F494083

General Info

Members Datasets Scaffolds Average Seq Length
1455 694 1220 315

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10017804|Ga0105240_100178048
Length 379
Sequence VALTRPPSGRAFGCAAFNVSGFETLAAACTKMIWEGTDGVQEGPSALLSPFKPLFSRPFFIGFPMTLVSIPANPVPENVVVGTIKTPDGADLRFARWAPPVGRRGTVCVFTGRGEQIEKYFETVRDLRDRGFAVAMIDWRGQGHSARRLRDPRKGYVRHFSDYEVDAETFVQQVVLPDCPPPFFALAHSMGGAVMLRIAHASKRWFDRIVLSAPMIDLPGRRTSFPVRTLLRTMRLMGQGGRYVPGGNDELVNTAPFVNNPLTSDPVRYARNAAILAEDPTLGIASPTVAWADTAFATMHGFRAVDYPSQIRQPLLMIAASNDTIVSTPAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRAQFWAAFDAFVPGTPLFQ

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
74 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
75 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
76 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
77 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
78 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
79 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
80 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
84 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
85 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
86 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
87 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
88 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
89 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
90 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
91 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904699407
104 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
105 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
106 2906610324
107 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
108 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
109 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
110 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
111 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
112 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
113 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
114 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
115 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
116 2922368715
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
119 2922425934
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
123 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
124 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
127 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
128 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
132 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
133 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
134 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
135 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
136 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
137 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
138 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
139 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
140 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
141 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
142 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
143 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
144 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
145 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
146 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
147 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
148 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
149 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
150 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
151 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
152 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
153 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
154 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
155 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
156 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
157 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
158 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
159 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
160 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
161 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
162 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
163 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
164 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
165 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
166 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
167 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
168 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
169 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
173 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
174 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
175 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
176 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
177 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
178 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
179 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
180 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
181 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
182 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
183 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
184 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
185 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
186 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
187 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
188 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
189 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
192 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
201 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
202 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
203 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
204 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
205 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
206 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
207 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
208 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
209 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
210 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
211 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
212 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
213 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
214 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
215 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
216 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
217 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
218 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
219 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
220 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
221 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
222 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
223 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
224 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
225 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
226 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
227 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
228 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
229 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
230 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
231 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
232 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
233 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
236 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
237 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
238 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
239 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
240 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
241 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
242 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
243 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
244 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
245 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
246 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
247 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
248 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
249 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
250 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
251 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
252 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
253 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
254 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
255 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
256 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
259 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
260 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
261 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
262 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
263 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
264 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
265 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
266 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
267 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
268 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
269 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
270 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
271 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
272 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
273 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
276 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
277 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
278 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
279 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
280 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
281 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
282 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
283 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
284 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
285 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
286 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
287 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
288 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
289 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
290 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
291 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
292 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
293 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
294 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
295 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
296 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
297 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
298 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
299 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
300 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
301 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
302 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
305 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
309 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
310 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
311 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
312 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
313 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
314 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
315 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
317 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
320 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
323 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
325 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
379 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
380 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
381 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
382 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
386 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
387 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
388 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
389 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
390 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
391 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
392 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
393 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
394 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
395 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
396 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
397 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
398 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
399 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
400 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
401 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
402 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
403 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
404 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
405 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
406 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
407 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
408 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
409 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
410 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
411 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
412 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
413 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
414 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
415 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
416 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
417 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
418 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
419 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
420 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
421 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
422 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
423 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
424 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
425 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
426 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
427 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
428 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
429 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
430 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
431 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
432 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
433 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
434 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
435 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
436 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
437 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
438 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
439 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
440 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
441 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
442 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
443 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
444 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
445 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
446 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
447 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
448 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
449 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
450 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
451 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
452 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
453 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
454 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
455 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
456 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
457 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
458 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
459 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
460 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
461 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
462 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
463 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
464 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
465 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
466 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
467 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
468 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
469 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
470 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
471 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
472 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
473 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
474 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
