga0070701_11166487 3300005438 Bacteria 545
158 Ga0070700_100131463 3300005441 Bacteria 1690
159 Ga0070663_100009632 3300005455 Bacteria 5990
160 Ga0070663_100019349 3300005455 Bacteria 4485
161 Ga0070663_100096616 3300005455 Bacteria 2198
162 Ga0070663_100436341 3300005455 Bacteria 1077
163 Ga0070663_100464499 3300005455 Bacteria 1045
164 Ga0070663_100627191 3300005455 Bacteria 907
165 Ga0070663_101685724 3300005455 Bacteria 566
166 Ga0070678_100011667 3300005456 Bacteria 5431
167 Ga0070678_100018712 3300005456 Bacteria 4496
168 Ga0070678_100039403 3300005456 Bacteria 3333
169 Ga0070678_100089762 3300005456 Bacteria 2353
170 Ga0070678_100159972 3300005456 Bacteria 1823
171 Ga0070678_100325158 3300005456 Bacteria 1314
172 Ga0070678_100341685 3300005456 Bacteria 1284
173 Ga0070678_100477001 3300005456 Bacteria 1097
174 Ga0070678_100581749 3300005456 Bacteria 997
175 Ga0070678_100809159 3300005456 Bacteria 851
176 Ga0070678_101606426 3300005456 Bacteria 610
177 Ga0070662_100001019 3300005457 Bacteria 17139
178 Ga0070662_100011240 3300005457 Bacteria 5901
179 Ga0070662_100023675 3300005457 Bacteria 4221
180 Ga0070662_100127956 3300005457 Bacteria 1954
181 Ga0070662_100170413 3300005457 Bacteria 1709
182 Ga0070662_100199797 3300005457 Bacteria 1586
183 Ga0070662_100444044 3300005457 Bacteria 1076
184 Ga0070662_100533932 3300005457 Bacteria 981
185 Ga0070662_101081723 3300005457 Bacteria 688
186 Ga0070681_10197965 3300005458 Bacteria 1928
187 Ga0070681_10278698 3300005458 Bacteria 1583
188 Ga0068867_100000102 3300005459 Bacteria 54275
189 Ga0068867_100016344 3300005459 Bacteria 5268
190 Ga0068867_100019254 3300005459 Bacteria 4864
191 Ga0068867_100021121 3300005459 Bacteria 4644
192 Ga0068867_100024764 3300005459 Bacteria 4301
193 Ga0068867_100034247 3300005459 Bacteria 3680
194 Ga0068867_100048865 3300005459 Bacteria 3113
195 Ga0068867_100256542 3300005459 Bacteria 1424
196 Ga0068867_100743637 3300005459 Bacteria 869
197 Ga0068867_100851984 3300005459 Bacteria 817
198 Ga0068867_101856265 3300005459 Bacteria 567
199 Ga0070685_10204044 3300005466 Bacteria 1287
200 Ga0070685_10319507 3300005466 Bacteria 1052
201 Ga0070685_10725257 3300005466 Bacteria 727
202 Ga0070706_100222505 3300005467 Bacteria 1762
203 Ga0070706_100894898 3300005467 Bacteria 820
204 Ga0070706_101269687 3300005467 Bacteria 676
205 Ga0070706_101283998 3300005467 Bacteria 672
206 Ga0070707_100068338 3300005468 Bacteria 3419
207 Ga0070707_101793977 3300005468 Bacteria 581
208 Ga0070699_100333141 3300005518 Bacteria 1365
209 Ga0070679_100008517 3300005530 Bacteria 9663
210 Ga0070684_100080735 3300005535 Bacteria 2877
211 Ga0070684_100357163 3300005535 Bacteria 1344
212 Ga0068853_100039549 3300005539 Bacteria 4023
213 Ga0068853_100082693 3300005539 Bacteria 2812
214 Ga0068853_100289610 3300005539 Bacteria 1511
215 Ga0068853_100585456 3300005539 Bacteria 1059
216 Ga0068853_100672118 3300005539 Bacteria 987
217 Ga0068853_102216775 3300005539 Bacteria 532
218 Ga0070672_100000367 3300005543 Bacteria 25974
219 Ga0070672_100005175 3300005543 Bacteria 8622
220 Ga0070672_100029306 3300005543 Bacteria 4127
221 Ga0070672_100053519 3300005543 Bacteria 3156
222 Ga0070672_100070307 3300005543 Bacteria 2781
223 Ga0070672_100076494 3300005543 Bacteria 2674
224 Ga0070672_100091204 3300005543 Bacteria 2458
225 Ga0070672_100126183 3300005543 Bacteria 2099
226 Ga0070672_100143469 3300005543 Bacteria 1971
227 Ga0070672_100286296 3300005543 Bacteria 1394
228 Ga0070672_100631445 3300005543 Bacteria 935
229 Ga0070672_101237673 3300005543 Bacteria 665
230 Ga0070672_101527324 3300005543 Bacteria 598
231 Ga0070686_100584919 3300005544 Bacteria 878
232 Ga0070686_101249616 3300005544 Bacteria 618
233 Ga0070686_101904375 3300005544 Bacteria 507
234 Ga0070695_100895853 3300005545 Bacteria 716
235 Ga0070693_100021069 3300005547 Bacteria 3448
236 Ga0070693_100127276 3300005547 Bacteria 1587
237 Ga0070665_100197332 3300005548 Bacteria 2013
238 Ga0070665_101042928 3300005548 Bacteria 830
239 Ga0070665_101238790 3300005548 Bacteria 756
240 Ga0070665_101321897 3300005548 Bacteria 731
241 Ga0070665_101550683 3300005548 Bacteria 671
242 Ga0068855_100063871 3300005563 Bacteria 4295
243 Ga0068855_100124744 3300005563 Bacteria 2945
244 Ga0070664_100000524 3300005564 Bacteria 29185
245 Ga0070664_100003061 3300005564 Bacteria 13518
246 Ga0070664_100163926 3300005564 Bacteria 1968
247 Ga0070664_100212193 3300005564 Bacteria 1730
248 Ga0070664_100344962 3300005564 Bacteria 1353
249 Ga0070664_100601512 3300005564 Bacteria 1020
250 Ga0070664_100879653 3300005564 Bacteria 839
251 Ga0070664_100976988 3300005564 Bacteria 795
252 Ga0068857_100008620 3300005577 Bacteria 8823
253 Ga0068857_100230301 3300005577 Bacteria 1694
254 Ga0068857_100300894 3300005577 Bacteria 1478
255 Ga0068857_100430985 3300005577 Bacteria 1231
256 Ga0068857_101833039 3300005577 Bacteria 594
257 Ga0068854_100020602 3300005578 Bacteria 4465
258 Ga0068854_100139888 3300005578 Bacteria 1856
259 Ga0068854_100542159 3300005578 Bacteria 985
260 Ga0068854_101163122 3300005578 Bacteria 690
261 Ga0068856_100006422 3300005614 Bacteria 11535
262 Ga0068856_100015458 3300005614 Bacteria 7374
263 Ga0068856_100057763 3300005614 Bacteria 3831
264 Ga0068856_101078255 3300005614 Bacteria 821
265 Ga0068856_102086819 3300005614 Bacteria 577
266 Ga0070702_100164921 3300005615 Bacteria 1436
267 Ga0070702_101036618 3300005615 Bacteria 652
268 Ga0068852_100003787 3300005616 Bacteria 10603
269 Ga0068852_100018700 3300005616 Bacteria 5463
270 Ga0068852_100025312 3300005616 Bacteria 4807
271 Ga0068852_100214846 3300005616 Bacteria 1826
272 Ga0068852_100217237 3300005616 Bacteria 1817
273 Ga0068852_100221503 3300005616 Bacteria 1799
274 Ga0068852_100260265 3300005616 Bacteria 1666
275 Ga0068852_100947732 3300005616 Bacteria 879
276 Ga0068852_101078970 3300005616 Bacteria 823
277 Ga0068852_101547430 3300005616 Bacteria 685
278 Ga0068852_102020113 3300005616 Bacteria 599
279 Ga0068859_100166319 3300005617 Bacteria 2285
280 Ga0068859_100617641 3300005617 Bacteria 1177
281 Ga0068859_101094095 3300005617 Bacteria 877
282 Ga0068859_102786939 3300005617 Bacteria 537
283 Ga0068864_100020683 3300005618 Bacteria 5507
284 Ga0068864_100028571 3300005618 Bacteria 4716
285 Ga0068864_100045025 3300005618 Bacteria 3785
286 Ga0068864_100066554 3300005618 Bacteria 3128
287 Ga0068864_100113586 3300005618 Bacteria 2414
288 Ga0068864_100188680 3300005618 Bacteria 1888
289 Ga0068864_100351616 3300005618 Bacteria 1390
290 Ga0068864_100378150 3300005618 Bacteria 1341
291 Ga0068864_100679397 3300005618 Bacteria 1004
292 Ga0068864_101506658 3300005618 Bacteria 676
293 Ga0068866_10029696 3300005718 Bacteria 2617
294 Ga0068866_10060240 3300005718 Bacteria 1967
295 Ga0068866_10083662 3300005718 Bacteria 1720
296 Ga0068866_10134098 3300005718 Bacteria 1412
297 Ga0068861_100002334 3300005719 Bacteria 12330
298 Ga0068861_100007942 3300005719 Bacteria 7301
299 Ga0068861_100042320 3300005719 Bacteria 3413
300 Ga0068861_100273857 3300005719 Bacteria 1451
301 Ga0068861_101213756 3300005719 Bacteria 730
302 Ga0068861_101679098 3300005719 Bacteria 628
303 Ga0068861_102670825 3300005719 Bacteria 504
304 Ga0068851_10010578 3300005834 Bacteria 4308
305 Ga0068851_10053755 3300005834 Bacteria 2051
306 Ga0068851_10126112 3300005834 Bacteria 1380
307 Ga0068851_10221816 3300005834 Bacteria 1062
308 Ga0068851_10379856 3300005834 Bacteria 827
309 Ga0068851_10508047 3300005834 Bacteria 723
310 Ga0068851_11080222 3300005834 Bacteria 508
311 Ga0068870_10349316 3300005840 Bacteria 949
312 Ga0068870_10691859 3300005840 Bacteria 702
313 Ga0068870_10979031 3300005840 Bacteria 602
314 Ga0068870_11021070 3300005840 Bacteria 591
315 Ga0068863_100029644 3300005841 Bacteria 5223
316 Ga0068863_100052427 3300005841 Bacteria 3866
317 Ga0068863_100056820 3300005841 Bacteria 3704
318 Ga0068863_100097913 3300005841 Bacteria 2786
319 Ga0068863_100128349 3300005841 Bacteria 2420
320 Ga0068863_100209124 3300005841 Bacteria 1878
321 Ga0068863_100297393 3300005841 Bacteria 1565
322 Ga0068863_100305432 3300005841 Bacteria 1544
323 Ga0068863_100326831 3300005841 Bacteria 1490
324 Ga0068858_100001369 3300005842 Bacteria 25137
325 Ga0068858_100012867 3300005842 Bacteria 7890
326 Ga0068858_100014492 3300005842 Bacteria 7428
327 Ga0068858_100019550 3300005842 Bacteria 6333
328 Ga0068858_100586552 3300005842 Bacteria 1081
329 Ga0068858_100593919 3300005842 Bacteria 1074
330 Ga0068858_100681293 3300005842 Bacteria 1000
331 Ga0068860_100002243 3300005843 Bacteria 20349
332 Ga0068860_100011668 3300005843 Bacteria 8662
333 Ga0068860_100058883 3300005843 Bacteria 3652
334 Ga0068860_100065639 3300005843 Bacteria 3446
335 Ga0068860_101082211 3300005843 Bacteria 821
336 Ga0068860_102398962 3300005843 Bacteria 548
337 Ga0068862_100003264 3300005844 Bacteria 14033
338 Ga0068862_100006660 3300005844 Bacteria 9581
339 Ga0068862_100201826 3300005844 Bacteria 1793
340 Ga0068862_100289662 3300005844 Bacteria 1503
341 Ga0068862_100642219 3300005844 Bacteria 1023
342 Ga0068862_102653626 3300005844 Bacteria 513
343 Ga0075365_10071131 3300006038 Bacteria 2341
344 Ga0075368_10027258 3300006042 Bacteria 2202
345 Ga0075368_10044569 3300006042 Bacteria 1750
346 Ga0075368_10132483 3300006042 Bacteria 1036
347 Ga0075368_10469290 3300006042 Bacteria 559
348 Ga0075363_100017431 3300006048 Bacteria 3562
349 Ga0075363_100691326 3300006048 Bacteria 615
350 Ga0070716_100377044 3300006173 Bacteria 1013
351 Ga0075362_10015137 3300006177 Bacteria 3132
352 Ga0075362_10024416 3300006177 Bacteria 2564
353 Ga0075362_10118069 3300006177 Bacteria 1254
354 Ga0075362_10120485 3300006177 Bacteria 1242
355 Ga0075362_10262805 3300006177 Bacteria 851
356 Ga0075367_10002153 3300006178 Bacteria 8863
357 Ga0075367_10106569 3300006178 Bacteria 1717
358 Ga0075367_10540917 3300006178 Bacteria 739
359 Ga0075369_10158584 3300006186 Bacteria 1036
360 Ga0075369_10237193 3300006186 Bacteria 846
361 Ga0075369_10541228 3300006186 Bacteria 555
362 Ga0075366_10000953 3300006195 Bacteria 14096
363 Ga0075366_10011821 3300006195 Bacteria 4938
364 Ga0075366_10012199 3300006195 Bacteria 4871
365 Ga0075366_10016893 3300006195 Bacteria 4194
366 Ga0075366_10032816 3300006195 Bacteria 3057
367 Ga0075366_10035903 3300006195 Bacteria 2922
368 Ga0075366_10036799 3300006195 Bacteria 2886
369 Ga0075366_10038857 3300006195 Bacteria 2811
370 Ga0075366_10053567 3300006195 Bacteria 2397
371 Ga0075366_10057998 3300006195 Bacteria 2300
372 Ga0075366_10084998 3300006195 Bacteria 1892
373 Ga0075366_10109724 3300006195 Bacteria 1659
374 Ga0075366_10130981 3300006195 Bacteria 1513
375 Ga0075366_10140401 3300006195 Bacteria 1460
376 Ga0075366_10177719 3300006195 Bacteria 1292
377 Ga0075366_10216436 3300006195 Bacteria 1167
378 Ga0075366_10218687 3300006195 Bacteria 1160
379 Ga0075366_10240109 3300006195 Bacteria 1104
380 Ga0075366_10343606 3300006195 Bacteria 915
381 Ga0075366_10718359 3300006195 Bacteria 621
382 Ga0075366_10733945 3300006195 Bacteria 614
383 Ga0097621_100025627 3300006237 Bacteria 4615
384 Ga0097621_100035295 3300006237 Bacteria 3995
385 Ga0097621_100215455 3300006237 Bacteria 1671
386 Ga0097621_100474969 3300006237 Bacteria 1129
387 Ga0097621_100513842 3300006237 Bacteria 1086
388 Ga0097621_100852260 3300006237 Bacteria 847
389 Ga0097621_101454911 3300006237 Bacteria 649
390 Ga0075370_10000895 3300006353 Bacteria 12211
391 Ga0075370_10010826 3300006353 Bacteria 4780
392 Ga0075370_10011595 3300006353 Bacteria 4636
393 Ga0075370_10026609 3300006353 Bacteria 3205
394 Ga0075370_10038797 3300006353 Bacteria 2681
395 Ga0075370_10049848 3300006353 Bacteria 2374
396 Ga0075370_10072515 3300006353 Bacteria 1971
397 Ga0075370_10094627 3300006353 Bacteria 1725
398 Ga0075370_10096140 3300006353 Bacteria 1711
399 Ga0075370_10218808 3300006353 Bacteria 1125
400 Ga0075370_10409958 3300006353 Bacteria 813
401 Ga0075370_10433789 3300006353 Bacteria 790
402 Ga0075370_10527534 3300006353 Bacteria 713
403 Ga0075370_10643318 3300006353 Bacteria 643
404 Ga0075370_10654221 3300006353 Bacteria 638
405 Ga0068871_100004241 3300006358 Bacteria 9937
406 Ga0068871_100094517 3300006358 Bacteria 2495
407 Ga0068871_100195365 3300006358 Bacteria 1745
408 Ga0068871_100614112 3300006358 Bacteria 990
409 Ga0068871_101606850 3300006358 Bacteria 615
410 Ga0068871_101863082 3300006358 Bacteria 571
411 Ga0068871_102233905 3300006358 Bacteria 521
412 Ga0075430_100025745 3300006846 Bacteria 5006
413 Ga0075433_10658183 3300006852 Bacteria 918
414 Ga0075429_100034324 3300006880 Bacteria 4408
415 Ga0075429_101789318 3300006880 Bacteria 533
416 Ga0068865_100036691 3300006881 Bacteria 3306
417 Ga0068865_100125124 3300006881 Bacteria 1918
418 Ga0068865_100139010 3300006881 Bacteria 1829
419 Ga0068865_100188351 3300006881 Bacteria 1594
420 Ga0068865_100532660 3300006881 Bacteria 984
421 Ga0068865_100625864 3300006881 Bacteria 912
422 Ga0068865_100714478 3300006881 Bacteria 857
423 Ga0068865_101013388 3300006881 Bacteria 728
424 Ga0097620_100166332 3300006931 Bacteria 2285
425 Ga0097620_100617651 3300006931 Bacteria 1177
426 Ga0097620_100709335 3300006931 Bacteria 1096
427 Ga0097620_101094136 3300006931 Bacteria 877
428 Ga0097620_102786881 3300006931 Bacteria 537
429 Ga0099823_1000164 3300006944 Bacteria 35666
430 Ga0075435_100757518 3300007076 Bacteria 845
431 Ga0105251_10594277 3300009011 Bacteria 525
432 Ga0105240_10020928 3300009093 Bacteria 8710
433 Ga0105240_10091540 3300009093 Bacteria 3715
434 Ga0105240_10192337 3300009093 Bacteria 2398
435 Ga0105240_10514691 3300009093 Bacteria 1329
436 Ga0105240_11916636 3300009093 Bacteria 616
437 Ga0105240_11999306 3300009093 Bacteria 602
438 Ga0111539_11587541 3300009094 Bacteria 759
439 Ga0105245_10004781 3300009098 Bacteria 11952
440 Ga0105245_10447177 3300009098 Bacteria 1300
441 Ga0105245_10848886 3300009098 Bacteria 953
442 Ga0114129_10457333 3300009147 Bacteria 1673
443 Ga0114129_10582865 3300009147 Bacteria 1451
444 Ga0105243_10001238 3300009148 Bacteria 22984
445 Ga0105243_10070292 3300009148 Bacteria 2826
446 Ga0105243_10185578 3300009148 Bacteria 1812
447 Ga0105243_10282955 3300009148 Bacteria 1495
448 Ga0105243_10448998 3300009148 Bacteria 1209
449 Ga0105243_10691013 3300009148 Bacteria 993
450 Ga0105241_10619696 3300009174 Bacteria 979
451 Ga0105241_10740028 3300009174 Bacteria 901
452 Ga0105241_10920631 3300009174 Bacteria 813
453 Ga0105242_10078680 3300009176 Bacteria 2753
454 Ga0105242_10261291 3300009176 Bacteria 1564
455 Ga0105242_13280570 3300009176 Bacteria 503
456 Ga0105248_10025146 3300009177 Bacteria 6619
457 Ga0105248_10115604 3300009177 Bacteria 3026
458 Ga0105248_10126227 3300009177 Bacteria 2886
459 Ga0105248_10560532 3300009177 Bacteria 1289
460 Ga0105237_10010119 3300009545 Bacteria 10053
461 Ga0105238_10020844 3300009551 Bacteria 6677
462 Ga0105238_10261763 3300009551 Bacteria 1709
463 Ga0105238_10609897 3300009551 Bacteria 1100
464 Ga0105238_10711555 3300009551 Bacteria 1017
465 Ga0105238_10960111 3300009551 Bacteria 875
466 Ga0105249_10015679 3300009553 Bacteria 6710
467 Ga0105249_10022012 3300009553 Bacteria 5708
468 Ga0105249_10027380 3300009553 Bacteria 5142
469 Ga0105239_10000914 3300010375 Bacteria 41919
470 Ga0105239_10253069 3300010375 Bacteria 1978
471 Ga0105239_11107013 3300010375 Bacteria 912
472 Ga0105239_11416417 3300010375 Bacteria 802
473 Ga0105239_13094518 3300010375 Bacteria 542
474 Ga0105246_11304357 3300011119 Bacteria 673
475 Ga0105246_11406569 3300011119 Bacteria 651
476 Ga0157340_1013755 3300012473 Bacteria 611
477 Ga0157325_1018032 3300012485 Bacteria 603
478 Ga0157319_1000009 3300012497 Bacteria 227971
479 Ga0157315_1006689 3300012508 Bacteria 910
480 Ga0157327_1050875 3300012512 Bacteria 589
481 Ga0157373_10178978 3300013100 Bacteria 1493
482 Ga0157373_10547074 3300013100 Bacteria 839
483 Ga0157373_11048390 3300013100 Bacteria 610
484 Ga0157371_10273729 3300013102 Bacteria 1219
485 Ga0157371_10393527 3300013102 Bacteria 1013
486 Ga0157370_10300284 3300013104 Bacteria 1482
487 Ga0157370_10603805 3300013104 Bacteria 1005
488 Ga0157370_10896628 3300013104 Bacteria 805
489 Ga0157369_10038041 3300013105 Bacteria 5263
490 Ga0157369_10720988 3300013105 Bacteria 1026
491 Ga0157369_11860210 3300013105 Bacteria 611
492 Ga0157374_10031516 3300013296 Bacteria 4819
493 Ga0157374_10071656 3300013296 Bacteria 3268
494 Ga0157374_10091743 3300013296 Bacteria 2897
495 Ga0157374_10109095 3300013296 Bacteria 2661
496 Ga0157374_10347798 3300013296 Bacteria 1473
497 Ga0157378_10013493 3300013297 Bacteria 7145
498 Ga0157378_10024860 3300013297 Bacteria 5275
499 Ga0157378_10083591 3300013297 Bacteria 2889
500 Ga0157378_10206658 3300013297 Bacteria 1860
501 Ga0157378_10234741 3300013297 Bacteria 1749
502 Ga0157378_10565633 3300013297 Bacteria 1144
503 Ga0157378_12004026 3300013297 Bacteria 629
504 Ga0163162_10036220 3300013306 Bacteria 4916
505 Ga0163162_10050457 3300013306 Bacteria 4172
506 Ga0163162_10133273 3300013306 Bacteria 2595
507 Ga0163162_10531748 3300013306 Bacteria 1305
508 Ga0163162_10603819 3300013306 Bacteria 1223
509 Ga0163162_10628255 3300013306 Bacteria 1199
510 Ga0163162_10632997 3300013306 Bacteria 1194
511 Ga0163162_10941602 3300013306 Bacteria 975
512 Ga0163162_11862038 3300013306 Bacteria 688
513 Ga0157372_10219116 3300013307 Bacteria 2206
514 Ga0157372_10424816 3300013307 Bacteria 1549
515 Ga0157372_10822618 3300013307 Bacteria 1079
516 Ga0157372_12403121 3300013307 Bacteria 605
517 Ga0157375_10006998 3300013308 Bacteria 9848
518 Ga0157375_10012615 3300013308 Bacteria 7499
519 Ga0157375_10014610 3300013308 Bacteria 7012
520 Ga0157375_10017183 3300013308 Bacteria 6522
521 Ga0157375_10097705 3300013308 Bacteria 3012
522 Ga0157375_10132410 3300013308 Bacteria 2614
523 Ga0157375_10204193 3300013308 Bacteria 2132
524 Ga0157375_10751085 3300013308 Bacteria 1127
525 Ga0157375_11566463 3300013308 Bacteria 779
526 Ga0157375_11827134 3300013308 Bacteria 721
527 Ga0157375_12140135 3300013308 Bacteria 666
528 Ga0163163_10000864 3300014325 Bacteria 25838
529 Ga0163163_11053786 3300014325 Bacteria 876
530 Ga0157380_10057760 3300014326 Bacteria 3091
531 Ga0157380_10172521 3300014326 Bacteria 1891
532 Ga0157380_10202828 3300014326 Bacteria 1761
533 Ga0157380_10696184 3300014326 Bacteria 1020
534 Ga0157380_11033392 3300014326 Bacteria 857
535 Ga0157380_11358176 3300014326 Bacteria 760
536 Ga0157377_10000014 3300014745 Bacteria 213961
537 Ga0157377_10002696 3300014745 Bacteria 7892
538 Ga0157377_10709345 3300014745 Bacteria 731
539 Ga0157377_10808312 3300014745 Bacteria 692
540 Ga0157379_10004431 3300014968 Bacteria 12036
541 Ga0157379_10028700 3300014968 Bacteria 4948
542 Ga0157379_10031149 3300014968 Bacteria 4751
543 Ga0157379_10053888 3300014968 Bacteria 3593
544 Ga0157379_10077404 3300014968 Bacteria 2978
545 Ga0157379_10212028 3300014968 Bacteria 1753
546 Ga0157379_10341460 3300014968 Bacteria 1370
547 Ga0157379_10412328 3300014968 Bacteria 1243
548 Ga0157379_10562367 3300014968 Bacteria 1062
549 Ga0157376_10024497 3300014969 Bacteria 4739
550 Ga0157376_10135295 3300014969 Bacteria 2205
551 Ga0157376_10144432 3300014969 Bacteria 2139
552 Ga0157376_10238764 3300014969 Bacteria 1692
553 Ga0157376_10246313 3300014969 Bacteria 1667
554 Ga0157376_10541042 3300014969 Bacteria 1151
555 Ga0157376_10555117 3300014969 Bacteria 1137
556 Ga0157376_10589480 3300014969 Bacteria 1105
557 Ga0157376_12906528 3300014969 Bacteria 518
558 Ga0182006_1211916 3300015261 Bacteria 640
559 Ga0182007_10266367 3300015262 Bacteria 619
560 Ga0182005_1091227 3300015265 Bacteria 847
561 Ga0163161_10012297 3300017792 Bacteria 5941
562 Ga0163161_10019156 3300017792 Bacteria 4798
563 Ga0163161_10040590 3300017792 Bacteria 3343
564 Ga0163161_10123509 3300017792 Bacteria 1947
565 Ga0163161_10181451 3300017792 Bacteria 1614
566 Ga0163161_10268707 3300017792 Bacteria 1334
567 Ga0206353_10514887 3300020082 Bacteria 583
568 Ga0213872_10002349 3300021361 Bacteria 11240
569 Ga0213872_10043062 3300021361 Bacteria 2058
570 Ga0213872_10251285 3300021361 Bacteria 745
571 Ga0209258_120493 3300025242 Bacteria 692
572 Ga0207425_1000511 3300025245 Bacteria 23911
573 Ga0209129_1002180 3300025258 Bacteria 9862
574 Ga0209129_1026616 3300025258 Bacteria 997
575 Ga0207666_1048305 3300025271 Bacteria 672
576 Ga0209673_1009744 3300025273 Bacteria 4123
577 Ga0209673_1012171 3300025273 Bacteria 3486
578 Ga0209673_1029638 3300025273 Bacteria 1739
579 Ga0209564_1000003 3300025295 Bacteria 1585848
580 Ga0209564_1000196 3300025295 Bacteria 141368
581 Ga0209758_1000181 3300025297 Bacteria 140847
582 Ga0209758_1000207 3300025297 Bacteria 129217
583 Ga0209050_1000858 3300025298 Bacteria 41211
584 Ga0209050_1001266 3300025298 Bacteria 29109
585 Ga0209050_1006370 3300025298 Bacteria 7004
586 Ga0209256_1031332 3300025299 Bacteria 1455
587 Ga0209256_1074696 3300025299 Bacteria 753
588 Ga0209051_1002697 3300025303 Bacteria 12355
589 Ga0209051_1012833 3300025303 Bacteria 4029
590 Ga0209051_1043460 3300025303 Bacteria 1577
591 Ga0209257_1000021 3300025304 Bacteria 771986
592 Ga0209257_1005175 3300025304 Bacteria 9399
593 Ga0209257_1015510 3300025304 Bacteria 3165
594 Ga0209257_1042771 3300025304 Bacteria 1334
595 Ga0209257_1153677 3300025304 Bacteria 504
596 Ga0207697_10110727 3300025315 Bacteria 1176
597 Ga0207656_10014661 3300025321 Bacteria 3024
598 Ga0207656_10082290 3300025321 Bacteria 1449
599 Ga0207656_10127880 3300025321 Bacteria 1188
600 Ga0207656_10147672 3300025321 Bacteria 1111
601 Ga0207656_10245505 3300025321 Bacteria 876
602 Ga0207656_10311423 3300025321 Bacteria 781
603 Ga0207682_10027282 3300025893 Bacteria 2273
604 Ga0207682_10043554 3300025893 Bacteria 1837
605 Ga0207642_10002666 3300025899 Bacteria 5560
606 Ga0207642_10012484 3300025899 Bacteria 3068
607 Ga0207642_10052446 3300025899 Bacteria 1850
608 Ga0207710_10156056 3300025900 Bacteria 1109
609 Ga0207688_10034955 3300025901 Bacteria 2784
610 Ga0207680_10005278 3300025903 Bacteria 6166
611 Ga0207680_10041270 3300025903 Bacteria 2691
612 Ga0207680_10185664 3300025903 Bacteria 1409
613 Ga0207680_10586460 3300025903 Bacteria 797
614 Ga0207685_10302143 3300025905 Bacteria 792
615 Ga0207645_10001190 3300025907 Bacteria 21497
616 Ga0207645_10029270 3300025907 Bacteria 3551
617 Ga0207645_10079243 3300025907 Bacteria 2105
618 Ga0207645_10140960 3300025907 Bacteria 1571
619 Ga0207645_10182418 3300025907 Bacteria 1377
620 Ga0207645_10192193 3300025907 Bacteria 1342
621 Ga0207643_10318077 3300025908 Bacteria 971
622 Ga0207643_10832915 3300025908 Bacteria 598
623 Ga0207643_10996285 3300025908 Bacteria 542
624 Ga0207705_10024072 3300025909 Bacteria 4345
625 Ga0207705_10039570 3300025909 Bacteria 3380
626 Ga0207705_10431687 3300025909 Bacteria 1021
627 Ga0207705_10956916 3300025909 Bacteria 662
628 Ga0207684_10015609 3300025910 Bacteria 6537
629 Ga0207684_10544836 3300025910 Bacteria 993
630 Ga0207654_10451245 3300025911 Bacteria 902
631 Ga0207654_10717037 3300025911 Bacteria 719
632 Ga0207654_10764005 3300025911 Bacteria 697
633 Ga0207707_10292186 3300025912 Bacteria 1410
634 Ga0207707_10324237 3300025912 Bacteria 1329
635 Ga0207695_10016280 3300025913 Bacteria 8710
636 Ga0207695_10519502 3300025913 Bacteria 1072
637 Ga0207695_10637486 3300025913 Bacteria 947
638 Ga0207671_10006390 3300025914 Bacteria 10506
639 Ga0207660_10101515 3300025917 Bacteria 2149
640 Ga0207662_10061901 3300025918 Bacteria 2248
641 Ga0207657_10024402 3300025919 Bacteria 5599
642 Ga0207657_10145653 3300025919 Bacteria 1932
643 Ga0207657_10675112 3300025919 Bacteria 803
644 Ga0207649_10001484 3300025920 Bacteria 13768
645 Ga0207649_10009940 3300025920 Bacteria 5214
646 Ga0207649_10409486 3300025920 Bacteria 1016
647 Ga0207649_10737510 3300025920 Bacteria 766
648 Ga0207649_11134876 3300025920 Bacteria 617
649 Ga0207652_10077074 3300025921 Bacteria 2908
650 Ga0207646_10307947 3300025922 Bacteria 1431
651 Ga0207681_10000214 3300025923 Bacteria 45816
652 Ga0207681_10099546 3300025923 Bacteria 2094
653 Ga0207681_10161918 3300025923 Bacteria 1688
654 Ga0207681_10192341 3300025923 Bacteria 1562
655 Ga0207681_10279077 3300025923 Bacteria 1315
656 Ga0207681_10439878 3300025923 Bacteria 1059
657 Ga0207681_10466410 3300025923 Bacteria 1029
658 Ga0207681_10691665 3300025923 Bacteria 847
659 Ga0207694_10009034 3300025924 Bacteria 7522
660 Ga0207694_10207529 3300025924 Bacteria 1595
661 Ga0207694_10478137 3300025924 Bacteria 1042
662 Ga0207694_11061595 3300025924 Bacteria 685
663 Ga0207650_10000937 3300025925 Bacteria 21987
664 Ga0207650_10002494 3300025925 Bacteria 12790
665 Ga0207650_10103958 3300025925 Bacteria 2191
666 Ga0207650_10143131 3300025925 Bacteria 1881
667 Ga0207650_10195655 3300025925 Bacteria 1617
668 Ga0207650_10273263 3300025925 Bacteria 1374
669 Ga0207650_10426023 3300025925 Bacteria 1102
670 Ga0207650_10777543 3300025925 Bacteria 811
671 Ga0207650_11545158 3300025925 Bacteria 564
672 Ga0207659_10004306 3300025926 Bacteria 8603
673 Ga0207659_10004991 3300025926 Bacteria 8039
674 Ga0207659_10017778 3300025926 Bacteria 4649
675 Ga0207659_10017801 3300025926 Bacteria 4648
676 Ga0207659_10055052 3300025926 Bacteria 2843
677 Ga0207659_10092294 3300025926 Bacteria 2263
678 Ga0207659_10482749 3300025926 Bacteria 1047
679 Ga0207659_10985527 3300025926 Bacteria 725
680 Ga0207687_10280279 3300025927 Bacteria 1336
681 Ga0207687_10506091 3300025927 Bacteria 1008
682 Ga0207687_10949392 3300025927 Bacteria 737
683 Ga0207687_11141610 3300025927 Bacteria 669
684 Ga0207644_10010554 3300025931 Bacteria 6089
685 Ga0207644_10014021 3300025931 Bacteria 5357
686 Ga0207644_10024213 3300025931 Bacteria 4165
687 Ga0207644_10044789 3300025931 Bacteria 3145
688 Ga0207644_10057347 3300025931 Bacteria 2812
689 Ga0207644_10196979 3300025931 Bacteria 1587
690 Ga0207644_11520441 3300025931 Bacteria 562
691 Ga0207644_11806127 3300025931 Bacteria 511
692 Ga0207690_10002792 3300025932 Bacteria 10532
693 Ga0207690_10017607 3300025932 Bacteria 4367
694 Ga0207690_10035310 3300025932 Bacteria 3229
695 Ga0207690_10084537 3300025932 Bacteria 2224
696 Ga0207690_10240615 3300025932 Bacteria 1394
697 Ga0207706_10000449 3300025933 Bacteria 43973
698 Ga0207706_10003147 3300025933 Bacteria 15850
699 Ga0207706_10018191 3300025933 Bacteria 6322
700 Ga0207706_10033988 3300025933 Bacteria 4538
701 Ga0207706_10322887 3300025933 Bacteria 1343
702 Ga0207706_10356451 3300025933 Bacteria 1271
703 Ga0207706_10506314 3300025933 Bacteria 1042
704 Ga0207706_10507711 3300025933 Bacteria 1040
705 Ga0207706_11135284 3300025933 Bacteria 652
706 Ga0207686_10008428 3300025934 Bacteria 5564
707 Ga0207686_10076296 3300025934 Bacteria 2173
708 Ga0207686_11064645 3300025934 Bacteria 658
709 Ga0207709_10000804 3300025935 Bacteria 24412
710 Ga0207709_10022408 3300025935 Bacteria 3583
711 Ga0207709_10264068 3300025935 Bacteria 1264
712 Ga0207709_10300940 3300025935 Bacteria 1192
713 Ga0207709_10937051 3300025935 Bacteria 705
714 Ga0207670_10120453 3300025936 Bacteria 1906
715 Ga0207670_10711682 3300025936 Bacteria 832
716 Ga0207670_11767725 3300025936 Bacteria 526
717 Ga0207669_10020710 3300025937 Bacteria 3455
718 Ga0207669_10031788 3300025937 Bacteria 2954
719 Ga0207669_10147654 3300025937 Bacteria 1642
720 Ga0207669_10158936 3300025937 Bacteria 1593
721 Ga0207669_10183787 3300025937 Bacteria 1501
722 Ga0207669_10301815 3300025937 Bacteria 1217
723 Ga0207669_10363569 3300025937 Bacteria 1122
724 Ga0207669_10458253 3300025937 Bacteria 1012
725 Ga0207669_10919911 3300025937 Bacteria 731
726 Ga0207704_10003076 3300025938 Bacteria 7541
727 Ga0207704_10026016 3300025938 Bacteria 3203
728 Ga0207704_10133576 3300025938 Bacteria 1723
729 Ga0207704_10184203 3300025938 Bacteria 1512
730 Ga0207704_10455008 3300025938 Bacteria 1022
731 Ga0207704_10471995 3300025938 Bacteria 1005
732 Ga0207704_10504016 3300025938 Bacteria 976
733 Ga0207704_10879031 3300025938 Bacteria 753
734 Ga0207665_10358200 3300025939 Bacteria 1102
735 Ga0207665_11537807 3300025939 Bacteria 528
736 Ga0207691_10001841 3300025940 Bacteria 20724
737 Ga0207691_10024826 3300025940 Bacteria 5634
738 Ga0207691_10045546 3300025940 Bacteria 4031
739 Ga0207691_10120992 3300025940 Bacteria 2320
740 Ga0207691_10202067 3300025940 Bacteria 1729
741 Ga0207691_10214760 3300025940 Bacteria 1670
742 Ga0207691_10230990 3300025940 Bacteria 1602
743 Ga0207691_10545743 3300025940 Bacteria 983
744 Ga0207691_10593261 3300025940 Bacteria 938
745 Ga0207691_10617357 3300025940 Bacteria 917
746 Ga0207691_11111503 3300025940 Bacteria 657
747 Ga0207711_10036125 3300025941 Bacteria 4191
748 Ga0207711_10040995 3300025941 Bacteria 3941
749 Ga0207711_10043521 3300025941 Bacteria 3831
750 Ga0207711_10056982 3300025941 Bacteria 3359
751 Ga0207711_10069942 3300025941 Bacteria 3043
752 Ga0207711_10077629 3300025941 Bacteria 2895
753 Ga0207711_10401642 3300025941 Bacteria 1273
754 Ga0207689_10001542 3300025942 Bacteria 21888
755 Ga0207689_10016843 3300025942 Bacteria 6185
756 Ga0207689_10099988 3300025942 Bacteria 2383
757 Ga0207689_10126213 3300025942 Bacteria 2105
758 Ga0207689_10154252 3300025942 Bacteria 1893
759 Ga0207689_10187388 3300025942 Bacteria 1706
760 Ga0207689_10276067 3300025942 Bacteria 1391
761 Ga0207661_10061440 3300025944 Bacteria 3035
762 Ga0207661_10179565 3300025944 Bacteria 1848
763 Ga0207661_10771878 3300025944 Bacteria 885
764 Ga0207679_10000220 3300025945 Bacteria 45059
765 Ga0207679_10017939 3300025945 Bacteria 4730
766 Ga0207679_11027953 3300025945 Bacteria 755
767 Ga0207667_10187364 3300025949 Bacteria 2124
768 Ga0207667_11371211 3300025949 Bacteria 681
769 Ga0207651_10007714 3300025960 Bacteria 5751
770 Ga0207651_10017944 3300025960 Bacteria 4196
771 Ga0207651_10023971 3300025960 Bacteria 3765
772 Ga0207651_10026542 3300025960 Bacteria 3621
773 Ga0207651_10179679 3300025960 Bacteria 1677
774 Ga0207651_10318084 3300025960 Bacteria 1300
775 Ga0207651_10420766 3300025960 Bacteria 1140
776 Ga0207651_10616424 3300025960 Bacteria 950
777 Ga0207651_11566746 3300025960 Bacteria 593
778 Ga0207712_10003685 3300025961 Bacteria 9663
779 Ga0207712_10037266 3300025961 Bacteria 3316
780 Ga0207712_10485526 3300025961 Bacteria 1054
781 Ga0207668_10007597 3300025972 Bacteria 6454
782 Ga0207668_10081814 3300025972 Bacteria 2344
783 Ga0207668_10083356 3300025972 Bacteria 2326
784 Ga0207668_10130917 3300025972 Bacteria 1915
785 Ga0207668_10589541 3300025972 Bacteria 967
786 Ga0207668_11135661 3300025972 Bacteria 701
787 Ga0207640_10480671 3300025981 Bacteria 1030
788 Ga0207640_10570827 3300025981 Bacteria 953
789 Ga0207658_10002329 3300025986 Bacteria 13956
790 Ga0207658_10003279 3300025986 Bacteria 11495
791 Ga0207658_10092681 3300025986 Bacteria 2347
792 Ga0207658_10297802 3300025986 Bacteria 1388
793 Ga0207658_10525847 3300025986 Bacteria 1056
794 Ga0207658_10751053 3300025986 Bacteria 883
795 Ga0207658_10786591 3300025986 Bacteria 863
796 Ga0207658_10902915 3300025986 Bacteria 804
797 Ga0207677_10004256 3300026023 Bacteria 7657
798 Ga0207677_10010920 3300026023 Bacteria 5158
799 Ga0207677_10064331 3300026023 Bacteria 2554
800 Ga0207677_10305442 3300026023 Bacteria 1316
801 Ga0207677_10324344 3300026023 Bacteria 1281
802 Ga0207677_10611657 3300026023 Bacteria 957
803 Ga0207677_10670329 3300026023 Bacteria 917
804 Ga0207677_11399452 3300026023 Bacteria 644
805 Ga0207703_10003713 3300026035 Bacteria 12704
806 Ga0207703_10013980 3300026035 Bacteria 6258
807 Ga0207703_11136695 3300026035 Bacteria 750
808 Ga0207639_10023473 3300026041 Bacteria 4454
809 Ga0207639_10038242 3300026041 Bacteria 3569
810 Ga0207639_10062937 3300026041 Bacteria 2871
811 Ga0207639_10108330 3300026041 Bacteria 2259
812 Ga0207639_11079247 3300026041 Bacteria 753
813 Ga0207639_11219935 3300026041 Bacteria 706
814 Ga0207639_11794840 3300026041 Bacteria 574
815 Ga0207678_10006005 3300026067 Bacteria 10804
816 Ga0207678_10268879 3300026067 Bacteria 1461
817 Ga0207678_10295515 3300026067 Bacteria 1391
818 Ga0207678_10528083 3300026067 Bacteria 1030
819 Ga0207708_10127265 3300026075 Bacteria 1989
820 Ga0207702_10012956 3300026078 Bacteria 6937
821 Ga0207702_10023008 3300026078 Bacteria 5169
822 Ga0207702_10336198 3300026078 Bacteria 1442
823 Ga0207702_10488907 3300026078 Bacteria 1198
824 Ga0207702_10880880 3300026078 Bacteria 887
825 Ga0207641_10015342 3300026088 Bacteria 6278
826 Ga0207641_10022787 3300026088 Bacteria 5156
827 Ga0207641_10040936 3300026088 Bacteria 3882
828 Ga0207641_10050442 3300026088 Bacteria 3520
829 Ga0207641_10053534 3300026088 Bacteria 3421
830 Ga0207641_10091665 3300026088 Bacteria 2660
831 Ga0207641_10109554 3300026088 Bacteria 2446
832 Ga0207641_10275304 3300026088 Bacteria 1581
833 Ga0207641_10410947 3300026088 Bacteria 1301
834 Ga0207648_10000062 3300026089 Bacteria 99889
835 Ga0207648_10005680 3300026089 Bacteria 12515
836 Ga0207648_10016056 3300026089 Bacteria 6860
837 Ga0207648_10022315 3300026089 Bacteria 5687
838 Ga0207648_10027768 3300026089 Bacteria 5022
839 Ga0207648_10039524 3300026089 Bacteria 4148
840 Ga0207648_10046362 3300026089 Bacteria 3811
841 Ga0207648_10155583 3300026089 Bacteria 2018
842 Ga0207648_10222240 3300026089 Bacteria 1679
843 Ga0207648_10299880 3300026089 Bacteria 1441
844 Ga0207648_10376683 3300026089 Bacteria 1283
845 Ga0207648_10538976 3300026089 Bacteria 1071
846 Ga0207648_10627432 3300026089 Bacteria 992
847 Ga0207676_10027995 3300026095 Bacteria 4204
848 Ga0207676_10040197 3300026095 Bacteria 3583
849 Ga0207676_10042173 3300026095 Bacteria 3508
850 Ga0207676_10148970 3300026095 Bacteria 2013
851 Ga0207676_10154293 3300026095 Bacteria 1981
852 Ga0207676_10174215 3300026095 Bacteria 1877
853 Ga0207676_10451756 3300026095 Bacteria 1211
854 Ga0207676_10579893 3300026095 Bacteria 1075
855 Ga0207676_10621491 3300026095 Bacteria 1040
856 Ga0207674_10008358 3300026116 Bacteria 11971
857 Ga0207674_10016738 3300026116 Bacteria 8012
858 Ga0207674_10117874 3300026116 Bacteria 2625
859 Ga0207674_10251500 3300026116 Bacteria 1714
860 Ga0207674_10579628 3300026116 Bacteria 1084
861 Ga0207674_10625124 3300026116 Bacteria 1040
862 Ga0207674_10685603 3300026116 Bacteria 989
863 Ga0207675_100000214 3300026118 Bacteria 54263
864 Ga0207675_100014189 3300026118 Bacteria 7430
865 Ga0207675_100115029 3300026118 Bacteria 2541
866 Ga0207675_100157793 3300026118 Bacteria 2163
867 Ga0207675_100358683 3300026118 Bacteria 1430
868 Ga0207675_101058402 3300026118 Bacteria 830
869 Ga0207683_10012322 3300026121 Bacteria 7298
870 Ga0207683_10041309 3300026121 Bacteria 4027
871 Ga0207683_10052458 3300026121 Bacteria 3574
872 Ga0207683_10111911 3300026121 Bacteria 2445
873 Ga0207683_10133661 3300026121 Bacteria 2232
874 Ga0207683_10196025 3300026121 Bacteria 1835
875 Ga0207683_10316180 3300026121 Bacteria 1430
876 Ga0207683_10465761 3300026121 Bacteria 1166
877 Ga0207683_10594593 3300026121 Bacteria 1024
878 Ga0207683_10848548 3300026121 Bacteria 848
879 Ga0207698_10003539 3300026142 Bacteria 9418
880 Ga0207698_10005500 3300026142 Bacteria 7837
881 Ga0207698_10006533 3300026142 Bacteria 7284
882 Ga0207698_10055990 3300026142 Bacteria 3043
883 Ga0207698_10064769 3300026142 Bacteria 2866
884 Ga0207698_10265655 3300026142 Bacteria 1579
885 Ga0207698_10292521 3300026142 Bacteria 1512
886 Ga0207698_10684324 3300026142 Bacteria 1019
887 Ga0207698_10742882 3300026142 Bacteria 979
888 Ga0207698_10743730 3300026142 Bacteria 979
889 Ga0207698_10991956 3300026142 Bacteria 850
890 Ga0207698_11079274 3300026142 Bacteria 815
891 Ga0209389_1037396 3300027296 Bacteria 3861
892 Ga0209371_1023370 3300027312 Bacteria 1456
893 Ga0209971_1044781 3300027682 Bacteria 1066
894 Ga0209813_10009766 3300027866 Bacteria 2465
895 Ga0209974_10000044 3300027876 Bacteria 31037
896 Ga0268266_10129746 3300028379 Bacteria 2253
897 Ga0268266_10242316 3300028379 Bacteria 1665
898 Ga0268266_11030168 3300028379 Bacteria 796
899 Ga0268266_11263554 3300028379 Bacteria 713
900 Ga0268265_10009334 3300028380 Bacteria 6630
901 Ga0268265_10039299 3300028380 Bacteria 3487
902 Ga0268265_10308172 3300028380 Bacteria 1429
903 Ga0268265_10624783 3300028380 Bacteria 1032
904 Ga0268265_11008029 3300028380 Bacteria 823
905 Ga0268264_10001033 3300028381 Bacteria 27952
906 Ga0268264_10072983 3300028381 Bacteria 2911
907 Ga0268264_10241607 3300028381 Bacteria 1673
908 Ga0268264_10263534 3300028381 Bacteria 1607
909 Ga0268264_10624264 3300028381 Bacteria 1064
910 Ga0268264_11109104 3300028381 Bacteria 800
911 Ga0268264_11375056 3300028381 Bacteria 716
912 Ga0307517_10000708 3300028786 Bacteria 57419
913 Ga0307517_10118579 3300028786 Bacteria 1969
914 Ga0307517_10273449 3300028786 Bacteria 969
915 Ga0307517_10410674 3300028786 Bacteria 713
916 Ga0307515_10000150 3300028794 Bacteria 169644
917 Ga0307515_10000187 3300028794 Bacteria 151904
918 Ga0307515_10005172 3300028794 Bacteria 26524
919 Ga0307515_10015579 3300028794 Bacteria 13992
920 Ga0307515_10032801 3300028794 Bacteria 8581
921 Ga0307515_10064599 3300028794 Bacteria 5115
922 Ga0307515_10096842 3300028794 Bacteria 3613
923 Ga0307515_10216175 3300028794 Bacteria 1747
924 Ga0307515_10259736 3300028794 Bacteria 1475
925 Ga0307515_10327804 3300028794 Bacteria 1192
926 Ga0307515_10343198 3300028794 Bacteria 1144
927 Ga0268256_1025964 3300030500 Bacteria 1480
928 Ga0307512_10109325 3300030522 Bacteria 1830
929 Ga0307512_10145132 3300030522 Bacteria 1438
930 Ga0307512_10231385 3300030522 Bacteria 949
931 Ga0307513_10017100 3300031456 Bacteria 8714
932 Ga0307513_10115414 3300031456 Bacteria 2667
933 Ga0307513_10122795 3300031456 Bacteria 2560
934 Ga0307513_10124857 3300031456 Bacteria 2532
935 Ga0307509_10034015 3300031507 Bacteria 5603
936 Ga0307509_10039232 3300031507 Bacteria 5160
937 Ga0307509_10185497 3300031507 Bacteria 1939
938 Ga0307509_10212909 3300031507 Bacteria 1755
939 Ga0307408_100000010 3300031548 Bacteria 420048
940 Ga0307408_100018381 3300031548 Bacteria 4692
941 Ga0307408_100113110 3300031548 Bacteria 2089
942 Ga0307408_100400521 3300031548 Bacteria 1178
943 Ga0307408_101204470 3300031548 Bacteria 706
944 Ga0307408_101441961 3300031548 Bacteria 649
945 Ga0307508_10001596 3300031616 Bacteria 25282
946 Ga0307508_10003456 3300031616 Bacteria 15989
947 Ga0307508_10110633 3300031616 Bacteria 2346
948 Ga0307508_10294188 3300031616 Bacteria 1217
949 Ga0307514_10002176 3300031649 Bacteria 21074