475 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
476 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
477 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
478 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
479 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
480 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
481 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
482 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
483 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
484 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
485 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
486 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
487 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
488 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
489 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
490 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
491 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
492 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
493 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
494 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
495 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
496 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
497 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
498 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
499 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
500 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
501 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
502 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
503 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
504 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
505 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
506 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
507 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
508 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
509 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
510 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
511 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
512 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
513 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
514 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
515 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
516 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
517 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
518 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
519 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
520 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
521 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
522 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
523 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
524 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
525 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
526 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
527 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
528 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
529 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
530 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
531 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
532 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
533 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
534 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
535 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
536 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
537 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
538 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
539 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
540 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
541 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
542 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
543 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
544 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
545 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
546 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
547 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
548 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
549 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
550 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
551 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
552 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
553 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
554 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
555 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
556 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
557 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
558 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
559 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
560 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
561 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
562 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
563 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
564 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
565 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
566 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
572 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
573 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
574 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
580 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
581 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
582 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
583 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
584 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
585 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
586 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
587 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
588 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
589 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
590 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
591 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
594 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
595 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
596 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
597 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
598 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
599 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
600 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
601 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
602 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
603 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
604 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
605 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
606 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
607 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
608 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
609 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
610 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
611 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
612 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
613 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
614 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
617 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
618 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
619 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
620 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
621 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
622 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
623 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
624 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
625 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
626 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
627 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
628 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
629 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
630 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
631 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
632 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
633 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
634 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
635 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
636 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
637 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
638 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
639 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
640 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
641 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
642 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
643 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
644 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
645 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
646 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
647 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
648 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
649 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
650 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
651 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
652 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
653 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
654 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
655 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
656 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
657 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
658 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
659 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
660 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
661 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
662 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
663 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
664 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
665 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
666 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
667 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
668 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
669 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
670 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
671 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
672 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
673 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
674 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
675 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
676 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
677 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
678 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
679 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
680 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
681 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
682 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
683 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
684 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
685 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
686 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
687 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
688 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
689 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
690 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
691 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
692 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
693 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
694 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.06
Metatranscriptomes 0.14
Isolates 15.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.75
Nodule 12.58
Rhizoplane 6.53
Rhizosphere 57.87
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010307 3300001979 Bacteria 3609
2 JGI24739J22299_10060499 3300001989 Bacteria 1198
3 JGI25406J46586_10000118 3300003203 Bacteria 34503
4 JGI25153J46596_10002224 3300003215 Bacteria 11324
5 JGI25153J46596_10006933 3300003215 Bacteria 5650
6 JGI25153J46596_10007072 3300003215 Bacteria 5576
7 JGI25153J46596_10024593 3300003215 Bacteria 2169
8 rootH2_10188699 3300003320 Bacteria 1166
9 JGI25404J52841_10002320 3300003659 Bacteria 3581
10 Ga0055524_1016148 3300003775 Bacteria 2691
11 Ga0055531_10009477 3300003794 Bacteria 4971
12 Ga0065165_1002792 3300005262 Bacteria 13765
13 Ga0065165_1003284 3300005262 Bacteria 11658
14 Ga0065165_1021603 3300005262 Bacteria 2230
15 Ga0070658_10114808 3300005327 Bacteria 2233
16 Ga0070658_10212017 3300005327 Bacteria 1636
17 Ga0070683_100048202 3300005329 Bacteria 3938
18 Ga0070683_100074217 3300005329 Bacteria 3176
19 Ga0070670_100041202 3300005331 Bacteria 3969
20 Ga0068869_100087480 3300005334 Bacteria 2337
21 Ga0070680_100081738 3300005336 Bacteria 2666
22 Ga0070680_100186943 3300005336 Bacteria 1745
23 Ga0070680_100456634 3300005336 Bacteria 1091
24 Ga0070682_100073402 3300005337 Bacteria 2195
25 Ga0068868_100005183 3300005338 Bacteria 9148
26 Ga0068868_100017996 3300005338 Bacteria 5274
27 Ga0068868_100059948 3300005338 Bacteria 3012
28 Ga0068868_100326312 3300005338 Bacteria 1309
29 Ga0070660_100030247 3300005339 Bacteria 4062
30 Ga0070689_100330612 3300005340 Bacteria 1275
31 Ga0070661_100154164 3300005344 Bacteria 1738
32 Ga0070661_100210998 3300005344 Bacteria 1486
33 Ga0070668_100020491 3300005347 Bacteria 4991
34 Ga0070668_100046605 3300005347 Bacteria 3329
35 Ga0070668_100081859 3300005347 Bacteria 2531
36 Ga0070668_100154139 3300005347 Bacteria 1860
37 Ga0070671_100101143 3300005355 Bacteria 2418
38 Ga0070674_100060947 3300005356 Bacteria 2631
39 Ga0070674_100229679 3300005356 Bacteria 1447
40 Ga0070667_100225702 3300005367 Bacteria 1668
41 Ga0070709_10000796 3300005434 Bacteria 17649
42 Ga0070709_10001261 3300005434 Bacteria 13852
43 Ga0070709_10007358 3300005434 Bacteria 6032
44 Ga0070709_10010265 3300005434 Bacteria 5177
45 Ga0070709_10042951 3300005434 Bacteria 2794
46 Ga0070709_10129874 3300005434 Bacteria 1719
47 Ga0070714_100028362 3300005435 Bacteria 4644
48 Ga0070714_100131457 3300005435 Bacteria 2237
49 Ga0070713_100004513 3300005436 Bacteria 9368
50 Ga0070713_100024796 3300005436 Bacteria 4680
51 Ga0070713_100114641 3300005436 Bacteria 2355
52 Ga0070713_100114913 3300005436 Bacteria 2352
53 Ga0070713_100155528 3300005436 Bacteria 2038
54 Ga0070710_10000991 3300005437 Bacteria 13505
55 Ga0070710_10010597 3300005437 Bacteria 4531
56 Ga0070711_100005239 3300005439 Bacteria 7737
57 Ga0070711_100006676 3300005439 Bacteria 6977
58 Ga0070711_100008277 3300005439 Bacteria 6363
59 Ga0070711_100315304 3300005439 Bacteria 1247
60 Ga0070705_100137382 3300005440 Bacteria 1604
61 Ga0070700_100032431 3300005441 Bacteria 3139
62 Ga0070694_100279741 3300005444 Bacteria 1272
63 Ga0070663_100021710 3300005455 Bacteria 4276
64 Ga0070663_100027837 3300005455 Bacteria 3842
65 Ga0070663_100043121 3300005455 Bacteria 3173
66 Ga0070663_100123124 3300005455 Bacteria 1961
67 Ga0070678_100065174 3300005456 Bacteria 2703
68 Ga0070678_100084703 3300005456 Bacteria 2414
69 Ga0070678_100099892 3300005456 Bacteria 2246
70 Ga0070662_100195353 3300005457 Bacteria 1602
71 Ga0070681_10062271 3300005458 Bacteria 3704
72 Ga0070681_10163471 3300005458 Bacteria 2149
73 Ga0068867_100107078 3300005459 Bacteria 2142
74 Ga0070706_100089246 3300005467 Bacteria 2858
75 Ga0070698_100403197 3300005471 Bacteria 1301
76 Ga0070699_100227522 3300005518 Bacteria 1663
77 Ga0070679_100034610 3300005530 Bacteria 5006
78 Ga0070679_100047353 3300005530 Bacteria 4285
79 Ga0070679_100324799 3300005530 Bacteria 1488
80 Ga0070684_100008848 3300005535 Bacteria 7895
81 Ga0070684_100071224 3300005535 Bacteria 3060
82 Ga0068853_100007083 3300005539 Bacteria 8970
83 Ga0068853_100007085 3300005539 Bacteria 8969
84 Ga0068853_100032710 3300005539 Bacteria 4408
85 Ga0070696_100094591 3300005546 Bacteria 2133
86 Ga0070665_100007326 3300005548 Bacteria 11223
87 Ga0070665_100016280 3300005548 Bacteria 7461
88 Ga0070665_100021701 3300005548 Bacteria 6457
89 Ga0070665_100050261 3300005548 Bacteria 4183
90 Ga0070665_100057391 3300005548 Bacteria 3902
91 Ga0070665_100084638 3300005548 Bacteria 3176
92 Ga0070665_100137569 3300005548 Bacteria 2445
93 Ga0070665_100240889 3300005548 Bacteria 1809
94 Ga0070665_100347802 3300005548 Bacteria 1488
95 Ga0068855_100235778 3300005563 Bacteria 2046
96 Ga0068855_100299148 3300005563 Bacteria 1782
97 Ga0070664_100016211 3300005564 Bacteria 6108
98 Ga0070664_100156175 3300005564 Bacteria 2016
99 Ga0068857_100021428 3300005577 Bacteria 5689
100 Ga0068857_100113770 3300005577 Bacteria 2433
101 Ga0068857_100126040 3300005577 Bacteria 2307
102 Ga0068854_100009851 3300005578 Bacteria 6181
103 Ga0068854_100041116 3300005578 Bacteria 3265
104 Ga0068856_100000522 3300005614 Bacteria 42457
105 Ga0068856_100010527 3300005614 Bacteria 8980
106 Ga0068856_100030658 3300005614 Bacteria 5257
107 Ga0070702_100055555 3300005615 Bacteria 2283
108 Ga0068852_100020416 3300005616 Bacteria 5269
109 Ga0068852_100067275 3300005616 Bacteria 3132
110 Ga0068852_100341945 3300005616 Bacteria 1459