950 Ga0307514_10120644 3300031649 Bacteria 1829
951 Ga0307514_10282290 3300031649 Bacteria 949
952 Ga0307514_10286116 3300031649 Bacteria 938
953 Ga0307516_10000268 3300031730 Bacteria 66758
954 Ga0307516_10003906 3300031730 Bacteria 18801
955 Ga0307516_10213559 3300031730 Bacteria 1642
956 Ga0307516_10294015 3300031730 Bacteria 1302
957 Ga0307516_10647278 3300031730 Bacteria 712
958 Ga0307516_10753397 3300031730 Bacteria 633
959 Ga0307405_10005746 3300031731 Bacteria 6028
960 Ga0307405_10274690 3300031731 Bacteria 1265
961 Ga0307405_10628796 3300031731 Bacteria 880
962 Ga0307405_11960169 3300031731 Bacteria 523
963 Ga0307413_10019225 3300031824 Bacteria 3604
964 Ga0307518_10370619 3300031838 Bacteria 820
965 Ga0307410_10003356 3300031852 Bacteria 8023
966 Ga0307406_10354766 3300031901 Bacteria 1147
967 Ga0307407_10008822 3300031903 Bacteria 4655
968 Ga0307407_10153575 3300031903 Bacteria 1499
969 Ga0307407_11439400 3300031903 Bacteria 544
970 Ga0307412_10134374 3300031911 Bacteria 1802
971 Ga0307412_10172020 3300031911 Bacteria 1620
972 Ga0307412_10415390 3300031911 Bacteria 1099
973 Ga0307412_10866769 3300031911 Bacteria 789
974 Ga0307412_10981464 3300031911 Bacteria 745
975 Ga0307409_100382829 3300031995 Bacteria 1338
976 Ga0307409_100529484 3300031995 Bacteria 1153
977 Ga0307416_100013304 3300032002 Bacteria 5588
978 Ga0307416_100274638 3300032002 Bacteria 1657
979 Ga0307416_100475036 3300032002 Bacteria 1309
980 Ga0307416_101647897 3300032002 Bacteria 746
981 Ga0307416_101921852 3300032002 Bacteria 695
982 Ga0307414_10223977 3300032004 Bacteria 1546
983 Ga0307414_10334425 3300032004 Bacteria 1294
984 Ga0307414_12201286 3300032004 Bacteria 515
985 Ga0307411_10001686 3300032005 Bacteria 9255
986 Ga0307411_10001815 3300032005 Bacteria 9045
987 Ga0307411_10460262 3300032005 Bacteria 1066
988 Ga0307411_10743021 3300032005 Bacteria 859
989 Ga0307411_11027769 3300032005 Bacteria 739
990 Ga0307415_100007903 3300032126 Bacteria 5854
991 Ga0307415_100205875 3300032126 Bacteria 1565
992 Ga0307507_10023516 3300033179 Bacteria 6761
993 Ga0307507_10094001 3300033179 Bacteria 2551
994 Ga0307510_10025175 3300033180 Bacteria 6868
995 Ga0307510_10045192 3300033180 Bacteria 4758
996 Ga0307510_10051426 3300033180 Bacteria 4357
997 Ga0307510_10498148 3300033180 Bacteria 661
998 Ga0373958_0058867 3300034819 Bacteria 828
999 Ga0373959_0046453 3300034820 Bacteria 926
1000 Ga0373938_0031692 3300034957 Bacteria 1135
1001 Ga0373940_0047582 3300035088 Bacteria 1196
1002 Ga0373940_0237584 3300035088 Bacteria 610
1003 Ga0373944_0272924 3300035089 Bacteria 629
1004 Ga0373949_0028332 3300035090 Bacteria 1321
1005 Ga0373951_0090239 3300035091 Bacteria 803
1006 Ga0373952_0104597 3300035092 Bacteria 751
1007 Ga0373923_0303749 3300035111 Bacteria 755
1008 Ga0373923_0516054 3300035111 Bacteria 584
1009 Ga0373932_0034081 3300035112 Bacteria 1433
1010 Ga0373939_0000272 3300035114 Bacteria 13809
1011 Ga0373954_0173704 3300035118 Bacteria 1056
1012 Ga0373943_0070104 3300035170 Bacteria 1773
1013 Ga0373943_0105381 3300035170 Bacteria 1480
1014 Ga0373943_0798885 3300035170 Bacteria 561
1015 Ga0373946_0320684 3300035171 Bacteria 770
1016 Ga0373946_0599319 3300035171 Bacteria 571
1017 Ga0373955_0177348 3300035172 Bacteria 1263
1018 Ga0373962_0006206 3300035242 Bacteria 2891
1019 Ga0373962_0011842 3300035242 Bacteria 2191
1020 Ga0373924_0106397 3300035410 Bacteria 1209
1021 Ga0373924_0503637 3300035410 Bacteria 544
1022 Ga0373931_0000665 3300035691 Bacteria 14209
1023 Ga0373931_0001429 3300035691 Bacteria 10246
1024 Ga0373931_0370700 3300035691 Bacteria 900
1025 Ga0373935_0795653 3300035692 Bacteria 698
1026 Ga0373927_0352780 3300035695 Bacteria 969
1027 Ga0373927_0448564 3300035695 Bacteria 852
1028 Ga0373933_0182375 3300035724 Bacteria 1339
1029 Ga0373933_0276253 3300035724 Bacteria 1085
1030 Ga0373947_0050825 3300035725 Bacteria 2493
1031 Ga0373947_0831150 3300035725 Bacteria 631
1032 Ga0373937_0065617 3300036401 Bacteria 3342
1033 Ga0373937_0129239 3300036401 Bacteria 2359
1034 Ga0373937_0162313 3300036401 Bacteria 2095
1035 Ga0373925_0070801 3300037068 Bacteria 2637
1036 Ga0373925_0080994 3300037068 Bacteria 2468
1037 Ga0373925_0193368 3300037068 Bacteria 1615
1038 Ga0373925_0405428 3300037068 Bacteria 1112
1039 Ga0373925_0673822 3300037068 Bacteria 852
1040 Ga0395900_0000535 3300037418 Bacteria 53622
1041 Ga0395898_0002836 3300037466 Bacteria 19833
1042 Ga0395905_0007293 3300037471 Bacteria 11021
1043 Ga0395905_0012706 3300037471 Bacteria 8098
1044 Ga0395905_0053650 3300037471 Bacteria 3772
1045 Ga0395905_0124032 3300037471 Bacteria 2429
1046 Ga0395905_0811662 3300037471 Bacteria 838
1047 Ga0436364_1495413 3300037853 Bacteria 958
1048 Ga0436365_1267282 3300039437 Bacteria 895
1049 Ga0436360_0381654 3300039438 Bacteria 606
1050 Ga0436361_0233952 3300039447 Bacteria 547
1051 Ga0436361_0240417 3300039447 Bacteria 3149
1052 Ga0436361_0996052 3300039447 Bacteria 5986
1053 Ga0439461_0059791 3300041410 Bacteria 863
1054 Ga0439461_0127329 3300041410 Bacteria 641
1055 Ga0439465_0338149 3300041413 Bacteria 567
1056 Ga0451789_1178356 3300041443 Bacteria 1226
1057 Ga0451793_0358311 3300041452 Bacteria 1139
1058 Ga0451793_1172903 3300041452 Bacteria 599
1059 Ga0451793_1673427 3300041452 Bacteria 1144
1060 Ga0451797_0278276 3300041453 Bacteria 597
1061 Ga0451797_1036550 3300041453 Bacteria 637
1062 Ga0451797_1315304 3300041453 Bacteria 961
1063 Ga0451795_0059148 3300041456 Bacteria 640
1064 Ga0451795_0139934 3300041456 Bacteria 533
1065 Ga0451795_0394184 3300041456 Bacteria 1321
1066 Ga0451798_0566853 3300041458 Bacteria 827
1067 Ga0451798_0791769 3300041458 Bacteria 739
1068 Ga0451798_1166708 3300041458 Bacteria 1199
1069 Ga0451800_0500868 3300041459 Bacteria 866
1070 Ga0451800_1533257 3300041459 Bacteria 680
1071 Ga0451802_0175899 3300041460 Bacteria 1688
1072 Ga0451805_098782 3300041461 Bacteria 600
1073 Ga0451804_0031720 3300041463 Bacteria 1149
1074 Ga0451804_0695359 3300041463 Bacteria 511
1075 Ga0451807_0270528 3300041486 Bacteria 771
1076 Ga0451807_0589163 3300041486 Bacteria 786
1077 Ga0451807_0592901 3300041486 Bacteria 925
1078 Ga0451833_1494138 3300041491 Bacteria 666
1079 Ga0451835_0060653 3300041492 Bacteria 580
1080 Ga0451839_0134199 3300041496 Bacteria 537
1081 Ga0451839_0843576 3300041496 Bacteria 649
1082 Ga0451841_0137167 3300041498 Bacteria 541
1083 Ga0451841_0202568 3300041498 Bacteria 1086
1084 Ga0451845_0177849 3300041501 Bacteria 788
1085 Ga0451849_0038608 3300041505 Bacteria 830
1086 Ga0451851_0007129 3300041507 Bacteria 799
1087 Ga0451851_0476484 3300041507 Bacteria 665
1088 Ga0451843_0724857 3300041509 Bacteria 752
1089 Ga0451843_1037426 3300041509 Bacteria 572
1090 Ga0451843_1577317 3300041509 Bacteria 516
1091 Ga0451855_0366185 3300041511 Bacteria 614
1092 Ga0451853_2795309 3300041512 Bacteria 921
1093 Ga0451853_3145576 3300041512 Bacteria 1007
1094 Ga0451853_3325265 3300041512 Bacteria 654
1095 Ga0451853_3908419 3300041512 Bacteria 1988
1096 Ga0439433_0025071 3300041999 Bacteria 1346
1097 Ga0439437_022894 3300042000 Bacteria 762
1098 Ga0439445_0030673 3300042004 Bacteria 1394
1099 Ga0439449_0117024 3300042007 Bacteria 989
1100 Ga0439450_001164 3300042008 Bacteria 3762
1101 Ga0439450_073815 3300042008 Bacteria 840
1102 Ga0439454_110360 3300042011 Bacteria 524
1103 Ga0439455_0049240 3300042012 Bacteria 1097
1104 Ga0450912_031564 3300042116 Bacteria 551
1105 Ga0450917_000284 3300042120 Bacteria 3743
1106 Ga0450919_000285 3300042121 Bacteria 5938
1107 Ga0450920_055118 3300042122 Bacteria 800
1108 Ga0450888_005886 3300042126 Bacteria 1320
1109 Ga0450888_010596 3300042126 Bacteria 1070
1110 Ga0450890_001614 3300042127 Bacteria 3233
1111 Ga0450890_001839 3300042127 Bacteria 3005
1112 Ga0450891_001574 3300042129 Bacteria 2346
1113 Ga0450892_001645 3300042130 Bacteria 2091
1114 Ga0450898_019707 3300042134 Bacteria 1177
1115 Ga0450898_028272 3300042134 Bacteria 1018
1116 Ga0450898_042079 3300042134 Bacteria 867
1117 Ga0450904_014100 3300042139 Bacteria 796
1118 Ga0450889_001274 3300042144 Bacteria 2617
1119 Ga0439446_0069153 3300042156 Bacteria 1078
1120 Ga0439458_0046384 3300042157 Bacteria 1064
1121 Ga0439458_0105508 3300042157 Bacteria 734
1122 Ga0439435_0169373 3300042436 Bacteria 709
1123 Ga0439444_0022531 3300042437 Bacteria 1124
1124 Ga0439464_0004537 3300042439 Bacteria 3557
1125 Ga0439460_0071551 3300042461 Bacteria 1075
1126 Ga0450918_000434 3300042531 Bacteria 9012
1127 Ga0450893_0006947 3300042532 Bacteria 1834
1128 Ga0450893_0030477 3300042532 Bacteria 960
1129 Ga0450893_0077745 3300042532 Bacteria 652
1130 Ga0451577_0001608 3300042876 Bacteria 29360
1131 Ga0451577_0008143 3300042876 Bacteria 10223
1132 Ga0451577_0009084 3300042876 Bacteria 9593
1133 Ga0451577_0292353 3300042876 Bacteria 1476
1134 Ga0451577_0379735 3300042876 Bacteria 1282
1135 Ga0451577_1509607 3300042876 Bacteria 594
1136 Ga0466969_0023536 3300044656 Bacteria 3174
1137 Ga0466969_0057161 3300044656 Bacteria 1902
1138 Ga0466972_0004153 3300044658 Bacteria 7225
1139 Ga0466972_0013057 3300044658 Bacteria 4174
1140 Ga0466972_0039081 3300044658 Bacteria 2317
1141 Ga0453683_0844060 3300044673 Bacteria 604
1142 Ga0466965_0036600 3300044683 Bacteria 2408
1143 Ga0466965_0057540 3300044683 Bacteria 1938
1144 Ga0466965_0153621 3300044683 Bacteria 1204
1145 Ga0466965_0212190 3300044683 Bacteria 1029
1146 Ga0466965_0220200 3300044683 Bacteria 1011
1147 Ga0466966_0004224 3300044684 Bacteria 9483
1148 Ga0466966_0041477 3300044684 Bacteria 2957
1149 Ga0466966_0050824 3300044684 Bacteria 2636
1150 Ga0466961_0032915 3300044693 Bacteria 3330
1151 Ga0466961_0045694 3300044693 Bacteria 2801
1152 Ga0466961_0240990 3300044693 Bacteria 1111
1153 Ga0466963_0037909 3300044694 Bacteria 3151
1154 Ga0466964_0012532 3300044706 Bacteria 3209
1155 Ga0466964_0060667 3300044706 Bacteria 1573
1156 Ga0453684_0007620 3300044712 Bacteria 19830
1157 Ga0453684_0041964 3300044712 Bacteria 6175
1158 Ga0453684_0118560 3300044712 Bacteria 3201
1159 Ga0453684_0242660 3300044712 Bacteria 2073
1160 Ga0453684_0296619 3300044712 Bacteria 1839
1161 Ga0453684_2447925 3300044712 Bacteria 516
1162 Ga0466968_0086394 3300044735 Bacteria 1384
1163 Ga0466970_0026135 3300044765 Bacteria 3060
1164 Ga0466970_0301278 3300044765 Bacteria 904
1165 Ga0466957_0096817 3300044842 Bacteria 1855
1166 Ga0466960_0005145 3300044901 Bacteria 5172
1167 Ga0466960_0205627 3300044901 Bacteria 1077
1168 Ga0466959_0000793 3300045049 Bacteria 18583
1169 Ga0466959_0058453 3300045049 Bacteria 2808
1170 Ga0451576_0004508 3300045051 Bacteria 18022
1171 Ga0451576_0014073 3300045051 Bacteria 8915
1172 Ga0451576_0040276 3300045051 Bacteria 4947
1173 Ga0451576_0067461 3300045051 Bacteria 3724
1174 Ga0451576_0094271 3300045051 Bacteria 3113
1175 Ga0451576_0179084 3300045051 Bacteria 2213
1176 Ga0451576_0226207 3300045051 Bacteria 1953
1177 Ga0451576_0357938 3300045051 Bacteria 1528
1178 Ga0466958_0138502 3300045836 Bacteria 1531
1179 Ga0495592_0000295 3300046454 Bacteria 42617
1180 Ga0495592_0570222 3300046454 Bacteria 694
1181 Ga0495603_0294798 3300046455 Bacteria 932
1182 Ga0495590_0088566 3300046457 Bacteria 1094
1183 Ga0495591_101977 3300046458 Bacteria 711
1184 Ga0495629_0183779 3300046459 Bacteria 1448
1185 Ga0495629_0913725 3300046459 Bacteria 575
1186 Ga0495638_0463109 3300046460 Bacteria 645
1187 Ga0495582_0516988 3300046473 Bacteria 690
1188 Ga0495639_0317507 3300046475 Bacteria 779
1189 Ga0495664_0351137 3300046477 Bacteria 888
1190 Ga0495583_0089971 3300046506 Bacteria 1323
1191 Ga0495606_0308558 3300046507 Bacteria 855
1192 Ga0495608_0220549 3300046511 Bacteria 1190
1193 Ga0495610_0005844 3300046512 Bacteria 8642
1194 Ga0495620_0083960 3300046515 Bacteria 1285
1195 Ga0495628_0935336 3300046516 Bacteria 600
1196 Ga0495630_1026686 3300046517 Bacteria 626
1197 Ga0495631_0066241 3300046518 Bacteria 1563
1198 Ga0495632_0010763 3300046519 Bacteria 5390
1199 Ga0495632_0020823 3300046519 Bacteria 3544
1200 Ga0495632_0284097 3300046519 Bacteria 736
1201 Ga0495643_0158986 3300046522 Bacteria 1113
1202 Ga0495648_0163679 3300046524 Bacteria 1147
1203 Ga0495648_0195975 3300046524 Bacteria 1015
1204 Ga0495648_0455521 3300046524 Bacteria 558
1205 Ga0495666_0091251 3300046526 Bacteria 1437
1206 Ga0495666_0482124 3300046526 Bacteria 555
1207 Ga0495586_0159847 3300046535 Bacteria 1270
1208 Ga0495586_0182997 3300046535 Bacteria 1186
1209 Ga0495609_0149509 3300046538 Bacteria 994
1210 Ga0495621_0292428 3300046539 Bacteria 673
1211 Ga0495597_0008922 3300046542 Bacteria 5001
1212 Ga0495645_0150423 3300046543 Bacteria 1618
1213 Ga0495667_0168248 3300046559 Bacteria 1409
1214 Ga0495668_0148343 3300046616 Bacteria 1284
1215 Ga0495668_0813534 3300046616 Bacteria 517
1216 Ga0495611_0062211 3300046648 Bacteria 1698
1217 Ga0495625_0002174 3300046660 Bacteria 21783
1218 Ga0495625_0004670 3300046660 Bacteria 12862
1219 Ga0495625_0289950 3300046660 Bacteria 1050
1220 Ga0495625_0608088 3300046660 Bacteria 655
1221 Ga0495635_0210694 3300046663 Bacteria 1316
1222 Ga0495647_0113929 3300046681 Bacteria 1131
1223 Ga0495647_0214694 3300046681 Bacteria 847
1224 Ga0495647_0371742 3300046681 Bacteria 653
1225 Ga0495658_0067119 3300046683 Bacteria 2074
1226 Ga0495658_0107084 3300046683 Bacteria 1676
1227 Ga0495658_0109706 3300046683 Bacteria 1658
1228 Ga0495658_0166449 3300046683 Bacteria 1362
1229 Ga0495613_0402751 3300046689 Bacteria 933
1230 Ga0495613_0475467 3300046689 Bacteria 844
1231 Ga0495624_0025731 3300046690 Bacteria 3862
1232 Ga0495670_0081267 3300046691 Bacteria 1651
1233 Ga0495670_0195654 3300046691 Bacteria 1070
1234 Ga0495671_0142081 3300046692 Bacteria 1170
1235 Ga0495671_0248083 3300046692 Bacteria 859
1236 Ga0495649_0006798 3300046694 Bacteria 7084
1237 Ga0495660_0020654 3300046810 Bacteria 3775
1238 Ga0495581_0418620 3300047315 Bacteria 781
1239 Ga0495636_0280313 3300047318 Bacteria 776
1240 Ga0495674_0667548 3300047319 Bacteria 818
1241 Ga0495687_000636 3300047443 Bacteria 40190
1242 Ga0495673_0076118 3300047469 Bacteria 1400
1243 Ga0495684_0179919 3300047471 Bacteria 1568
1244 Ga0495684_0941954 3300047471 Bacteria 553
1245 Ga0495686_0002900 3300047472 Bacteria 15394
1246 Ga0495686_0069329 3300047472 Bacteria 2174
1247 Ga0495602_0403157 3300048088 Bacteria 975
1248 Ga0495626_0133152 3300048091 Bacteria 1060
1249 Ga0496101_0221248 3300048904 Bacteria 1469
1250 Ga0496101_0573894 3300048904 Bacteria 892
1251 Ga0496101_0997218 3300048904 Bacteria 659
1252 Ga0496101_1062950 3300048904 Bacteria 636
1253 Ga0496102_0027533 3300048905 Bacteria 5076
1254 Ga0496102_0652466 3300048905 Bacteria 975
1255 Ga0496104_0214747 3300048907 Bacteria 1835
1256 Ga0496104_0308141 3300048907 Bacteria 1496
1257 Ga0496105_0026211 3300048908 Bacteria 4753
1258 Ga0496105_0231209 3300048908 Bacteria 1503
1259 Ga0496105_0302639 3300048908 Bacteria 1285
1260 Ga0496105_1066228 3300048908 Bacteria 601
1261 Ga0496106_0010515 3300048909 Bacteria 6836
1262 Ga0496106_0125219 3300048909 Bacteria 2011
1263 Ga0496107_0007401 3300048910 Bacteria 7569
1264 Ga0496107_0373843 3300048910 Bacteria 1060
1265 Ga0496108_0028747 3300048911 Bacteria 4600
1266 Ga0496108_0216381 3300048911 Bacteria 1664
1267 Ga0496108_0332358 3300048911 Bacteria 1325
1268 Ga0496108_0378982 3300048911 Bacteria 1235
1269 Ga0496108_1201518 3300048911 Bacteria 641
1270 Ga0496109_0304524 3300048912 Bacteria 1503
1271 Ga0496109_1588787 3300048912 Bacteria 588
1272 Ga0496110_0031571 3300048913 Bacteria 4571
1273 Ga0496110_0297248 3300048913 Bacteria 1471
1274 Ga0496110_0938505 3300048913 Bacteria 772
1275 Ga0496111_0640031 3300048914 Bacteria 776
1276 Ga0496111_0913893 3300048914 Bacteria 632
1277 Ga0496112_0263917 3300048915 Bacteria 1671
1278 Ga0496113_0272336 3300048916 Bacteria 1353
1279 Ga0496113_0350661 3300048916 Bacteria 1184
1280 Ga0496114_0263997 3300048917 Bacteria 1516
1281 Ga0496114_0272685 3300048917 Bacteria 1491
1282 Ga0496114_0957620 3300048917 Bacteria 738
1283 Ga0496114_1025311 3300048917 Bacteria 709
1284 Ga0496115_0200731 3300048918 Bacteria 1647
1285 Ga0496121_0018192 3300048924 Bacteria 7102
1286 Ga0496123_0302375 3300048926 Bacteria 763
1287 Ga0496124_0071074 3300048927 Bacteria 2886
1288 Ga0496125_0006880 3300048928 Bacteria 12182
1289 Ga0496125_0137600 3300048928 Bacteria 1705
1290 Ga0496125_0361294 3300048928 Bacteria 863
1291 Ga0496126_0100589 3300048929 Bacteria 2530
1292 Ga0496126_0200834 3300048929 Bacteria 1684
1293 Ga0501309_016098 3300049129 Bacteria 1016
1294 Ga0501310_002487 3300049130 Bacteria 1754
1295 Ga0501305_009668 3300049161 Bacteria 1272
1296 Ga0501292_009653 3300049515 Bacteria 1435
1297 Ga0501293_015501 3300049516 Bacteria 702
1298 Ga0501294_005995 3300049517 Bacteria 1158
1299 Ga0501295_102340 3300049518 Bacteria 673
1300 Ga0501298_016579 3300049521 Bacteria 1337
1301 Ga0501301_011540 3300049524 Bacteria 739
1302 Ga0501303_007065 3300049526 Bacteria 993
1303 Ga0501312_032643 3300049528 Bacteria 823
1304 Ga0501312_078798 3300049528 Bacteria 594
1305 Ga0501313_011837 3300049529 Bacteria 1010
1306 Ga0501043_0000075 3300049579 Bacteria 86156
1307 Ga0501046_0000195 3300049580 Bacteria 62300
1308 Ga0501047_0000145 3300049581 Bacteria 86319
1309 Ga0501048_0000999 3300049582 Bacteria 21090
1310 Ga0501070_1001267 3300049586 Bacteria 648
1311 Ga0501198_000015 3300049649 Bacteria 102945
1312 Ga0501206_010361 3300049653 Bacteria 1248
1313 Ga0501207_019830 3300049654 Bacteria 1069
1314 Ga0501211_005166 3300049658 Bacteria 1313
1315 Ga0501217_146762 3300049661 Bacteria 702
1316 Ga0501222_000040 3300049662 Bacteria 49987
1317 Ga0501222_004797 3300049662 Bacteria 1838
1318 Ga0501222_059558 3300049662 Bacteria 575
1319 Ga0501223_018194 3300049663 Bacteria 1383
1320 Ga0501233_123583 3300049668 Bacteria 701
1321 Ga0501235_018965 3300049669 Bacteria 1525
1322 Ga0501249_009208 3300049679 Bacteria 2054
1323 Ga0501257_190349 3300049686 Bacteria 585
1324 Ga0501261_048038 3300049690 Bacteria 692
1325 Ga0501229_000012 3300049706 Bacteria 25765
1326 Ga0501245_035141 3300049708 Bacteria 843
1327 Ga0501079_0520663 3300049741 Bacteria 935
1328 Ga0501232_059792 3300049757 Bacteria 607
1329 Ga0501262_019485 3300049759 Bacteria 919
1330 Ga0501262_091132 3300049759 Bacteria 518
1331 Ga0501263_091079 3300049760 Bacteria 515
1332 Ga0501265_004388 3300049762 Bacteria 1605
1333 Ga0501269_048975 3300049766 Bacteria 578
1334 Ga0501272_001140 3300049769 Bacteria 2457
1335 Ga0501274_027674 3300049771 Bacteria 624
1336 Ga0501276_031686 3300049773 Bacteria 555
1337 Ga0501280_042545 3300049776 Bacteria 741
1338 Ga0501035_0067274 3300049822 Bacteria 3180
1339 Ga0501045_0010507 3300049824 Bacteria 6485
1340 Ga0501226_017971 3300049853 Bacteria 778
1341 nmdc:mga03683_118420_c1 3300050489 Bacteria 1176
1342 nmdc:mga03683_12560_c1 3300050489 Bacteria 3097
1343 nmdc:mga03683_18823_c1 3300050489 Bacteria 2631
1344 nmdc:mga03683_49338_c1 3300050489 Bacteria 1752
1345 nmdc:mga00v17_102345_c1 3300050491 Bacteria 1809
1346 nmdc:mga0k408_112983_c1 3300050493 Bacteria 1606
1347 nmdc:mga0k408_115773_c1 3300050493 Bacteria 1586
1348 nmdc:mga0k408_148_c1 3300050493 Bacteria 35989
1349 nmdc:mga0k408_157915_c1 3300050493 Bacteria 1351