111 Ga0068859_100304741 3300005617 Bacteria 1686
112 Ga0068859_100643876 3300005617 Bacteria 1152
113 Ga0068864_100313875 3300005618 Bacteria 1470
114 Ga0068861_100088531 3300005719 Bacteria 2438
115 Ga0068851_10047299 3300005834 Bacteria 2178
116 Ga0068858_100127907 3300005842 Bacteria 2380
117 Ga0068860_100000441 3300005843 Bacteria 52446
118 Ga0068860_100155651 3300005843 Bacteria 2202
119 Ga0068862_100156535 3300005844 Bacteria 2031
120 Ga0068862_100215740 3300005844 Bacteria 1735
121 Ga0068862_100220550 3300005844 Bacteria 1717
122 Ga0081455_10000715 3300005937 Bacteria 43119
123 Ga0081455_10000774 3300005937 Bacteria 41248
124 Ga0081455_10003833 3300005937 Bacteria 17148
125 Ga0081455_10013479 3300005937 Bacteria 8073
126 Ga0081455_10028784 3300005937 Bacteria 5072
127 Ga0081455_10049450 3300005937 Bacteria 3625
128 Ga0081538_10029587 3300005981 Bacteria 3738
129 Ga0081538_10066454 3300005981 Bacteria 2022
130 Ga0081540_1002251 3300005983 Bacteria 15895
131 Ga0081540_1002343 3300005983 Bacteria 15504
132 Ga0081540_1003941 3300005983 Bacteria 11537
133 Ga0081540_1005884 3300005983 Bacteria 9064
134 Ga0081540_1014466 3300005983 Bacteria 5053
135 Ga0081540_1016536 3300005983 Bacteria 4609
136 Ga0081540_1022699 3300005983 Bacteria 3699
137 Ga0081540_1025221 3300005983 Bacteria 3428
138 Ga0081540_1026177 3300005983 Bacteria 3337
139 Ga0081540_1035117 3300005983 Bacteria 2693
140 Ga0081540_1065365 3300005983 Bacteria 1711
141 Ga0081540_1075776 3300005983 Bacteria 1536
142 Ga0081539_10000425 3300005985 Bacteria 89942
143 Ga0081539_10001114 3300005985 Bacteria 48756
144 Ga0081539_10053002 3300005985 Bacteria 2274
145 Ga0081539_10099924 3300005985 Bacteria 1481
146 Ga0081539_10109976 3300005985 Bacteria 1389
147 Ga0070717_10000325 3300006028 Bacteria 31034
148 Ga0070717_10084579 3300006028 Bacteria 2669
149 Ga0075365_10011659 3300006038 Bacteria 5179
150 Ga0075365_10026252 3300006038 Bacteria 3695
151 Ga0075365_10033426 3300006038 Bacteria 3314
152 Ga0075365_10040469 3300006038 Bacteria 3039
153 Ga0075365_10060412 3300006038 Bacteria 2529
154 Ga0075368_10007800 3300006042 Bacteria 3792
155 Ga0075368_10008135 3300006042 Bacteria 3723
156 Ga0075368_10012725 3300006042 Bacteria 3082
157 Ga0075368_10049183 3300006042 Bacteria 1672
158 Ga0075363_100001726 3300006048 Bacteria 8492
159 Ga0075363_100017481 3300006048 Bacteria 3557
160 Ga0075363_100088419 3300006048 Bacteria 1703
161 Ga0075363_100122224 3300006048 Bacteria 1455
162 Ga0075363_100176997 3300006048 Bacteria 1212
163 Ga0075364_10007861 3300006051 Bacteria 6347
164 Ga0075364_10010966 3300006051 Bacteria 5495
165 Ga0075364_10022059 3300006051 Bacteria 4018
166 Ga0075364_10043166 3300006051 Bacteria 2931
167 Ga0075432_10058339 3300006058 Bacteria 1371
168 Ga0070715_10000561 3300006163 Bacteria 9783
169 Ga0070715_10025862 3300006163 Bacteria 2329
170 Ga0070715_10103424 3300006163 Bacteria 1332
171 Ga0070716_100001763 3300006173 Bacteria 9784
172 Ga0070716_100171349 3300006173 Bacteria 1416
173 Ga0070712_100044490 3300006175 Bacteria 3062
174 Ga0070712_100167104 3300006175 Bacteria 1704
175 Ga0070712_100284740 3300006175 Bacteria 1332
176 Ga0075367_10040235 3300006178 Bacteria 2729
177 Ga0075367_10059339 3300006178 Bacteria 2278
178 Ga0075367_10075447 3300006178 Bacteria 2034
179 Ga0075367_10077676 3300006178 Bacteria 2004
180 Ga0075369_10002297 3300006186 Bacteria 6796
181 Ga0075369_10026891 3300006186 Bacteria 2401
182 Ga0075366_10006775 3300006195 Bacteria 6295
183 Ga0075366_10018597 3300006195 Bacteria 4013
184 Ga0075366_10035098 3300006195 Bacteria 2956
185 Ga0097621_100141141 3300006237 Bacteria 2058
186 Ga0097621_100375741 3300006237 Bacteria 1269
187 Ga0097621_100453462 3300006237 Bacteria 1156
188 Ga0075370_10017731 3300006353 Bacteria 3850
189 Ga0075370_10047609 3300006353 Bacteria 2428
190 Ga0075370_10047964 3300006353 Bacteria 2419
191 Ga0075370_10080144 3300006353 Bacteria 1876
192 Ga0068871_100113220 3300006358 Bacteria 2285
193 Ga0075428_100023204 3300006844 Bacteria 6862
194 Ga0075430_100382451 3300006846 Bacteria 1161
195 Ga0075431_100029253 3300006847 Bacteria 5669
196 Ga0075434_100020473 3300006871 Bacteria 6418
197 Ga0075434_100050474 3300006871 Bacteria 4133
198 Ga0075434_100074720 3300006871 Bacteria 3382
199 Ga0075434_100084478 3300006871 Bacteria 3173
200 Ga0068865_100150267 3300006881 Bacteria 1766
201 Ga0075436_100096406 3300006914 Bacteria 2058
202 Ga0097620_100304731 3300006931 Bacteria 1686
203 Ga0097620_100643933 3300006931 Bacteria 1152
204 Ga0099825_1019128 3300006941 Bacteria 5158
205 Ga0099824_1005278 3300006942 Bacteria 18259
206 Ga0099824_1017855 3300006942 Bacteria 6007
207 Ga0099822_1013722 3300006943 Bacteria 9448
208 Ga0099794_10009088 3300007265 Bacteria 4156
209 Ga0099795_10000836 3300007788 Bacteria 6125
210 Ga0099795_10024305 3300007788 Bacteria 2020
211 Ga0099795_10034455 3300007788 Bacteria 1764
212 Ga0105240_10002968 3300009093 Bacteria 26700
213 Ga0105240_10017804 3300009093 Bacteria 9563
214 Ga0105240_10021771 3300009093 Bacteria 8518
215 Ga0105240_10033109 3300009093 Bacteria 6682
216 Ga0105240_10076367 3300009093 Bacteria 4130
217 Ga0105240_10146029 3300009093 Bacteria 2822
218 Ga0105240_10463304 3300009093 Bacteria 1416
219 Ga0105240_10477187 3300009093 Bacteria 1391
220 Ga0105240_10547751 3300009093 Bacteria 1280
221 Ga0105240_10644663 3300009093 Bacteria 1162
222 Ga0111539_10333654 3300009094 Bacteria 1765
223 Ga0105245_10011836 3300009098 Bacteria 7588
224 Ga0105245_10024933 3300009098 Bacteria 5256
225 Ga0105245_10030674 3300009098 Bacteria 4755
226 Ga0105245_10551186 3300009098 Bacteria 1175
227 Ga0105247_10135573 3300009101 Bacteria 1608
228 Ga0114129_10196005 3300009147 Bacteria 2739
229 Ga0114129_10228379 3300009147 Bacteria 2508
230 Ga0105243_10328556 3300009148 Bacteria 1396
231 Ga0105243_10424563 3300009148 Bacteria 1241
232 Ga0105241_10001388 3300009174 Bacteria 18512
233 Ga0105241_10016444 3300009174 Bacteria 5427
234 Ga0105241_10227892 3300009174 Bacteria 1570
235 Ga0105242_10179201 3300009176 Bacteria 1868
236 Ga0105248_10044195 3300009177 Bacteria 4996
237 Ga0105248_10073680 3300009177 Bacteria 3837
238 Ga0105248_10161310 3300009177 Bacteria 2529
239 Ga0105248_10264975 3300009177 Bacteria 1934
240 Ga0105248_10459244 3300009177 Bacteria 1436
241 Ga0105237_10009401 3300009545 Bacteria 10469
242 Ga0105237_10018051 3300009545 Bacteria 7307
243 Ga0105237_10019256 3300009545 Bacteria 7050
244 Ga0105237_10029341 3300009545 Bacteria 5593
245 Ga0105237_10063125 3300009545 Bacteria 3702
246 Ga0105237_10081504 3300009545 Bacteria 3227
247 Ga0105237_10117726 3300009545 Bacteria 2650
248 Ga0105237_10121493 3300009545 Bacteria 2606
249 Ga0105237_10219525 3300009545 Bacteria 1901
250 Ga0105237_10279682 3300009545 Bacteria 1671
251 Ga0105237_10302610 3300009545 Bacteria 1602
252 Ga0105237_10330910 3300009545 Bacteria 1527
253 Ga0105238_10007201 3300009551 Bacteria 11135
254 Ga0105238_10025146 3300009551 Bacteria 6068
255 Ga0105238_10028995 3300009551 Bacteria 5638
256 Ga0105238_10066871 3300009551 Bacteria 3595
257 Ga0105238_10083975 3300009551 Bacteria 3174
258 Ga0105238_10134821 3300009551 Bacteria 2447
259 Ga0105238_10140056 3300009551 Bacteria 2396
260 Ga0105249_10161283 3300009553 Bacteria 2167
261 Ga0099796_10000143 3300010159 Bacteria 10566
262 Ga0099796_10014081 3300010159 Bacteria 2301
263 Ga0099796_10049573 3300010159 Bacteria 1452
264 Ga0105239_10026237 3300010375 Bacteria 6414
265 Ga0105239_10054242 3300010375 Bacteria 4396
266 Ga0105239_10075076 3300010375 Bacteria 3717
267 Ga0105239_10108752 3300010375 Bacteria 3072
268 Ga0105239_10129571 3300010375 Bacteria 2805
269 Ga0105239_10132265 3300010375 Bacteria 2776
270 Ga0105239_10666468 3300010375 Bacteria 1189
271 Ga0105239_10745374 3300010375 Bacteria 1121
272 Ga0105246_10024946 3300011119 Bacteria 3893
273 Ga0157371_10231668 3300013102 Bacteria 1327
274 Ga0157370_10120699 3300013104 Bacteria 2447
275 Ga0157370_10140019 3300013104 Bacteria 2254
276 Ga0157369_10011069 3300013105 Bacteria 10263
277 Ga0157369_10022494 3300013105 Bacteria 7032
278 Ga0157369_10085496 3300013105 Bacteria 3370
279 Ga0157374_10025945 3300013296 Bacteria 5268
280 Ga0157374_10348201 3300013296 Bacteria 1472
281 Ga0157378_10019128 3300013297 Bacteria 6017
282 Ga0157378_10085139 3300013297 Bacteria 2864
283 Ga0163162_10020858 3300013306 Bacteria 6443
284 Ga0157372_10050306 3300013307 Bacteria 4636
285 Ga0157372_10680296 3300013307 Bacteria 1198
286 Ga0157375_10016660 3300013308 Bacteria 6610
287 Ga0163163_10063284 3300014325 Bacteria 3667
288 Ga0163163_10067838 3300014325 Bacteria 3548
289 Ga0163163_10069545 3300014325 Bacteria 3505
290 Ga0163163_10110804 3300014325 Bacteria 2773
291 Ga0163163_10115145 3300014325 Bacteria 2720
292 Ga0163163_10196568 3300014325 Bacteria 2065
293 Ga0157380_10212424 3300014326 Bacteria 1725
294 Ga0157377_10133442 3300014745 Bacteria 1519
295 Ga0157379_10012889 3300014968 Bacteria 7313
296 Ga0157379_10095943 3300014968 Bacteria 2661
297 Ga0157379_10129426 3300014968 Bacteria 2271
298 Ga0157379_10263968 3300014968 Bacteria 1565
299 Ga0157376_10008369 3300014969 Bacteria 7461
300 Ga0157376_10175361 3300014969 Bacteria 1955
301 Ga0163161_10113270 3300017792 Bacteria 2030
302 Ga0206353_10807201 3300020082 Bacteria 2646
303 Ga0214544_1000011 3300021320 Bacteria 262952
304 Ga0214542_1000009 3300021321 Bacteria 262861
305 Ga0214545_1000007 3300021324 Bacteria 262984
306 Ga0214543_1000020 3300021327 Bacteria 262861
307 Ga0213876_10008681 3300021384 Bacteria 5497
308 Ga0209563_103763 3300025230 Bacteria 3051
309 Ga0207425_1007458 3300025245 Bacteria 2883
310 Ga0209677_103733 3300025253 Bacteria 4760
311 Ga0209148_1000316 3300025254 Bacteria 68104
312 Ga0209148_1007100 3300025254 Bacteria 2356
313 Ga0209233_1016979 3300025261 Bacteria 1992
314 Ga0209455_1006070 3300025272 Bacteria 3631
315 Ga0209564_1000407 3300025295 Bacteria 76572
316 Ga0209564_1002075 3300025295 Bacteria 17222
317 Ga0209564_1005161 3300025295 Bacteria 7581
318 Ga0209564_1023569 3300025295 Bacteria 2132
319 Ga0209758_1000106 3300025297 Bacteria 218450
320 Ga0209758_1001012 3300025297 Bacteria 37211
321 Ga0209758_1001683 3300025297 Bacteria 24919
322 Ga0209758_1002332 3300025297 Bacteria 19594
323 Ga0209758_1002396 3300025297 Bacteria 19259
324 Ga0209758_1003816 3300025297 Bacteria 13250
325 Ga0209758_1007915 3300025297 Bacteria 7053
326 Ga0209758_1014959 3300025297 Bacteria 4065
327 Ga0209758_1029030 3300025297 Bacteria 2324
328 Ga0209758_1037061 3300025297 Bacteria 1891
329 Ga0209256_1002946 3300025299 Bacteria 12776
330 Ga0207426_1000374 3300025302 Bacteria 78498
331 Ga0207426_1001007 3300025302 Bacteria 27365
332 Ga0207426_1004033 3300025302 Bacteria 7438
333 Ga0209257_1001741 3300025304 Bacteria 24170
334 Ga0207692_10005299 3300025898 Bacteria 5157
335 Ga0207710_10086053 3300025900 Bacteria 1464
336 Ga0207688_10204097 3300025901 Bacteria 1186
337 Ga0207680_10221195 3300025903 Bacteria 1298
338 Ga0207647_10000972 3300025904 Bacteria 22175
339 Ga0207685_10018879 3300025905 Bacteria 2261
340 Ga0207685_10023611 3300025905 Bacteria 2096
341 Ga0207685_10077029 3300025905 Bacteria 1369
342 Ga0207699_10000363 3300025906 Bacteria 24040
343 Ga0207699_10002914 3300025906 Bacteria 8131
344 Ga0207699_10041739 3300025906 Bacteria 2652
345 Ga0207699_10082273 3300025906 Bacteria 2000
346 Ga0207645_10182413 3300025907 Bacteria 1377
347 Ga0207645_10192206 3300025907 Bacteria 1342
348 Ga0207645_10265271 3300025907 Bacteria 1138
349 Ga0207705_10033327 3300025909 Bacteria 3679
350 Ga0207705_10075543 3300025909 Bacteria 2447
351 Ga0207705_10194066 3300025909 Bacteria 1536
352 Ga0207684_10174378 3300025910 Bacteria 1854
353 Ga0207654_10000729 3300025911 Bacteria 18348
354 Ga0207654_10028175 3300025911 Bacteria 3061
355 Ga0207654_10030934 3300025911 Bacteria 2944
356 Ga0207654_10061268 3300025911 Bacteria 2201
357 Ga0207707_10000541 3300025912 Bacteria 38481
358 Ga0207707_10050125 3300025912 Bacteria 3638
359 Ga0207695_10000478 3300025913 Bacteria 86076
360 Ga0207695_10004497 3300025913 Bacteria 18978
361 Ga0207695_10017775 3300025913 Bacteria 8252
362 Ga0207695_10024109 3300025913 Bacteria 6854
363 Ga0207695_10191850 3300025913 Bacteria 1961
364 Ga0207671_10003084 3300025914 Bacteria 17008
365 Ga0207671_10133861 3300025914 Bacteria 1905
366 Ga0207671_10151954 3300025914 Bacteria 1789
367 Ga0207671_10184623 3300025914 Bacteria 1624
368 Ga0207693_10005512 3300025915 Bacteria 10533
369 Ga0207693_10008188 3300025915 Bacteria 8565
370 Ga0207693_10008624 3300025915 Bacteria 8342
371 Ga0207693_10020448 3300025915 Bacteria 5266
372 Ga0207693_10024640 3300025915 Bacteria 4772
373 Ga0207693_10076040 3300025915 Bacteria 2630
374 Ga0207663_10000425 3300025916 Bacteria 18308
375 Ga0207663_10031078 3300025916 Bacteria 3156
376 Ga0207663_10038050 3300025916 Bacteria 2905
377 Ga0207663_10069893 3300025916 Bacteria 2260
378 Ga0207660_10009028 3300025917 Bacteria 6454
379 Ga0207660_10210524 3300025917 Bacteria 1522
380 Ga0207657_10002950 3300025919 Bacteria 18254
381 Ga0207657_10014763 3300025919 Bacteria 7605
382 Ga0207657_10029326 3300025919 Bacteria 5010
383 Ga0207657_10080145 3300025919 Bacteria 2745
384 Ga0207649_10251963 3300025920 Bacteria 1272
385 Ga0207652_10007298 3300025921 Bacteria 8902
386 Ga0207652_10205326 3300025921 Bacteria 1773
387 Ga0207694_10000849 3300025924 Bacteria 27168
388 Ga0207694_10009743 3300025924 Bacteria 7248
389 Ga0207694_10049921 3300025924 Bacteria 3239
390 Ga0207694_10103254 3300025924 Bacteria 2260
391 Ga0207687_10106472 3300025927 Bacteria 2073
392 Ga0207687_10125264 3300025927 Bacteria 1928
393 Ga0207700_10008743 3300025928 Bacteria 6290
394 Ga0207700_10021069 3300025928 Bacteria 4443
395 Ga0207700_10077617 3300025928 Bacteria 2581
396 Ga0207700_10085514 3300025928 Bacteria 2476
397 Ga0207700_10095006 3300025928 Bacteria 2364
398 Ga0207700_10135559 3300025928 Bacteria 2016
399 Ga0207664_10006763 3300025929 Bacteria 7918
400 Ga0207664_10111058 3300025929 Bacteria 2280
401 Ga0207664_10209590 3300025929 Bacteria 1686
402 Ga0207644_10197868 3300025931 Bacteria 1584
403 Ga0207706_10033954 3300025933 Bacteria 4541
404 Ga0207706_10410092 3300025933 Bacteria 1174
405 Ga0207686_10040719 3300025934 Bacteria 2827
406 Ga0207709_10256227 3300025935 Bacteria 1281
407 Ga0207669_10240701 3300025937 Bacteria 1341
408 Ga0207669_10339047 3300025937 Bacteria 1157
409 Ga0207665_10003367 3300025939 Bacteria 10702
410 Ga0207665_10008013 3300025939 Bacteria 6969
411 Ga0207665_10009754 3300025939 Bacteria 6304
412 Ga0207665_10055096 3300025939 Bacteria 2682
413 Ga0207665_10186442 3300025939 Bacteria 1505
414 Ga0207665_10270161 3300025939 Bacteria 1262
415 Ga0207665_10275786 3300025939 Bacteria 1250
416 Ga0207691_10323914 3300025940 Bacteria 1321
417 Ga0207711_10061206 3300025941 Bacteria 3246
418 Ga0207689_10047666 3300025942 Bacteria 3536
419 Ga0207689_10073080 3300025942 Bacteria 2817
420 Ga0207689_10103200 3300025942 Bacteria 2343
421 Ga0207689_10343547 3300025942 Bacteria 1240
422 Ga0207661_10000109 3300025944 Bacteria 52179
423 Ga0207661_10029282 3300025944 Bacteria 4227
424 Ga0207661_10035452 3300025944 Bacteria 3888
425 Ga0207667_10003413 3300025949 Bacteria 19620
426 Ga0207667_10090006 3300025949 Bacteria 3171
427 Ga0207667_10139182 3300025949 Bacteria 2499
428 Ga0207667_10148280 3300025949 Bacteria 2415
429 Ga0207667_10193729 3300025949 Bacteria 2085
430 Ga0207651_10229428 3300025960 Bacteria 1506
431 Ga0207712_10162993 3300025961 Bacteria 1735
432 Ga0207668_10067563 3300025972 Bacteria 2538
433 Ga0207668_10070947 3300025972 Bacteria 2486
434 Ga0207668_10354060 3300025972 Bacteria 1228
435 Ga0207668_10442358 3300025972 Bacteria 1107
436 Ga0207640_10039426 3300025981 Bacteria 2990
437 Ga0207640_10101239 3300025981 Bacteria 2021
438 Ga0207640_10206678 3300025981 Bacteria 1492
439 Ga0207640_10272708 3300025981 Bacteria 1324
440 Ga0207658_10150905 3300025986 Bacteria 1893
441 Ga0207658_10280329 3300025986 Bacteria 1428
442 Ga0207677_10003182 3300026023 Bacteria 8665
443 Ga0207677_10008230 3300026023 Bacteria 5812
444 Ga0207677_10011875 3300026023 Bacteria 4984
445 Ga0207677_10023110 3300026023 Bacteria 3834
446 Ga0207677_10453452 3300026023 Bacteria 1099
447 Ga0207639_10025543 3300026041 Bacteria 4283
448 Ga0207639_10188415 3300026041 Bacteria 1760
449 Ga0207639_10418632 3300026041 Bacteria 1211
450 Ga0207678_10006080 3300026067 Bacteria 10738
451 Ga0207678_10025278 3300026067 Bacteria 5185
452 Ga0207678_10035705 3300026067 Bacteria 4328
453 Ga0207678_10045068 3300026067 Bacteria 3813
454 Ga0207678_10106641 3300026067 Bacteria 2390
455 Ga0207708_10117190 3300026075 Bacteria 2072
456 Ga0207702_10000003 3300026078 Bacteria 434196
457 Ga0207702_10000014 3300026078 Bacteria 253304
458 Ga0207702_10059058 3300026078 Bacteria 3266
459 Ga0207702_10108328 3300026078 Bacteria 2465
460 Ga0207641_10519200 3300026088 Bacteria 1158
461 Ga0207648_10011805 3300026089 Bacteria 8209
462 Ga0207648_10074325 3300026089 Bacteria 2962
463 Ga0207676_10104985 3300026095 Bacteria 2351
464 Ga0207674_10029977 3300026116 Bacteria 5723
465 Ga0207674_10033474 3300026116 Bacteria 5380
466 Ga0207674_10033728 3300026116 Bacteria 5358
467 Ga0207674_10064316 3300026116 Bacteria 3700
468 Ga0207675_100049152 3300026118 Bacteria 3937
469 Ga0207675_100067188 3300026118 Bacteria 3351
470 Ga0207683_10085838 3300026121 Bacteria 2798
471 Ga0207683_10102982 3300026121 Bacteria 2549
472 Ga0207683_10156685 3300026121 Bacteria 2057
473 Ga0207683_10186779 3300026121 Bacteria 1881
474 Ga0207698_10042042 3300026142 Bacteria 3411
475 Ga0207698_10274298 3300026142 Bacteria 1556
476 Ga0207698_10340597 3300026142 Bacteria 1412
477 Ga0209389_1000016 3300027296 Bacteria 184844
478 Ga0209389_1000027 3300027296 Bacteria 146917
479 Ga0209589_1000005 3300027357 Bacteria 530958
480 Ga0209589_1000031 3300027357 Bacteria 147054
481 Ga0209489_100005 3300027361 Bacteria 530958
482 Ga0209489_100057 3300027361 Bacteria 147398
483 Ga0209489_100063 3300027361 Bacteria 144408
484 Ga0209700_100006 3300027363 Bacteria 530958
485 Ga0209700_100012 3300027363 Bacteria 357892
486 Ga0268266_10004891 3300028379 Bacteria 12707
487 Ga0268266_10013890 3300028379 Bacteria 6934
488 Ga0268266_10029751 3300028379 Bacteria 4640
489 Ga0268266_10150134 3300028379 Bacteria 2099
490 Ga0268266_10239949 3300028379 Bacteria 1672
491 Ga0268266_10251298 3300028379 Bacteria 1635
492 Ga0268265_10031565 3300028380 Bacteria 3826
493 Ga0268265_10204273 3300028380 Bacteria 1716
494 Ga0268265_10287455 3300028380 Bacteria 1474
495 Ga0268264_10000042 3300028381 Bacteria 372069
496 Ga0265337_1033706 3300028556 Bacteria 1510
497 Ga0265323_10004217 3300028653 Bacteria 6219
498 Ga0307517_10000176 3300028786 Bacteria 105402
499 Ga0307515_10170151 3300028794 Bacteria 2176
500 Ga0307515_10170492 3300028794 Bacteria 2172
501 Ga0307515_10320650 3300028794 Bacteria 1216
502 Ga0265338_10000018 3300028800 Bacteria 338910
503 Ga0307511_10109053 3300030521 Bacteria 1772
504 Ga0265330_10017820 3300031235 Bacteria 3267
505 Ga0265332_10009331 3300031238 Bacteria 4382
506 Ga0265325_10005802 3300031241 Bacteria 7568
507 Ga0265340_10001337 3300031247 Bacteria 14130
508 Ga0265340_10025601 3300031247 Bacteria 2987
509 Ga0265339_10000383 3300031249 Bacteria 34934
510 Ga0265331_10116621 3300031250 Bacteria 1222
511 Ga0307513_10198053 3300031456 Bacteria 1853
512 Ga0307508_10000029 3300031616 Bacteria 168411
513 Ga0307508_10094048 3300031616 Bacteria 2588
514 Ga0307508_10208833 3300031616 Bacteria 1553
515 Ga0265314_10006665 3300031711 Bacteria 10147
516 Ga0265314_10008159 3300031711 Bacteria 9012
517 Ga0265342_10005588 3300031712 Bacteria 9535
518 Ga0307516_10010558 3300031730 Bacteria 10139
519 Ga0307516_10052151 3300031730 Bacteria 4006
520 Ga0307516_10159510 3300031730 Bacteria 2007
521 Ga0307516_10334755 3300031730 Bacteria 1182
522 Ga0307405_10126650 3300031731 Bacteria 1757
523 Ga0307413_10027580 3300031824 Bacteria 3149
524 Ga0307518_10172468 3300031838 Bacteria 1473
525 Ga0307407_10204728 3300031903 Bacteria 1325
526 Ga0307412_10317466 3300031911 Bacteria 1238
527 Ga0307409_100111072 3300031995 Bacteria 2298
528 Ga0307414_10206054 3300032004 Bacteria 1604
529 Ga0307415_100059081 3300032126 Bacteria 2643
530 Ga0307415_100255756 3300032126 Bacteria 1426
531 Ga0307507_10018699 3300033179 Bacteria 7861
532 Ga0307510_10010093 3300033180 Bacteria 11228
533 Ga0307510_10016909 3300033180 Bacteria 8604
534 Ga0307510_10069235 3300033180 Bacteria 3536
535 Ga0307510_10082122 3300033180 Bacteria 3120
536 Ga0307510_10092093 3300033180 Bacteria 2870
537 Ga0307510_10287697 3300033180 Bacteria 1111
538 Ga0315911_1000005 3300033442 Bacteria 426255
539 Ga0316215_1002174 3300033544 Bacteria 1854
540 Ga0373934_0008533 3300035086 Bacteria 3819
541 Ga0373923_0000376 3300035111 Bacteria 10201
542 Ga0373936_0042953 3300035113 Bacteria 1816
543 Ga0373936_0045036 3300035113 Bacteria 1776
544 Ga0373945_0013564 3300035116 Bacteria 2721
545 Ga0373953_0000156 3300035117 Bacteria 17676
546 Ga0373953_0008171 3300035117 Bacteria 3542
547 Ga0373953_0123191 3300035117 Bacteria 1102
548 Ga0373954_0007578 3300035118 Bacteria 4751
549 Ga0373954_0020449 3300035118 Bacteria 2994
550 Ga0373956_0002378 3300035119 Bacteria 7686
551 Ga0373956_0103597 3300035119 Bacteria 1322
552 Ga0373957_0017078 3300035120 Bacteria 2521
553 Ga0373957_0063987 3300035120 Bacteria 1429
554 Ga0373943_0040115 3300035170 Bacteria 2259
555 Ga0373943_0101959 3300035170 Bacteria 1502
556 Ga0373943_0134726 3300035170 Bacteria 1325
557 Ga0373946_0043204 3300035171 Bacteria 1856
558 Ga0373955_0000395 3300035172 Bacteria 18509
559 Ga0373955_0013079 3300035172 Bacteria 4003
560 Ga0373955_0022863 3300035172 Bacteria 3177
561 Ga0373962_0044677 3300035242 Bacteria 1259
562 Ga0373924_0010939 3300035410 Bacteria 3359
563 Ga0373924_0013913 3300035410 Bacteria 3031
564 Ga0373924_0055242 3300035410 Bacteria 1652
565 Ga0373931_0018329 3300035691 Bacteria 3480
566 Ga0373935_0055538 3300035692 Bacteria 2523
567 Ga0373927_0002702 3300035695 Bacteria 12926
568 Ga0373927_0004819 3300035695 Bacteria 9380
569 Ga0373927_0005543 3300035695 Bacteria 8684
570 Ga0373927_0007994 3300035695 Bacteria 7144
571 Ga0373927_0017690 3300035695 Bacteria 4689
572 Ga0373927_0043246 3300035695 Bacteria 2917
573 Ga0373933_0001227 3300035724 Bacteria 15171
574 Ga0373933_0004820 3300035724 Bacteria 7373
575 Ga0373933_0075719 3300035724 Bacteria 2055
576 Ga0373933_0193597 3300035724 Bacteria 1299
577 Ga0373947_0003219 3300035725 Bacteria 9692
578 Ga0373947_0006770 3300035725 Bacteria 6647
579 Ga0373947_0044253 3300035725 Bacteria 2660
580 Ga0373947_0050934 3300035725 Bacteria 2490
581 Ga0373937_0053490 3300036401 Bacteria 3703
582 Ga0373937_0096791 3300036401 Bacteria 2737
583 Ga0373937_0128821 3300036401 Bacteria 2362
584 Ga0372808_002595 3300036459 Bacteria 2107
585 Ga0373925_0009475 3300037068 Bacteria 7089
586 Ga0373925_0042948 3300037068 Bacteria 3354
587 Ga0373925_0053938 3300037068 Bacteria 3006
588 Ga0373925_0055671 3300037068 Bacteria 2961
589 Ga0373925_0099706 3300037068 Bacteria 2231
590 Ga0395899_0076124 3300037312 Bacteria 2450
591 Ga0395900_0047842 3300037418 Bacteria 4405
592 Ga0395900_0102016 3300037418 Bacteria 2947
593 Ga0395900_0112435 3300037418 Bacteria 2796
594 Ga0395900_0216970 3300037418 Bacteria 1930
595 Ga0395900_0229693 3300037418 Bacteria 1866
596 Ga0395900_0272758 3300037418 Bacteria 1686
597 Ga0395898_0017601 3300037466 Bacteria 7294
598 Ga0395898_0028587 3300037466 Bacteria 5587
599 Ga0395898_0088505 3300037466 Bacteria 2981
600 Ga0395898_0152606 3300037466 Bacteria 2210
601 Ga0395898_0195694 3300037466 Bacteria 1931
602 Ga0395905_0020329 3300037471 Bacteria 6289
603 Ga0395905_0046809 3300037471 Bacteria 4056
604 Ga0436364_0974159 3300037853 Bacteria 22406
605 Ga0395901_0008223 3300038443 Bacteria 10541
606 Ga0395901_0230018 3300038443 Bacteria 1936
607 Ga0395901_0248432 3300038443 Bacteria 1854
608 Ga0395901_0305113 3300038443 Bacteria 1650
609 Ga0436365_0902375 3300039437 Bacteria 4502
610 Ga0436365_1181574 3300039437 Bacteria 1670
611 Ga0436365_1371184 3300039437 Bacteria 10334
612 Ga0436365_1421230 3300039437 Bacteria 2143
613 Ga0436360_1202522 3300039438 Bacteria 1358
614 Ga0436361_0189402 3300039447 Bacteria 1894
615 Ga0436363_0012099 3300039450 Bacteria 11206
616 Ga0436363_0300253 3300039450 Bacteria 1244
617 Ga0436363_0351383 3300039450 Bacteria 1124
618 Ga0436363_0717611 3300039450 Bacteria 1331
619 Ga0436363_0972840 3300039450 Bacteria 1425
620 Ga0436362_0993687 3300039453 Bacteria 2478
621 Ga0439459_0027711 3300042438 Bacteria 1133
622 Ga0466972_0000177 3300044658 Bacteria 49318
623 Ga0466972_0009169 3300044658 Bacteria 4969
624 Ga0466965_0060131 3300044683 Bacteria 1897
625 Ga0466966_0008326 3300044684 Bacteria 6872
626 Ga0466966_0112238 3300044684 Bacteria 1680
627 Ga0466966_0127871 3300044684 Bacteria 1557
628 Ga0466961_0000023 3300044693 Bacteria 97134
629 Ga0466963_0139531 3300044694 Bacteria 1678
630 Ga0466963_0248798 3300044694 Bacteria 1247
631 Ga0466971_0050539 3300044719 Bacteria 1871
632 Ga0466968_0001025 3300044735 Bacteria 9854
633 Ga0466968_0063853 3300044735 Bacteria 1592
634 Ga0466957_0042855 3300044842 Bacteria 2739
635 Ga0466960_0039020 3300044901 Bacteria 2237
636 Ga0466959_0011640 3300045049 Bacteria 6326
637 Ga0466959_0030640 3300045049 Bacteria 3983
638 Ga0466967_0055936 3300045976 Bacteria 3477
639 Ga0466967_0121122 3300045976 Bacteria 2417
640 Ga0466967_0184510 3300045976 Bacteria 1969
641 Ga0466967_0235009 3300045976 Bacteria 1746
642 Ga0495617_022025 3300046452 Bacteria 2153
643 Ga0495617_044644 3300046452 Bacteria 1478
644 Ga0495592_0014358 3300046454 Bacteria 6013
645 Ga0495592_0030040 3300046454 Bacteria 4110
646 Ga0495592_0041543 3300046454 Bacteria 3446
647 Ga0495592_0064793 3300046454 Bacteria 2677
648 Ga0495603_0000521 3300046455 Bacteria 21337
649 Ga0495603_0001754 3300046455 Bacteria 12775
650 Ga0495603_0008860 3300046455 Bacteria 6082
651 Ga0495603_0025504 3300046455 Bacteria 3575
652 Ga0495603_0028412 3300046455 Bacteria 3373
653 Ga0495603_0029577 3300046455 Bacteria 3303
654 Ga0495603_0051688 3300046455 Bacteria 2441
655 Ga0495629_0000416 3300046459 Bacteria 35794
656 Ga0495629_0015774 3300046459 Bacteria 5425
657 Ga0495629_0027646 3300046459 Bacteria 4027
658 Ga0495629_0032989 3300046459 Bacteria 3664
659 Ga0495629_0252456 3300046459 Bacteria 1213
660 Ga0495638_0022170 3300046460 Bacteria 4171
661 Ga0495638_0038240 3300046460 Bacteria 3050
662 Ga0495638_0182674 3300046460 Bacteria 1195
663 Ga0495641_0002593 3300046461 Bacteria 14172
664 Ga0495641_0140642 3300046461 Bacteria 1078
665 Ga0495651_0017227 3300046462 Bacteria 5599
666 Ga0495651_0019582 3300046462 Bacteria 5248
667 Ga0495651_0080458 3300046462 Bacteria 2461
668 Ga0495653_0003573 3300046463 Bacteria 12536
669 Ga0495653_0023310 3300046463 Bacteria 5003
670 Ga0495653_0210320 3300046463 Bacteria 1314
671 Ga0495650_0039141 3300046471 Bacteria 2048
672 Ga0495580_0016728 3300046472 Bacteria 5504
673 Ga0495580_0039257 3300046472 Bacteria 3387
674 Ga0495580_0113133 3300046472 Bacteria 1885
675 Ga0495582_0002376 3300046473 Bacteria 10534
676 Ga0495582_0070470 3300046473 Bacteria 1934
677 Ga0495582_0080684 3300046473 Bacteria 1807
678 Ga0495605_0065220 3300046474 Bacteria 1732
679 Ga0495639_0001046 3300046475 Bacteria 12485
680 Ga0495639_0061572 3300046475 Bacteria 1721
681 Ga0495639_0096435 3300046475 Bacteria 1392
682 Ga0495662_0008728 3300046476 Bacteria 4984
683 Ga0495664_0009023 3300046477 Bacteria 5574
684 Ga0495664_0009265 3300046477 Bacteria 5505
685 Ga0495664_0050469 3300046477 Bacteria 2471
686 Ga0495664_0125425 3300046477 Bacteria 1553
687 Ga0495664_0126090 3300046477 Bacteria 1549
688 Ga0495584_0016300 3300046491 Bacteria 3790
689 Ga0495584_0080163 3300046491 Bacteria 1642
690 Ga0495585_0035154 3300046492 Bacteria 2833
691 Ga0495594_0000194 3300046499 Bacteria 29650
692 Ga0495594_0015448 3300046499 Bacteria 4011
693 Ga0495594_0074283 3300046499 Bacteria 1894
694 Ga0495596_0093615 3300046500 Bacteria 1166
695 Ga0495583_0028181 3300046506 Bacteria 2765
696 Ga0495583_0061572 3300046506 Bacteria 1674
697 Ga0495606_0002692 3300046507 Bacteria 20068
698 Ga0495606_0028857 3300046507 Bacteria 3906
699 Ga0495606_0212094 3300046507 Bacteria 1096
700 Ga0495608_0005104 3300046511 Bacteria 9377
701 Ga0495608_0031821 3300046511 Bacteria 3565
702 Ga0495608_0032235 3300046511 Bacteria 3542
703 Ga0495608_0032328 3300046511 Bacteria 3536
704 Ga0495608_0172333 3300046511 Bacteria 1372
705 Ga0495610_0027743 3300046512 Bacteria 3004
706 Ga0495610_0037091 3300046512 Bacteria 2484
707 Ga0495618_0049985 3300046514 Bacteria 2640
708 Ga0495618_0060411 3300046514 Bacteria 2403
709 Ga0495618_0075508 3300046514 Bacteria 2147
710 Ga0495620_0010396 3300046515 Bacteria 4912
711 Ga0495620_0033954 3300046515 Bacteria 2310
712 Ga0495628_0044263 3300046516 Bacteria 3542
713 Ga0495628_0058442 3300046516 Bacteria 3030
714 Ga0495628_0106350 3300046516 Bacteria 2161
715 Ga0495628_0321080 3300046516 Bacteria 1142
716 Ga0495630_0006451 3300046517 Bacteria 8344
717 Ga0495630_0097184 3300046517 Bacteria 2227
718 Ga0495630_0134827 3300046517 Bacteria 1876
719 Ga0495630_0333958 3300046517 Bacteria 1159
720 Ga0495632_0077742 3300046519 Bacteria 1586
721 Ga0495643_0076774 3300046522 Bacteria 1746
722 Ga0495643_0168421 3300046522 Bacteria 1073
723 Ga0495644_0012613 3300046523 Bacteria 3250
724 Ga0495644_0028145 3300046523 Bacteria 2127
725 Ga0495644_0052933 3300046523 Bacteria 1525
726 Ga0495648_0000640 3300046524 Bacteria 37287
727 Ga0495648_0004726 3300046524 Bacteria 11536
728 Ga0495648_0031996 3300046524 Bacteria 3458
729 Ga0495648_0093792 3300046524 Bacteria 1673
730 Ga0495648_0155220 3300046524 Bacteria 1189
731 Ga0495652_0010465 3300046529 Bacteria 8405
732 Ga0495652_0030338 3300046529 Bacteria 4743
733 Ga0495652_0046863 3300046529 Bacteria 3709
734 Ga0495652_0062849 3300046529 Bacteria 3128
735 Ga0495652_0075223 3300046529 Bacteria 2806
736 Ga0495652_0094913 3300046529 Bacteria 2432
737 Ga0495665_0028025 3300046531 Bacteria 3022
738 Ga0495640_0006591 3300046533 Bacteria 9166
739 Ga0495640_0011385 3300046533 Bacteria 6843
740 Ga0495640_0020972 3300046533 Bacteria 4803
741 Ga0495640_0030206 3300046533 Bacteria 3882
742 Ga0495586_0175358 3300046535 Bacteria 1212
743 Ga0495587_0010857 3300046536 Bacteria 5781
744 Ga0495587_0035814 3300046536 Bacteria 2988
745 Ga0495587_0082267 3300046536 Bacteria 1866
746 Ga0495598_0080814 3300046537 Bacteria 1042
747 Ga0495609_0024989 3300046538 Bacteria 2739
748 Ga0495621_0045917 3300046539 Bacteria 1548
749 Ga0495597_0089847 3300046542 Bacteria 1305
750 Ga0495645_0012719 3300046543 Bacteria 5938
751 Ga0495645_0012763 3300046543 Bacteria 5928
752 Ga0495622_0002024 3300046557 Bacteria 9908
753 Ga0495622_0060394 3300046557 Bacteria 1755
754 Ga0495633_0035962 3300046558 Bacteria 2375
755 Ga0495633_0036957 3300046558 Bacteria 2338
756 Ga0495667_0009312 3300046559 Bacteria 6655
757 Ga0495667_0020357 3300046559 Bacteria 4477
758 Ga0495667_0030759 3300046559 Bacteria 3607
759 Ga0495667_0114893 3300046559 Bacteria 1739
760 Ga0495667_0196348 3300046559 Bacteria 1292
761 Ga0495667_0256126 3300046559 Bacteria 1113
762 Ga0495656_0005884 3300046615 Bacteria 4266
763 Ga0495656_0014228 3300046615 Bacteria 2979
764 Ga0495656_0021610 3300046615 Bacteria 2507
765 Ga0495656_0038955 3300046615 Bacteria 1972
766 Ga0495668_0013742 3300046616 Bacteria 4764
767 Ga0495668_0091403 3300046616 Bacteria 1668
768 Ga0495668_0099536 3300046616 Bacteria 1590
769 Ga0495634_0000602 3300046642 Bacteria 34812
770 Ga0495634_0029561 3300046642 Bacteria 3793
771 Ga0495634_0031702 3300046642 Bacteria 3639
772 Ga0495625_0012900 3300046660 Bacteria 6751
773 Ga0495625_0068905 3300046660 Bacteria 2486
774 Ga0495635_0002469 3300046663 Bacteria 12625
775 Ga0495635_0003077 3300046663 Bacteria 11477
776 Ga0495635_0047928 3300046663 Bacteria 2945
777 Ga0495635_0116781 3300046663 Bacteria 1821
778 Ga0495635_0247729 3300046663 Bacteria 1201
779 Ga0495659_0025775 3300046664 Bacteria 2014
780 Ga0495661_0078336 3300046665 Bacteria 1912
781 Ga0495661_0108046 3300046665 Bacteria 1555
782 Ga0495588_0025303 3300046674 Bacteria 2956
783 Ga0495588_0037312 3300046674 Bacteria 2468
784 Ga0495588_0119203 3300046674 Bacteria 1391
785 Ga0495657_0004929 3300046675 Bacteria 10619
786 Ga0495657_0021231 3300046675 Bacteria 4660
787 Ga0495657_0026420 3300046675 Bacteria 4110
788 Ga0495657_0044079 3300046675 Bacteria 3037
789 Ga0495599_0006110 3300046678 Bacteria 7252
790 Ga0495599_0006329 3300046678 Bacteria 7136
791 Ga0495599_0011625 3300046678 Bacteria 5415
792 Ga0495623_0004956 3300046679 Bacteria 8733
793 Ga0495623_0011109 3300046679 Bacteria 5828
794 Ga0495623_0016712 3300046679 Bacteria 4740
795 Ga0495646_0048818 3300046680 Bacteria 2570
796 Ga0495646_0060074 3300046680 Bacteria 2268
797 Ga0495646_0076660 3300046680 Bacteria 1957
798 Ga0495646_0108652 3300046680 Bacteria 1581
799 Ga0495647_0000414 3300046681 Bacteria 12222
800 Ga0495658_0002719 3300046683 Bacteria 8895
801 Ga0495658_0028724 3300046683 Bacteria 3004
802 Ga0495658_0183068 3300046683 Bacteria 1300
803 Ga0495669_0044936 3300046684 Bacteria 1968
804 Ga0495613_0022972 3300046689 Bacteria 4647
805 Ga0495613_0033323 3300046689 Bacteria 3828
806 Ga0495613_0148239 3300046689 Bacteria 1674
807 Ga0495613_0188071 3300046689 Bacteria 1460
808 Ga0495613_0208217 3300046689 Bacteria 1376
809 Ga0495624_0003072 3300046690 Bacteria 12498
810 Ga0495624_0038315 3300046690 Bacteria 3080
811 Ga0495624_0068957 3300046690 Bacteria 2204
812 Ga0495670_0001065 3300046691 Bacteria 13316
813 Ga0495670_0043819 3300046691 Bacteria 2233
814 Ga0495671_0065512 3300046692 Bacteria 1788
815 Ga0495649_0026167 3300046694 Bacteria 3247
816 Ga0495649_0046915 3300046694 Bacteria 2351
817 Ga0495589_0022229 3300046794 Bacteria 3238
818 Ga0495600_0012415 3300046809 Bacteria 5326
819 Ga0495600_0012561 3300046809 Bacteria 5298
820 Ga0495600_0038915 3300046809 Bacteria 3096
821 Ga0495600_0081594 3300046809 Bacteria 2111
822 Ga0495581_0000133 3300047315 Bacteria 32384
823 Ga0495581_0132153 3300047315 Bacteria 1454
824 Ga0495581_0150227 3300047315 Bacteria 1360
825 Ga0495581_0202051 3300047315 Bacteria 1162
826 Ga0495581_0256787 3300047315 Bacteria 1022
827 Ga0495604_0013217 3300047317 Bacteria 6575
828 Ga0495604_0054319 3300047317 Bacteria 3091
829 Ga0495604_0089599 3300047317 Bacteria 2286
830 Ga0495674_0000874 3300047319 Bacteria 28828
831 Ga0495674_0012220 3300047319 Bacteria 8091
832 Ga0495674_0054204 3300047319 Bacteria 3522
833 Ga0495674_0317188 3300047319 Bacteria 1271
834 Ga0495672_0025641 3300047320 Bacteria 3768
835 Ga0495672_0035311 3300047320 Bacteria 3079
836 Ga0495676_0015692 3300047321 Bacteria 6736
837 Ga0495676_0064310 3300047321 Bacteria 2854
838 Ga0495676_0120501 3300047321 Bacteria 1909
839 Ga0495676_0134248 3300047321 Bacteria 1782
840 Ga0495680_0017277 3300047322 Bacteria 6164
841 Ga0495680_0053089 3300047322 Bacteria 3156