1350 nmdc:mga0k408_187083_c1 3300050493 Bacteria 1235
1351 nmdc:mga0k408_199009_c1 3300050493 Bacteria 1196
1352 nmdc:mga0k408_204526_c1 3300050493 Bacteria 1179
1353 nmdc:mga0k408_20746_c1 3300050493 Bacteria 3686
1354 nmdc:mga0k408_209336_c1 3300050493 Bacteria 1164
1355 nmdc:mga0k408_228472_c1 3300050493 Bacteria 1111
1356 nmdc:mga0k408_2372_c1 3300050493 Bacteria 8674
1357 nmdc:mga0k408_2509_c1 3300050493 Bacteria 9764
1358 nmdc:mga0k408_26933_c1 3300050493 Bacteria 3262
1359 nmdc:mga0k408_283907_c1 3300050493 Bacteria 988
1360 nmdc:mga0k408_29340_c1 3300050493 Bacteria 3131
1361 nmdc:mga0k408_37851_c1 3300050493 Bacteria 2770
1362 nmdc:mga0k408_39980_c1 3300050493 Bacteria 2697
1363 nmdc:mga0k408_422366_c1 3300050493 Bacteria 793
1364 nmdc:mga0k408_48557_c1 3300050493 Bacteria 2456
1365 nmdc:mga0k408_565085_c1 3300050493 Bacteria 672
1366 nmdc:mga0k408_631204_c1 3300050493 Bacteria 631
1367 nmdc:mga0k408_69397_c1 3300050493 Bacteria 2057
1368 nmdc:mga0k408_7192_c1 3300050493 Bacteria 5951
1369 nmdc:mga0k408_816325_c1 3300050493 Bacteria 543
1370 nmdc:mga0k408_9250_c1 3300050493 Bacteria 5309
1371 nmdc:mga06z11_250734_c1 3300050494 Bacteria 1042
1372 nmdc:mga06z11_27747_c1 3300050494 Bacteria 2709
1373 nmdc:mga06z11_36995_c1 3300050494 Bacteria 2414
1374 nmdc:mga04h51_11416_c1 3300050495 Bacteria 2465
1375 nmdc:mga04h51_143940_c1 3300050495 Bacteria 906
1376 nmdc:mga07m45_141279_c1 3300050496 Bacteria 1395
1377 nmdc:mga07m45_1748_c1 3300050496 Bacteria 10008
1378 nmdc:mga07m45_17681_c1 3300050496 Bacteria 3835
1379 nmdc:mga07m45_195687_c1 3300050496 Bacteria 1176
1380 nmdc:mga07m45_207593_c1 3300050496 Bacteria 1140
1381 nmdc:mga07m45_219380_c1 3300050496 Bacteria 1106
1382 nmdc:mga07m45_26285_c1 3300050496 Bacteria 3199
1383 nmdc:mga07m45_454377_c1 3300050496 Bacteria 743
1384 nmdc:mga07m45_507282_c1 3300050496 Bacteria 698
1385 nmdc:mga07m45_5236_c1 3300050496 Bacteria 6439
1386 nmdc:mga07m45_569_c1 3300050496 Bacteria 5463
1387 nmdc:mga07m45_587096_c1 3300050496 Bacteria 644
1388 nmdc:mga07m45_637902_c1 3300050496 Bacteria 614
1389 nmdc:mga07m45_651412_c1 3300050496 Bacteria 607
1390 nmdc:mga07m45_9266_c1 3300050496 Bacteria 5097
1391 nmdc:mga05p37_1042262_c1 3300050507 Bacteria 864
1392 nmdc:mga09592_2500_c1 3300050508 Bacteria 14862
1393 nmdc:mga0qj67_687499_c1 3300050509 Bacteria 814
1394 nmdc:mga0rr50_598170_c1 3300050513 Bacteria 940
1395 nmdc:mga0sz30_223290_c1 3300050516 Bacteria 838
1396 nmdc:mga0sz30_485404_c1 3300050516 Bacteria 555
1397 nmdc:mga0sz30_93180_c1 3300050516 Bacteria 1312
1398 Ga0495601_0239039 3300053077 Bacteria 1186
1399 Ga0495612_0109920 3300053078 Bacteria 1179
1400 Ga0495612_0111159 3300053078 Bacteria 1173
1401 Ga0500635_0089445 3300053080 Bacteria 1118
1402 Ga0495595_0045883 3300053084 Bacteria 2011
1403 Ga0495619_0263687 3300053085 Bacteria 1194
1404 Ga0495619_1013021 3300053085 Bacteria 555
1405 Ga0500578_0000224 3300053086 Bacteria 70358
1406 Ga0500578_0050616 3300053086 Bacteria 2664
1407 Ga0500578_0299536 3300053086 Bacteria 954
1408 Ga0500643_034161 3300053087 Bacteria 1533
1409 Ga0500644_0010134 3300053088 Bacteria 2543
1410 Ga0500644_0120932 3300053088 Bacteria 1020
1411 Ga0500646_0004682 3300053090 Bacteria 3457
1412 Ga0500646_0164139 3300053090 Bacteria 743
1413 Ga0500583_0036759 3300053092 Bacteria 2195
1414 Ga0500583_0149970 3300053092 Bacteria 1160
1415 Ga0500651_0017559 3300053093 Bacteria 4417
1416 Ga0500651_0135489 3300053093 Bacteria 1487
1417 Ga0500651_0269812 3300053093 Bacteria 984
1418 Ga0500650_0082359 3300053098 Bacteria 1505
1419 Ga0500650_0114126 3300053098 Bacteria 1260
1420 Ga0500562_126507 3300053108 Bacteria 696
1421 Ga0500569_053929 3300053109 Bacteria 1221
1422 Ga0500593_000250 3300053117 Bacteria 22072
1423 Ga0500594_0016209 3300053118 Bacteria 1808
1424 Ga0500614_013639 3300053123 Bacteria 1789
1425 Ga0500628_002390 3300053129 Bacteria 3113
1426 Ga0500642_0007522 3300053130 Bacteria 3668
1427 Ga0500652_001099 3300053131 Bacteria 8722
1428 Ga0500652_033825 3300053131 Bacteria 2022
1429 Ga0500655_002874 3300053133 Bacteria 3128
1430 Ga0500655_042869 3300053133 Bacteria 890
1431 Ga0500658_0007909 3300053134 Bacteria 3929
1432 Ga0500658_0187077 3300053134 Bacteria 944
1433 Ga0500559_0000011 3300053136 Bacteria 164751
1434 Ga0500559_0126453 3300053136 Bacteria 1192
1435 Ga0500564_106111 3300053138 Bacteria 1237
1436 Ga0500568_0050224 3300053139 Bacteria 1644
1437 Ga0500577_0015015 3300053142 Bacteria 2409
1438 Ga0500577_0365620 3300053142 Bacteria 631
1439 Ga0500577_0397043 3300053142 Bacteria 603
1440 Ga0500579_189477 3300053143 Bacteria 788
1441 Ga0500589_123070 3300053147 Bacteria 1095
1442 Ga0500619_000143 3300053154 Bacteria 17415
1443 Ga0500619_012224 3300053154 Bacteria 2236
1444 Ga0500622_0001541 3300053156 Bacteria 18260
1445 Ga0500622_0001880 3300053156 Bacteria 15853
1446 Ga0500622_0009235 3300053156 Bacteria 5469
1447 Ga0500627_0322206 3300053158 Bacteria 671
1448 Ga0500636_0083939 3300053177 Bacteria 1832
1449 Ga0500637_0462678 3300053178 Bacteria 640
1450 Ga0500570_080325 3300053724 Bacteria 1473
1451 Ga0500570_083568 3300053724 Bacteria 1425
1452 Ga0500645_014572 3300053730 Bacteria 2502
1453 Ga0500645_096771 3300053730 Bacteria 834
1454 Ga0500587_000945 3300053739 Bacteria 3908
1455 Ga0500587_005067 3300053739 Bacteria 1786
1456 Ga0500661_106554 3300055283 Bacteria 535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0233952 Ga0436361_0233952_89_466 107
2 3300042876 Ga0451577_0001608 Ga0451577_0001608_10038_10412 107
3 3300045051 Ga0451576_0004508 Ga0451576_0004508_6322_6705 107
4 3300041496 Ga0451839_0134199 Ga0451839_0134199_59_451 110
5 3300046542 Ga0495597_0008922 Ga0495597_0008922_3635_4057 110
6 3300047443 Ga0495687_000636 Ga0495687_000636_4198_4620 110
7 3300005354 Ga0070675_100851828 Ga0070675_1008518281 114
8 3300005455 Ga0070663_100096616 Ga0070663_1000966162 114
9 3300005455 Ga0070663_100436341 Ga0070663_1004363412 114
10 3300005456 Ga0070678_100039403 Ga0070678_1000394032 114
11 3300005548 Ga0070665_101321897 Ga0070665_1013218972 114
12 3300005577 Ga0068857_100300894 Ga0068857_1003008943 114
13 3300006048 Ga0075363_100691326 Ga0075363_1006913262 114
14 3300006353 Ga0075370_10049848 Ga0075370_100498483 114
15 3300009093 Ga0105240_10020928 Ga0105240_100209287 114
16 3300009093 Ga0105240_10091540 Ga0105240_100915403 114
17 3300009545 Ga0105237_10010119 Ga0105237_100101199 114
18 3300009551 Ga0105238_10261763 Ga0105238_102617632 114
19 3300010375 Ga0105239_10000914 Ga0105239_1000091411 114
20 3300010375 Ga0105239_10253069 Ga0105239_102530693 114
21 3300010375 Ga0105239_13094518 Ga0105239_130945181 114
22 3300013308 Ga0157375_12140135 Ga0157375_121401351 114
23 3300025913 Ga0207695_10016280 Ga0207695_100162804 114
24 3300025913 Ga0207695_10637486 Ga0207695_106374862 114
25 3300025914 Ga0207671_10006390 Ga0207671_100063905 114
26 3300025923 Ga0207681_10279077 Ga0207681_102790772 114
27 3300025924 Ga0207694_10009034 Ga0207694_100090347 114
28 3300025933 Ga0207706_10507711 Ga0207706_105077112 114
29 3300025942 Ga0207689_10154252 Ga0207689_101542522 114
30 3300025981 Ga0207640_10570827 Ga0207640_105708272 114
31 3300026041 Ga0207639_10038242 Ga0207639_100382423 114
32 3300026041 Ga0207639_10062937 Ga0207639_100629372 114
33 3300026116 Ga0207674_10016738 Ga0207674_100167382 114
34 3300026121 Ga0207683_10052458 Ga0207683_100524583 114
35 3300026142 Ga0207698_10064769 Ga0207698_100647693 114
36 3300028379 Ga0268266_10242316 Ga0268266_102423163 114
37 3300028381 Ga0268264_10263534 Ga0268264_102635344 114
38 3300050493 nmdc:mga0k408_26933_c1 nmdc:mga0k408_26933_c1_1746_2168 114
39 3300034957 Ga0373938_0031692 Ga0373938_0031692_96_458 115
40 3300042876 Ga0451577_0009084 Ga0451577_0009084_4594_4986 115
41 3300044658 Ga0466972_0039081 Ga0466972_0039081_1609_2013 115
42 3300044683 Ga0466965_0212190 Ga0466965_0212190_276_680 115
43 3300044901 Ga0466960_0205627 Ga0466960_0205627_10_414 115
44 iso_pu_bacteria 2643221654 2644305083 115
45 3300005295 Ga0065707_10082794 Ga0065707_1008279410 116
46 3300005295 Ga0065707_10327756 Ga0065707_103277562 116
47 3300005334 Ga0068869_100138200 Ga0068869_1001382002 116
48 3300005335 Ga0070666_10542382 Ga0070666_105423821 116
49 3300005344 Ga0070661_100000791 Ga0070661_1000007913 116
50 3300005347 Ga0070668_100050350 Ga0070668_1000503502 116
51 3300005356 Ga0070674_100013715 Ga0070674_1000137152 116
52 3300005366 Ga0070659_100000451 Ga0070659_10000045121 116
53 3300005367 Ga0070667_100763566 Ga0070667_1007635662 116
54 3300005438 Ga0070701_11166487 Ga0070701_111664871 116
55 3300005455 Ga0070663_100627191 Ga0070663_1006271911 116
56 3300005456 Ga0070678_100809159 Ga0070678_1008091591 116
57 3300005457 Ga0070662_100199797 Ga0070662_1001997972 116
58 3300005459 Ga0068867_100024764 Ga0068867_1000247644 116
59 3300005467 Ga0070706_100894898 Ga0070706_1008948982 116
60 3300005543 Ga0070672_101237673 Ga0070672_1012376732 116
61 3300005545 Ga0070695_100895853 Ga0070695_1008958531 116
62 3300005564 Ga0070664_100000524 Ga0070664_1000005242 116
63 3300005617 Ga0068859_100617641 Ga0068859_1006176412 116
64 3300005718 Ga0068866_10029696 Ga0068866_100296962 116
65 3300005718 Ga0068866_10060240 Ga0068866_100602405 116
66 3300005719 Ga0068861_100007942 Ga0068861_1000079428 116
67 3300005719 Ga0068861_101679098 Ga0068861_1016790982 116
68 3300005840 Ga0068870_10349316 Ga0068870_103493162 116
69 3300005843 Ga0068860_100002243 Ga0068860_1000022437 116
70 3300005844 Ga0068862_100003264 Ga0068862_10000326413 116
71 3300005844 Ga0068862_100006660 Ga0068862_10000666010 116
72 3300006177 Ga0075362_10120485 Ga0075362_101204852 116
73 3300006195 Ga0075366_10011821 Ga0075366_100118215 116
74 3300006195 Ga0075366_10012199 Ga0075366_100121993 116
75 3300006195 Ga0075366_10053567 Ga0075366_100535672 116
76 3300006195 Ga0075366_10057998 Ga0075366_100579982 116
77 3300006881 Ga0068865_100036691 Ga0068865_1000366912 116
78 3300006881 Ga0068865_100532660 Ga0068865_1005326602 116
79 3300006931 Ga0097620_100617651 Ga0097620_1006176512 116
80 3300009094 Ga0111539_11587541 Ga0111539_115875412 116
81 3300009148 Ga0105243_10282955 Ga0105243_102829553 116
82 3300009148 Ga0105243_10691013 Ga0105243_106910131 116
83 3300009553 Ga0105249_10027380 Ga0105249_100273805 116
84 3300013297 Ga0157378_10013493 Ga0157378_100134934 116
85 3300013306 Ga0163162_10036220 Ga0163162_100362202 116
86 3300013308 Ga0157375_10204193 Ga0157375_102041933 116
87 3300014326 Ga0157380_11358176 Ga0157380_113581762 116
88 3300014968 Ga0157379_10212028 Ga0157379_102120283 116
89 3300014969 Ga0157376_10555117 Ga0157376_105551172 116
90 3300017792 Ga0163161_10040590 Ga0163161_100405902 116
91 3300025899 Ga0207642_10012484 Ga0207642_100124842 116
92 3300025899 Ga0207642_10052446 Ga0207642_100524465 116
93 3300025907 Ga0207645_10182418 Ga0207645_101824183 116
94 3300025908 Ga0207643_10996285 Ga0207643_109962851 116
95 3300025920 Ga0207649_10001484 Ga0207649_100014843 116
96 3300025923 Ga0207681_10192341 Ga0207681_101923412 116
97 3300025927 Ga0207687_11141610 Ga0207687_111416102 116
98 3300025932 Ga0207690_10002792 Ga0207690_100027929 116
99 3300025933 Ga0207706_10322887 Ga0207706_103228872 116
100 3300025935 Ga0207709_10300940 Ga0207709_103009402 116
101 3300025937 Ga0207669_10031788 Ga0207669_100317884 116
102 3300025938 Ga0207704_10026016 Ga0207704_100260163 116
103 3300025940 Ga0207691_10545743 Ga0207691_105457432 116
104 3300025942 Ga0207689_10126213 Ga0207689_101262132 116
105 3300025945 Ga0207679_10000220 Ga0207679_1000022015 116
106 3300025961 Ga0207712_10037266 Ga0207712_100372664 116
107 3300025972 Ga0207668_10083356 Ga0207668_100833562 116
108 3300025986 Ga0207658_10902915 Ga0207658_109029151 116
109 3300026067 Ga0207678_10528083 Ga0207678_105280832 116
110 3300026089 Ga0207648_10005680 Ga0207648_100056805 116
111 3300026118 Ga0207675_100014189 Ga0207675_1000141892 116
112 3300026118 Ga0207675_100115029 Ga0207675_1001150293 116
113 3300026121 Ga0207683_10133661 Ga0207683_101336612 116
114 3300028380 Ga0268265_10039299 Ga0268265_100392992 116
115 3300028381 Ga0268264_10072983 Ga0268264_100729834 116
116 3300031548 Ga0307408_101441961 Ga0307408_1014419611 116
117 3300035170 Ga0373943_0070104 Ga0373943_0070104_496_861 116
118 3300035410 Ga0373924_0503637 Ga0373924_0503637_124_489 116
119 3300042876 Ga0451577_1509607 Ga0451577_1509607_82_447 116
120 3300044712 Ga0453684_0007620 Ga0453684_0007620_14504_14866 116
121 3300044712 Ga0453684_0041964 Ga0453684_0041964_3293_3655 116
122 3300045051 Ga0451576_0226207 Ga0451576_0226207_809_1174 116
123 3300046535 Ga0495586_0159847 Ga0495586_0159847_309_674 116
124 3300047315 Ga0495581_0418620 Ga0495581_0418620_293_658 116
125 3300049579 Ga0501043_0000075 Ga0501043_0000075_29994_30356 116
126 3300049580 Ga0501046_0000195 Ga0501046_0000195_55866_56228 116
127 3300049581 Ga0501047_0000145 Ga0501047_0000145_29994_30356 116
128 3300049582 Ga0501048_0000999 Ga0501048_0000999_3303_3665 116
129 3300049741 Ga0501079_0520663 Ga0501079_0520663_254_619 116
130 3300049824 Ga0501045_0010507 Ga0501045_0010507_3015_3377 116
131 3300050489 nmdc:mga03683_49338_c1 nmdc:mga03683_49338_c1_1151_1513 116
132 3300050493 nmdc:mga0k408_228472_c1 nmdc:mga0k408_228472_c1_583_948 116
133 3300050493 nmdc:mga0k408_2509_c1 nmdc:mga0k408_2509_c1_609_971 116
134 3300050493 nmdc:mga0k408_39980_c1 nmdc:mga0k408_39980_c1_755_1120 116
135 3300050493 nmdc:mga0k408_9250_c1 nmdc:mga0k408_9250_c1_4342_4704 116
136 3300050509 nmdc:mga0qj67_687499_c1 nmdc:mga0qj67_687499_c1_204_569 116
137 3300003320 rootH2_10019535 rootH2_100195351 117
138 3300003322 rootL2_10005851 rootL2_100058513 117
139 3300003371 JGI26145J50221_1002180 JGI26145J50221_10021802 117
140 3300003771 Ga0055526_1001112 Ga0055526_10011127 117
141 3300003791 Ga0055530_10058995 Ga0055530_100589952 117
142 3300003794 Ga0055531_10046861 Ga0055531_100468612 117
143 3300004625 Ga0055543_1002155 Ga0055543_10021553 117
144 3300005262 Ga0065165_1000184 Ga0065165_100018448 117
145 3300005354 Ga0070675_101266567 Ga0070675_1012665671 117
146 3300005356 Ga0070674_100224261 Ga0070674_1002242612 117
147 3300005455 Ga0070663_100019349 Ga0070663_1000193496 117
148 3300005459 Ga0068867_100048865 Ga0068867_1000488653 117
149 3300006042 Ga0075368_10027258 Ga0075368_100272582 117
150 3300006042 Ga0075368_10469290 Ga0075368_104692902 117
151 3300006177 Ga0075362_10024416 Ga0075362_100244162 117
152 3300006177 Ga0075362_10118069 Ga0075362_101180692 117
153 3300006195 Ga0075366_10000953 Ga0075366_100009538 117
154 3300006195 Ga0075366_10016893 Ga0075366_100168938 117
155 3300006195 Ga0075366_10035903 Ga0075366_100359032 117
156 3300006195 Ga0075366_10109724 Ga0075366_101097241 117
157 3300006195 Ga0075366_10140401 Ga0075366_101404013 117
158 3300006195 Ga0075366_10343606 Ga0075366_103436062 117
159 3300006353 Ga0075370_10010826 Ga0075370_100108265 117
160 3300006353 Ga0075370_10433789 Ga0075370_104337892 117
161 3300006353 Ga0075370_10643318 Ga0075370_106433181 117
162 3300006846 Ga0075430_100025745 Ga0075430_1000257455 117
163 3300006880 Ga0075429_100034324 Ga0075429_1000343243 117
164 3300006881 Ga0068865_100625864 Ga0068865_1006258642 117
165 3300006944 Ga0099823_1000164 Ga0099823_10001649 117
166 3300009093 Ga0105240_10514691 Ga0105240_105146912 117
167 3300009093 Ga0105240_11999306 Ga0105240_119993061 117
168 3300009148 Ga0105243_10448998 Ga0105243_104489982 117
169 3300009176 Ga0105242_13280570 Ga0105242_132805701 117
170 3300011119 Ga0105246_11304357 Ga0105246_113043572 117
171 3300012497 Ga0157319_1000009 Ga0157319_100000957 117
172 3300013296 Ga0157374_10091743 Ga0157374_100917432 117
173 3300013297 Ga0157378_10234741 Ga0157378_102347413 117
174 3300014968 Ga0157379_10562367 Ga0157379_105623671 117
175 3300021361 Ga0213872_10002349 Ga0213872_100023498 117
176 3300025242 Ga0209258_120493 Ga0209258_1204932 117
177 3300025273 Ga0209673_1009744 Ga0209673_10097442 117
178 3300025295 Ga0209564_1000003 Ga0209564_1000003429 117
179 3300025298 Ga0209050_1006370 Ga0209050_10063703 117
180 3300025303 Ga0209051_1012833 Ga0209051_10128335 117
181 3300025304 Ga0209257_1005175 Ga0209257_10051753 117
182 3300025913 Ga0207695_10519502 Ga0207695_105195022 117
183 3300025926 Ga0207659_10985527 Ga0207659_109855272 117
184 3300025937 Ga0207669_10363569 Ga0207669_103635692 117
185 3300026067 Ga0207678_10268879 Ga0207678_102688792 117
186 3300026089 Ga0207648_10046362 Ga0207648_100463623 117
187 3300027296 Ga0209389_1037396 Ga0209389_10373965 117
188 3300027312 Ga0209371_1023370 Ga0209371_10233702 117
189 3300027682 Ga0209971_1044781 Ga0209971_10447812 117
190 3300027876 Ga0209974_10000044 Ga0209974_1000004421 117
191 3300030500 Ga0268256_1025964 Ga0268256_10259642 117
192 3300031456 Ga0307513_10017100 Ga0307513_100171004 117
193 3300031507 Ga0307509_10185497 Ga0307509_101854976 117
194 3300031548 Ga0307408_100018381 Ga0307408_1000183811 117
195 3300031911 Ga0307412_10981464 Ga0307412_109814641 117
196 3300032004 Ga0307414_10223977 Ga0307414_102239772 117
197 3300035171 Ga0373946_0320684 Ga0373946_0320684_331_726 117
198 3300035695 Ga0373927_0448564 Ga0373927_0448564_131_526 117
199 3300036401 Ga0373937_0162313 Ga0373937_0162313_1083_1445 117
200 3300037068 Ga0373925_0080994 Ga0373925_0080994_1363_1758 117
201 3300042011 Ga0439454_110360 Ga0439454_110360_110_481 117
202 3300042116 Ga0450912_031564 Ga0450912_031564_171_536 117
203 3300042121 Ga0450919_000285 Ga0450919_000285_5338_5736 117
204 3300042122 Ga0450920_055118 Ga0450920_055118_236_634 117
205 3300042127 Ga0450890_001839 Ga0450890_001839_843_1214 117
206 3300042134 Ga0450898_028272 Ga0450898_028272_138_533 117
207 3300042436 Ga0439435_0169373 Ga0439435_0169373_213_578 117
208 3300042437 Ga0439444_0022531 Ga0439444_0022531_266_637 117
209 3300042531 Ga0450918_000434 Ga0450918_000434_2676_3074 117
210 3300042532 Ga0450893_0077745 Ga0450893_0077745_117_482 117
211 3300044694 Ga0466963_0037909 Ga0466963_0037909_2473_2838 117
212 3300044712 Ga0453684_0242660 Ga0453684_0242660_376_750 117
213 3300045051 Ga0451576_0014073 Ga0451576_0014073_2784_3158 117
214 3300046691 Ga0495670_0081267 Ga0495670_0081267_150_515 117
215 3300048912 Ga0496109_1588787 Ga0496109_1588787_57_422 117
216 3300048924 Ga0496121_0018192 Ga0496121_0018192_3280_3651 117
217 3300048926 Ga0496123_0302375 Ga0496123_0302375_79_444 117
218 3300048927 Ga0496124_0071074 Ga0496124_0071074_1856_2221 117
219 3300048928 Ga0496125_0137600 Ga0496125_0137600_1317_1688 117
220 3300048929 Ga0496126_0100589 Ga0496126_0100589_610_975 117
221 3300050489 nmdc:mga03683_12560_c1 nmdc:mga03683_12560_c1_2081_2503 117
222 3300050493 nmdc:mga0k408_148_c1 nmdc:mga0k408_148_c1_31185_31607 117
223 3300050493 nmdc:mga0k408_199009_c1 nmdc:mga0k408_199009_c1_681_1043 117
224 3300050493 nmdc:mga0k408_20746_c1 nmdc:mga0k408_20746_c1_1606_1977 117
225 3300050493 nmdc:mga0k408_2372_c1 nmdc:mga0k408_2372_c1_989_1351 117
226 3300050495 nmdc:mga04h51_143940_c1 nmdc:mga04h51_143940_c1_115_537 117
227 3300050496 nmdc:mga07m45_454377_c1 nmdc:mga07m45_454377_c1_213_575 117
228 3300050496 nmdc:mga07m45_9266_c1 nmdc:mga07m45_9266_c1_879_1250 117