842 Ga0495680_0258365 3300047322 Bacteria 1232
843 Ga0495687_013529 3300047443 Bacteria 4253
844 Ga0495675_0001856 3300047444 Bacteria 12578
845 Ga0495675_0014102 3300047444 Bacteria 5052
846 Ga0495675_0014120 3300047444 Bacteria 5049
847 Ga0495673_0004092 3300047469 Bacteria 9261
848 Ga0495684_0000294 3300047471 Bacteria 40596
849 Ga0495684_0020080 3300047471 Bacteria 5146
850 Ga0495684_0025060 3300047471 Bacteria 4588
851 Ga0495684_0049052 3300047471 Bacteria 3227
852 Ga0495686_0180977 3300047472 Bacteria 1221
853 Ga0495593_0000022 3300047673 Bacteria 69741
854 Ga0495593_0000744 3300047673 Bacteria 18938
855 Ga0495593_0009120 3300047673 Bacteria 5754
856 Ga0495593_0016629 3300047673 Bacteria 4147
857 Ga0495593_0032757 3300047673 Bacteria 2832
858 Ga0495602_0030626 3300048088 Bacteria 5100
859 Ga0495602_0060623 3300048088 Bacteria 3295
860 Ga0495602_0156786 3300048088 Bacteria 1782
861 Ga0495602_0209035 3300048088 Bacteria 1483
862 Ga0495602_0230461 3300048088 Bacteria 1392
863 Ga0495602_0271777 3300048088 Bacteria 1252
864 Ga0495614_0022860 3300048089 Bacteria 2695
865 Ga0496100_0003499 3300048903 Bacteria 8201
866 Ga0496100_0147031 3300048903 Bacteria 1677
867 Ga0496101_0009124 3300048904 Bacteria 6509
868 Ga0496101_0056421 3300048904 Bacteria 2840
869 Ga0496101_0153683 3300048904 Bacteria 1761
870 Ga0496101_0349734 3300048904 Bacteria 1161
871 Ga0496102_0006184 3300048905 Bacteria 10206
872 Ga0496102_0029606 3300048905 Bacteria 4900
873 Ga0496102_0059757 3300048905 Bacteria 3486
874 Ga0496102_0073409 3300048905 Bacteria 3144
875 Ga0496102_0159376 3300048905 Bacteria 2122
876 Ga0496102_0160810 3300048905 Bacteria 2113
877 Ga0496102_0307848 3300048905 Bacteria 1493
878 Ga0496103_0006862 3300048906 Bacteria 6799
879 Ga0496103_0061923 3300048906 Bacteria 2328
880 Ga0496103_0165405 3300048906 Bacteria 1419
881 Ga0496103_0210261 3300048906 Bacteria 1251
882 Ga0496104_0002005 3300048907 Bacteria 17670
883 Ga0496104_0030942 3300048907 Bacteria 4976
884 Ga0496104_0039125 3300048907 Bacteria 4439
885 Ga0496104_0043721 3300048907 Bacteria 4207
886 Ga0496104_0070616 3300048907 Bacteria 3320
887 Ga0496104_0110978 3300048907 Bacteria 2629
888 Ga0496104_0164368 3300048907 Bacteria 2128
889 Ga0496104_0166508 3300048907 Bacteria 2114
890 Ga0496105_0015812 3300048908 Bacteria 6019
891 Ga0496105_0018819 3300048908 Bacteria 5561
892 Ga0496105_0026728 3300048908 Bacteria 4710
893 Ga0496105_0127943 3300048908 Bacteria 2094
894 Ga0496105_0239545 3300048908 Bacteria 1473
895 Ga0496106_0003691 3300048909 Bacteria 11418
896 Ga0496106_0007852 3300048909 Bacteria 7895
897 Ga0496106_0009940 3300048909 Bacteria 7024
898 Ga0496106_0010150 3300048909 Bacteria 6957
899 Ga0496106_0038934 3300048909 Bacteria 3560
900 Ga0496106_0309438 3300048909 Bacteria 1267
901 Ga0496106_0413790 3300048909 Bacteria 1084
902 Ga0496107_0020799 3300048910 Bacteria 4637
903 Ga0496107_0042505 3300048910 Bacteria 3264
904 Ga0496107_0063392 3300048910 Bacteria 2678
905 Ga0496107_0122472 3300048910 Bacteria 1916
906 Ga0496107_0315214 3300048910 Bacteria 1164
907 Ga0496108_0024899 3300048911 Bacteria 4929
908 Ga0496108_0068090 3300048911 Bacteria 3003
909 Ga0496108_0079127 3300048911 Bacteria 2783
910 Ga0496108_0150464 3300048911 Bacteria 2008
911 Ga0496108_0215261 3300048911 Bacteria 1668
912 Ga0496109_0000910 3300048912 Bacteria 24624
913 Ga0496109_0010481 3300048912 Bacteria 7919
914 Ga0496109_0016308 3300048912 Bacteria 6493
915 Ga0496109_0016600 3300048912 Bacteria 6439
916 Ga0496109_0061904 3300048912 Bacteria 3422
917 Ga0496109_0157729 3300048912 Bacteria 2126
918 Ga0496109_0593720 3300048912 Bacteria 1043
919 Ga0496110_0039029 3300048913 Bacteria 4134
920 Ga0496110_0074770 3300048913 Bacteria 3010
921 Ga0496110_0145765 3300048913 Bacteria 2141
922 Ga0496110_0275393 3300048913 Bacteria 1532
923 Ga0496111_0011896 3300048914 Bacteria 5879
924 Ga0496111_0094046 3300048914 Bacteria 2198
925 Ga0496111_0267495 3300048914 Bacteria 1268
926 Ga0496111_0361996 3300048914 Bacteria 1073
927 Ga0496112_0000022 3300048915 Bacteria 156255
928 Ga0496112_0008650 3300048915 Bacteria 9128
929 Ga0496112_0020467 3300048915 Bacteria 6273
930 Ga0496112_0020945 3300048915 Bacteria 6208
931 Ga0496112_0029523 3300048915 Bacteria 5303
932 Ga0496112_0035183 3300048915 Bacteria 4877
933 Ga0496112_0039089 3300048915 Bacteria 4634
934 Ga0496112_0067762 3300048915 Bacteria 3523
935 Ga0496112_0113658 3300048915 Bacteria 2678
936 Ga0496112_0162367 3300048915 Bacteria 2201
937 Ga0496112_0318263 3300048915 Bacteria 1500
938 Ga0496113_0001596 3300048916 Bacteria 12741
939 Ga0496113_0021222 3300048916 Bacteria 4579
940 Ga0496113_0026536 3300048916 Bacteria 4142
941 Ga0496113_0094105 3300048916 Bacteria 2314
942 Ga0496113_0131651 3300048916 Bacteria 1963
943 Ga0496114_0072883 3300048917 Bacteria 2889
944 Ga0496114_0116982 3300048917 Bacteria 2289
945 Ga0496114_0310704 3300048917 Bacteria 1392
946 Ga0496114_0397536 3300048917 Bacteria 1220
947 Ga0496115_0032084 3300048918 Bacteria 4143
948 Ga0496115_0037994 3300048918 Bacteria 3819
949 Ga0496115_0043743 3300048918 Bacteria 3571
950 Ga0496115_0043883 3300048918 Bacteria 3565
951 Ga0496115_0047207 3300048918 Bacteria 3443
952 Ga0496115_0083801 3300048918 Bacteria 2599
953 Ga0496115_0122982 3300048918 Bacteria 2136
954 Ga0496115_0126130 3300048918 Bacteria 2108
955 Ga0496115_0133100 3300048918 Bacteria 2050
956 Ga0496115_0161714 3300048918 Bacteria 1850
957 Ga0496115_0328247 3300048918 Bacteria 1250
958 Ga0496116_0004251 3300048919 Bacteria 13742
959 Ga0496117_0012698 3300048920 Bacteria 7397
960 Ga0496117_0028820 3300048920 Bacteria 4292
961 Ga0496118_0016505 3300048921 Bacteria 6773
962 Ga0496118_0031958 3300048921 Bacteria 4348
963 Ga0496118_0032185 3300048921 Bacteria 4328
964 Ga0496119_0022613 3300048922 Bacteria 4493
965 Ga0496119_0022773 3300048922 Bacteria 4471
966 Ga0496119_0023433 3300048922 Bacteria 4377
967 Ga0496120_0021002 3300048923 Bacteria 4133
968 Ga0496120_0059770 3300048923 Bacteria 2135
969 Ga0496120_0076022 3300048923 Bacteria 1831
970 Ga0496121_0000146 3300048924 Bacteria 154459
971 Ga0496121_0000254 3300048924 Bacteria 113314
972 Ga0496121_0001567 3300048924 Bacteria 38104
973 Ga0496121_0019232 3300048924 Bacteria 6840
974 Ga0496121_0024814 3300048924 Bacteria 5718
975 Ga0496121_0069007 3300048924 Bacteria 2856
976 Ga0496121_0080649 3300048924 Bacteria 2579
977 Ga0496121_0094782 3300048924 Bacteria 2321
978 Ga0496121_0099020 3300048924 Bacteria 2254
979 Ga0496121_0111711 3300048924 Bacteria 2083
980 Ga0496121_0123657 3300048924 Bacteria 1949
981 Ga0496121_0157723 3300048924 Bacteria 1663
982 Ga0496121_0170222 3300048924 Bacteria 1583
983 Ga0496121_0258583 3300048924 Bacteria 1203
984 Ga0496121_0300586 3300048924 Bacteria 1089
985 Ga0496122_0009335 3300048925 Bacteria 10359
986 Ga0496122_0044528 3300048925 Bacteria 3461
987 Ga0496122_0051764 3300048925 Bacteria 3116
988 Ga0496122_0194241 3300048925 Bacteria 1194
989 Ga0496124_0001236 3300048927 Bacteria 39269
990 Ga0496124_0067274 3300048927 Bacteria 2982
991 Ga0496124_0102995 3300048927 Bacteria 2309
992 Ga0496124_0340978 3300048927 Bacteria 1064
993 Ga0496125_0000099 3300048928 Bacteria 203333
994 Ga0496125_0002791 3300048928 Bacteria 22081
995 Ga0496125_0010906 3300048928 Bacteria 9137
996 Ga0496125_0015991 3300048928 Bacteria 7225
997 Ga0496125_0029525 3300048928 Bacteria 4926
998 Ga0496125_0043420 3300048928 Bacteria 3816
999 Ga0496125_0053712 3300048928 Bacteria 3300
1000 Ga0496126_0007002 3300048929 Bacteria 12454
1001 Ga0496126_0012504 3300048929 Bacteria 8690
1002 Ga0496126_0017287 3300048929 Bacteria 7187
1003 Ga0496126_0027699 3300048929 Bacteria 5408
1004 Ga0496126_0031094 3300048929 Bacteria 5048
1005 Ga0496126_0038428 3300048929 Bacteria 4454
1006 Ga0496126_0039889 3300048929 Bacteria 4354
1007 Ga0496126_0043377 3300048929 Bacteria 4149
1008 Ga0496126_0047403 3300048929 Bacteria 3934
1009 Ga0496126_0052470 3300048929 Bacteria 3705
1010 Ga0496126_0054860 3300048929 Bacteria 3607
1011 Ga0496126_0072997 3300048929 Bacteria 3051
1012 Ga0496126_0074489 3300048929 Bacteria 3015
1013 Ga0496126_0085828 3300048929 Bacteria 2774
1014 Ga0496126_0088703 3300048929 Bacteria 2724
1015 Ga0496126_0117052 3300048929 Bacteria 2315
1016 Ga0496126_0157571 3300048929 Bacteria 1942
1017 Ga0496126_0181511 3300048929 Bacteria 1788
1018 Ga0496126_0228793 3300048929 Bacteria 1558
1019 Ga0496126_0277747 3300048929 Bacteria 1388
1020 Ga0495678_045022 3300049459 Bacteria 1743
1021 Ga0495678_076933 3300049459 Bacteria 1208
1022 Ga0495682_0054436 3300049460 Bacteria 1452
1023 Ga0495682_0074821 3300049460 Bacteria 1218
1024 Ga0501031_0038957 3300049568 Bacteria 3100
1025 Ga0501031_0128997 3300049568 Bacteria 1652
1026 Ga0501033_0017918 3300049570 Bacteria 5347
1027 Ga0501033_0152040 3300049570 Bacteria 1669
1028 Ga0501033_0301708 3300049570 Bacteria 1127
1029 Ga0501034_0051004 3300049571 Bacteria 4173
1030 Ga0501034_0076053 3300049571 Bacteria 3364
1031 Ga0501034_0140986 3300049571 Bacteria 2390
1032 Ga0501034_0190086 3300049571 Bacteria 2016
1033 Ga0501034_0290059 3300049571 Bacteria 1574
1034 Ga0501034_0425660 3300049571 Bacteria 1248
1035 Ga0501036_0080538 3300049572 Bacteria 2753
1036 Ga0501036_0427198 3300049572 Bacteria 1104
1037 Ga0501037_0045907 3300049573 Bacteria 3205
1038 Ga0501037_0063104 3300049573 Bacteria 2701
1039 Ga0501037_0170333 3300049573 Bacteria 1548
1040 Ga0501037_0233594 3300049573 Bacteria 1290
1041 Ga0501038_0003347 3300049574 Bacteria 14952
1042 Ga0501038_0127264 3300049574 Bacteria 2095
1043 Ga0501038_0265321 3300049574 Bacteria 1355
1044 Ga0501039_0058689 3300049575 Bacteria 2980
1045 Ga0501039_0132838 3300049575 Bacteria 1953
1046 Ga0501039_0154459 3300049575 Bacteria 1803
1047 Ga0501039_0173689 3300049575 Bacteria 1694
1048 Ga0501040_0024640 3300049576 Bacteria 4039
1049 Ga0501042_0092237 3300049578 Bacteria 2174
1050 Ga0501043_0022652 3300049579 Bacteria 4925
1051 Ga0501043_0035798 3300049579 Bacteria 3906
1052 Ga0501043_0063091 3300049579 Bacteria 2909
1053 Ga0501043_0115915 3300049579 Bacteria 2103
1054 Ga0501046_0080691 3300049580 Bacteria 2513
1055 Ga0501046_0097458 3300049580 Bacteria 2259
1056 Ga0501046_0104382 3300049580 Bacteria 2172
1057 Ga0501046_0123973 3300049580 Bacteria 1964
1058 Ga0501047_0074414 3300049581 Bacteria 3270
1059 Ga0501048_0048652 3300049582 Bacteria 3023
1060 Ga0501048_0064298 3300049582 Bacteria 2595
1061 Ga0501067_0002459 3300049583 Bacteria 10222
1062 Ga0501067_0042939 3300049583 Bacteria 2511
1063 Ga0501068_0014532 3300049584 Bacteria 4502
1064 Ga0501069_0066775 3300049585 Bacteria 2011
1065 Ga0501069_0085199 3300049585 Bacteria 1783
1066 Ga0501070_0057445 3300049586 Bacteria 3225
1067 Ga0501070_0080344 3300049586 Bacteria 2698
1068 Ga0501070_0150891 3300049586 Bacteria 1917
1069 Ga0501071_0013466 3300049587 Bacteria 5575
1070 Ga0501072_0032282 3300049588 Bacteria 4101
1071 Ga0501072_0135256 3300049588 Bacteria 1965
1072 Ga0501073_0028457 3300049589 Bacteria 3994
1073 Ga0501073_0032066 3300049589 Bacteria 3747
1074 Ga0501073_0194538 3300049589 Bacteria 1403
1075 Ga0501073_0203203 3300049589 Bacteria 1370
1076 Ga0501074_0064390 3300049590 Bacteria 2639
1077 Ga0501077_0077753 3300049593 Bacteria 2102
1078 Ga0501079_0118133 3300049741 Bacteria 2061
1079 Ga0501080_0063191 3300049742 Bacteria 3446
1080 Ga0501083_0041501 3300049744 Bacteria 3120
1081 Ga0501035_0084000 3300049822 Bacteria 2809
1082 Ga0501035_0090339 3300049822 Bacteria 2696
1083 Ga0501035_0110125 3300049822 Bacteria 2413
1084 Ga0501035_0170282 3300049822 Bacteria 1882
1085 Ga0501035_0411886 3300049822 Bacteria 1123
1086 Ga0501044_0032392 3300049823 Bacteria 5496
1087 Ga0501044_0037782 3300049823 Bacteria 5046
1088 Ga0501044_0038321 3300049823 Bacteria 5005
1089 Ga0501044_0088359 3300049823 Bacteria 3128
1090 Ga0501044_0138564 3300049823 Bacteria 2422
1091 Ga0501044_0223236 3300049823 Bacteria 1834
1092 Ga0501044_0240445 3300049823 Bacteria 1754
1093 Ga0501044_0565022 3300049823 Bacteria 1033
1094 Ga0501045_0024317 3300049824 Bacteria 4348
1095 nmdc:mga03683_101559_c1 3300050489 Bacteria 1264
1096 nmdc:mga03683_60325_c1 3300050489 Bacteria 1602
1097 nmdc:mga03n38_2791_c1 3300050490 Bacteria 5486
1098 nmdc:mga03n38_71308_c1 3300050490 Bacteria 1609
1099 nmdc:mga00v17_4195_c1 3300050491 Bacteria 6144
1100 nmdc:mga00v17_70029_c1 3300050491 Bacteria 2172
1101 nmdc:mga00v17_7814_c1 3300050491 Bacteria 5733
1102 nmdc:mga0yw44_27245_c1 3300050492 Bacteria 3271
1103 nmdc:mga0yw44_51316_c1 3300050492 Bacteria 2497
1104 nmdc:mga0yw44_66487_c1 3300050492 Bacteria 2225
1105 nmdc:mga0yw44_69816_c1 3300050492 Bacteria 2177
1106 nmdc:mga0yw44_73238_c1 3300050492 Bacteria 2131
1107 nmdc:mga0yw44_8369_c1 3300050492 Bacteria 5149
1108 nmdc:mga0yw44_97315_c1 3300050492 Bacteria 1869
1109 nmdc:mga0k408_100867_c1 3300050493 Bacteria 1702
1110 nmdc:mga0k408_40338_c1 3300050493 Bacteria 2686
1111 nmdc:mga0k408_60219_c1 3300050493 Bacteria 2206
1112 nmdc:mga06z11_12111_c1 3300050494 Bacteria 3741
1113 nmdc:mga06z11_22737_c1 3300050494 Bacteria 2933
1114 nmdc:mga06z11_228368_c1 3300050494 Bacteria 1090
1115 nmdc:mga06z11_2940_c1 3300050494 Bacteria 6558
1116 nmdc:mga06z11_63873_c1 3300050494 Bacteria 1928
1117 nmdc:mga07m45_104960_c1 3300050496 Bacteria 1625
1118 nmdc:mga07m45_14891_c1 3300050496 Bacteria 4153
1119 nmdc:mga07m45_4272_c1 3300050496 Bacteria 6990
1120 nmdc:mga07m45_66119_c1 3300050496 Bacteria 2054
1121 nmdc:mga07m45_6917_c1 3300050496 Bacteria 5770
1122 nmdc:mga05p37_20147_c1 3300050507 Bacteria 8072
1123 nmdc:mga05p37_72277_c1 3300050507 Bacteria 4244
1124 nmdc:mga0qj67_101885_c1 3300050509 Bacteria 2315
1125 nmdc:mga06r32_56945_c1 3300050510 Bacteria 3754
1126 nmdc:mga0n895_33569_c1 3300050512 Bacteria 4933
1127 nmdc:mga0n895_348159_c1 3300050512 Bacteria 1500
1128 nmdc:mga0n895_71602_c1 3300050512 Bacteria 3438
1129 nmdc:mga0sz30_1155_c1 3300050516 Bacteria 9461
1130 nmdc:mga0sz30_2482_c1 3300050516 Bacteria 6223
1131 Ga0495601_0004994 3300053077 Bacteria 7698
1132 Ga0495601_0013942 3300053077 Bacteria 4840
1133 Ga0495601_0170591 3300053077 Bacteria 1422
1134 Ga0495601_0187674 3300053077 Bacteria 1351
1135 Ga0495612_0011892 3300053078 Bacteria 3508
1136 Ga0495612_0030072 3300053078 Bacteria 2188
1137 Ga0500635_0011261 3300053080 Bacteria 2537
1138 Ga0495595_0000670 3300053084 Bacteria 13076
1139 Ga0495595_0016585 3300053084 Bacteria 3155
1140 Ga0495619_0026443 3300053085 Bacteria 3733
1141 Ga0495619_0035364 3300053085 Bacteria 3248
1142 Ga0495619_0095687 3300053085 Bacteria 2015
1143 Ga0500578_0206155 3300053086 Bacteria 1201
1144 Ga0500643_000052 3300053087 Bacteria 144656
1145 Ga0500651_0014169 3300053093 Bacteria 4875
1146 Ga0500566_0002331 3300053094 Bacteria 11235
1147 Ga0500566_0002512 3300053094 Bacteria 10894
1148 Ga0500566_0002754 3300053094 Bacteria 10472
1149 Ga0500566_0011017 3300053094 Bacteria 5327
1150 Ga0500566_0054199 3300053094 Bacteria 2287
1151 Ga0500641_0037727 3300053096 Bacteria 1938
1152 Ga0500641_0091352 3300053096 Bacteria 1300
1153 Ga0500556_0000035 3300053104 Bacteria 145357
1154 Ga0500557_000057 3300053105 Bacteria 47849
1155 Ga0500562_019096 3300053108 Bacteria 1771
1156 Ga0500572_000655 3300053111 Bacteria 11430
1157 Ga0500572_003541 3300053111 Bacteria 3557
1158 Ga0500591_058871 3300053115 Bacteria 1778
1159 Ga0500594_0002896 3300053118 Bacteria 3744
1160 Ga0500595_002818 3300053119 Bacteria 8361
1161 Ga0500595_004352 3300053119 Bacteria 6371
1162 Ga0500595_028193 3300053119 Bacteria 1916
1163 Ga0500595_034967 3300053119 Bacteria 1658
1164 Ga0500595_062917 3300053119 Bacteria 1116
1165 Ga0500607_109387 3300053121 Bacteria 1357
1166 Ga0500608_000780 3300053122 Bacteria 11633
1167 Ga0500614_003528 3300053123 Bacteria 3363
1168 Ga0500618_004716 3300053125 Bacteria 4280
1169 Ga0500642_0000027 3300053130 Bacteria 119688
1170 Ga0500642_0000263 3300053130 Bacteria 19627
1171 Ga0500642_0112543 3300053130 Bacteria 1271
1172 Ga0500652_000934 3300053131 Bacteria 9664
1173 Ga0500559_0000064 3300053136 Bacteria 85844
1174 Ga0500559_0000486 3300053136 Bacteria 28052
1175 Ga0500559_0003342 3300053136 Bacteria 7941
1176 Ga0500559_0015332 3300053136 Bacteria 3236
1177 Ga0500559_0070038 3300053136 Bacteria 1577
1178 Ga0500568_0001465 3300053139 Bacteria 15127
1179 Ga0500568_0022037 3300053139 Bacteria 2732
1180 Ga0500577_0000035 3300053142 Bacteria 31742
1181 Ga0500588_0053235 3300053146 Bacteria 1270
1182 Ga0500589_041912 3300053147 Bacteria 2135
1183 Ga0500590_017886 3300053148 Bacteria 3666
1184 Ga0500590_054044 3300053148 Bacteria 2034
1185 Ga0500603_000667 3300053150 Bacteria 8359
1186 Ga0500603_001350 3300053150 Bacteria 5626
1187 Ga0500604_0002237 3300053151 Bacteria 5296
1188 Ga0500604_0053553 3300053151 Bacteria 1251
1189 Ga0500616_0000028 3300053153 Bacteria 435722
1190 Ga0500616_0000054 3300053153 Bacteria 290186
1191 Ga0500622_0003626 3300053156 Bacteria 10145
1192 Ga0500622_0006780 3300053156 Bacteria 6591
1193 Ga0500627_0002332 3300053158 Bacteria 5603
1194 Ga0500634_0017216 3300053161 Bacteria 3868
1195 Ga0500634_0042983 3300053161 Bacteria 2450
1196 Ga0500634_0121455 3300053161 Bacteria 1270
1197 Ga0500638_044057 3300053162 Bacteria 2166
1198 Ga0500639_001074 3300053163 Bacteria 13945
1199 Ga0500639_132718 3300053163 Bacteria 1177
1200 Ga0500636_0026615 3300053177 Bacteria 3416
1201 Ga0500636_0030405 3300053177 Bacteria 3193
1202 Ga0500636_0043902 3300053177 Bacteria 2638
1203 Ga0500636_0067038 3300053177 Bacteria 2085
1204 Ga0500636_0126036 3300053177 Bacteria 1431
1205 Ga0500636_0220568 3300053177 Bacteria 988
1206 Ga0500637_0001280 3300053178 Bacteria 10539
1207 Ga0500637_0001814 3300053178 Bacteria 9236
1208 Ga0500637_0138128 3300053178 Bacteria 1411
1209 Ga0500625_118975 3300053729 Bacteria 1066
1210 Ga0500645_014952 3300053730 Bacteria 2466
1211 Ga0500645_041853 3300053730 Bacteria 1352
1212 Ga0500609_006142 3300053731 Bacteria 1637
1213 Ga0500596_000644 3300053735 Bacteria 6723
1214 Ga0500596_008419 3300053735 Bacteria 1645
1215 Ga0500599_002539 3300053736 Bacteria 2191
1216 Ga0500601_003142 3300053737 Bacteria 1785
1217 Ga0501084_0005438 3300054114 Bacteria 10447
1218 Ga0500661_001546 3300055283 Bacteria 4330
1219 Ga0501082_0000040 3300060353 Bacteria 91596
1220 Ga0501082_0018483 3300060353 Bacteria 6004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0099536 Ga0495668_0099536_188_1120 305
2 3300048924 Ga0496121_0300586 Ga0496121_0300586_12_929 305
3 iso_pu_bacteria 2791355199 2793077886 306
4 iso_pu_bacteria 2879110137 2879114941 306
5 iso_pu_bacteria 2889033259 2889037708 306
6 iso_pu_bacteria 8006984368 8006984730 306
7 3300005530 Ga0070679_100034610 Ga0070679_1000346103 307
8 3300013104 Ga0157370_10140019 Ga0157370_101400191 307
9 3300046674 Ga0495588_0025303 Ga0495588_0025303_1788_2717 309
10 3300003320 rootH2_10188699 rootH2_101886991 310
11 3300005334 Ga0068869_100087480 Ga0068869_1000874804 310
12 3300005338 Ga0068868_100005183 Ga0068868_1000051836 310
13 3300005347 Ga0070668_100046605 Ga0070668_1000466052 310
14 3300005347 Ga0070668_100081859 Ga0070668_1000818594 310
15 3300005456 Ga0070678_100084703 Ga0070678_1000847033 310
16 3300005546 Ga0070696_100094591 Ga0070696_1000945912 310
17 3300005548 Ga0070665_100021701 Ga0070665_1000217012 310
18 3300005548 Ga0070665_100057391 Ga0070665_1000573913 310
19 3300005548 Ga0070665_100084638 Ga0070665_1000846383 310
20 3300005617 Ga0068859_100304741 Ga0068859_1003047412 310
21 3300005618 Ga0068864_100313875 Ga0068864_1003138752 310
22 3300005719 Ga0068861_100088531 Ga0068861_1000885312 310
23 3300005842 Ga0068858_100127907 Ga0068858_1001279072 310
24 3300005844 Ga0068862_100220550 Ga0068862_1002205502 310
25 3300005937 Ga0081455_10000715 Ga0081455_1000071537 310
26 3300005937 Ga0081455_10049450 Ga0081455_100494502 310
27 3300005983 Ga0081540_1014466 Ga0081540_10144662 310
28 3300006042 Ga0075368_10008135 Ga0075368_100081353 310
29 3300006051 Ga0075364_10043166 Ga0075364_100431662 310
30 3300006358 Ga0068871_100113220 Ga0068871_1001132203 310
31 3300006931 Ga0097620_100304731 Ga0097620_1003047312 310
32 3300009147 Ga0114129_10196005 Ga0114129_101960053 310
33 3300009148 Ga0105243_10328556 Ga0105243_103285562 310
34 3300009174 Ga0105241_10016444 Ga0105241_100164445 310
35 3300009177 Ga0105248_10073680 Ga0105248_100736803 310
36 3300009177 Ga0105248_10161310 Ga0105248_101613104 310
37 3300009551 Ga0105238_10066871 Ga0105238_100668714 310
38 3300010375 Ga0105239_10666468 Ga0105239_106664682 310
39 3300011119 Ga0105246_10024946 Ga0105246_100249465 310
40 3300013297 Ga0157378_10085139 Ga0157378_100851392 310
41 3300014325 Ga0163163_10069545 Ga0163163_100695452 310
42 3300014968 Ga0157379_10095943 Ga0157379_100959432 310
43 3300014969 Ga0157376_10175361 Ga0157376_101753612 310
44 3300025907 Ga0207645_10182413 Ga0207645_101824131 310
45 3300025911 Ga0207654_10061268 Ga0207654_100612682 310
46 3300025933 Ga0207706_10410092 Ga0207706_104100921 310
47 3300025937 Ga0207669_10240701 Ga0207669_102407012 310
48 3300025942 Ga0207689_10047666 Ga0207689_100476662 310
49 3300025942 Ga0207689_10103200 Ga0207689_101032002 310
50 3300025949 Ga0207667_10148280 Ga0207667_101482802 310
51 3300025972 Ga0207668_10067563 Ga0207668_100675632 310
52 3300025972 Ga0207668_10354060 Ga0207668_103540601 310
53 3300025972 Ga0207668_10442358 Ga0207668_104423581 310
54 3300026023 Ga0207677_10003182 Ga0207677_100031825 310
55 3300026067 Ga0207678_10045068 Ga0207678_100450683 310
56 3300026118 Ga0207675_100067188 Ga0207675_1000671882 310
57 3300026121 Ga0207683_10102982 Ga0207683_101029822 310
58 3300028379 Ga0268266_10004891 Ga0268266_100048916 310
59 3300028379 Ga0268266_10029751 Ga0268266_100297513 310
60 3300031616 Ga0307508_10094048 Ga0307508_100940482 310
61 3300033180 Ga0307510_10082122 Ga0307510_100821222 310
62 3300046452 Ga0495617_022025 Ga0495617_022025_819_1751 310
63 3300046455 Ga0495603_0001754 Ga0495603_0001754_6700_7632 310
64 3300046460 Ga0495638_0022170 Ga0495638_0022170_487_1419 310
65 3300046491 Ga0495584_0016300 Ga0495584_0016300_684_1616 310
66 3300046491 Ga0495584_0080163 Ga0495584_0080163_68_1000 310
67 3300046492 Ga0495585_0035154 Ga0495585_0035154_590_1522 310
68 3300046512 Ga0495610_0037091 Ga0495610_0037091_148_1080 310
69 3300046523 Ga0495644_0028145 Ga0495644_0028145_780_1712 310
70 3300046523 Ga0495644_0052933 Ga0495644_0052933_553_1485 310
71 3300046539 Ga0495621_0045917 Ga0495621_0045917_550_1482 310
72 3300046542 Ga0495597_0089847 Ga0495597_0089847_313_1245 310
73 3300046558 Ga0495633_0036957 Ga0495633_0036957_569_1501 310
74 3300046616 Ga0495668_0013742 Ga0495668_0013742_1290_2222 310
75 3300046664 Ga0495659_0025775 Ga0495659_0025775_444_1376 310
76 3300046665 Ga0495661_0108046 Ga0495661_0108046_426_1358 310
77 3300046692 Ga0495671_0065512 Ga0495671_0065512_616_1548 310
78 3300048905 Ga0496102_0160810 Ga0496102_0160810_766_1698 310
79 3300048908 Ga0496105_0239545 Ga0496105_0239545_416_1348 310
80 3300048911 Ga0496108_0150464 Ga0496108_0150464_78_1010 310
81 3300048912 Ga0496109_0157729 Ga0496109_0157729_722_1654 310
82 3300048913 Ga0496110_0074770 Ga0496110_0074770_1125_2057 310
83 3300048915 Ga0496112_0318263 Ga0496112_0318263_382_1314 310
84 3300048924 Ga0496121_0094782 Ga0496121_0094782_1244_2176 310
85 3300048924 Ga0496121_0157723 Ga0496121_0157723_614_1546 310
86 3300048929 Ga0496126_0012504 Ga0496126_0012504_2668_3600 310
87 3300048929 Ga0496126_0074489 Ga0496126_0074489_1587_2519 310
88 3300049459 Ga0495678_045022 Ga0495678_045022_292_1224 310
89 3300050489 nmdc:mga03683_60325_c1 nmdc:mga03683_60325_c1_396_1328 310
90 3300050492 nmdc:mga0yw44_27245_c1 nmdc:mga0yw44_27245_c1_322_1254 310
91 3300050492 nmdc:mga0yw44_66487_c1 nmdc:mga0yw44_66487_c1_884_1864 310
92 3300050493 nmdc:mga0k408_100867_c1 nmdc:mga0k408_100867_c1_620_1552 310
93 3300050507 nmdc:mga05p37_72277_c1 nmdc:mga05p37_72277_c1_774_1706 310
94 3300050512 nmdc:mga0n895_348159_c1 nmdc:mga0n895_348159_c1_72_1004 310
95 3300053096 Ga0500641_0091352 Ga0500641_0091352_148_1080 310
96 3300053108 Ga0500562_019096 Ga0500562_019096_454_1386 310
97 3300053119 Ga0500595_002818 Ga0500595_002818_6657_7589 310
98 3300005843 Ga0068860_100155651 Ga0068860_1001556512 311
99 3300035117 Ga0373953_0123191 Ga0373953_0123191_96_1031 311
100 iso_pu_bacteria 2507262055 2507504329 311
101 iso_pu_bacteria 2508501009 2508545763 311
102 iso_pu_bacteria 2508501042 2508694588 311
103 iso_pu_bacteria 2511231028 2511398407 311
104 iso_pu_bacteria 2513237092 2513624499 311
105 iso_pu_bacteria 2513237094 2513638637 311
106 iso_pu_bacteria 2513237095 2513649974 311
107 iso_pu_bacteria 2513237096 2513655412 311
108 iso_pu_bacteria 2513237101 2513697537 311
109 iso_pu_bacteria 2513237102 2513703218 311
110 iso_pu_bacteria 2513237104 2513716819 311
111 iso_pu_bacteria 2513237137 2513860024 311
112 iso_pu_bacteria 2513237139 2513874267 311
113 iso_pu_bacteria 2513237141 2513892378 311
114 iso_pu_bacteria 2513237145 2513916510 311
115 iso_pu_bacteria 2513237161 2514009967 311
116 iso_pu_bacteria 2515154112 2515624483 311
117 iso_pu_bacteria 2517093001 2517104587 311
118 iso_pu_bacteria 2517572143 2517889899 311
119 iso_pu_bacteria 2524023205 2524438544 311
120 iso_pu_bacteria 2524023210 2524470516 311
121 iso_pu_bacteria 2524023228 2524532912 311
122 iso_pu_bacteria 2528768022 2528850393 311
123 iso_pu_bacteria 2602042107 2603860613 311
124 iso_pu_bacteria 2617270735 2617354172 311
125 iso_pu_bacteria 2617270741 2617374670 311
126 iso_pu_bacteria 2643221651 2644290205 311
127 iso_pu_bacteria 2667528175 2671121077 311
128 iso_pu_bacteria 2721755755 2723842580 311
129 iso_pu_bacteria 2728368998 2728751703 311
130 iso_pu_bacteria 2744054633 2745077231 311
131 iso_pu_bacteria 2791355196 2793059402 311
132 iso_pu_bacteria 2791355197 2793068153 311
133 iso_pu_bacteria 2791355199 2793078549 311
134 iso_pu_bacteria 2802429603 2805916033 311
135 iso_pu_bacteria 2816332527 2818240974 311
136 iso_pu_bacteria 2824600985 2824604424 311
137 iso_pu_bacteria 2824609381 2824615035 311
138 iso_pu_bacteria 2824617872 2824626176 311
139 iso_pu_bacteria 2824626560 2824633229 311
140 iso_pu_bacteria 2824635225 2824643189 311
141 iso_pu_bacteria 2824644064 2824651380 311
142 iso_pu_bacteria 2824653114 2824659181 311
143 iso_pu_bacteria 2824661429 2824665225 311
144 iso_pu_bacteria 2824671348 2824676380 311
145 iso_pu_bacteria 2824679649 2824687070 311
146 iso_pu_bacteria 2824687955 2824692702 311
147 iso_pu_bacteria 2824696289 2824703725 311
148 iso_pu_bacteria 2824704595 2824713910 311
149 iso_pu_bacteria 2824714736 2824722721 311
150 iso_pu_bacteria 2824723954 2824731413 311
151 iso_pu_bacteria 2824732956 2824738367 311
152 iso_pu_bacteria 2824746037 2824751268 311
153 iso_pu_bacteria 2824753945 2824761105 311
154 iso_pu_bacteria 2824763712 2824771778 311
155 iso_pu_bacteria 2824773399 2824778250 311
156 iso_pu_bacteria 2838122688 2838126128 311
157 iso_pu_bacteria 2841941048 2841942479 311
158 iso_pu_bacteria 2841949485 2841953174 311
159 iso_pu_bacteria 2841957949 2841960681 311
160 iso_pu_bacteria 2841966195 2841970801 311
161 iso_pu_bacteria 2841974524 2841977940 311
162 iso_pu_bacteria 2841983080 2841984499 311
163 iso_pu_bacteria 2844315083 2844321335 311
164 iso_pu_bacteria 2847939898 2847943312 311
165 iso_pu_bacteria 2849076700 2849077040 311
166 iso_pu_bacteria 2857509624 2857514686 311
167 iso_pu_bacteria 2857524615 2857525571 311
168 iso_pu_bacteria 2874590934 2874595714 311
169 iso_pu_bacteria 2874604998 2874606736 311
170 iso_pu_bacteria 2874612657 2874620286 311
171 iso_pu_bacteria 2874620515 2874624222 311
172 iso_pu_bacteria 2874628541 2874630306 311
173 iso_pu_bacteria 2874645413 2874651654 311
174 iso_pu_bacteria 2876761206 2876767662 311
175 iso_pu_bacteria 2876771140 2876775909 311
176 iso_pu_bacteria 2876808645 2876816682 311
177 iso_pu_bacteria 2876818435 2876821549 311
178 iso_pu_bacteria 2879074833 2879080000 311
179 iso_pu_bacteria 2879099564 2879100582 311
180 iso_pu_bacteria 2879110137 2879113553 311
181 iso_pu_bacteria 2879127579 2879134083 311
182 iso_pu_bacteria 2879142872 2879148568 311
183 iso_pu_bacteria 2881364244 2881367722 311
184 iso_pu_bacteria 2881665667 2881669315 311
185 iso_pu_bacteria 2885366525 2885374483 311
186 iso_pu_bacteria 2885374607 2885379427 311
187 iso_pu_bacteria 2885383462 2885388230 311
188 iso_pu_bacteria 2885409591 2885412168 311
189 iso_pu_bacteria 2888378607 2888387633 311
190 iso_pu_bacteria 2888388044 2888391529 311
191 iso_pu_bacteria 2888419890 2888426849 311
192 iso_pu_bacteria 2889033259 2889034135 311
193 iso_pu_bacteria 2893066018 2893070710 311
194 iso_pu_bacteria 2903727486 2903731475 311
195 iso_pu_bacteria 2903748898 2903750746 311
196 iso_pu_bacteria 2904666416 2904670933 311
197 iso_pu_bacteria 2904690495 2904692663 311
198 iso_pu_bacteria 2904699407 2904711120 311
199 iso_pu_bacteria 2904711408 2904713561 311
200 iso_pu_bacteria 2906602504 2906607949 311
201 iso_pu_bacteria 2906610324 2906612363 311
202 iso_pu_bacteria 2906626472 2906633079 311
203 iso_pu_bacteria 2906635258 2906638311 311
204 iso_pu_bacteria 2906660503 2906663404 311
205 iso_pu_bacteria 2908739725 2908739764 311
206 iso_pu_bacteria 2908756301 2908757875 311
207 iso_pu_bacteria 2908775508 2908777151 311
208 iso_pu_bacteria 2919073203 2919074621 311
209 iso_pu_bacteria 2922361189 2922367533 311
210 iso_pu_bacteria 2922368715 2922376617 311
211 iso_pu_bacteria 2922386360 2922391508 311
212 iso_pu_bacteria 2922393267 2922398567 311
213 iso_pu_bacteria 2922425934 2922426932 311
214 iso_pu_bacteria 2929615660 2929619878 311
215 iso_pu_bacteria 2929624759 2929629190 311
216 iso_pu_bacteria 2932784394 2932789677 311
217 iso_pu_bacteria 2932794094 2932796655 311
218 iso_pu_bacteria 2932801729 2932802565 311
219 iso_pu_bacteria 2932809354 2932814816 311
220 iso_pu_bacteria 2932818245 2932824327 311
221 iso_pu_bacteria 2932828146 2932833946 311
222 iso_pu_bacteria 2933577622 2933581796 311
223 iso_pu_bacteria 2935608549 2935613256 311
224 iso_pu_bacteria 2935616580 2935623664 311
225 iso_pu_bacteria 2935630451 2935633091 311
226 iso_pu_bacteria 2935638405 2935645052 311
227 iso_pu_bacteria 2935648319 2935656630 311
228 iso_pu_bacteria 2935656913 2935665446 311
229 iso_pu_bacteria 2935665750 2935672101 311
230 iso_pu_bacteria 2935675223 2935684093 311
231 iso_pu_bacteria 2935684952 2935689141 311
232 iso_pu_bacteria 2935694250 2935697598 311
233 iso_pu_bacteria 2935703347 2935711377 311
234 iso_pu_bacteria 2935713505 2935720087 311
235 iso_pu_bacteria 2935722832 2935728296 311
236 iso_pu_bacteria 2935732158 2935737107 311
237 iso_pu_bacteria 2935741537 2935746832 311
238 iso_pu_bacteria 2935750917 2935757799 311
239 iso_pu_bacteria 2935760218 2935764178 311
240 iso_pu_bacteria 2935769743 2935775195 311
241 iso_pu_bacteria 2935777560 2935780097 311
242 iso_pu_bacteria 2935785616 2935790219 311
243 iso_pu_bacteria 2935793552 2935798739 311
244 iso_pu_bacteria 2935801545 2935808764 311
245 iso_pu_bacteria 2935810662 2935817561 311
246 iso_pu_bacteria 2935819856 2935824890 311
247 iso_pu_bacteria 2935827899 2935834102 311
248 iso_pu_bacteria 2935837841 2935844705 311
249 iso_pu_bacteria 2935847175 2935852110 311
250 iso_pu_bacteria 2935855204 2935861729 311
251 iso_pu_bacteria 2935864058 2935868635 311
252 iso_pu_bacteria 2935873716 2935879409 311
253 iso_pu_bacteria 2935883170 2935886995 311
254 iso_pu_bacteria 2935908558 2935911457 311
255 iso_pu_bacteria 2935916978 2935920992 311
256 iso_pu_bacteria 2935926038 2935928486 311
257 iso_pu_bacteria 2935934488 2935938131 311
258 iso_pu_bacteria 2935942939 2935945413 311
259 iso_pu_bacteria 2935951376 2935954081 311
260 iso_pu_bacteria 2935959822 2935965460 311
261 iso_pu_bacteria 2935967501 2935971651 311
262 iso_pu_bacteria 2935975950 2935980055 311
263 iso_pu_bacteria 2935984226 2935989483 311
264 iso_pu_bacteria 2935992306 2935998423 311
265 iso_pu_bacteria 2936002035 2936009116 311
266 iso_pu_bacteria 2936011229 2936019493 311
267 iso_pu_bacteria 2936019824 2936028097 311
268 iso_pu_bacteria 2936028420 2936036931 311
269 iso_pu_bacteria 2936037263 2936044358 311
270 iso_pu_bacteria 2936046547 2936054954 311
271 iso_pu_bacteria 2936055302 2936060739 311
272 iso_pu_bacteria 2940556831 2940563379 311
273 iso_pu_bacteria 2941507105 2941509607 311
274 iso_pu_bacteria 2941515067 2941517436 311
275 iso_pu_bacteria 2941523033 2941526611 311
276 iso_pu_bacteria 2941531003 2941531908 311
277 iso_pu_bacteria 2941538514 2941545400 311
278 iso_pu_bacteria 3005474847 3005476116 311
279 iso_pu_bacteria 3005483717 3005486005 311
280 iso_pu_bacteria 3005506211 3005506672 311
281 iso_pu_bacteria 3005587118 3005592743 311
282 iso_pu_bacteria 3005594810 3005601687 311
283 iso_pu_bacteria 3005710791 3005717424 311
284 iso_pu_bacteria 3005718088 3005724369 311
285 iso_pu_bacteria 8006926726 8006932549 311
286 iso_pu_bacteria 8006933436 8006937430 311
287 iso_pu_bacteria 8006973647 8006977459 311
288 iso_pu_bacteria 8006984368 8006986203 311
289 iso_pu_bacteria 8006994254 8006999143 311
290 iso_pu_bacteria 8016511872 8016519220 311
291 iso_pu_bacteria 8016522445 8016525102 311
292 iso_pu_bacteria 8016530956 8016538678 311
293 iso_pu_bacteria 8016539877 8016542967 311
294 iso_pu_bacteria 8016548790 8016550326 311
295 iso_pu_bacteria 8016557553 8016558733 311
296 iso_pu_bacteria 8016566248 8016568365 311
297 iso_pu_bacteria 8016575299 8016581023 311
298 iso_pu_bacteria 8016583857 8016587702 311
299 iso_pu_bacteria 8016595262 8016596708 311
300 iso_pu_bacteria 8016603502 8016607583 311
301 iso_pu_bacteria 8016613128 8016619376 311
302 iso_pu_bacteria 8016622563 8016630216 311
303 iso_pu_bacteria 8016630954 8016636935 311
304 iso_pu_bacteria 8017057580 8017066289 311
305 iso_pu_bacteria 8019530166 8019538350 311
306 iso_pu_bacteria 8019538911 8019541472 311
307 iso_pu_bacteria 8019547302 8019549156 311
308 iso_pu_bacteria 8019555841 8019561195 311
309 iso_pu_bacteria 8019565922 8019571285 311
310 iso_pu_bacteria 8019586578 8019596371 311
311 iso_pu_bacteria 8019597564 8019605331 311
312 iso_pu_bacteria 8019608314 8019613211 311
313 iso_pu_bacteria 8019619141 8019623895 311
314 iso_pu_bacteria 8019629233 8019638146 311
315 iso_pu_bacteria 8019638758 8019641490 311
316 iso_pu_bacteria 8019648815 8019651551 311
317 iso_pu_bacteria 8019659431 8019666061 311
318 iso_pu_bacteria 8019668869 8019675578 311
319 iso_pu_bacteria 8019678201 8019680521 311
320 iso_pu_bacteria 8055742211 8055750370 311
321 iso_pu_bacteria 8056673599 8056678862 311
322 iso_pu_bacteria 8056681323 8056685977 311
323 iso_pu_bacteria 8056689827 8056691991 311
324 iso_pu_bacteria 8056967851 8056976139 311
325 3300048921 Ga0496118_0016505 Ga0496118_0016505_939_1877 312
326 3300003203 JGI25406J46586_10000118 JGI25406J46586_1000011810 313
327 3300005437 Ga0070710_10010597 Ga0070710_100105974 313
328 3300005439 Ga0070711_100315304 Ga0070711_1003153041 313
329 3300005983 Ga0081540_1022699 Ga0081540_10226993 313