229 3300050508 nmdc:mga09592_2500_c1 nmdc:mga09592_2500_c1_8892_9260 117
230 3300053156 Ga0500622_0001541 Ga0500622_0001541_697_1062 117
231 3300003322 rootL2_10003847 rootL2_100038472 118
232 3300003323 rootH1_10108114 rootH1_101081141 118
233 3300005337 Ga0070682_101024262 Ga0070682_1010242621 118
234 3300005356 Ga0070674_100486718 Ga0070674_1004867182 118
235 3300005459 Ga0068867_100000102 Ga0068867_10000010236 118
236 3300005467 Ga0070706_100222505 Ga0070706_1002225052 118
237 3300005467 Ga0070706_101269687 Ga0070706_1012696871 118
238 3300005468 Ga0070707_101793977 Ga0070707_1017939771 118
239 3300005614 Ga0068856_101078255 Ga0068856_1010782552 118
240 3300005616 Ga0068852_100018700 Ga0068852_1000187002 118
241 3300005841 Ga0068863_100128349 Ga0068863_1001283492 118
242 3300005842 Ga0068858_100593919 Ga0068858_1005939192 118
243 3300005842 Ga0068858_100681293 Ga0068858_1006812932 118
244 3300006177 Ga0075362_10262805 Ga0075362_102628052 118
245 3300006186 Ga0075369_10541228 Ga0075369_105412281 118
246 3300006195 Ga0075366_10036799 Ga0075366_100367998 118
247 3300006195 Ga0075366_10084998 Ga0075366_100849982 118
248 3300006195 Ga0075366_10130981 Ga0075366_101309813 118
249 3300006195 Ga0075366_10216436 Ga0075366_102164362 118
250 3300006195 Ga0075366_10240109 Ga0075366_102401092 118
251 3300006353 Ga0075370_10011595 Ga0075370_100115955 118
252 3300006353 Ga0075370_10218808 Ga0075370_102188082 118
253 3300006353 Ga0075370_10409958 Ga0075370_104099582 118
254 3300006353 Ga0075370_10527534 Ga0075370_105275341 118
255 3300006931 Ga0097620_100709335 Ga0097620_1007093352 118
256 3300009148 Ga0105243_10001238 Ga0105243_100012389 118
257 3300012512 Ga0157327_1050875 Ga0157327_10508751 118
258 3300013306 Ga0163162_10632997 Ga0163162_106329972 118
259 3300014326 Ga0157380_10696184 Ga0157380_106961842 118
260 3300014745 Ga0157377_10000014 Ga0157377_1000001495 118
261 3300014968 Ga0157379_10053888 Ga0157379_100538884 118
262 3300021361 Ga0213872_10043062 Ga0213872_100430623 118
263 3300021361 Ga0213872_10251285 Ga0213872_102512852 118
264 3300025910 Ga0207684_10544836 Ga0207684_105448362 118
265 3300025935 Ga0207709_10000804 Ga0207709_1000080413 118
266 3300025937 Ga0207669_10458253 Ga0207669_104582532 118
267 3300025972 Ga0207668_10081814 Ga0207668_100818143 118
268 3300025972 Ga0207668_11135661 Ga0207668_111356612 118
269 3300026035 Ga0207703_11136695 Ga0207703_111366952 118
270 3300026078 Ga0207702_10880880 Ga0207702_108808802 118
271 3300026088 Ga0207641_10091665 Ga0207641_100916652 118
272 3300026089 Ga0207648_10000062 Ga0207648_1000006215 118
273 3300026142 Ga0207698_10055990 Ga0207698_100559902 118
274 3300028786 Ga0307517_10273449 Ga0307517_102734492 118
275 3300028794 Ga0307515_10032801 Ga0307515_100328017 118
276 3300028794 Ga0307515_10259736 Ga0307515_102597364 118
277 3300031456 Ga0307513_10115414 Ga0307513_101154142 118
278 3300031548 Ga0307408_100000010 Ga0307408_100000010311 118
279 3300031616 Ga0307508_10110633 Ga0307508_101106332 118
280 3300031731 Ga0307405_11960169 Ga0307405_119601691 118
281 3300031911 Ga0307412_10415390 Ga0307412_104153902 118
282 3300031995 Ga0307409_100382829 Ga0307409_1003828292 118
283 3300032002 Ga0307416_101647897 Ga0307416_1016478972 118
284 3300032002 Ga0307416_101921852 Ga0307416_1019218522 118
285 3300032005 Ga0307411_10001815 Ga0307411_100018158 118
286 3300032005 Ga0307411_10743021 Ga0307411_107430212 118
287 3300033179 Ga0307507_10023516 Ga0307507_100235167 118
288 3300033180 Ga0307510_10498148 Ga0307510_104981481 118
289 3300034820 Ga0373959_0046453 Ga0373959_0046453_40_408 118
290 3300035114 Ga0373939_0000272 Ga0373939_0000272_9180_9548 118
291 3300035242 Ga0373962_0006206 Ga0373962_0006206_1084_1452 118
292 3300035691 Ga0373931_0000665 Ga0373931_0000665_4273_4641 118
293 3300037471 Ga0395905_0012706 Ga0395905_0012706_805_1173 118
294 3300037471 Ga0395905_0053650 Ga0395905_0053650_1478_1843 118
295 3300039447 Ga0436361_0240417 Ga0436361_0240417_2148_2516 118
296 3300039447 Ga0436361_0996052 Ga0436361_0996052_707_1084 118
297 3300041410 Ga0439461_0127329 Ga0439461_0127329_261_629 118
298 3300041443 Ga0451789_1178356 Ga0451789_1178356_699_1070 118
299 3300041452 Ga0451793_1673427 Ga0451793_1673427_368_739 118
300 3300041453 Ga0451797_1036550 Ga0451797_1036550_237_599 118
301 3300041453 Ga0451797_1315304 Ga0451797_1315304_128_499 118
302 3300041456 Ga0451795_0139934 Ga0451795_0139934_61_432 118
303 3300041458 Ga0451798_0566853 Ga0451798_0566853_358_729 118
304 3300041491 Ga0451833_1494138 Ga0451833_1494138_210_578 118
305 3300041498 Ga0451841_0202568 Ga0451841_0202568_697_1068 118
306 3300041505 Ga0451849_0038608 Ga0451849_0038608_324_695 118
307 3300041507 Ga0451851_0476484 Ga0451851_0476484_93_464 118
308 3300041509 Ga0451843_0724857 Ga0451843_0724857_268_630 118
309 3300041509 Ga0451843_1037426 Ga0451843_1037426_87_458 118
310 3300042004 Ga0439445_0030673 Ga0439445_0030673_957_1325 118
311 3300042120 Ga0450917_000284 Ga0450917_000284_1257_1625 118
312 3300042126 Ga0450888_010596 Ga0450888_010596_333_701 118
313 3300042127 Ga0450890_001614 Ga0450890_001614_2222_2590 118
314 3300042129 Ga0450891_001574 Ga0450891_001574_1624_1992 118
315 3300042130 Ga0450892_001645 Ga0450892_001645_946_1314 118
316 3300042139 Ga0450904_014100 Ga0450904_014100_240_608 118
317 3300042144 Ga0450889_001274 Ga0450889_001274_665_1033 118
318 3300042532 Ga0450893_0006947 Ga0450893_0006947_683_1051 118
319 3300042876 Ga0451577_0292353 Ga0451577_0292353_804_1166 118
320 3300044658 Ga0466972_0013057 Ga0466972_0013057_293_691 118
321 3300044712 Ga0453684_0296619 Ga0453684_0296619_629_1003 118
322 3300044712 Ga0453684_2447925 Ga0453684_2447925_82_450 118
323 3300044735 Ga0466968_0086394 Ga0466968_0086394_312_713 118
324 3300044901 Ga0466960_0005145 Ga0466960_0005145_457_855 118
325 3300045051 Ga0451576_0040276 Ga0451576_0040276_3811_4179 118
326 3300045051 Ga0451576_0179084 Ga0451576_0179084_1764_2132 118
327 3300046457 Ga0495590_0088566 Ga0495590_0088566_354_773 118
328 3300046506 Ga0495583_0089971 Ga0495583_0089971_46_465 118
329 3300046512 Ga0495610_0005844 Ga0495610_0005844_8166_8537 118
330 3300046519 Ga0495632_0010763 Ga0495632_0010763_628_1047 118
331 3300046519 Ga0495632_0020823 Ga0495632_0020823_3130_3501 118
332 3300046522 Ga0495643_0158986 Ga0495643_0158986_649_1020 118
333 3300046524 Ga0495648_0455521 Ga0495648_0455521_103_522 118
334 3300046538 Ga0495609_0149509 Ga0495609_0149509_445_864 118
335 3300046616 Ga0495668_0813534 Ga0495668_0813534_18_437 118
336 3300046648 Ga0495611_0062211 Ga0495611_0062211_778_1197 118
337 3300046660 Ga0495625_0002174 Ga0495625_0002174_19300_19671 118
338 3300046660 Ga0495625_0004670 Ga0495625_0004670_1435_1854 118
339 3300046660 Ga0495625_0608088 Ga0495625_0608088_179_598 118
340 3300046692 Ga0495671_0248083 Ga0495671_0248083_241_642 118
341 3300046694 Ga0495649_0006798 Ga0495649_0006798_5503_5922 118
342 3300046810 Ga0495660_0020654 Ga0495660_0020654_1787_2206 118
343 3300048091 Ga0495626_0133152 Ga0495626_0133152_60_479 118
344 3300048909 Ga0496106_0125219 Ga0496106_0125219_1480_1878 118
345 3300048913 Ga0496110_0938505 Ga0496110_0938505_38_403 118
346 3300048917 Ga0496114_1025311 Ga0496114_1025311_68_436 118
347 3300049129 Ga0501309_016098 Ga0501309_016098_110_478 118
348 3300049130 Ga0501310_002487 Ga0501310_002487_606_974 118
349 3300049161 Ga0501305_009668 Ga0501305_009668_56_424 118
350 3300049515 Ga0501292_009653 Ga0501292_009653_390_758 118
351 3300049516 Ga0501293_015501 Ga0501293_015501_151_519 118
352 3300049517 Ga0501294_005995 Ga0501294_005995_74_442 118
353 3300049518 Ga0501295_102340 Ga0501295_102340_232_600 118
354 3300049521 Ga0501298_016579 Ga0501298_016579_586_954 118
355 3300049524 Ga0501301_011540 Ga0501301_011540_258_626 118
356 3300049526 Ga0501303_007065 Ga0501303_007065_386_754 118
357 3300049528 Ga0501312_032643 Ga0501312_032643_231_599 118
358 3300049529 Ga0501313_011837 Ga0501313_011837_27_395 118
359 3300049653 Ga0501206_010361 Ga0501206_010361_253_621 118
360 3300049654 Ga0501207_019830 Ga0501207_019830_349_717 118
361 3300049658 Ga0501211_005166 Ga0501211_005166_501_869 118
362 3300049661 Ga0501217_146762 Ga0501217_146762_93_461 118
363 3300049662 Ga0501222_004797 Ga0501222_004797_400_768 118
364 3300049663 Ga0501223_018194 Ga0501223_018194_843_1211 118
365 3300049668 Ga0501233_123583 Ga0501233_123583_224_592 118
366 3300049669 Ga0501235_018965 Ga0501235_018965_816_1184 118
367 3300049679 Ga0501249_009208 Ga0501249_009208_446_814 118
368 3300049686 Ga0501257_190349 Ga0501257_190349_15_383 118
369 3300049690 Ga0501261_048038 Ga0501261_048038_302_670 118
370 3300049706 Ga0501229_000012 Ga0501229_000012_150_518 118
371 3300049757 Ga0501232_059792 Ga0501232_059792_225_593 118
372 3300049759 Ga0501262_019485 Ga0501262_019485_269_637 118
373 3300049759 Ga0501262_091132 Ga0501262_091132_58_426 118
374 3300049766 Ga0501269_048975 Ga0501269_048975_155_523 118
375 3300049769 Ga0501272_001140 Ga0501272_001140_941_1309 118
376 3300049771 Ga0501274_027674 Ga0501274_027674_242_610 118
377 3300049773 Ga0501276_031686 Ga0501276_031686_44_412 118
378 3300049776 Ga0501280_042545 Ga0501280_042545_122_493 118
379 3300050493 nmdc:mga0k408_112983_c1 nmdc:mga0k408_112983_c1_818_1186 118
380 3300050493 nmdc:mga0k408_187083_c1 nmdc:mga0k408_187083_c1_735_1106 118
381 3300050493 nmdc:mga0k408_204526_c1 nmdc:mga0k408_204526_c1_525_893 118
382 3300050493 nmdc:mga0k408_209336_c1 nmdc:mga0k408_209336_c1_722_1090 118
383 3300050493 nmdc:mga0k408_283907_c1 nmdc:mga0k408_283907_c1_262_627 118
384 3300050493 nmdc:mga0k408_29340_c1 nmdc:mga0k408_29340_c1_2314_2685 118
385 3300050493 nmdc:mga0k408_631204_c1 nmdc:mga0k408_631204_c1_103_471 118
386 3300050493 nmdc:mga0k408_69397_c1 nmdc:mga0k408_69397_c1_414_785 118
387 3300050493 nmdc:mga0k408_816325_c1 nmdc:mga0k408_816325_c1_122_484 118
388 3300050494 nmdc:mga06z11_250734_c1 nmdc:mga06z11_250734_c1_465_836 118
389 3300050496 nmdc:mga07m45_141279_c1 nmdc:mga07m45_141279_c1_603_974 118
390 3300050496 nmdc:mga07m45_195687_c1 nmdc:mga07m45_195687_c1_95_463 118
391 3300050496 nmdc:mga07m45_207593_c1 nmdc:mga07m45_207593_c1_728_1099 118
392 3300050496 nmdc:mga07m45_5236_c1 nmdc:mga07m45_5236_c1_5096_5464 118
393 3300050496 nmdc:mga07m45_569_c1 nmdc:mga07m45_569_c1_47_466 118
394 3300050516 nmdc:mga0sz30_485404_c1 nmdc:mga0sz30_485404_c1_149_520 118
395 3300053086 Ga0500578_0050616 Ga0500578_0050616_914_1312 118
396 3300053086 Ga0500578_0299536 Ga0500578_0299536_385_804 118
397 3300053117 Ga0500593_000250 Ga0500593_000250_3566_3931 118
398 3300053134 Ga0500658_0007909 Ga0500658_0007909_3313_3732 118
399 3300053142 Ga0500577_0365620 Ga0500577_0365620_188_559 118
400 3300053142 Ga0500577_0397043 Ga0500577_0397043_150_569 118
401 3300053724 Ga0500570_083568 Ga0500570_083568_154_525 118
402 3300053730 Ga0500645_014572 Ga0500645_014572_997_1395 118
403 3300053739 Ga0500587_000945 Ga0500587_000945_1691_2062 118
404 3300003215 JGI25153J46596_10030106 JGI25153J46596_100301062 119
405 3300003316 rootH1_10062755 rootH1_100627552 119
406 3300003792 Ga0055540_1112627 Ga0055540_11126271 119
407 3300005262 Ga0065165_1006209 Ga0065165_10062093 119
408 3300005293 Ga0065715_10493371 Ga0065715_104933712 119
409 3300005295 Ga0065707_10422887 Ga0065707_104228872 119
410 3300005328 Ga0070676_10151549 Ga0070676_101515494 119
411 3300005330 Ga0070690_100016127 Ga0070690_1000161274 119
412 3300005331 Ga0070670_100034250 Ga0070670_1000342501 119
413 3300005334 Ga0068869_100230986 Ga0068869_1002309862 119
414 3300005335 Ga0070666_10058891 Ga0070666_100588913 119
415 3300005337 Ga0070682_100040490 Ga0070682_1000404902 119
416 3300005338 Ga0068868_100019252 Ga0068868_1000192524 119
417 3300005338 Ga0068868_100193168 Ga0068868_1001931684 119
418 3300005338 Ga0068868_100327318 Ga0068868_1003273182 119
419 3300005340 Ga0070689_100147818 Ga0070689_1001478182 119
420 3300005340 Ga0070689_102135811 Ga0070689_1021358111 119
421 3300005347 Ga0070668_100367400 Ga0070668_1003674002 119
422 3300005354 Ga0070675_100000269 Ga0070675_10000026934 119
423 3300005355 Ga0070671_100021062 Ga0070671_1000210626 119
424 3300005355 Ga0070671_100232448 Ga0070671_1002324483 119
425 3300005355 Ga0070671_101263473 Ga0070671_1012634732 119
426 3300005367 Ga0070667_100003333 Ga0070667_1000033334 119
427 3300005367 Ga0070667_100087470 Ga0070667_1000874703 119
428 3300005367 Ga0070667_100576390 Ga0070667_1005763901 119
429 3300005367 Ga0070667_100893616 Ga0070667_1008936162 119
430 3300005441 Ga0070700_100131463 Ga0070700_1001314632 119
431 3300005456 Ga0070678_100018712 Ga0070678_1000187125 119
432 3300005456 Ga0070678_100581749 Ga0070678_1005817492 119
433 3300005459 Ga0068867_100021121 Ga0068867_1000211213 119
434 3300005459 Ga0068867_100256542 Ga0068867_1002565423 119
435 3300005539 Ga0068853_100672118 Ga0068853_1006721182 119
436 3300005543 Ga0070672_100070307 Ga0070672_1000703072 119
437 3300005543 Ga0070672_100076494 Ga0070672_1000764942 119
438 3300005543 Ga0070672_100126183 Ga0070672_1001261832 119
439 3300005544 Ga0070686_100584919 Ga0070686_1005849192 119
440 3300005548 Ga0070665_100197332 Ga0070665_1001973322 119
441 3300005548 Ga0070665_101042928 Ga0070665_1010429282 119
442 3300005548 Ga0070665_101238790 Ga0070665_1012387902 119
443 3300005616 Ga0068852_100217237 Ga0068852_1002172372 119
444 3300005616 Ga0068852_102020113 Ga0068852_1020201132 119
445 3300005617 Ga0068859_100166319 Ga0068859_1001663192 119
446 3300005618 Ga0068864_100045025 Ga0068864_1000450252 119
447 3300005618 Ga0068864_100351616 Ga0068864_1003516162 119
448 3300005618 Ga0068864_101506658 Ga0068864_1015066582 119
449 3300005718 Ga0068866_10083662 Ga0068866_100836622 119
450 3300005719 Ga0068861_100273857 Ga0068861_1002738572 119
451 3300005834 Ga0068851_10053755 Ga0068851_100537552 119
452 3300005841 Ga0068863_100029644 Ga0068863_1000296442 119
453 3300005841 Ga0068863_100097913 Ga0068863_1000979132 119
454 3300005842 Ga0068858_100012867 Ga0068858_1000128675 119
455 3300005843 Ga0068860_100058883 Ga0068860_1000588833 119
456 3300005843 Ga0068860_102398962 Ga0068860_1023989622 119
457 3300005844 Ga0068862_100289662 Ga0068862_1002896622 119
458 3300006038 Ga0075365_10071131 Ga0075365_100711312 119
459 3300006042 Ga0075368_10132483 Ga0075368_101324832 119
460 3300006048 Ga0075363_100017431 Ga0075363_1000174313 119
461 3300006177 Ga0075362_10015137 Ga0075362_100151373 119
462 3300006178 Ga0075367_10106569 Ga0075367_101065692 119
463 3300006178 Ga0075367_10540917 Ga0075367_105409172 119
464 3300006186 Ga0075369_10158584 Ga0075369_101585842 119
465 3300006195 Ga0075366_10032816 Ga0075366_100328162 119
466 3300006195 Ga0075366_10177719 Ga0075366_101777192 119
467 3300006195 Ga0075366_10733945 Ga0075366_107339452 119
468 3300006237 Ga0097621_100474969 Ga0097621_1004749692 119
469 3300006353 Ga0075370_10038797 Ga0075370_100387972 119
470 3300006353 Ga0075370_10094627 Ga0075370_100946271 119
471 3300006353 Ga0075370_10654221 Ga0075370_106542211 119
472 3300006880 Ga0075429_101789318 Ga0075429_1017893181 119
473 3300006881 Ga0068865_100125124 Ga0068865_1001251242 119
474 3300006881 Ga0068865_100188351 Ga0068865_1001883513 119
475 3300006931 Ga0097620_100166332 Ga0097620_1001663322 119
476 3300009093 Ga0105240_11916636 Ga0105240_119166362 119
477 3300009098 Ga0105245_10004781 Ga0105245_1000478112 119
478 3300009098 Ga0105245_10848886 Ga0105245_108488862 119
479 3300009176 Ga0105242_10078680 Ga0105242_100786802 119
480 3300009177 Ga0105248_10025146 Ga0105248_100251464 119
481 3300009553 Ga0105249_10022012 Ga0105249_100220121 119
482 3300010375 Ga0105239_11107013 Ga0105239_111070132 119
483 3300011119 Ga0105246_11406569 Ga0105246_114065691 119
484 3300013100 Ga0157373_11048390 Ga0157373_110483901 119
485 3300013296 Ga0157374_10109095 Ga0157374_101090952 119
486 3300013297 Ga0157378_10206658 Ga0157378_102066582 119
487 3300013306 Ga0163162_10050457 Ga0163162_100504571 119
488 3300013306 Ga0163162_10603819 Ga0163162_106038192 119
489 3300013308 Ga0157375_10014610 Ga0157375_100146102 119
490 3300013308 Ga0157375_10132410 Ga0157375_101324101 119
491 3300013308 Ga0157375_11827134 Ga0157375_118271342 119
492 3300014325 Ga0163163_10000864 Ga0163163_1000086426 119
493 3300014745 Ga0157377_10709345 Ga0157377_107093451 119
494 3300014968 Ga0157379_10031149 Ga0157379_100311494 119
495 3300014968 Ga0157379_10077404 Ga0157379_100774042 119
496 3300014968 Ga0157379_10412328 Ga0157379_104123282 119
497 3300014969 Ga0157376_10135295 Ga0157376_101352952 119
498 3300017792 Ga0163161_10268707 Ga0163161_102687072 119
499 3300025258 Ga0209129_1026616 Ga0209129_10266162 119
500 3300025271 Ga0207666_1048305 Ga0207666_10483052 119
501 3300025273 Ga0209673_1012171 Ga0209673_10121712 119
502 3300025297 Ga0209758_1000207 Ga0209758_100020767 119
503 3300025298 Ga0209050_1000858 Ga0209050_100085831 119
504 3300025299 Ga0209256_1031332 Ga0209256_10313322 119
505 3300025303 Ga0209051_1043460 Ga0209051_10434602 119
506 3300025304 Ga0209257_1153677 Ga0209257_11536771 119
507 3300025321 Ga0207656_10127880 Ga0207656_101278802 119
508 3300025903 Ga0207680_10041270 Ga0207680_100412703 119
509 3300025903 Ga0207680_10586460 Ga0207680_105864602 119
510 3300025923 Ga0207681_10466410 Ga0207681_104664102 119
511 3300025925 Ga0207650_10103958 Ga0207650_101039582 119
512 3300025926 Ga0207659_10004306 Ga0207659_100043067 119
513 3300025927 Ga0207687_10280279 Ga0207687_102802792 119
514 3300025927 Ga0207687_10506091 Ga0207687_105060912 119
515 3300025931 Ga0207644_10014021 Ga0207644_100140213 119
516 3300025931 Ga0207644_10057347 Ga0207644_100573474 119
517 3300025931 Ga0207644_11520441 Ga0207644_115204412 119
518 3300025934 Ga0207686_10076296 Ga0207686_100762962 119
519 3300025936 Ga0207670_10120453 Ga0207670_101204532 119
520 3300025936 Ga0207670_11767725 Ga0207670_117677252 119
521 3300025937 Ga0207669_10147654 Ga0207669_101476542 119
522 3300025938 Ga0207704_10133576 Ga0207704_101335762 119
523 3300025938 Ga0207704_10455008 Ga0207704_104550082 119
524 3300025938 Ga0207704_10471995 Ga0207704_104719952 119
525 3300025940 Ga0207691_10214760 Ga0207691_102147602 119
526 3300025941 Ga0207711_10036125 Ga0207711_100361253 119
527 3300025942 Ga0207689_10187388 Ga0207689_101873882 119
528 3300025942 Ga0207689_10276067 Ga0207689_102760673 119
529 3300025961 Ga0207712_10485526 Ga0207712_104855261 119
530 3300025972 Ga0207668_10130917 Ga0207668_101309172 119
531 3300025986 Ga0207658_10002329 Ga0207658_100023298 119
532 3300025986 Ga0207658_10751053 Ga0207658_107510532 119
533 3300026023 Ga0207677_10010920 Ga0207677_100109203 119
534 3300026023 Ga0207677_10064331 Ga0207677_100643312 119
535 3300026023 Ga0207677_10305442 Ga0207677_103054424 119
536 3300026041 Ga0207639_11219935 Ga0207639_112199351 119
537 3300026088 Ga0207641_10022787 Ga0207641_100227872 119
538 3300026088 Ga0207641_10050442 Ga0207641_100504422 119
539 3300026089 Ga0207648_10155583 Ga0207648_101555833 119
540 3300026089 Ga0207648_10299880 Ga0207648_102998802 119
541 3300026089 Ga0207648_10376683 Ga0207648_103766833 119
542 3300026095 Ga0207676_10027995 Ga0207676_100279952 119