330 3300005985 Ga0081539_10000425 Ga0081539_1000042566 313
331 3300006163 Ga0070715_10000561 Ga0070715_100005616 313
332 3300006871 Ga0075434_100084478 Ga0075434_1000844782 313
333 3300006914 Ga0075436_100096406 Ga0075436_1000964062 313
334 3300025905 Ga0207685_10023611 Ga0207685_100236112 313
335 3300025915 Ga0207693_10008624 Ga0207693_100086245 313
336 3300025928 Ga0207700_10021069 Ga0207700_100210692 313
337 3300025939 Ga0207665_10009754 Ga0207665_100097545 313
338 3300048909 Ga0496106_0010150 Ga0496106_0010150_4399_5340 313
339 3300005327 Ga0070658_10212017 Ga0070658_102120172 314
340 3300013102 Ga0157371_10231668 Ga0157371_102316682 314
341 3300025909 Ga0207705_10033327 Ga0207705_100333274 314
342 3300025917 Ga0207660_10210524 Ga0207660_102105242 314
343 3300025919 Ga0207657_10014763 Ga0207657_100147634 314
344 3300025933 Ga0207706_10033954 Ga0207706_100339544 314
345 3300037418 Ga0395900_0047842 Ga0395900_0047842_3339_4283 314
346 3300037418 Ga0395900_0112435 Ga0395900_0112435_799_1743 314
347 3300037466 Ga0395898_0195694 Ga0395898_0195694_833_1777 314
348 3300038443 Ga0395901_0008223 Ga0395901_0008223_6511_7455 314
349 3300045976 Ga0466967_0235009 Ga0466967_0235009_203_1147 314
350 3300048905 Ga0496102_0307848 Ga0496102_0307848_425_1369 314
351 3300048909 Ga0496106_0413790 Ga0496106_0413790_82_1026 314
352 3300048924 Ga0496121_0001567 Ga0496121_0001567_20756_21700 314
353 3300048929 Ga0496126_0027699 Ga0496126_0027699_2900_3844 314
354 3300048929 Ga0496126_0031094 Ga0496126_0031094_1216_2160 314
355 3300049568 Ga0501031_0038957 Ga0501031_0038957_1893_2837 314
356 3300049568 Ga0501031_0128997 Ga0501031_0128997_54_998 314
357 3300049570 Ga0501033_0017918 Ga0501033_0017918_761_1705 314
358 3300049570 Ga0501033_0152040 Ga0501033_0152040_57_1001 314
359 3300049570 Ga0501033_0301708 Ga0501033_0301708_41_1087 314
360 3300049571 Ga0501034_0051004 Ga0501034_0051004_1165_2112 314
361 3300049571 Ga0501034_0076053 Ga0501034_0076053_669_1613 314
362 3300049571 Ga0501034_0140986 Ga0501034_0140986_514_1458 314
363 3300049571 Ga0501034_0190086 Ga0501034_0190086_391_1437 314
364 3300049571 Ga0501034_0290059 Ga0501034_0290059_283_1227 314
365 3300049572 Ga0501036_0427198 Ga0501036_0427198_104_1048 314
366 3300049573 Ga0501037_0045907 Ga0501037_0045907_2221_3165 314
367 3300049573 Ga0501037_0063104 Ga0501037_0063104_1675_2619 314
368 3300049573 Ga0501037_0233594 Ga0501037_0233594_264_1208 314
369 3300049574 Ga0501038_0003347 Ga0501038_0003347_2199_3143 314
370 3300049574 Ga0501038_0265321 Ga0501038_0265321_314_1258 314
371 3300049575 Ga0501039_0058689 Ga0501039_0058689_1849_2793 314
372 3300049575 Ga0501039_0132838 Ga0501039_0132838_940_1884 314
373 3300049575 Ga0501039_0173689 Ga0501039_0173689_591_1535 314
374 3300049576 Ga0501040_0024640 Ga0501040_0024640_2102_3046 314
375 3300049578 Ga0501042_0092237 Ga0501042_0092237_198_1142 314
376 3300049579 Ga0501043_0022652 Ga0501043_0022652_1393_2439 314
377 3300049579 Ga0501043_0035798 Ga0501043_0035798_824_1768 314
378 3300049579 Ga0501043_0063091 Ga0501043_0063091_1152_2096 314
379 3300049580 Ga0501046_0080691 Ga0501046_0080691_453_1397 314
380 3300049580 Ga0501046_0104382 Ga0501046_0104382_793_1836 314
381 3300049582 Ga0501048_0048652 Ga0501048_0048652_210_1154 314
382 3300049583 Ga0501067_0002459 Ga0501067_0002459_5926_6870 314
383 3300049584 Ga0501068_0014532 Ga0501068_0014532_1893_2837 314
384 3300049585 Ga0501069_0066775 Ga0501069_0066775_991_1935 314
385 3300049586 Ga0501070_0150891 Ga0501070_0150891_493_1437 314
386 3300049587 Ga0501071_0013466 Ga0501071_0013466_3151_4095 314
387 3300049588 Ga0501072_0032282 Ga0501072_0032282_1099_2043 314
388 3300049588 Ga0501072_0135256 Ga0501072_0135256_455_1399 314
389 3300049589 Ga0501073_0028457 Ga0501073_0028457_1812_2756 314
390 3300049589 Ga0501073_0032066 Ga0501073_0032066_540_1484 314
391 3300049589 Ga0501073_0194538 Ga0501073_0194538_417_1361 314
392 3300049593 Ga0501077_0077753 Ga0501077_0077753_154_1098 314
393 3300049741 Ga0501079_0118133 Ga0501079_0118133_104_1048 314
394 3300049742 Ga0501080_0063191 Ga0501080_0063191_26_970 314
395 3300049744 Ga0501083_0041501 Ga0501083_0041501_284_1228 314
396 3300049822 Ga0501035_0084000 Ga0501035_0084000_320_1264 314
397 3300049822 Ga0501035_0090339 Ga0501035_0090339_1433_2479 314
398 3300049822 Ga0501035_0110125 Ga0501035_0110125_1259_2203 314
399 3300049822 Ga0501035_0170282 Ga0501035_0170282_546_1490 314
400 3300049823 Ga0501044_0038321 Ga0501044_0038321_2288_3334 314
401 3300049823 Ga0501044_0088359 Ga0501044_0088359_692_1636 314
402 3300049823 Ga0501044_0138564 Ga0501044_0138564_608_1552 314
403 3300049823 Ga0501044_0223236 Ga0501044_0223236_291_1235 314
404 3300049823 Ga0501044_0240445 Ga0501044_0240445_409_1353 314
405 3300049823 Ga0501044_0565022 Ga0501044_0565022_47_991 314
406 3300049824 Ga0501045_0024317 Ga0501045_0024317_104_1048 314
407 3300054114 Ga0501084_0005438 Ga0501084_0005438_7104_8048 314
408 3300060353 Ga0501082_0018483 Ga0501082_0018483_2874_3818 314
409 iso_pu_bacteria 2842038055 2842041781 314
410 iso_pu_bacteria 2842045827 2842049823 314
411 iso_pu_bacteria 2847930680 2847932075 314
412 iso_pu_bacteria 2879083081 2879085750 314
413 iso_pu_bacteria 2906643746 2906650128 314
414 3300001979 JGI24740J21852_10010307 JGI24740J21852_100103073 315
415 3300001989 JGI24739J22299_10060499 JGI24739J22299_100604991 315
416 3300003215 JGI25153J46596_10002224 JGI25153J46596_100022249 315
417 3300003215 JGI25153J46596_10006933 JGI25153J46596_100069331 315
418 3300003215 JGI25153J46596_10007072 JGI25153J46596_100070721 315
419 3300003215 JGI25153J46596_10024593 JGI25153J46596_100245932 315
420 3300003659 JGI25404J52841_10002320 JGI25404J52841_100023203 315
421 3300003775 Ga0055524_1016148 Ga0055524_10161482 315
422 3300003794 Ga0055531_10009477 Ga0055531_100094772 315
423 3300005262 Ga0065165_1002792 Ga0065165_10027929 315
424 3300005262 Ga0065165_1003284 Ga0065165_10032844 315
425 3300005262 Ga0065165_1021603 Ga0065165_10216032 315
426 3300005327 Ga0070658_10114808 Ga0070658_101148082 315
427 3300005329 Ga0070683_100048202 Ga0070683_1000482021 315
428 3300005329 Ga0070683_100074217 Ga0070683_1000742173 315
429 3300005331 Ga0070670_100041202 Ga0070670_1000412025 315
430 3300005336 Ga0070680_100081738 Ga0070680_1000817382 315
431 3300005336 Ga0070680_100186943 Ga0070680_1001869431 315
432 3300005336 Ga0070680_100456634 Ga0070680_1004566341 315
433 3300005337 Ga0070682_100073402 Ga0070682_1000734022 315
434 3300005338 Ga0068868_100017996 Ga0068868_1000179964 315
435 3300005338 Ga0068868_100059948 Ga0068868_1000599484 315
436 3300005338 Ga0068868_100326312 Ga0068868_1003263121 315
437 3300005339 Ga0070660_100030247 Ga0070660_1000302474 315
438 3300005340 Ga0070689_100330612 Ga0070689_1003306121 315
439 3300005344 Ga0070661_100154164 Ga0070661_1001541642 315
440 3300005344 Ga0070661_100210998 Ga0070661_1002109982 315
441 3300005347 Ga0070668_100020491 Ga0070668_1000204914 315
442 3300005347 Ga0070668_100154139 Ga0070668_1001541392 315
443 3300005355 Ga0070671_100101143 Ga0070671_1001011432 315
444 3300005356 Ga0070674_100060947 Ga0070674_1000609472 315
445 3300005356 Ga0070674_100229679 Ga0070674_1002296792 315
446 3300005367 Ga0070667_100225702 Ga0070667_1002257022 315
447 3300005434 Ga0070709_10000796 Ga0070709_100007969 315
448 3300005434 Ga0070709_10001261 Ga0070709_100012615 315
449 3300005434 Ga0070709_10007358 Ga0070709_100073585 315
450 3300005434 Ga0070709_10010265 Ga0070709_100102653 315
451 3300005434 Ga0070709_10042951 Ga0070709_100429513 315
452 3300005434 Ga0070709_10129874 Ga0070709_101298742 315
453 3300005435 Ga0070714_100028362 Ga0070714_1000283622 315
454 3300005435 Ga0070714_100131457 Ga0070714_1001314572 315
455 3300005436 Ga0070713_100004513 Ga0070713_1000045135 315
456 3300005436 Ga0070713_100024796 Ga0070713_1000247962 315
457 3300005436 Ga0070713_100114641 Ga0070713_1001146411 315
458 3300005436 Ga0070713_100114913 Ga0070713_1001149133 315
459 3300005436 Ga0070713_100155528 Ga0070713_1001555282 315
460 3300005437 Ga0070710_10000991 Ga0070710_100009915 315
461 3300005439 Ga0070711_100005239 Ga0070711_1000052395 315
462 3300005439 Ga0070711_100006676 Ga0070711_1000066767 315
463 3300005439 Ga0070711_100008277 Ga0070711_1000082772 315
464 3300005440 Ga0070705_100137382 Ga0070705_1001373821 315
465 3300005441 Ga0070700_100032431 Ga0070700_1000324313 315
466 3300005444 Ga0070694_100279741 Ga0070694_1002797411 315
467 3300005455 Ga0070663_100021710 Ga0070663_1000217104 315
468 3300005455 Ga0070663_100027837 Ga0070663_1000278373 315
469 3300005455 Ga0070663_100043121 Ga0070663_1000431212 315
470 3300005455 Ga0070663_100123124 Ga0070663_1001231242 315
471 3300005456 Ga0070678_100065174 Ga0070678_1000651742 315
472 3300005456 Ga0070678_100099892 Ga0070678_1000998922 315
473 3300005457 Ga0070662_100195353 Ga0070662_1001953531 315
474 3300005458 Ga0070681_10062271 Ga0070681_100622713 315
475 3300005458 Ga0070681_10163471 Ga0070681_101634711 315
476 3300005459 Ga0068867_100107078 Ga0068867_1001070782 315
477 3300005467 Ga0070706_100089246 Ga0070706_1000892463 315
478 3300005471 Ga0070698_100403197 Ga0070698_1004031971 315
479 3300005518 Ga0070699_100227522 Ga0070699_1002275221 315
480 3300005530 Ga0070679_100047353 Ga0070679_1000473535 315
481 3300005530 Ga0070679_100324799 Ga0070679_1003247992 315
482 3300005535 Ga0070684_100008848 Ga0070684_1000088484 315
483 3300005535 Ga0070684_100071224 Ga0070684_1000712243 315
484 3300005539 Ga0068853_100007083 Ga0068853_1000070839 315
485 3300005539 Ga0068853_100007085 Ga0068853_10000708510 315
486 3300005539 Ga0068853_100032710 Ga0068853_1000327104 315
487 3300005548 Ga0070665_100007326 Ga0070665_1000073265 315
488 3300005548 Ga0070665_100016280 Ga0070665_1000162804 315
489 3300005548 Ga0070665_100050261 Ga0070665_1000502612 315
490 3300005548 Ga0070665_100137569 Ga0070665_1001375692 315
491 3300005548 Ga0070665_100240889 Ga0070665_1002408892 315
492 3300005548 Ga0070665_100347802 Ga0070665_1003478021 315
493 3300005563 Ga0068855_100235778 Ga0068855_1002357782 315
494 3300005563 Ga0068855_100299148 Ga0068855_1002991482 315
495 3300005564 Ga0070664_100016211 Ga0070664_1000162115 315
496 3300005564 Ga0070664_100156175 Ga0070664_1001561752 315
497 3300005577 Ga0068857_100021428 Ga0068857_1000214284 315
498 3300005577 Ga0068857_100113770 Ga0068857_1001137703 315
499 3300005577 Ga0068857_100126040 Ga0068857_1001260402 315
500 3300005578 Ga0068854_100009851 Ga0068854_1000098514 315
501 3300005578 Ga0068854_100041116 Ga0068854_1000411162 315
502 3300005614 Ga0068856_100000522 Ga0068856_10000052232 315
503 3300005614 Ga0068856_100010527 Ga0068856_1000105279 315
504 3300005614 Ga0068856_100030658 Ga0068856_1000306584 315
505 3300005615 Ga0070702_100055555 Ga0070702_1000555552 315
506 3300005616 Ga0068852_100020416 Ga0068852_1000204164 315
507 3300005616 Ga0068852_100067275 Ga0068852_1000672752 315
508 3300005616 Ga0068852_100341945 Ga0068852_1003419451 315
509 3300005617 Ga0068859_100643876 Ga0068859_1006438761 315
510 3300005834 Ga0068851_10047299 Ga0068851_100472993 315
511 3300005843 Ga0068860_100000441 Ga0068860_1000004415 315
512 3300005844 Ga0068862_100156535 Ga0068862_1001565352 315
513 3300005844 Ga0068862_100215740 Ga0068862_1002157402 315
514 3300005937 Ga0081455_10000774 Ga0081455_100007744 315
515 3300005937 Ga0081455_10003833 Ga0081455_100038334 315
516 3300005937 Ga0081455_10013479 Ga0081455_100134798 315
517 3300005937 Ga0081455_10028784 Ga0081455_100287843 315
518 3300005981 Ga0081538_10029587 Ga0081538_100295873 315
519 3300005981 Ga0081538_10066454 Ga0081538_100664542 315
520 3300005983 Ga0081540_1002251 Ga0081540_10022515 315
521 3300005983 Ga0081540_1002343 Ga0081540_100234310 315
522 3300005983 Ga0081540_1003941 Ga0081540_100394112 315
523 3300005983 Ga0081540_1005884 Ga0081540_10058845 315
524 3300005983 Ga0081540_1016536 Ga0081540_10165363 315
525 3300005983 Ga0081540_1025221 Ga0081540_10252213 315
526 3300005983 Ga0081540_1026177 Ga0081540_10261773 315
527 3300005983 Ga0081540_1035117 Ga0081540_10351173 315
528 3300005983 Ga0081540_1065365 Ga0081540_10653652 315
529 3300005983 Ga0081540_1075776 Ga0081540_10757761 315
530 3300005985 Ga0081539_10001114 Ga0081539_1000111447 315
531 3300005985 Ga0081539_10053002 Ga0081539_100530022 315
532 3300005985 Ga0081539_10099924 Ga0081539_100999242 315
533 3300005985 Ga0081539_10109976 Ga0081539_101099761 315
534 3300006028 Ga0070717_10000325 Ga0070717_1000032513 315
535 3300006028 Ga0070717_10084579 Ga0070717_100845792 315
536 3300006038 Ga0075365_10011659 Ga0075365_100116594 315
537 3300006038 Ga0075365_10026252 Ga0075365_100262522 315
538 3300006038 Ga0075365_10033426 Ga0075365_100334262 315
539 3300006038 Ga0075365_10040469 Ga0075365_100404692 315
540 3300006038 Ga0075365_10060412 Ga0075365_100604122 315
541 3300006042 Ga0075368_10007800 Ga0075368_100078004 315
542 3300006042 Ga0075368_10012725 Ga0075368_100127252 315
543 3300006042 Ga0075368_10049183 Ga0075368_100491832 315
544 3300006048 Ga0075363_100001726 Ga0075363_1000017266 315
545 3300006048 Ga0075363_100017481 Ga0075363_1000174813 315
546 3300006048 Ga0075363_100088419 Ga0075363_1000884192 315
547 3300006048 Ga0075363_100122224 Ga0075363_1001222241 315
548 3300006048 Ga0075363_100176997 Ga0075363_1001769972 315
549 3300006051 Ga0075364_10007861 Ga0075364_100078613 315
550 3300006051 Ga0075364_10010966 Ga0075364_100109663 315
551 3300006051 Ga0075364_10022059 Ga0075364_100220592 315
552 3300006058 Ga0075432_10058339 Ga0075432_100583392 315
553 3300006163 Ga0070715_10025862 Ga0070715_100258622 315
554 3300006163 Ga0070715_10103424 Ga0070715_101034242 315
555 3300006173 Ga0070716_100001763 Ga0070716_1000017635 315
556 3300006173 Ga0070716_100171349 Ga0070716_1001713492 315
557 3300006175 Ga0070712_100044490 Ga0070712_1000444903 315
558 3300006175 Ga0070712_100167104 Ga0070712_1001671042 315
559 3300006175 Ga0070712_100284740 Ga0070712_1002847401 315
560 3300006178 Ga0075367_10040235 Ga0075367_100402352 315
561 3300006178 Ga0075367_10059339 Ga0075367_100593392 315
562 3300006178 Ga0075367_10075447 Ga0075367_100754472 315
563 3300006178 Ga0075367_10077676 Ga0075367_100776762 315
564 3300006186 Ga0075369_10002297 Ga0075369_100022973 315
565 3300006186 Ga0075369_10026891 Ga0075369_100268912 315
566 3300006195 Ga0075366_10006775 Ga0075366_100067753 315
567 3300006195 Ga0075366_10018597 Ga0075366_100185972 315
568 3300006195 Ga0075366_10035098 Ga0075366_100350983 315
569 3300006237 Ga0097621_100141141 Ga0097621_1001411412 315
570 3300006237 Ga0097621_100375741 Ga0097621_1003757411 315
571 3300006237 Ga0097621_100453462 Ga0097621_1004534622 315
572 3300006353 Ga0075370_10017731 Ga0075370_100177312 315
573 3300006353 Ga0075370_10047609 Ga0075370_100476092 315
574 3300006353 Ga0075370_10047964 Ga0075370_100479642 315
575 3300006353 Ga0075370_10080144 Ga0075370_100801442 315
576 3300006844 Ga0075428_100023204 Ga0075428_1000232045 315
577 3300006846 Ga0075430_100382451 Ga0075430_1003824511 315
578 3300006847 Ga0075431_100029253 Ga0075431_1000292535 315
579 3300006871 Ga0075434_100020473 Ga0075434_1000204735 315
580 3300006871 Ga0075434_100050474 Ga0075434_1000504742 315
581 3300006871 Ga0075434_100074720 Ga0075434_1000747203 315
582 3300006881 Ga0068865_100150267 Ga0068865_1001502672 315
583 3300006931 Ga0097620_100643933 Ga0097620_1006439331 315
584 3300006941 Ga0099825_1019128 Ga0099825_10191281 315
585 3300006942 Ga0099824_1005278 Ga0099824_10052784 315
586 3300006942 Ga0099824_1017855 Ga0099824_10178553 315
587 3300006943 Ga0099822_1013722 Ga0099822_10137229 315
588 3300007265 Ga0099794_10009088 Ga0099794_100090882 315
589 3300007788 Ga0099795_10000836 Ga0099795_100008364 315
590 3300007788 Ga0099795_10024305 Ga0099795_100243052 315
591 3300007788 Ga0099795_10034455 Ga0099795_100344551 315
592 3300009093 Ga0105240_10002968 Ga0105240_100029685 315
593 3300009093 Ga0105240_10017804 Ga0105240_100178048 315
594 3300009093 Ga0105240_10021771 Ga0105240_100217718 315
595 3300009093 Ga0105240_10033109 Ga0105240_100331094 315
596 3300009093 Ga0105240_10076367 Ga0105240_100763672 315
597 3300009093 Ga0105240_10146029 Ga0105240_101460293 315
598 3300009093 Ga0105240_10463304 Ga0105240_104633042 315
599 3300009093 Ga0105240_10477187 Ga0105240_104771872 315
600 3300009093 Ga0105240_10547751 Ga0105240_105477511 315
601 3300009093 Ga0105240_10644663 Ga0105240_106446631 315
602 3300009094 Ga0111539_10333654 Ga0111539_103336542 315
603 3300009098 Ga0105245_10011836 Ga0105245_100118362 315
604 3300009098 Ga0105245_10024933 Ga0105245_100249331 315
605 3300009098 Ga0105245_10030674 Ga0105245_100306744 315
606 3300009098 Ga0105245_10551186 Ga0105245_105511861 315
607 3300009101 Ga0105247_10135573 Ga0105247_101355732 315
608 3300009147 Ga0114129_10228379 Ga0114129_102283792 315
609 3300009148 Ga0105243_10424563 Ga0105243_104245631 315
610 3300009174 Ga0105241_10001388 Ga0105241_1000138815 315
611 3300009174 Ga0105241_10227892 Ga0105241_102278921 315
612 3300009176 Ga0105242_10179201 Ga0105242_101792012 315
613 3300009177 Ga0105248_10044195 Ga0105248_100441953 315
614 3300009177 Ga0105248_10264975 Ga0105248_102649752 315
615 3300009177 Ga0105248_10459244 Ga0105248_104592441 315
616 3300009545 Ga0105237_10009401 Ga0105237_100094012 315
617 3300009545 Ga0105237_10018051 Ga0105237_100180513 315
618 3300009545 Ga0105237_10019256 Ga0105237_100192565 315
619 3300009545 Ga0105237_10029341 Ga0105237_100293414 315
620 3300009545 Ga0105237_10063125 Ga0105237_100631254 315