543 3300026095 Ga0207676_10042173 Ga0207676_100421734 119
544 3300026116 Ga0207674_10251500 Ga0207674_102515002 119
545 3300026121 Ga0207683_10012322 Ga0207683_100123226 119
546 3300026121 Ga0207683_10316180 Ga0207683_103161802 119
547 3300026142 Ga0207698_10684324 Ga0207698_106843242 119
548 3300026142 Ga0207698_10743730 Ga0207698_107437302 119
549 3300027866 Ga0209813_10009766 Ga0209813_100097662 119
550 3300028379 Ga0268266_10129746 Ga0268266_101297464 119
551 3300028379 Ga0268266_11030168 Ga0268266_110301682 119
552 3300028379 Ga0268266_11263554 Ga0268266_112635542 119
553 3300028380 Ga0268265_10624783 Ga0268265_106247831 119
554 3300028380 Ga0268265_11008029 Ga0268265_110080293 119
555 3300028381 Ga0268264_10241607 Ga0268264_102416072 119
556 3300028381 Ga0268264_11375056 Ga0268264_113750561 119
557 3300028786 Ga0307517_10118579 Ga0307517_101185792 119
558 3300028786 Ga0307517_10410674 Ga0307517_104106741 119
559 3300028794 Ga0307515_10064599 Ga0307515_100645992 119
560 3300028794 Ga0307515_10096842 Ga0307515_100968422 119
561 3300028794 Ga0307515_10216175 Ga0307515_102161754 119
562 3300031456 Ga0307513_10124857 Ga0307513_101248571 119
563 3300031507 Ga0307509_10212909 Ga0307509_102129092 119
564 3300031548 Ga0307408_100400521 Ga0307408_1004005212 119
565 3300031548 Ga0307408_101204470 Ga0307408_1012044702 119
566 3300031730 Ga0307516_10294015 Ga0307516_102940153 119
567 3300031903 Ga0307407_11439400 Ga0307407_114394002 119
568 3300031911 Ga0307412_10134374 Ga0307412_101343742 119
569 3300031995 Ga0307409_100529484 Ga0307409_1005294842 119
570 3300032002 Ga0307416_100475036 Ga0307416_1004750362 119
571 3300033180 Ga0307510_10051426 Ga0307510_100514264 119
572 3300037471 Ga0395905_0811662 Ga0395905_0811662_345_731 119
573 3300041410 Ga0439461_0059791 Ga0439461_0059791_436_798 119
574 3300041413 Ga0439465_0338149 Ga0439465_0338149_152_514 119
575 3300041453 Ga0451797_0278276 Ga0451797_0278276_170_538 119
576 3300041456 Ga0451795_0059148 Ga0451795_0059148_30_401 119
577 3300041456 Ga0451795_0394184 Ga0451795_0394184_519_887 119
578 3300041458 Ga0451798_1166708 Ga0451798_1166708_92_460 119
579 3300041460 Ga0451802_0175899 Ga0451802_0175899_727_1095 119
580 3300041463 Ga0451804_0031720 Ga0451804_0031720_393_761 119
581 3300041463 Ga0451804_0695359 Ga0451804_0695359_53_475 119
582 3300041486 Ga0451807_0592901 Ga0451807_0592901_168_536 119
583 3300041501 Ga0451845_0177849 Ga0451845_0177849_65_433 119
584 3300041507 Ga0451851_0007129 Ga0451851_0007129_57_425 119
585 3300041509 Ga0451843_1577317 Ga0451843_1577317_126_494 119
586 3300041512 Ga0451853_3908419 Ga0451853_3908419_287_655 119
587 3300041999 Ga0439433_0025071 Ga0439433_0025071_340_726 119
588 3300042008 Ga0439450_073815 Ga0439450_073815_353_739 119
589 3300042012 Ga0439455_0049240 Ga0439455_0049240_34_396 119
590 3300042126 Ga0450888_005886 Ga0450888_005886_569_931 119
591 3300042134 Ga0450898_019707 Ga0450898_019707_647_1033 119
592 3300042134 Ga0450898_042079 Ga0450898_042079_304_666 119
593 3300042157 Ga0439458_0046384 Ga0439458_0046384_169_531 119
594 3300042532 Ga0450893_0030477 Ga0450893_0030477_439_801 119
595 3300042876 Ga0451577_0379735 Ga0451577_0379735_139_501 119
596 3300044684 Ga0466966_0041477 Ga0466966_0041477_18_416 119
597 3300045051 Ga0451576_0067461 Ga0451576_0067461_2448_2810 119
598 3300045051 Ga0451576_0357938 Ga0451576_0357938_495_857 119
599 3300046454 Ga0495592_0000295 Ga0495592_0000295_30924_31328 119
600 3300046515 Ga0495620_0083960 Ga0495620_0083960_329_733 119
601 3300046524 Ga0495648_0163679 Ga0495648_0163679_635_1036 119
602 3300046616 Ga0495668_0148343 Ga0495668_0148343_116_514 119
603 3300046692 Ga0495671_0142081 Ga0495671_0142081_681_1079 119
604 3300047318 Ga0495636_0280313 Ga0495636_0280313_216_578 119
605 3300047472 Ga0495686_0002900 Ga0495686_0002900_13585_13956 119
606 3300047472 Ga0495686_0069329 Ga0495686_0069329_1285_1689 119
607 3300048911 Ga0496108_0028747 Ga0496108_0028747_392_754 119
608 3300048916 Ga0496113_0350661 Ga0496113_0350661_617_1027 119
609 3300049528 Ga0501312_078798 Ga0501312_078798_121_525 119
610 3300049586 Ga0501070_1001267 Ga0501070_1001267_77_439 119
611 3300049662 Ga0501222_059558 Ga0501222_059558_136_498 119
612 3300049760 Ga0501263_091079 Ga0501263_091079_75_449 119
613 3300049762 Ga0501265_004388 Ga0501265_004388_642_1013 119
614 3300049853 Ga0501226_017971 Ga0501226_017971_213_575 119
615 3300050489 nmdc:mga03683_118420_c1 nmdc:mga03683_118420_c1_385_753 119
616 3300050489 nmdc:mga03683_18823_c1 nmdc:mga03683_18823_c1_1322_1744 119
617 3300050491 nmdc:mga00v17_102345_c1 nmdc:mga00v17_102345_c1_675_1043 119
618 3300050493 nmdc:mga0k408_115773_c1 nmdc:mga0k408_115773_c1_723_1145 119
619 3300050493 nmdc:mga0k408_157915_c1 nmdc:mga0k408_157915_c1_204_575 119
620 3300050493 nmdc:mga0k408_48557_c1 nmdc:mga0k408_48557_c1_1180_1548 119
621 3300050493 nmdc:mga0k408_7192_c1 nmdc:mga0k408_7192_c1_3065_3487 119
622 3300050494 nmdc:mga06z11_27747_c1 nmdc:mga06z11_27747_c1_275_697 119
623 3300050494 nmdc:mga06z11_36995_c1 nmdc:mga06z11_36995_c1_1723_2091 119
624 3300050495 nmdc:mga04h51_11416_c1 nmdc:mga04h51_11416_c1_1677_2099 119
625 3300050496 nmdc:mga07m45_1748_c1 nmdc:mga07m45_1748_c1_3291_3713 119
626 3300050496 nmdc:mga07m45_17681_c1 nmdc:mga07m45_17681_c1_2365_2733 119
627 3300050496 nmdc:mga07m45_637902_c1 nmdc:mga07m45_637902_c1_191_589 119
628 3300050516 nmdc:mga0sz30_223290_c1 nmdc:mga0sz30_223290_c1_263_685 119
629 3300050516 nmdc:mga0sz30_93180_c1 nmdc:mga0sz30_93180_c1_622_990 119
630 3300053080 Ga0500635_0089445 Ga0500635_0089445_273_641 119
631 3300053086 Ga0500578_0000224 Ga0500578_0000224_37986_38354 119
632 3300053087 Ga0500643_034161 Ga0500643_034161_347_715 119
633 3300053088 Ga0500644_0010134 Ga0500644_0010134_1790_2194 119
634 3300053088 Ga0500644_0120932 Ga0500644_0120932_529_897 119
635 3300053090 Ga0500646_0004682 Ga0500646_0004682_26_394 119
636 3300053092 Ga0500583_0149970 Ga0500583_0149970_167_535 119
637 3300053093 Ga0500651_0017559 Ga0500651_0017559_145_549 119
638 3300053093 Ga0500651_0135489 Ga0500651_0135489_945_1313 119
639 3300053098 Ga0500650_0114126 Ga0500650_0114126_672_1040 119
640 3300053108 Ga0500562_126507 Ga0500562_126507_109_477 119
641 3300053109 Ga0500569_053929 Ga0500569_053929_748_1116 119
642 3300053118 Ga0500594_0016209 Ga0500594_0016209_926_1330 119
643 3300053123 Ga0500614_013639 Ga0500614_013639_370_774 119
644 3300053129 Ga0500628_002390 Ga0500628_002390_329_697 119
645 3300053130 Ga0500642_0007522 Ga0500642_0007522_2449_2817 119
646 3300053131 Ga0500652_001099 Ga0500652_001099_3211_3579 119
647 3300053133 Ga0500655_002874 Ga0500655_002874_2319_2687 119
648 3300053133 Ga0500655_042869 Ga0500655_042869_168_572 119
649 3300053134 Ga0500658_0187077 Ga0500658_0187077_422_790 119
650 3300053136 Ga0500559_0000011 Ga0500559_0000011_157791_158195 119
651 3300053138 Ga0500564_106111 Ga0500564_106111_590_994 119
652 3300053139 Ga0500568_0050224 Ga0500568_0050224_891_1259 119
653 3300053142 Ga0500577_0015015 Ga0500577_0015015_394_762 119
654 3300053143 Ga0500579_189477 Ga0500579_189477_360_728 119
655 3300053147 Ga0500589_123070 Ga0500589_123070_532_900 119
656 3300053154 Ga0500619_000143 Ga0500619_000143_11018_11386 119
657 3300053154 Ga0500619_012224 Ga0500619_012224_1362_1766 119
658 3300053156 Ga0500622_0001880 Ga0500622_0001880_13449_13853 119
659 3300053156 Ga0500622_0009235 Ga0500622_0009235_3742_4110 119
660 3300053158 Ga0500627_0322206 Ga0500627_0322206_239_607 119
661 3300053177 Ga0500636_0083939 Ga0500636_0083939_585_989 119
662 3300053178 Ga0500637_0462678 Ga0500637_0462678_61_429 119
663 3300053724 Ga0500570_080325 Ga0500570_080325_780_1148 119
664 3300053730 Ga0500645_096771 Ga0500645_096771_72_440 119
665 3300053739 Ga0500587_005067 Ga0500587_005067_321_725 119
666 3300055283 Ga0500661_106554 Ga0500661_106554_129_497 119
667 3300002774 JGI25150J39212_1006308 JGI25150J39212_10063084 120
668 3300003215 JGI25153J46596_10009043 JGI25153J46596_100090432 120
669 3300003323 rootH1_10023641 rootH1_100236412 120
670 3300003792 Ga0055540_1022368 Ga0055540_10223682 120
671 3300003794 Ga0055531_10001930 Ga0055531_1000193013 120
672 3300005293 Ga0065715_10121665 Ga0065715_101216652 120
673 3300005293 Ga0065715_10195151 Ga0065715_101951512 120
674 3300005295 Ga0065707_10568002 Ga0065707_105680021 120
675 3300005327 Ga0070658_10085385 Ga0070658_100853854 120
676 3300005327 Ga0070658_10255739 Ga0070658_102557394 120
677 3300005328 Ga0070676_10002035 Ga0070676_100020357 120
678 3300005328 Ga0070676_10088789 Ga0070676_100887891 120
679 3300005328 Ga0070676_10167278 Ga0070676_101672782 120
680 3300005328 Ga0070676_10443337 Ga0070676_104433371 120
681 3300005328 Ga0070676_11619813 Ga0070676_116198131 120
682 3300005329 Ga0070683_100049615 Ga0070683_1000496152 120
683 3300005329 Ga0070683_101356018 Ga0070683_1013560182 120
684 3300005330 Ga0070690_100020915 Ga0070690_1000209155 120
685 3300005331 Ga0070670_100001136 Ga0070670_1000011364 120
686 3300005331 Ga0070670_100065307 Ga0070670_1000653072 120
687 3300005331 Ga0070670_100379370 Ga0070670_1003793702 120
688 3300005331 Ga0070670_100417662 Ga0070670_1004176622 120
689 3300005331 Ga0070670_100842064 Ga0070670_1008420642 120
690 3300005331 Ga0070670_101220447 Ga0070670_1012204472 120
691 3300005331 Ga0070670_101945992 Ga0070670_1019459921 120
692 3300005331 Ga0070670_102100816 Ga0070670_1021008161 120
693 3300005333 Ga0070677_10046190 Ga0070677_100461902 120
694 3300005333 Ga0070677_10051350 Ga0070677_100513501 120
695 3300005333 Ga0070677_10140396 Ga0070677_101403962 120
696 3300005333 Ga0070677_10558075 Ga0070677_105580751 120
697 3300005334 Ga0068869_100003616 Ga0068869_1000036165 120
698 3300005334 Ga0068869_100013951 Ga0068869_1000139515 120
699 3300005334 Ga0068869_100084261 Ga0068869_1000842612 120
700 3300005335 Ga0070666_10051060 Ga0070666_100510602 120
701 3300005335 Ga0070666_10402295 Ga0070666_104022952 120
702 3300005335 Ga0070666_10799652 Ga0070666_107996521 120
703 3300005336 Ga0070680_100656390 Ga0070680_1006563901 120
704 3300005338 Ga0068868_100000818 Ga0068868_1000008181 120
705 3300005338 Ga0068868_100014677 Ga0068868_1000146772 120
706 3300005338 Ga0068868_100035823 Ga0068868_1000358232 120
707 3300005338 Ga0068868_100132399 Ga0068868_1001323991 120
708 3300005338 Ga0068868_101203844 Ga0068868_1012038441 120
709 3300005339 Ga0070660_100046927 Ga0070660_1000469273 120
710 3300005339 Ga0070660_100168309 Ga0070660_1001683091 120
711 3300005339 Ga0070660_100822386 Ga0070660_1008223861 120
712 3300005340 Ga0070689_100391053 Ga0070689_1003910532 120
713 3300005341 Ga0070691_10912387 Ga0070691_109123871 120
714 3300005343 Ga0070687_101180020 Ga0070687_1011800202 120
715 3300005344 Ga0070661_100020436 Ga0070661_1000204364 120
716 3300005344 Ga0070661_100061356 Ga0070661_1000613564 120
717 3300005344 Ga0070661_100084411 Ga0070661_1000844111 120
718 3300005344 Ga0070661_100309400 Ga0070661_1003094002 120
719 3300005347 Ga0070668_101635463 Ga0070668_1016354631 120
720 3300005353 Ga0070669_100119297 Ga0070669_1001192972 120
721 3300005353 Ga0070669_100124487 Ga0070669_1001244871 120
722 3300005353 Ga0070669_100391317 Ga0070669_1003913173 120
723 3300005353 Ga0070669_100527011 Ga0070669_1005270112 120
724 3300005353 Ga0070669_100579569 Ga0070669_1005795692 120
725 3300005353 Ga0070669_100636036 Ga0070669_1006360362 120
726 3300005354 Ga0070675_100001006 Ga0070675_10000100611 120
727 3300005354 Ga0070675_100004442 Ga0070675_1000044423 120
728 3300005354 Ga0070675_100034940 Ga0070675_1000349401 120
729 3300005354 Ga0070675_100067143 Ga0070675_1000671432 120
730 3300005354 Ga0070675_100130871 Ga0070675_1001308712 120
731 3300005354 Ga0070675_100149834 Ga0070675_1001498342 120
732 3300005355 Ga0070671_100025141 Ga0070671_1000251416 120
733 3300005355 Ga0070671_100054032 Ga0070671_1000540323 120
734 3300005355 Ga0070671_100056765 Ga0070671_1000567652 120
735 3300005355 Ga0070671_100109545 Ga0070671_1001095452 120
736 3300005355 Ga0070671_100350208 Ga0070671_1003502083 120
737 3300005355 Ga0070671_100496619 Ga0070671_1004966192 120
738 3300005355 Ga0070671_100697473 Ga0070671_1006974732 120
739 3300005356 Ga0070674_100011798 Ga0070674_1000117985 120
740 3300005356 Ga0070674_100026145 Ga0070674_1000261455 120
741 3300005356 Ga0070674_100155833 Ga0070674_1001558332 120
742 3300005356 Ga0070674_100232817 Ga0070674_1002328172 120
743 3300005356 Ga0070674_100235016 Ga0070674_1002350162 120
744 3300005356 Ga0070674_100255810 Ga0070674_1002558101 120
745 3300005356 Ga0070674_102072756 Ga0070674_1020727561 120
746 3300005364 Ga0070673_100008559 Ga0070673_1000085594 120
747 3300005364 Ga0070673_100071365 Ga0070673_1000713651 120
748 3300005364 Ga0070673_100075952 Ga0070673_1000759525 120
749 3300005364 Ga0070673_100240978 Ga0070673_1002409782 120
750 3300005364 Ga0070673_100274092 Ga0070673_1002740922 120
751 3300005364 Ga0070673_100796000 Ga0070673_1007960002 120
752 3300005365 Ga0070688_100445952 Ga0070688_1004459522 120
753 3300005366 Ga0070659_100010741 Ga0070659_1000107416 120
754 3300005366 Ga0070659_100010749 Ga0070659_1000107492 120
755 3300005366 Ga0070659_100076710 Ga0070659_1000767102 120
756 3300005366 Ga0070659_101845862 Ga0070659_1018458621 120
757 3300005367 Ga0070667_100023446 Ga0070667_1000234465 120
758 3300005367 Ga0070667_100069129 Ga0070667_1000691293 120
759 3300005367 Ga0070667_100107798 Ga0070667_1001077983 120
760 3300005367 Ga0070667_100109237 Ga0070667_1001092372 120
761 3300005367 Ga0070667_100751731 Ga0070667_1007517312 120
762 3300005367 Ga0070667_102045404 Ga0070667_1020454041 120
763 3300005438 Ga0070701_10883299 Ga0070701_108832992 120
764 3300005455 Ga0070663_100009632 Ga0070663_1000096325 120
765 3300005455 Ga0070663_100464499 Ga0070663_1004644992 120
766 3300005455 Ga0070663_101685724 Ga0070663_1016857241 120
767 3300005456 Ga0070678_100011667 Ga0070678_1000116674 120
768 3300005456 Ga0070678_100089762 Ga0070678_1000897623 120
769 3300005456 Ga0070678_100159972 Ga0070678_1001599721 120
770 3300005456 Ga0070678_100325158 Ga0070678_1003251582 120
771 3300005456 Ga0070678_100341685 Ga0070678_1003416851 120
772 3300005456 Ga0070678_100477001 Ga0070678_1004770012 120
773 3300005456 Ga0070678_101606426 Ga0070678_1016064262 120
774 3300005457 Ga0070662_100001019 Ga0070662_1000010193 120
775 3300005457 Ga0070662_100011240 Ga0070662_1000112407 120
776 3300005457 Ga0070662_100023675 Ga0070662_1000236751 120
777 3300005457 Ga0070662_100127956 Ga0070662_1001279562 120
778 3300005457 Ga0070662_100170413 Ga0070662_1001704132 120
779 3300005457 Ga0070662_100444044 Ga0070662_1004440441 120
780 3300005457 Ga0070662_100533932 Ga0070662_1005339322 120
781 3300005457 Ga0070662_101081723 Ga0070662_1010817232 120
782 3300005458 Ga0070681_10197965 Ga0070681_101979654 120
783 3300005458 Ga0070681_10278698 Ga0070681_102786982 120
784 3300005459 Ga0068867_100016344 Ga0068867_1000163444 120
785 3300005459 Ga0068867_100034247 Ga0068867_1000342472 120
786 3300005459 Ga0068867_100743637 Ga0068867_1007436372 120
787 3300005459 Ga0068867_100851984 Ga0068867_1008519841 120
788 3300005459 Ga0068867_101856265 Ga0068867_1018562652 120
789 3300005466 Ga0070685_10204044 Ga0070685_102040443 120
790 3300005466 Ga0070685_10319507 Ga0070685_103195072 120
791 3300005467 Ga0070706_101283998 Ga0070706_1012839981 120
792 3300005468 Ga0070707_100068338 Ga0070707_1000683382 120
793 3300005518 Ga0070699_100333141 Ga0070699_1003331412 120
794 3300005530 Ga0070679_100008517 Ga0070679_1000085179 120
795 3300005535 Ga0070684_100080735 Ga0070684_1000807352 120
796 3300005535 Ga0070684_100357163 Ga0070684_1003571632 120
797 3300005539 Ga0068853_100039549 Ga0068853_1000395493 120
798 3300005539 Ga0068853_100082693 Ga0068853_1000826932 120
799 3300005539 Ga0068853_100289610 Ga0068853_1002896102 120
800 3300005539 Ga0068853_102216775 Ga0068853_1022167751 120
801 3300005543 Ga0070672_100005175 Ga0070672_1000051752 120
802 3300005543 Ga0070672_100029306 Ga0070672_1000293063 120
803 3300005543 Ga0070672_100053519 Ga0070672_1000535192 120
804 3300005543 Ga0070672_100091204 Ga0070672_1000912042 120
805 3300005543 Ga0070672_100143469 Ga0070672_1001434692 120
806 3300005543 Ga0070672_100286296 Ga0070672_1002862961 120
807 3300005543 Ga0070672_100631445 Ga0070672_1006314452 120
808 3300005543 Ga0070672_101527324 Ga0070672_1015273241 120
809 3300005544 Ga0070686_101249616 Ga0070686_1012496161 120
810 3300005544 Ga0070686_101904375 Ga0070686_1019043751 120
811 3300005547 Ga0070693_100021069 Ga0070693_1000210692 120
812 3300005547 Ga0070693_100127276 Ga0070693_1001272763 120
813 3300005548 Ga0070665_101550683 Ga0070665_1015506831 120
814 3300005563 Ga0068855_100063871 Ga0068855_1000638713 120
815 3300005563 Ga0068855_100124744 Ga0068855_1001247444 120
816 3300005564 Ga0070664_100003061 Ga0070664_1000030614 120
817 3300005564 Ga0070664_100163926 Ga0070664_1001639262 120
818 3300005564 Ga0070664_100212193 Ga0070664_1002121933 120
819 3300005564 Ga0070664_100344962 Ga0070664_1003449622 120
820 3300005564 Ga0070664_100601512 Ga0070664_1006015122 120
821 3300005564 Ga0070664_100879653 Ga0070664_1008796531 120
822 3300005564 Ga0070664_100976988 Ga0070664_1009769882 120
823 3300005577 Ga0068857_100008620 Ga0068857_1000086206 120
824 3300005577 Ga0068857_100230301 Ga0068857_1002303013 120
825 3300005577 Ga0068857_100430985 Ga0068857_1004309852 120
826 3300005578 Ga0068854_100020602 Ga0068854_1000206022 120
827 3300005578 Ga0068854_100139888 Ga0068854_1001398882 120
828 3300005578 Ga0068854_100542159 Ga0068854_1005421592 120
829 3300005578 Ga0068854_101163122 Ga0068854_1011631222 120
830 3300005614 Ga0068856_100006422 Ga0068856_1000064229 120
831 3300005614 Ga0068856_100015458 Ga0068856_1000154585 120
832 3300005614 Ga0068856_100057763 Ga0068856_1000577633 120
833 3300005614 Ga0068856_102086819 Ga0068856_1020868192 120
834 3300005615 Ga0070702_100164921 Ga0070702_1001649212 120
835 3300005615 Ga0070702_101036618 Ga0070702_1010366181 120
836 3300005616 Ga0068852_100003787 Ga0068852_1000037879 120
837 3300005616 Ga0068852_100025312 Ga0068852_1000253124 120
838 3300005616 Ga0068852_100214846 Ga0068852_1002148462 120
839 3300005616 Ga0068852_100221503 Ga0068852_1002215032 120
840 3300005616 Ga0068852_100260265 Ga0068852_1002602652 120
841 3300005616 Ga0068852_101078970 Ga0068852_1010789702 120
842 3300005616 Ga0068852_101547430 Ga0068852_1015474302 120
843 3300005617 Ga0068859_101094095 Ga0068859_1010940951 120
844 3300005617 Ga0068859_102786939 Ga0068859_1027869392 120
845 3300005618 Ga0068864_100028571 Ga0068864_1000285714 120
846 3300005618 Ga0068864_100066554 Ga0068864_1000665542 120
847 3300005618 Ga0068864_100113586 Ga0068864_1001135863 120
848 3300005618 Ga0068864_100188680 Ga0068864_1001886802 120
849 3300005618 Ga0068864_100378150 Ga0068864_1003781502 120
850 3300005618 Ga0068864_100679397 Ga0068864_1006793972 120
851 3300005718 Ga0068866_10134098 Ga0068866_101340982 120
852 3300005719 Ga0068861_100002334 Ga0068861_1000023347 120
853 3300005719 Ga0068861_100042320 Ga0068861_1000423202 120
854 3300005719 Ga0068861_102670825 Ga0068861_1026708251 120
855 3300005834 Ga0068851_10010578 Ga0068851_100105782 120
856 3300005834 Ga0068851_10126112 Ga0068851_101261122 120
857 3300005834 Ga0068851_10221816 Ga0068851_102218162 120
858 3300005834 Ga0068851_10379856 Ga0068851_103798561 120
859 3300005834 Ga0068851_10508047 Ga0068851_105080472 120
860 3300005834 Ga0068851_11080222 Ga0068851_110802221 120
861 3300005840 Ga0068870_10691859 Ga0068870_106918591 120
862 3300005840 Ga0068870_10979031 Ga0068870_109790312 120
863 3300005840 Ga0068870_11021070 Ga0068870_110210701 120
864 3300005841 Ga0068863_100052427 Ga0068863_1000524273 120
865 3300005841 Ga0068863_100056820 Ga0068863_1000568203 120
866 3300005841 Ga0068863_100209124 Ga0068863_1002091242 120
867 3300005841 Ga0068863_100297393 Ga0068863_1002973932 120
868 3300005841 Ga0068863_100305432 Ga0068863_1003054322 120
869 3300005841 Ga0068863_100326831 Ga0068863_1003268312 120
870 3300005842 Ga0068858_100001369 Ga0068858_10000136921 120
871 3300005842 Ga0068858_100014492 Ga0068858_1000144922 120
872 3300005842 Ga0068858_100019550 Ga0068858_1000195508 120
873 3300005842 Ga0068858_100586552 Ga0068858_1005865522 120
874 3300005843 Ga0068860_100011668 Ga0068860_1000116688 120
875 3300005843 Ga0068860_100065639 Ga0068860_1000656394 120
876 3300005843 Ga0068860_101082211 Ga0068860_1010822112 120
877 3300005844 Ga0068862_100201826 Ga0068862_1002018262 120
878 3300005844 Ga0068862_100642219 Ga0068862_1006422192 120
879 3300005844 Ga0068862_102653626 Ga0068862_1026536261 120
880 3300006042 Ga0075368_10044569 Ga0075368_100445694 120
881 3300006173 Ga0070716_100377044 Ga0070716_1003770442 120
882 3300006178 Ga0075367_10002153 Ga0075367_100021534 120
883 3300006186 Ga0075369_10237193 Ga0075369_102371932 120
884 3300006195 Ga0075366_10038857 Ga0075366_100388573 120
885 3300006195 Ga0075366_10218687 Ga0075366_102186872 120
886 3300006195 Ga0075366_10718359 Ga0075366_107183591 120
887 3300006237 Ga0097621_100025627 Ga0097621_1000256271 120
888 3300006237 Ga0097621_100035295 Ga0097621_1000352954 120
889 3300006237 Ga0097621_100215455 Ga0097621_1002154553 120
890 3300006237 Ga0097621_100513842 Ga0097621_1005138423 120
891 3300006237 Ga0097621_100852260 Ga0097621_1008522602 120
892 3300006237 Ga0097621_101454911 Ga0097621_1014549111 120
893 3300006353 Ga0075370_10000895 Ga0075370_100008957 120
894 3300006353 Ga0075370_10026609 Ga0075370_100266092 120
895 3300006353 Ga0075370_10072515 Ga0075370_100725152 120
896 3300006353 Ga0075370_10096140 Ga0075370_100961403 120
897 3300006358 Ga0068871_100004241 Ga0068871_1000042412 120
898 3300006358 Ga0068871_100094517 Ga0068871_1000945171 120
899 3300006358 Ga0068871_100614112 Ga0068871_1006141122 120
900 3300006358 Ga0068871_101606850 Ga0068871_1016068501 120
901 3300006358 Ga0068871_101863082 Ga0068871_1018630822 120
902 3300006358 Ga0068871_102233905 Ga0068871_1022339051 120
903 3300006881 Ga0068865_100139010 Ga0068865_1001390102 120
904 3300006881 Ga0068865_100714478 Ga0068865_1007144782 120
905 3300006881 Ga0068865_101013388 Ga0068865_1010133882 120
906 3300006931 Ga0097620_101094136 Ga0097620_1010941362 120
907 3300006931 Ga0097620_102786881 Ga0097620_1027868812 120
908 3300007076 Ga0075435_100757518 Ga0075435_1007575182 120
909 3300009011 Ga0105251_10594277 Ga0105251_105942771 120
910 3300009093 Ga0105240_10192337 Ga0105240_101923374 120
911 3300009098 Ga0105245_10447177 Ga0105245_104471772 120
912 3300009147 Ga0114129_10457333 Ga0114129_104573332 120
913 3300009148 Ga0105243_10070292 Ga0105243_100702924 120
914 3300009148 Ga0105243_10185578 Ga0105243_101855782 120
915 3300009174 Ga0105241_10619696 Ga0105241_106196962 120
916 3300009174 Ga0105241_10740028 Ga0105241_107400282 120
917 3300009174 Ga0105241_10920631 Ga0105241_109206312 120
918 3300009176 Ga0105242_10261291 Ga0105242_102612913 120
919 3300009177 Ga0105248_10115604 Ga0105248_101156043 120
920 3300009177 Ga0105248_10126227 Ga0105248_101262272 120
921 3300009177 Ga0105248_10560532 Ga0105248_105605322 120
922 3300009551 Ga0105238_10020844 Ga0105238_100208443 120
923 3300009551 Ga0105238_10609897 Ga0105238_106098972 120
924 3300009551 Ga0105238_10711555 Ga0105238_107115552 120
925 3300009551 Ga0105238_10960111 Ga0105238_109601112 120
926 3300009553 Ga0105249_10015679 Ga0105249_100156792 120
927 3300010375 Ga0105239_11416417 Ga0105239_114164172 120
928 3300012473 Ga0157340_1013755 Ga0157340_10137552 120
929 3300012485 Ga0157325_1018032 Ga0157325_10180321 120
930 3300012508 Ga0157315_1006689 Ga0157315_10066892 120
931 3300013100 Ga0157373_10178978 Ga0157373_101789782 120
932 3300013100 Ga0157373_10547074 Ga0157373_105470742 120
933 3300013102 Ga0157371_10273729 Ga0157371_102737292 120
934 3300013102 Ga0157371_10393527 Ga0157371_103935271 120
935 3300013104 Ga0157370_10300284 Ga0157370_103002842 120
936 3300013104 Ga0157370_10603805 Ga0157370_106038052 120
937 3300013104 Ga0157370_10896628 Ga0157370_108966282 120
938 3300013105 Ga0157369_10038041 Ga0157369_100380414 120
939 3300013105 Ga0157369_10720988 Ga0157369_107209881 120
940 3300013105 Ga0157369_11860210 Ga0157369_118602101 120
941 3300013296 Ga0157374_10031516 Ga0157374_100315164 120
942 3300013296 Ga0157374_10071656 Ga0157374_100716562 120
943 3300013296 Ga0157374_10347798 Ga0157374_103477982 120
944 3300013297 Ga0157378_10024860 Ga0157378_1002486011 120
945 3300013297 Ga0157378_10083591 Ga0157378_100835912 120
946 3300013297 Ga0157378_10565633 Ga0157378_105656332 120
947 3300013297 Ga0157378_12004026 Ga0157378_120040262 120
948 3300013306 Ga0163162_10133273 Ga0163162_101332733 120
949 3300013306 Ga0163162_10531748 Ga0163162_105317482 120
950 3300013306 Ga0163162_10628255 Ga0163162_106282552 120
951 3300013306 Ga0163162_10941602 Ga0163162_109416022 120
952 3300013306 Ga0163162_11862038 Ga0163162_118620382 120
953 3300013307 Ga0157372_10219116 Ga0157372_102191164 120
954 3300013307 Ga0157372_10424816 Ga0157372_104248162 120
955 3300013307 Ga0157372_10822618 Ga0157372_108226182 120
956 3300013307 Ga0157372_12403121 Ga0157372_124031212 120
957 3300013308 Ga0157375_10006998 Ga0157375_100069982 120
958 3300013308 Ga0157375_10012615 Ga0157375_100126155 120
959 3300013308 Ga0157375_10017183 Ga0157375_100171835 120
960 3300013308 Ga0157375_10097705 Ga0157375_100977051 120
961 3300013308 Ga0157375_10751085 Ga0157375_107510852 120
962 3300013308 Ga0157375_11566463 Ga0157375_115664631 120
963 3300014325 Ga0163163_11053786 Ga0163163_110537862 120
964 3300014326 Ga0157380_10057760 Ga0157380_100577602 120
965 3300014326 Ga0157380_10172521 Ga0157380_101725212 120
966 3300014326 Ga0157380_10202828 Ga0157380_102028282 120
967 3300014326 Ga0157380_11033392 Ga0157380_110333922 120
968 3300014745 Ga0157377_10002696 Ga0157377_100026966 120
969 3300014745 Ga0157377_10808312 Ga0157377_108083121 120
970 3300014968 Ga0157379_10004431 Ga0157379_100044318 120
971 3300014968 Ga0157379_10028700 Ga0157379_100287004 120
972 3300014968 Ga0157379_10341460 Ga0157379_103414603 120
973 3300014969 Ga0157376_10024497 Ga0157376_100244974 120
974 3300014969 Ga0157376_10238764 Ga0157376_102387643 120
975 3300014969 Ga0157376_10246313 Ga0157376_102463132 120
976 3300014969 Ga0157376_10541042 Ga0157376_105410422 120
977 3300014969 Ga0157376_10589480 Ga0157376_105894801 120
978 3300014969 Ga0157376_12906528 Ga0157376_129065281 120
979 3300015261 Ga0182006_1211916 Ga0182006_12119162 120
980 3300015262 Ga0182007_10266367 Ga0182007_102663672 120
981 3300015265 Ga0182005_1091227 Ga0182005_10912272 120
982 3300017792 Ga0163161_10019156 Ga0163161_100191564 120
983 3300017792 Ga0163161_10123509 Ga0163161_101235092 120
984 3300017792 Ga0163161_10181451 Ga0163161_101814512 120
985 3300020082 Ga0206353_10514887 Ga0206353_105148872 120
986 3300025245 Ga0207425_1000511 Ga0207425_100051125 120
987 3300025258 Ga0209129_1002180 Ga0209129_10021805 120
988 3300025273 Ga0209673_1029638 Ga0209673_10296382 120
989 3300025295 Ga0209564_1000196 Ga0209564_100019672 120
990 3300025297 Ga0209758_1000181 Ga0209758_100018158 120
991 3300025298 Ga0209050_1001266 Ga0209050_100126624 120
992 3300025299 Ga0209256_1074696 Ga0209256_10746962 120
993 3300025303 Ga0209051_1002697 Ga0209051_10026972 120
994 3300025304 Ga0209257_1000021 Ga0209257_1000021713 120
995 3300025304 Ga0209257_1015510 Ga0209257_10155105 120
996 3300025304 Ga0209257_1042771 Ga0209257_10427713 120
997 3300025321 Ga0207656_10014661 Ga0207656_100146614 120
998 3300025321 Ga0207656_10082290 Ga0207656_100822902 120
999 3300025321 Ga0207656_10147672 Ga0207656_101476722 120
1000 3300025321 Ga0207656_10245505 Ga0207656_102455051 120
1001 3300025321 Ga0207656_10311423 Ga0207656_103114231 120
1002 3300025893 Ga0207682_10027282 Ga0207682_100272822 120
1003 3300025893 Ga0207682_10043554 Ga0207682_100435542 120
1004 3300025899 Ga0207642_10002666 Ga0207642_100026664 120
1005 3300025900 Ga0207710_10156056 Ga0207710_101560562 120
1006 3300025901 Ga0207688_10034955 Ga0207688_100349552 120
1007 3300025903 Ga0207680_10005278 Ga0207680_100052784 120
1008 3300025905 Ga0207685_10302143 Ga0207685_103021432 120
1009 3300025907 Ga0207645_10001190 Ga0207645_100011909 120
1010 3300025907 Ga0207645_10029270 Ga0207645_100292702 120
1011 3300025907 Ga0207645_10079243 Ga0207645_100792433 120
1012 3300025907 Ga0207645_10192193 Ga0207645_101921932 120
1013 3300025908 Ga0207643_10318077 Ga0207643_103180772 120
1014 3300025908 Ga0207643_10832915 Ga0207643_108329151 120
1015 3300025909 Ga0207705_10024072 Ga0207705_100240723 120
1016 3300025909 Ga0207705_10039570 Ga0207705_100395703 120
1017 3300025909 Ga0207705_10431687 Ga0207705_104316872 120
1018 3300025909 Ga0207705_10956916 Ga0207705_109569162 120
1019 3300025910 Ga0207684_10015609 Ga0207684_100156096 120
1020 3300025911 Ga0207654_10451245 Ga0207654_104512452 120
1021 3300025911 Ga0207654_10717037 Ga0207654_107170372 120
1022 3300025911 Ga0207654_10764005 Ga0207654_107640052 120
1023 3300025912 Ga0207707_10292186 Ga0207707_102921863 120
1024 3300025912 Ga0207707_10324237 Ga0207707_103242372 120
1025 3300025917 Ga0207660_10101515 Ga0207660_101015152 120
1026 3300025918 Ga0207662_10061901 Ga0207662_100619013 120
1027 3300025919 Ga0207657_10024402 Ga0207657_100244023 120
1028 3300025919 Ga0207657_10145653 Ga0207657_101456532 120
1029 3300025919 Ga0207657_10675112 Ga0207657_106751122 120
1030 3300025920 Ga0207649_10009940 Ga0207649_100099406 120
1031 3300025920 Ga0207649_10409486 Ga0207649_104094861 120
1032 3300025920 Ga0207649_10737510 Ga0207649_107375102 120
1033 3300025920 Ga0207649_11134876 Ga0207649_111348761 120
1034 3300025921 Ga0207652_10077074 Ga0207652_100770742 120
1035 3300025922 Ga0207646_10307947 Ga0207646_103079471 120
1036 3300025923 Ga0207681_10000214 Ga0207681_1000021411 120
1037 3300025923 Ga0207681_10099546 Ga0207681_100995463 120
1038 3300025923 Ga0207681_10161918 Ga0207681_101619182 120
1039 3300025923 Ga0207681_10439878 Ga0207681_104398781 120
1040 3300025924 Ga0207694_10207529 Ga0207694_102075292 120
1041 3300025924 Ga0207694_10478137 Ga0207694_104781372 120
1042 3300025924 Ga0207694_11061595 Ga0207694_110615952 120
1043 3300025925 Ga0207650_10000937 Ga0207650_1000093720 120
1044 3300025925 Ga0207650_10143131 Ga0207650_101431312 120
1045 3300025925 Ga0207650_10195655 Ga0207650_101956552 120
1046 3300025925 Ga0207650_10273263 Ga0207650_102732632 120
1047 3300025925 Ga0207650_10426023 Ga0207650_104260232 120
1048 3300025925 Ga0207650_10777543 Ga0207650_107775431 120
1049 3300025926 Ga0207659_10004991 Ga0207659_100049915 120
1050 3300025926 Ga0207659_10017778 Ga0207659_100177785 120
1051 3300025926 Ga0207659_10017801 Ga0207659_100178013 120
1052 3300025926 Ga0207659_10055052 Ga0207659_100550522 120
1053 3300025926 Ga0207659_10092294 Ga0207659_100922943 120
1054 3300025926 Ga0207659_10482749 Ga0207659_104827492 120
1055 3300025927 Ga0207687_10949392 Ga0207687_109493922 120
1056 3300025931 Ga0207644_10010554 Ga0207644_100105544 120
1057 3300025931 Ga0207644_10044789 Ga0207644_100447892 120
1058 3300025931 Ga0207644_10196979 Ga0207644_101969792 120
1059 3300025931 Ga0207644_11806127 Ga0207644_118061272 120
1060 3300025932 Ga0207690_10017607 Ga0207690_100176073 120
1061 3300025932 Ga0207690_10035310 Ga0207690_100353102 120
1062 3300025932 Ga0207690_10084537 Ga0207690_100845372 120
1063 3300025932 Ga0207690_10240615 Ga0207690_102406152 120
1064 3300025933 Ga0207706_10000449 Ga0207706_1000044910 120
1065 3300025933 Ga0207706_10018191 Ga0207706_100181917 120
1066 3300025933 Ga0207706_10033988 Ga0207706_100339881 120
1067 3300025933 Ga0207706_10356451 Ga0207706_103564512 120
1068 3300025933 Ga0207706_10506314 Ga0207706_105063142 120
1069 3300025933 Ga0207706_11135284 Ga0207706_111352842 120
1070 3300025934 Ga0207686_10008428 Ga0207686_100084283 120
1071 3300025934 Ga0207686_11064645 Ga0207686_110646452 120
1072 3300025935 Ga0207709_10022408 Ga0207709_100224081 120
1073 3300025935 Ga0207709_10264068 Ga0207709_102640683 120
1074 3300025935 Ga0207709_10937051 Ga0207709_109370512 120
1075 3300025936 Ga0207670_10711682 Ga0207670_107116822 120
1076 3300025937 Ga0207669_10020710 Ga0207669_100207102 120
1077 3300025937 Ga0207669_10183787 Ga0207669_101837872 120
1078 3300025937 Ga0207669_10301815 Ga0207669_103018152 120
1079 3300025937 Ga0207669_10919911 Ga0207669_109199112 120
1080 3300025938 Ga0207704_10003076 Ga0207704_100030765 120
1081 3300025938 Ga0207704_10184203 Ga0207704_101842033 120
1082 3300025938 Ga0207704_10879031 Ga0207704_108790311 120
1083 3300025939 Ga0207665_10358200 Ga0207665_103582002 120
1084 3300025939 Ga0207665_11537807 Ga0207665_115378071 120
1085 3300025940 Ga0207691_10024826 Ga0207691_100248264 120
1086 3300025940 Ga0207691_10045546 Ga0207691_100455463 120
1087 3300025940 Ga0207691_10120992 Ga0207691_101209923 120
1088 3300025940 Ga0207691_10202067 Ga0207691_102020672 120
1089 3300025940 Ga0207691_10230990 Ga0207691_102309901 120
1090 3300025940 Ga0207691_10593261 Ga0207691_105932612 120
1091 3300025940 Ga0207691_10617357 Ga0207691_106173572 120
1092 3300025940 Ga0207691_11111503 Ga0207691_111115031 120
1093 3300025941 Ga0207711_10040995 Ga0207711_100409952 120
1094 3300025941 Ga0207711_10043521 Ga0207711_100435213 120
1095 3300025941 Ga0207711_10056982 Ga0207711_100569823 120
1096 3300025941 Ga0207711_10069942 Ga0207711_100699423 120
1097 3300025941 Ga0207711_10077629 Ga0207711_100776292 120
1098 3300025941 Ga0207711_10401642 Ga0207711_104016422 120
1099 3300025942 Ga0207689_10001542 Ga0207689_1000154210 120
1100 3300025942 Ga0207689_10016843 Ga0207689_100168437 120
1101 3300025942 Ga0207689_10099988 Ga0207689_100999882 120
1102 3300025944 Ga0207661_10061440 Ga0207661_100614404 120
1103 3300025944 Ga0207661_10179565 Ga0207661_101795652 120
1104 3300025944 Ga0207661_10771878 Ga0207661_107718782 120
1105 3300025945 Ga0207679_10017939 Ga0207679_100179393 120
1106 3300025945 Ga0207679_11027953 Ga0207679_110279532 120
1107 3300025949 Ga0207667_10187364 Ga0207667_101873642 120
1108 3300025949 Ga0207667_11371211 Ga0207667_113712112 120
1109 3300025960 Ga0207651_10007714 Ga0207651_100077142 120
1110 3300025960 Ga0207651_10023971 Ga0207651_100239713 120
1111 3300025960 Ga0207651_10026542 Ga0207651_100265422 120
1112 3300025960 Ga0207651_10179679 Ga0207651_101796791 120
1113 3300025960 Ga0207651_10318084 Ga0207651_103180842 120
1114 3300025960 Ga0207651_10420766 Ga0207651_104207663 120
1115 3300025960 Ga0207651_10616424 Ga0207651_106164242 120
1116 3300025960 Ga0207651_11566746 Ga0207651_115667461 120
1117 3300025961 Ga0207712_10003685 Ga0207712_100036856 120
1118 3300025972 Ga0207668_10007597 Ga0207668_100075975 120
1119 3300025981 Ga0207640_10480671 Ga0207640_104806712 120
1120 3300025986 Ga0207658_10003279 Ga0207658_100032794 120
1121 3300025986 Ga0207658_10092681 Ga0207658_100926814 120
1122 3300025986 Ga0207658_10297802 Ga0207658_102978022 120
1123 3300025986 Ga0207658_10525847 Ga0207658_105258472 120
1124 3300025986 Ga0207658_10786591 Ga0207658_107865912 120
1125 3300026023 Ga0207677_10004256 Ga0207677_100042562 120
1126 3300026023 Ga0207677_10324344 Ga0207677_103243442 120
1127 3300026023 Ga0207677_10611657 Ga0207677_106116572 120
1128 3300026023 Ga0207677_10670329 Ga0207677_106703291 120
1129 3300026023 Ga0207677_11399452 Ga0207677_113994522 120
1130 3300026035 Ga0207703_10003713 Ga0207703_100037137 120
1131 3300026035 Ga0207703_10013980 Ga0207703_100139806 120
1132 3300026041 Ga0207639_10023473 Ga0207639_100234735 120
1133 3300026041 Ga0207639_10108330 Ga0207639_101083303 120
1134 3300026041 Ga0207639_11079247 Ga0207639_110792472 120
1135 3300026041 Ga0207639_11794840 Ga0207639_117948402 120
1136 3300026067 Ga0207678_10006005 Ga0207678_100060059 120
1137 3300026067 Ga0207678_10295515 Ga0207678_102955152 120
1138 3300026075 Ga0207708_10127265 Ga0207708_101272652 120
1139 3300026078 Ga0207702_10012956 Ga0207702_100129563 120
1140 3300026078 Ga0207702_10023008 Ga0207702_100230083 120
1141 3300026078 Ga0207702_10336198 Ga0207702_103361982 120
1142 3300026078 Ga0207702_10488907 Ga0207702_104889071 120
1143 3300026088 Ga0207641_10015342 Ga0207641_100153423 120
1144 3300026088 Ga0207641_10040936 Ga0207641_100409363 120
1145 3300026088 Ga0207641_10053534 Ga0207641_100535342 120
1146 3300026088 Ga0207641_10109554 Ga0207641_101095542 120
1147 3300026088 Ga0207641_10275304 Ga0207641_102753041 120
1148 3300026088 Ga0207641_10410947 Ga0207641_104109471 120
1149 3300026089 Ga0207648_10016056 Ga0207648_100160562 120
1150 3300026089 Ga0207648_10027768 Ga0207648_100277686 120
1151 3300026089 Ga0207648_10039524 Ga0207648_100395243 120
1152 3300026089 Ga0207648_10222240 Ga0207648_102222402 120
1153 3300026089 Ga0207648_10538976 Ga0207648_105389762 120
1154 3300026089 Ga0207648_10627432 Ga0207648_106274321 120
1155 3300026095 Ga0207676_10148970 Ga0207676_101489702 120
1156 3300026095 Ga0207676_10154293 Ga0207676_101542931 120
1157 3300026095 Ga0207676_10174215 Ga0207676_101742152 120
1158 3300026095 Ga0207676_10451756 Ga0207676_104517563 120
1159 3300026095 Ga0207676_10579893 Ga0207676_105798932 120
1160 3300026095 Ga0207676_10621491 Ga0207676_106214911 120
1161 3300026116 Ga0207674_10008358 Ga0207674_100083586 120
1162 3300026116 Ga0207674_10117874 Ga0207674_101178742 120
1163 3300026116 Ga0207674_10579628 Ga0207674_105796282 120
1164 3300026116 Ga0207674_10625124 Ga0207674_106251242 120
1165 3300026116 Ga0207674_10685603 Ga0207674_106856032 120
1166 3300026118 Ga0207675_100000214 Ga0207675_10000021441 120
1167 3300026118 Ga0207675_100157793 Ga0207675_1001577932 120
1168 3300026118 Ga0207675_100358683 Ga0207675_1003586832 120
1169 3300026121 Ga0207683_10041309 Ga0207683_100413092 120
1170 3300026121 Ga0207683_10111911 Ga0207683_101119113 120
1171 3300026121 Ga0207683_10196025 Ga0207683_101960252 120
1172 3300026121 Ga0207683_10465761 Ga0207683_104657612 120
1173 3300026121 Ga0207683_10594593 Ga0207683_105945932 120
1174 3300026121 Ga0207683_10848548 Ga0207683_108485481 120
1175 3300026142 Ga0207698_10003539 Ga0207698_100035398 120
1176 3300026142 Ga0207698_10005500 Ga0207698_100055006 120
1177 3300026142 Ga0207698_10006533 Ga0207698_100065332 120
1178 3300026142 Ga0207698_10265655 Ga0207698_102656553 120
1179 3300026142 Ga0207698_10742882 Ga0207698_107428822 120
1180 3300026142 Ga0207698_10991956 Ga0207698_109919562 120
1181 3300026142 Ga0207698_11079274 Ga0207698_110792742 120
1182 3300028380 Ga0268265_10009334 Ga0268265_100093343 120
1183 3300028380 Ga0268265_10308172 Ga0268265_103081723 120
1184 3300028381 Ga0268264_10001033 Ga0268264_1000103315 120
1185 3300028381 Ga0268264_10624264 Ga0268264_106242642 120
1186 3300028381 Ga0268264_11109104 Ga0268264_111091041 120
1187 3300028786 Ga0307517_10000708 Ga0307517_1000070824 120
1188 3300028794 Ga0307515_10000150 Ga0307515_1000015039 120
1189 3300028794 Ga0307515_10000187 Ga0307515_100001876 120
1190 3300028794 Ga0307515_10005172 Ga0307515_1000517218 120
1191 3300028794 Ga0307515_10015579 Ga0307515_100155792 120
1192 3300028794 Ga0307515_10327804 Ga0307515_103278042 120
1193 3300028794 Ga0307515_10343198 Ga0307515_103431982 120
1194 3300030522 Ga0307512_10109325 Ga0307512_101093252 120
1195 3300030522 Ga0307512_10145132 Ga0307512_101451322 120
1196 3300030522 Ga0307512_10231385 Ga0307512_102313852 120
1197 3300031456 Ga0307513_10122795 Ga0307513_101227952 120
1198 3300031507 Ga0307509_10034015 Ga0307509_100340156 120
1199 3300031507 Ga0307509_10039232 Ga0307509_100392322 120
1200 3300031548 Ga0307408_100113110 Ga0307408_1001131102 120
1201 3300031616 Ga0307508_10001596 Ga0307508_1000159621 120
1202 3300031616 Ga0307508_10003456 Ga0307508_1000345615 120
1203 3300031616 Ga0307508_10294188 Ga0307508_102941883 120
1204 3300031649 Ga0307514_10002176 Ga0307514_1000217610 120
1205 3300031649 Ga0307514_10120644 Ga0307514_101206444 120
1206 3300031649 Ga0307514_10282290 Ga0307514_102822901 120
1207 3300031649 Ga0307514_10286116 Ga0307514_102861162 120
1208 3300031730 Ga0307516_10000268 Ga0307516_1000026846 120
1209 3300031730 Ga0307516_10003906 Ga0307516_1000390613 120
1210 3300031730 Ga0307516_10213559 Ga0307516_102135592 120
1211 3300031730 Ga0307516_10647278 Ga0307516_106472782 120
1212 3300031730 Ga0307516_10753397 Ga0307516_107533971 120
1213 3300031731 Ga0307405_10005746 Ga0307405_100057462 120
1214 3300031731 Ga0307405_10274690 Ga0307405_102746902 120
1215 3300031731 Ga0307405_10628796 Ga0307405_106287962 120
1216 3300031824 Ga0307413_10019225 Ga0307413_100192253 120
1217 3300031838 Ga0307518_10370619 Ga0307518_103706191 120
1218 3300031852 Ga0307410_10003356 Ga0307410_100033567 120
1219 3300031901 Ga0307406_10354766 Ga0307406_103547663 120
1220 3300031903 Ga0307407_10008822 Ga0307407_100088225 120
1221 3300031903 Ga0307407_10153575 Ga0307407_101535752 120
1222 3300031911 Ga0307412_10172020 Ga0307412_101720202 120
1223 3300031911 Ga0307412_10866769 Ga0307412_108667692 120
1224 3300032002 Ga0307416_100013304 Ga0307416_1000133043 120
1225 3300032002 Ga0307416_100274638 Ga0307416_1002746382 120
1226 3300032004 Ga0307414_10334425 Ga0307414_103344252 120
1227 3300032004 Ga0307414_12201286 Ga0307414_122012861 120
1228 3300032005 Ga0307411_10001686 Ga0307411_100016862 120
1229 3300032005 Ga0307411_10460262 Ga0307411_104602622 120
1230 3300032126 Ga0307415_100007903 Ga0307415_1000079035 120
1231 3300032126 Ga0307415_100205875 Ga0307415_1002058752 120
1232 3300033179 Ga0307507_10094001 Ga0307507_100940014 120
1233 3300033180 Ga0307510_10025175 Ga0307510_100251756 120
1234 3300034819 Ga0373958_0058867 Ga0373958_0058867_391_753 120
1235 3300035088 Ga0373940_0047582 Ga0373940_0047582_418_780 120
1236 3300035088 Ga0373940_0237584 Ga0373940_0237584_31_426 120
1237 3300035089 Ga0373944_0272924 Ga0373944_0272924_50_412 120
1238 3300035090 Ga0373949_0028332 Ga0373949_0028332_406_768 120
1239 3300035091 Ga0373951_0090239 Ga0373951_0090239_383_778 120
1240 3300035092 Ga0373952_0104597 Ga0373952_0104597_84_446 120
1241 3300035111 Ga0373923_0303749 Ga0373923_0303749_222_584 120
1242 3300035111 Ga0373923_0516054 Ga0373923_0516054_121_486 120
1243 3300035112 Ga0373932_0034081 Ga0373932_0034081_545_940 120
1244 3300035118 Ga0373954_0173704 Ga0373954_0173704_438_800 120
1245 3300035170 Ga0373943_0105381 Ga0373943_0105381_1097_1459 120
1246 3300035170 Ga0373943_0798885 Ga0373943_0798885_37_399 120
1247 3300035171 Ga0373946_0599319 Ga0373946_0599319_183_545 120
1248 3300035172 Ga0373955_0177348 Ga0373955_0177348_628_990 120
1249 3300035242 Ga0373962_0011842 Ga0373962_0011842_63_425 120
1250 3300035410 Ga0373924_0106397 Ga0373924_0106397_665_1027 120
1251 3300035691 Ga0373931_0001429 Ga0373931_0001429_566_928 120
1252 3300035691 Ga0373931_0370700 Ga0373931_0370700_316_714 120
1253 3300035692 Ga0373935_0795653 Ga0373935_0795653_193_555 120
1254 3300035695 Ga0373927_0352780 Ga0373927_0352780_161_523 120
1255 3300035724 Ga0373933_0182375 Ga0373933_0182375_606_968 120
1256 3300035724 Ga0373933_0276253 Ga0373933_0276253_500_862 120
1257 3300035725 Ga0373947_0050825 Ga0373947_0050825_1486_1848 120
1258 3300035725 Ga0373947_0831150 Ga0373947_0831150_200_562 120
1259 3300036401 Ga0373937_0065617 Ga0373937_0065617_1565_1927 120
1260 3300036401 Ga0373937_0129239 Ga0373937_0129239_750_1112 120
1261 3300037068 Ga0373925_0070801 Ga0373925_0070801_676_1080 120
1262 3300037068 Ga0373925_0193368 Ga0373925_0193368_613_975 120
1263 3300037068 Ga0373925_0405428 Ga0373925_0405428_574_936 120
1264 3300037068 Ga0373925_0673822 Ga0373925_0673822_259_621 120
1265 3300037418 Ga0395900_0000535 Ga0395900_0000535_47097_47510 120
1266 3300037466 Ga0395898_0002836 Ga0395898_0002836_18996_19418 120
1267 3300037471 Ga0395905_0007293 Ga0395905_0007293_600_989 120
1268 3300037471 Ga0395905_0124032 Ga0395905_0124032_1303_1689 120
1269 3300037853 Ga0436364_1495413 Ga0436364_1495413_94_456 120
1270 3300039437 Ga0436365_1267282 Ga0436365_1267282_29_412 120
1271 3300039438 Ga0436360_0381654 Ga0436360_0381654_48_410 120
1272 3300041452 Ga0451793_0358311 Ga0451793_0358311_582_980 120
1273 3300041452 Ga0451793_1172903 Ga0451793_1172903_12_377 120
1274 3300041458 Ga0451798_0791769 Ga0451798_0791769_86_448 120
1275 3300041459 Ga0451800_0500868 Ga0451800_0500868_49_411 120
1276 3300041459 Ga0451800_1533257 Ga0451800_1533257_181_585 120
1277 3300041461 Ga0451805_098782 Ga0451805_098782_199_588 120
1278 3300041486 Ga0451807_0270528 Ga0451807_0270528_100_462 120
1279 3300041486 Ga0451807_0589163 Ga0451807_0589163_262_624 120
1280 3300041492 Ga0451835_0060653 Ga0451835_0060653_206_568 120
1281 3300041496 Ga0451839_0843576 Ga0451839_0843576_19_384 120
1282 3300041498 Ga0451841_0137167 Ga0451841_0137167_144_506 120
1283 3300041511 Ga0451855_0366185 Ga0451855_0366185_58_420 120
1284 3300041512 Ga0451853_2795309 Ga0451853_2795309_54_452 120
1285 3300041512 Ga0451853_3145576 Ga0451853_3145576_456_860 120
1286 3300041512 Ga0451853_3325265 Ga0451853_3325265_113_475 120
1287 3300042000 Ga0439437_022894 Ga0439437_022894_220_585 120
1288 3300042008 Ga0439450_001164 Ga0439450_001164_2725_3090 120
1289 3300042156 Ga0439446_0069153 Ga0439446_0069153_71_469 120
1290 3300042439 Ga0439464_0004537 Ga0439464_0004537_2967_3332 120
1291 3300042461 Ga0439460_0071551 Ga0439460_0071551_635_1000 120
1292 3300042876 Ga0451577_0008143 Ga0451577_0008143_8347_8733 120
1293 3300044656 Ga0466969_0023536 Ga0466969_0023536_926_1324 120
1294 3300044656 Ga0466969_0057161 Ga0466969_0057161_368_784 120
1295 3300044658 Ga0466972_0004153 Ga0466972_0004153_1502_1882 120
1296 3300044673 Ga0453683_0844060 Ga0453683_0844060_121_486 120
1297 3300044683 Ga0466965_0036600 Ga0466965_0036600_1367_1768 120
1298 3300044683 Ga0466965_0057540 Ga0466965_0057540_1045_1458 120
1299 3300044683 Ga0466965_0153621 Ga0466965_0153621_499_927 120
1300 3300044683 Ga0466965_0220200 Ga0466965_0220200_231_611 120
1301 3300044684 Ga0466966_0004224 Ga0466966_0004224_2293_2721 120
1302 3300044684 Ga0466966_0050824 Ga0466966_0050824_968_1366 120
1303 3300044693 Ga0466961_0032915 Ga0466961_0032915_1080_1478 120
1304 3300044693 Ga0466961_0045694 Ga0466961_0045694_792_1208 120
1305 3300044693 Ga0466961_0240990 Ga0466961_0240990_413_841 120
1306 3300044706 Ga0466964_0012532 Ga0466964_0012532_838_1251 120
1307 3300044706 Ga0466964_0060667 Ga0466964_0060667_566_964 120
1308 3300044712 Ga0453684_0118560 Ga0453684_0118560_1967_2332 120
1309 3300044765 Ga0466970_0026135 Ga0466970_0026135_590_1006 120
1310 3300044765 Ga0466970_0301278 Ga0466970_0301278_392_790 120
1311 3300044842 Ga0466957_0096817 Ga0466957_0096817_503_901 120
1312 3300045049 Ga0466959_0000793 Ga0466959_0000793_4746_5162 120
1313 3300045049 Ga0466959_0058453 Ga0466959_0058453_1118_1516 120
1314 3300045051 Ga0451576_0094271 Ga0451576_0094271_2591_2953 120
1315 3300045836 Ga0466958_0138502 Ga0466958_0138502_733_1149 120
1316 3300046454 Ga0495592_0570222 Ga0495592_0570222_83_445 120
1317 3300046455 Ga0495603_0294798 Ga0495603_0294798_61_423 120
1318 3300046458 Ga0495591_101977 Ga0495591_101977_112_474 120
1319 3300046459 Ga0495629_0183779 Ga0495629_0183779_116_478 120
1320 3300046459 Ga0495629_0913725 Ga0495629_0913725_143_505 120
1321 3300046460 Ga0495638_0463109 Ga0495638_0463109_140_541 120
1322 3300046473 Ga0495582_0516988 Ga0495582_0516988_19_381 120
1323 3300046475 Ga0495639_0317507 Ga0495639_0317507_146_508 120
1324 3300046477 Ga0495664_0351137 Ga0495664_0351137_218_580 120
1325 3300046507 Ga0495606_0308558 Ga0495606_0308558_420_812 120
1326 3300046511 Ga0495608_0220549 Ga0495608_0220549_345_707 120
1327 3300046516 Ga0495628_0935336 Ga0495628_0935336_29_391 120
1328 3300046517 Ga0495630_1026686 Ga0495630_1026686_153_515 120
1329 3300046518 Ga0495631_0066241 Ga0495631_0066241_1033_1431 120
1330 3300046519 Ga0495632_0284097 Ga0495632_0284097_49_447 120
1331 3300046524 Ga0495648_0195975 Ga0495648_0195975_397_795 120
1332 3300046526 Ga0495666_0091251 Ga0495666_0091251_172_570 120
1333 3300046526 Ga0495666_0482124 Ga0495666_0482124_179_541 120
1334 3300046535 Ga0495586_0182997 Ga0495586_0182997_265_627 120
1335 3300046539 Ga0495621_0292428 Ga0495621_0292428_78_440 120
1336 3300046543 Ga0495645_0150423 Ga0495645_0150423_110_472 120
1337 3300046559 Ga0495667_0168248 Ga0495667_0168248_646_1008 120
1338 3300046660 Ga0495625_0289950 Ga0495625_0289950_618_1016 120
1339 3300046663 Ga0495635_0210694 Ga0495635_0210694_167_529 120
1340 3300046681 Ga0495647_0113929 Ga0495647_0113929_590_952 120
1341 3300046681 Ga0495647_0214694 Ga0495647_0214694_196_558 120
1342 3300046683 Ga0495658_0067119 Ga0495658_0067119_1572_1934 120
1343 3300046683 Ga0495658_0107084 Ga0495658_0107084_58_420 120
1344 3300046683 Ga0495658_0109706 Ga0495658_0109706_664_1062 120
1345 3300046683 Ga0495658_0166449 Ga0495658_0166449_606_971 120
1346 3300046689 Ga0495613_0402751 Ga0495613_0402751_246_608 120
1347 3300046689 Ga0495613_0475467 Ga0495613_0475467_46_408 120
1348 3300046690 Ga0495624_0025731 Ga0495624_0025731_1068_1466 120
1349 3300046691 Ga0495670_0195654 Ga0495670_0195654_535_897 120
1350 3300047319 Ga0495674_0667548 Ga0495674_0667548_147_509 120
1351 3300047469 Ga0495673_0076118 Ga0495673_0076118_530_928 120
1352 3300047471 Ga0495684_0179919 Ga0495684_0179919_412_774 120
1353 3300047471 Ga0495684_0941954 Ga0495684_0941954_180_542 120
1354 3300048088 Ga0495602_0403157 Ga0495602_0403157_128_523 120
1355 3300048904 Ga0496101_0221248 Ga0496101_0221248_657_1019 120
1356 3300048904 Ga0496101_0573894 Ga0496101_0573894_25_387 120
1357 3300048904 Ga0496101_0997218 Ga0496101_0997218_16_378 120
1358 3300048904 Ga0496101_1062950 Ga0496101_1062950_127_489 120
1359 3300048905 Ga0496102_0027533 Ga0496102_0027533_1062_1445 120
1360 3300048905 Ga0496102_0652466 Ga0496102_0652466_149_511 120
1361 3300048907 Ga0496104_0214747 Ga0496104_0214747_654_1019 120
1362 3300048907 Ga0496104_0308141 Ga0496104_0308141_622_984 120
1363 3300048908 Ga0496105_0026211 Ga0496105_0026211_507_872 120
1364 3300048908 Ga0496105_0231209 Ga0496105_0231209_412_831 120
1365 3300048908 Ga0496105_0302639 Ga0496105_0302639_362_724 120
1366 3300048908 Ga0496105_1066228 Ga0496105_1066228_137_502 120
1367 3300048909 Ga0496106_0010515 Ga0496106_0010515_1980_2342 120
1368 3300048910 Ga0496107_0007401 Ga0496107_0007401_5955_6317 120
1369 3300048910 Ga0496107_0373843 Ga0496107_0373843_333_698 120
1370 3300048911 Ga0496108_0216381 Ga0496108_0216381_1200_1562 120
1371 3300048911 Ga0496108_0332358 Ga0496108_0332358_80_442 120
1372 3300048911 Ga0496108_0378982 Ga0496108_0378982_387_773 120
1373 3300048911 Ga0496108_1201518 Ga0496108_1201518_161_523 120
1374 3300048912 Ga0496109_0304524 Ga0496109_0304524_94_456 120
1375 3300048913 Ga0496110_0031571 Ga0496110_0031571_3428_3790 120
1376 3300048913 Ga0496110_0297248 Ga0496110_0297248_194_556 120
1377 3300048914 Ga0496111_0640031 Ga0496111_0640031_295_657 120
1378 3300048914 Ga0496111_0913893 Ga0496111_0913893_30_392 120
1379 3300048915 Ga0496112_0263917 Ga0496112_0263917_539_901 120
1380 3300048916 Ga0496113_0272336 Ga0496113_0272336_112_474 120
1381 3300048917 Ga0496114_0263997 Ga0496114_0263997_672_1037 120
1382 3300048917 Ga0496114_0272685 Ga0496114_0272685_120_482 120
1383 3300048917 Ga0496114_0957620 Ga0496114_0957620_24_386 120
1384 3300048918 Ga0496115_0200731 Ga0496115_0200731_481_843 120
1385 3300048928 Ga0496125_0006880 Ga0496125_0006880_5692_6087 120
1386 3300048928 Ga0496125_0361294 Ga0496125_0361294_54_446 120
1387 3300048929 Ga0496126_0200834 Ga0496126_0200834_1107_1481 120
1388 3300049649 Ga0501198_000015 Ga0501198_000015_10725_11099 120
1389 3300049662 Ga0501222_000040 Ga0501222_000040_38852_39226 120
1390 3300049708 Ga0501245_035141 Ga0501245_035141_136_498 120
1391 3300049822 Ga0501035_0067274 Ga0501035_0067274_1964_2377 120
1392 3300050493 nmdc:mga0k408_37851_c1 nmdc:mga0k408_37851_c1_2080_2505 120
1393 3300050493 nmdc:mga0k408_422366_c1 nmdc:mga0k408_422366_c1_40_411 120
1394 3300050493 nmdc:mga0k408_565085_c1 nmdc:mga0k408_565085_c1_189_596 120
1395 3300050496 nmdc:mga07m45_219380_c1 nmdc:mga07m45_219380_c1_639_1043 120
1396 3300050496 nmdc:mga07m45_26285_c1 nmdc:mga07m45_26285_c1_582_986 120
1397 3300050496 nmdc:mga07m45_507282_c1 nmdc:mga07m45_507282_c1_24_422 120
1398 3300050496 nmdc:mga07m45_587096_c1 nmdc:mga07m45_587096_c1_194_619 120
1399 3300050496 nmdc:mga07m45_651412_c1 nmdc:mga07m45_651412_c1_122_523 120
1400 3300050507 nmdc:mga05p37_1042262_c1 nmdc:mga05p37_1042262_c1_345_716 120
1401 3300050513 nmdc:mga0rr50_598170_c1 nmdc:mga0rr50_598170_c1_507_869 120
1402 3300053077 Ga0495601_0239039 Ga0495601_0239039_755_1117 120
1403 3300053078 Ga0495612_0109920 Ga0495612_0109920_729_1133 120
1404 3300053078 Ga0495612_0111159 Ga0495612_0111159_580_942 120
1405 3300053084 Ga0495595_0045883 Ga0495595_0045883_227_589 120
1406 3300053085 Ga0495619_0263687 Ga0495619_0263687_213_605 120
1407 3300053085 Ga0495619_1013021 Ga0495619_1013021_39_401 120
1408 3300053090 Ga0500646_0164139 Ga0500646_0164139_207_605 120
1409 3300053092 Ga0500583_0036759 Ga0500583_0036759_57_455 120
1410 3300053093 Ga0500651_0269812 Ga0500651_0269812_62_469 120
1411 3300053098 Ga0500650_0082359 Ga0500650_0082359_209_607 120
1412 3300053136 Ga0500559_0126453 Ga0500559_0126453_213_605 120
1413 3300006852 Ga0075433_10658183 Ga0075433_106581832 121
1414 3300009147 Ga0114129_10582865 Ga0114129_105828652 121
1415 3300025933 Ga0207706_10003147 Ga0207706_100031472 121
1416 3300026142 Ga0207698_10292521 Ga0207698_102925214 121
1417 3300042007 Ga0439449_0117024 Ga0439449_0117024_70_513 121
1418 3300042157 Ga0439458_0105508 Ga0439458_0105508_63_476 121
1419 3300033180 Ga0307510_10045192 Ga0307510_100451924 132
1420 3300053131 Ga0500652_033825 Ga0500652_033825_232_639 132
1421 3300046681 Ga0495647_0371742 Ga0495647_0371742_171_623 135
1422 3300002155 JGI24033J26618_1036228 JGI24033J26618_10362282 137
1423 3300005327 Ga0070658_10560847 Ga0070658_105608472 137
1424 3300005331 Ga0070670_100020708 Ga0070670_1000207087 137
1425 3300005338 Ga0068868_100542579 Ga0068868_1005425792 137
1426 3300005344 Ga0070661_101008793 Ga0070661_1010087931 137
1427 3300005354 Ga0070675_100001473 Ga0070675_10000147320 137
1428 3300005364 Ga0070673_100481228 Ga0070673_1004812282 137
1429 3300005365 Ga0070688_100284908 Ga0070688_1002849082 137
1430 3300005459 Ga0068867_100019254 Ga0068867_1000192546 137
1431 3300005466 Ga0070685_10725257 Ga0070685_107252571 137
1432 3300005539 Ga0068853_100585456 Ga0068853_1005854561 137
1433 3300005543 Ga0070672_100000367 Ga0070672_10000036718 137
1434 3300005577 Ga0068857_101833039 Ga0068857_1018330392 137
1435 3300005616 Ga0068852_100947732 Ga0068852_1009477322 137
1436 3300005618 Ga0068864_100020683 Ga0068864_1000206835 137
1437 3300005719 Ga0068861_101213756 Ga0068861_1012137562 137
1438 3300006358 Ga0068871_100195365 Ga0068871_1001953653 137
1439 3300014969 Ga0157376_10144432 Ga0157376_101444322 137
1440 3300017792 Ga0163161_10012297 Ga0163161_100122977 137
1441 3300025315 Ga0207697_10110727 Ga0207697_101107272 137
1442 3300025903 Ga0207680_10185664 Ga0207680_101856642 137
1443 3300025907 Ga0207645_10140960 Ga0207645_101409602 137
1444 3300025923 Ga0207681_10691665 Ga0207681_106916652 137
1445 3300025925 Ga0207650_10002494 Ga0207650_1000249411 137
1446 3300025925 Ga0207650_11545158 Ga0207650_115451581 137
1447 3300025931 Ga0207644_10024213 Ga0207644_100242133 137
1448 3300025937 Ga0207669_10158936 Ga0207669_101589362 137
1449 3300025938 Ga0207704_10504016 Ga0207704_105040161 137
1450 3300025940 Ga0207691_10001841 Ga0207691_100018417 137
1451 3300025960 Ga0207651_10017944 Ga0207651_100179446 137
1452 3300025972 Ga0207668_10589541 Ga0207668_105895412 137
1453 3300026089 Ga0207648_10022315 Ga0207648_100223157 137
1454 3300026095 Ga0207676_10040197 Ga0207676_100401973 137
1455 3300026118 Ga0207675_101058402 Ga0207675_1010584022 137
1456 3300032005 Ga0307411_11027769 Ga0307411_110277692 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00216

Bac_DNA_binding

Bacterial DNA-binding protein

51

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.9392 38 126
1riy-assembly1.cif.gz_A-2 hu mutant v42i from thermotoga maritima 0.9177 38 126
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.9132 38 126
4p3v-assembly1.cif.gz_A-2 crystal structure of the e. coli hu beta2 protein 0.9115 38 126
1huu-assembly2.cif.gz_B dna-binding protein hu from bacillus stearothermophilus 0.9047 38 126
ID Description Score Start End Superfamily
af_Q4D6K7_133_320_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9276 40 62 3.30.420.10
af_A0A1D8PLR7_520_680_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8951 40 68 3.40.50.80
4dkyA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8843 38 133 4.10.520.10
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8736 38 127 4.10.520.10
4yexA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8694 38 126 4.10.520.10
ID Description Score Start End GO Terms
AF-A0A5D9CQ11-F1-model_v4 HU family DNA-binding protein 0.952 64 128 GO:0003677
GO:0030261
GO:0030527
AF-A0A3M1RL10-F1-model_v4 Integration host factor subunit alpha 0.9456 38 127 GO:0003677
GO:0005829
GO:0006310
GO:0006355
GO:0006417
GO:0030527
AF-A0A6L8C2B3-F1-model_v4 HU family DNA-binding protein 0.9444 45 128 GO:0003677
GO:0005829
GO:0030527
AF-A0A316LPA8-F1-model_v4 deleted 0.9289 37 126
AF-A0A416MW47-F1-model_v4 deleted 0.9277 38 127

Feature Viewer

pLDDT pTM Quality
78.88 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map