621 3300009545 Ga0105237_10081504 Ga0105237_100815043 315
622 3300009545 Ga0105237_10117726 Ga0105237_101177262 315
623 3300009545 Ga0105237_10121493 Ga0105237_101214932 315
624 3300009545 Ga0105237_10219525 Ga0105237_102195252 315
625 3300009545 Ga0105237_10279682 Ga0105237_102796822 315
626 3300009545 Ga0105237_10302610 Ga0105237_103026101 315
627 3300009545 Ga0105237_10330910 Ga0105237_103309102 315
628 3300009551 Ga0105238_10007201 Ga0105238_1000720114 315
629 3300009551 Ga0105238_10025146 Ga0105238_100251465 315
630 3300009551 Ga0105238_10028995 Ga0105238_100289954 315
631 3300009551 Ga0105238_10083975 Ga0105238_100839753 315
632 3300009551 Ga0105238_10134821 Ga0105238_101348212 315
633 3300009551 Ga0105238_10140056 Ga0105238_101400563 315
634 3300009553 Ga0105249_10161283 Ga0105249_101612832 315
635 3300010159 Ga0099796_10000143 Ga0099796_100001439 315
636 3300010159 Ga0099796_10014081 Ga0099796_100140811 315
637 3300010159 Ga0099796_10049573 Ga0099796_100495732 315
638 3300010375 Ga0105239_10026237 Ga0105239_100262372 315
639 3300010375 Ga0105239_10054242 Ga0105239_100542424 315
640 3300010375 Ga0105239_10075076 Ga0105239_100750762 315
641 3300010375 Ga0105239_10108752 Ga0105239_101087522 315
642 3300010375 Ga0105239_10129571 Ga0105239_101295712 315
643 3300010375 Ga0105239_10132265 Ga0105239_101322651 315
644 3300010375 Ga0105239_10745374 Ga0105239_107453741 315
645 3300013104 Ga0157370_10120699 Ga0157370_101206993 315
646 3300013105 Ga0157369_10011069 Ga0157369_100110697 315
647 3300013105 Ga0157369_10022494 Ga0157369_100224944 315
648 3300013105 Ga0157369_10085496 Ga0157369_100854963 315
649 3300013296 Ga0157374_10025945 Ga0157374_100259452 315
650 3300013296 Ga0157374_10348201 Ga0157374_103482011 315
651 3300013297 Ga0157378_10019128 Ga0157378_100191282 315
652 3300013306 Ga0163162_10020858 Ga0163162_100208584 315
653 3300013307 Ga0157372_10050306 Ga0157372_100503062 315
654 3300013307 Ga0157372_10680296 Ga0157372_106802961 315
655 3300013308 Ga0157375_10016660 Ga0157375_100166605 315
656 3300014325 Ga0163163_10063284 Ga0163163_100632841 315
657 3300014325 Ga0163163_10067838 Ga0163163_100678382 315
658 3300014325 Ga0163163_10110804 Ga0163163_101108043 315
659 3300014325 Ga0163163_10115145 Ga0163163_101151453 315
660 3300014325 Ga0163163_10196568 Ga0163163_101965682 315
661 3300014326 Ga0157380_10212424 Ga0157380_102124243 315
662 3300014745 Ga0157377_10133442 Ga0157377_101334422 315
663 3300014968 Ga0157379_10012889 Ga0157379_100128897 315
664 3300014968 Ga0157379_10129426 Ga0157379_101294263 315
665 3300014968 Ga0157379_10263968 Ga0157379_102639682 315
666 3300014969 Ga0157376_10008369 Ga0157376_100083695 315
667 3300017792 Ga0163161_10113270 Ga0163161_101132702 315
668 3300020082 Ga0206353_10807201 Ga0206353_108072013 315
669 3300021320 Ga0214544_1000011 Ga0214544_100001156 315
670 3300021321 Ga0214542_1000009 Ga0214542_1000009186 315
671 3300021324 Ga0214545_1000007 Ga0214545_100000756 315
672 3300021327 Ga0214543_1000020 Ga0214543_1000020186 315
673 3300021384 Ga0213876_10008681 Ga0213876_100086814 315
674 3300025230 Ga0209563_103763 Ga0209563_1037632 315
675 3300025245 Ga0207425_1007458 Ga0207425_10074583 315
676 3300025253 Ga0209677_103733 Ga0209677_1037332 315
677 3300025254 Ga0209148_1000316 Ga0209148_100031661 315
678 3300025254 Ga0209148_1007100 Ga0209148_10071003 315
679 3300025261 Ga0209233_1016979 Ga0209233_10169791 315
680 3300025272 Ga0209455_1006070 Ga0209455_10060702 315
681 3300025295 Ga0209564_1000407 Ga0209564_10004076 315
682 3300025295 Ga0209564_1002075 Ga0209564_10020759 315
683 3300025295 Ga0209564_1005161 Ga0209564_10051614 315
684 3300025295 Ga0209564_1023569 Ga0209564_10235691 315
685 3300025297 Ga0209758_1000106 Ga0209758_1000106128 315
686 3300025297 Ga0209758_1001012 Ga0209758_10010125 315
687 3300025297 Ga0209758_1001683 Ga0209758_100168321 315
688 3300025297 Ga0209758_1002332 Ga0209758_100233219 315
689 3300025297 Ga0209758_1002396 Ga0209758_100239611 315
690 3300025297 Ga0209758_1003816 Ga0209758_10038168 315
691 3300025297 Ga0209758_1007915 Ga0209758_10079153 315
692 3300025297 Ga0209758_1014959 Ga0209758_10149592 315
693 3300025297 Ga0209758_1029030 Ga0209758_10290302 315
694 3300025297 Ga0209758_1037061 Ga0209758_10370612 315
695 3300025299 Ga0209256_1002946 Ga0209256_10029463 315
696 3300025302 Ga0207426_1000374 Ga0207426_10003745 315
697 3300025302 Ga0207426_1001007 Ga0207426_10010075 315
698 3300025302 Ga0207426_1004033 Ga0207426_10040335 315
699 3300025304 Ga0209257_1001741 Ga0209257_100174119 315
700 3300025898 Ga0207692_10005299 Ga0207692_100052994 315
701 3300025900 Ga0207710_10086053 Ga0207710_100860532 315
702 3300025901 Ga0207688_10204097 Ga0207688_102040972 315
703 3300025903 Ga0207680_10221195 Ga0207680_102211952 315
704 3300025904 Ga0207647_10000972 Ga0207647_1000097213 315
705 3300025905 Ga0207685_10018879 Ga0207685_100188792 315
706 3300025905 Ga0207685_10077029 Ga0207685_100770292 315
707 3300025906 Ga0207699_10000363 Ga0207699_100003635 315
708 3300025906 Ga0207699_10002914 Ga0207699_100029144 315
709 3300025906 Ga0207699_10041739 Ga0207699_100417392 315
710 3300025906 Ga0207699_10082273 Ga0207699_100822733 315
711 3300025907 Ga0207645_10192206 Ga0207645_101922062 315
712 3300025907 Ga0207645_10265271 Ga0207645_102652711 315
713 3300025909 Ga0207705_10075543 Ga0207705_100755432 315
714 3300025909 Ga0207705_10194066 Ga0207705_101940662 315
715 3300025910 Ga0207684_10174378 Ga0207684_101743782 315
716 3300025911 Ga0207654_10000729 Ga0207654_100007297 315
717 3300025911 Ga0207654_10028175 Ga0207654_100281753 315
718 3300025911 Ga0207654_10030934 Ga0207654_100309341 315
719 3300025912 Ga0207707_10000541 Ga0207707_1000054131 315
720 3300025912 Ga0207707_10050125 Ga0207707_100501252 315
721 3300025913 Ga0207695_10000478 Ga0207695_1000047844 315
722 3300025913 Ga0207695_10004497 Ga0207695_100044974 315
723 3300025913 Ga0207695_10017775 Ga0207695_100177754 315
724 3300025913 Ga0207695_10024109 Ga0207695_100241095 315
725 3300025913 Ga0207695_10191850 Ga0207695_101918502 315
726 3300025914 Ga0207671_10003084 Ga0207671_100030843 315
727 3300025914 Ga0207671_10133861 Ga0207671_101338611 315
728 3300025914 Ga0207671_10151954 Ga0207671_101519542 315
729 3300025914 Ga0207671_10184623 Ga0207671_101846232 315
730 3300025915 Ga0207693_10005512 Ga0207693_100055124 315
731 3300025915 Ga0207693_10008188 Ga0207693_100081885 315
732 3300025915 Ga0207693_10020448 Ga0207693_100204482 315
733 3300025915 Ga0207693_10024640 Ga0207693_100246402 315
734 3300025915 Ga0207693_10076040 Ga0207693_100760403 315
735 3300025916 Ga0207663_10000425 Ga0207663_100004258 315
736 3300025916 Ga0207663_10031078 Ga0207663_100310782 315
737 3300025916 Ga0207663_10038050 Ga0207663_100380503 315
738 3300025916 Ga0207663_10069893 Ga0207663_100698931 315
739 3300025917 Ga0207660_10009028 Ga0207660_100090284 315
740 3300025919 Ga0207657_10002950 Ga0207657_1000295018 315
741 3300025919 Ga0207657_10029326 Ga0207657_100293263 315
742 3300025919 Ga0207657_10080145 Ga0207657_100801452 315
743 3300025920 Ga0207649_10251963 Ga0207649_102519631 315
744 3300025921 Ga0207652_10007298 Ga0207652_100072984 315
745 3300025921 Ga0207652_10205326 Ga0207652_102053261 315
746 3300025924 Ga0207694_10000849 Ga0207694_1000084918 315
747 3300025924 Ga0207694_10009743 Ga0207694_100097434 315
748 3300025924 Ga0207694_10049921 Ga0207694_100499214 315
749 3300025924 Ga0207694_10103254 Ga0207694_101032542 315
750 3300025927 Ga0207687_10106472 Ga0207687_101064723 315
751 3300025927 Ga0207687_10125264 Ga0207687_101252643 315
752 3300025928 Ga0207700_10008743 Ga0207700_100087435 315
753 3300025928 Ga0207700_10077617 Ga0207700_100776172 315
754 3300025928 Ga0207700_10085514 Ga0207700_100855142 315
755 3300025928 Ga0207700_10095006 Ga0207700_100950063 315
756 3300025928 Ga0207700_10135559 Ga0207700_101355592 315
757 3300025929 Ga0207664_10006763 Ga0207664_100067634 315
758 3300025929 Ga0207664_10111058 Ga0207664_101110582 315
759 3300025929 Ga0207664_10209590 Ga0207664_102095902 315
760 3300025931 Ga0207644_10197868 Ga0207644_101978682 315
761 3300025934 Ga0207686_10040719 Ga0207686_100407192 315
762 3300025935 Ga0207709_10256227 Ga0207709_102562271 315
763 3300025937 Ga0207669_10339047 Ga0207669_103390471 315
764 3300025939 Ga0207665_10003367 Ga0207665_100033674 315
765 3300025939 Ga0207665_10008013 Ga0207665_100080135 315
766 3300025939 Ga0207665_10055096 Ga0207665_100550962 315
767 3300025939 Ga0207665_10186442 Ga0207665_101864422 315
768 3300025939 Ga0207665_10270161 Ga0207665_102701611 315
769 3300025939 Ga0207665_10275786 Ga0207665_102757861 315
770 3300025940 Ga0207691_10323914 Ga0207691_103239142 315
771 3300025941 Ga0207711_10061206 Ga0207711_100612062 315
772 3300025942 Ga0207689_10073080 Ga0207689_100730803 315
773 3300025942 Ga0207689_10343547 Ga0207689_103435471 315
774 3300025944 Ga0207661_10000109 Ga0207661_1000010912 315
775 3300025944 Ga0207661_10029282 Ga0207661_100292823 315
776 3300025944 Ga0207661_10035452 Ga0207661_100354523 315
777 3300025949 Ga0207667_10003413 Ga0207667_100034137 315
778 3300025949 Ga0207667_10090006 Ga0207667_100900062 315
779 3300025949 Ga0207667_10139182 Ga0207667_101391823 315
780 3300025949 Ga0207667_10193729 Ga0207667_101937292 315
781 3300025960 Ga0207651_10229428 Ga0207651_102294281 315
782 3300025961 Ga0207712_10162993 Ga0207712_101629932 315
783 3300025972 Ga0207668_10070947 Ga0207668_100709473 315
784 3300025981 Ga0207640_10039426 Ga0207640_100394263 315
785 3300025981 Ga0207640_10101239 Ga0207640_101012392 315
786 3300025981 Ga0207640_10206678 Ga0207640_102066782 315
787 3300025981 Ga0207640_10272708 Ga0207640_102727082 315
788 3300025986 Ga0207658_10150905 Ga0207658_101509052 315
789 3300025986 Ga0207658_10280329 Ga0207658_102803291 315
790 3300026023 Ga0207677_10008230 Ga0207677_100082304 315
791 3300026023 Ga0207677_10011875 Ga0207677_100118753 315
792 3300026023 Ga0207677_10023110 Ga0207677_100231103 315
793 3300026023 Ga0207677_10453452 Ga0207677_104534521 315
794 3300026041 Ga0207639_10025543 Ga0207639_100255434 315
795 3300026041 Ga0207639_10188415 Ga0207639_101884152 315
796 3300026041 Ga0207639_10418632 Ga0207639_104186322 315
797 3300026067 Ga0207678_10006080 Ga0207678_100060808 315
798 3300026067 Ga0207678_10025278 Ga0207678_100252782 315
799 3300026067 Ga0207678_10035705 Ga0207678_100357053 315
800 3300026067 Ga0207678_10106641 Ga0207678_101066413 315
801 3300026075 Ga0207708_10117190 Ga0207708_101171902 315
802 3300026078 Ga0207702_10000003 Ga0207702_1000000355 315
803 3300026078 Ga0207702_10000014 Ga0207702_10000014230 315
804 3300026078 Ga0207702_10059058 Ga0207702_100590583 315
805 3300026078 Ga0207702_10108328 Ga0207702_101083283 315
806 3300026088 Ga0207641_10519200 Ga0207641_105192001 315
807 3300026089 Ga0207648_10011805 Ga0207648_100118051 315
808 3300026089 Ga0207648_10074325 Ga0207648_100743253 315
809 3300026095 Ga0207676_10104985 Ga0207676_101049852 315
810 3300026116 Ga0207674_10029977 Ga0207674_100299774 315
811 3300026116 Ga0207674_10033474 Ga0207674_100334744 315
812 3300026116 Ga0207674_10033728 Ga0207674_100337283 315
813 3300026116 Ga0207674_10064316 Ga0207674_100643163 315
814 3300026118 Ga0207675_100049152 Ga0207675_1000491523 315
815 3300026121 Ga0207683_10085838 Ga0207683_100858382 315
816 3300026121 Ga0207683_10156685 Ga0207683_101566852 315
817 3300026121 Ga0207683_10186779 Ga0207683_101867792 315
818 3300026142 Ga0207698_10042042 Ga0207698_100420421 315
819 3300026142 Ga0207698_10274298 Ga0207698_102742981 315
820 3300026142 Ga0207698_10340597 Ga0207698_103405972 315
821 3300027296 Ga0209389_1000016 Ga0209389_100001675 315
822 3300027296 Ga0209389_1000027 Ga0209389_100002770 315
823 3300027357 Ga0209589_1000005 Ga0209589_1000005334 315
824 3300027357 Ga0209589_1000031 Ga0209589_100003182 315
825 3300027361 Ga0209489_100005 Ga0209489_100005334 315
826 3300027361 Ga0209489_100057 Ga0209489_10005765 315
827 3300027361 Ga0209489_100063 Ga0209489_10006333 315
828 3300027363 Ga0209700_100006 Ga0209700_100006334 315
829 3300027363 Ga0209700_100012 Ga0209700_10001276 315
830 3300028379 Ga0268266_10013890 Ga0268266_100138903 315
831 3300028379 Ga0268266_10150134 Ga0268266_101501342 315
832 3300028379 Ga0268266_10239949 Ga0268266_102399491 315
833 3300028379 Ga0268266_10251298 Ga0268266_102512981 315
834 3300028380 Ga0268265_10031565 Ga0268265_100315654 315
835 3300028380 Ga0268265_10204273 Ga0268265_102042732 315
836 3300028380 Ga0268265_10287455 Ga0268265_102874552 315
837 3300028381 Ga0268264_10000042 Ga0268264_1000004254 315
838 3300028556 Ga0265337_1033706 Ga0265337_10337062 315
839 3300028653 Ga0265323_10004217 Ga0265323_100042172 315
840 3300028786 Ga0307517_10000176 Ga0307517_1000017622 315
841 3300028794 Ga0307515_10170151 Ga0307515_101701513 315
842 3300028794 Ga0307515_10170492 Ga0307515_101704923 315
843 3300028794 Ga0307515_10320650 Ga0307515_103206502 315
844 3300028800 Ga0265338_10000018 Ga0265338_10000018298 315
845 3300030521 Ga0307511_10109053 Ga0307511_101090532 315
846 3300031235 Ga0265330_10017820 Ga0265330_100178203 315
847 3300031238 Ga0265332_10009331 Ga0265332_100093312 315
848 3300031241 Ga0265325_10005802 Ga0265325_100058024 315
849 3300031247 Ga0265340_10001337 Ga0265340_100013377 315
850 3300031247 Ga0265340_10025601 Ga0265340_100256013 315
851 3300031249 Ga0265339_10000383 Ga0265339_100003834 315
852 3300031250 Ga0265331_10116621 Ga0265331_101166211 315
853 3300031456 Ga0307513_10198053 Ga0307513_101980532 315
854 3300031616 Ga0307508_10000029 Ga0307508_10000029101 315
855 3300031616 Ga0307508_10208833 Ga0307508_102088331 315
856 3300031711 Ga0265314_10006665 Ga0265314_100066654 315
857 3300031711 Ga0265314_10008159 Ga0265314_100081594 315
858 3300031712 Ga0265342_10005588 Ga0265342_100055887 315
859 3300031730 Ga0307516_10010558 Ga0307516_1001055812 315
860 3300031730 Ga0307516_10052151 Ga0307516_100521512 315
861 3300031730 Ga0307516_10159510 Ga0307516_101595102 315
862 3300031730 Ga0307516_10334755 Ga0307516_103347551 315
863 3300031731 Ga0307405_10126650 Ga0307405_101266503 315
864 3300031824 Ga0307413_10027580 Ga0307413_100275801 315
865 3300031838 Ga0307518_10172468 Ga0307518_101724682 315
866 3300031903 Ga0307407_10204728 Ga0307407_102047282 315
867 3300031911 Ga0307412_10317466 Ga0307412_103174661 315
868 3300031995 Ga0307409_100111072 Ga0307409_1001110722 315
869 3300032004 Ga0307414_10206054 Ga0307414_102060542 315
870 3300032126 Ga0307415_100059081 Ga0307415_1000590812 315
871 3300032126 Ga0307415_100255756 Ga0307415_1002557561 315
872 3300033179 Ga0307507_10018699 Ga0307507_100186997 315
873 3300033180 Ga0307510_10010093 Ga0307510_100100939 315
874 3300033180 Ga0307510_10016909 Ga0307510_100169094 315
875 3300033180 Ga0307510_10069235 Ga0307510_100692352 315
876 3300033180 Ga0307510_10092093 Ga0307510_100920932 315
877 3300033180 Ga0307510_10287697 Ga0307510_102876971 315
878 3300033442 Ga0315911_1000005 Ga0315911_1000005297 315
879 3300033544 Ga0316215_1002174 Ga0316215_10021742 315
880 3300035086 Ga0373934_0008533 Ga0373934_0008533_2084_3031 315
881 3300035111 Ga0373923_0000376 Ga0373923_0000376_6181_7128 315
882 3300035113 Ga0373936_0042953 Ga0373936_0042953_778_1725 315
883 3300035113 Ga0373936_0045036 Ga0373936_0045036_668_1615 315
884 3300035116 Ga0373945_0013564 Ga0373945_0013564_747_1694 315
885 3300035117 Ga0373953_0000156 Ga0373953_0000156_8880_9827 315
886 3300035117 Ga0373953_0008171 Ga0373953_0008171_676_1623 315
887 3300035118 Ga0373954_0007578 Ga0373954_0007578_3296_4243 315
888 3300035118 Ga0373954_0020449 Ga0373954_0020449_716_1663 315
889 3300035119 Ga0373956_0002378 Ga0373956_0002378_5242_6189 315
890 3300035119 Ga0373956_0103597 Ga0373956_0103597_196_1143 315
891 3300035120 Ga0373957_0017078 Ga0373957_0017078_603_1550 315
892 3300035120 Ga0373957_0063987 Ga0373957_0063987_262_1209 315
893 3300035170 Ga0373943_0040115 Ga0373943_0040115_486_1433 315
894 3300035170 Ga0373943_0101959 Ga0373943_0101959_74_1021 315
895 3300035170 Ga0373943_0134726 Ga0373943_0134726_26_973 315
896 3300035171 Ga0373946_0043204 Ga0373946_0043204_175_1122 315
897 3300035172 Ga0373955_0000395 Ga0373955_0000395_14618_15565 315
898 3300035172 Ga0373955_0013079 Ga0373955_0013079_54_1001 315
899 3300035172 Ga0373955_0022863 Ga0373955_0022863_867_1814 315
900 3300035242 Ga0373962_0044677 Ga0373962_0044677_28_975 315
901 3300035410 Ga0373924_0010939 Ga0373924_0010939_1853_2800 315
902 3300035410 Ga0373924_0013913 Ga0373924_0013913_1807_2754 315
903 3300035410 Ga0373924_0055242 Ga0373924_0055242_78_1025 315
904 3300035691 Ga0373931_0018329 Ga0373931_0018329_2277_3224 315
905 3300035692 Ga0373935_0055538 Ga0373935_0055538_1377_2324 315
906 3300035695 Ga0373927_0002702 Ga0373927_0002702_8120_9067 315
907 3300035695 Ga0373927_0004819 Ga0373927_0004819_7165_8112 315
908 3300035695 Ga0373927_0005543 Ga0373927_0005543_840_1787 315
909 3300035695 Ga0373927_0007994 Ga0373927_0007994_4716_5663 315
910 3300035695 Ga0373927_0017690 Ga0373927_0017690_1600_2547 315
911 3300035695 Ga0373927_0043246 Ga0373927_0043246_1712_2659 315
912 3300035724 Ga0373933_0001227 Ga0373933_0001227_11339_12286 315
913 3300035724 Ga0373933_0004820 Ga0373933_0004820_1924_2871 315
914 3300035724 Ga0373933_0075719 Ga0373933_0075719_172_1119 315
915 3300035724 Ga0373933_0193597 Ga0373933_0193597_78_1025 315
916 3300035725 Ga0373947_0003219 Ga0373947_0003219_823_1770 315
917 3300035725 Ga0373947_0006770 Ga0373947_0006770_3047_3994 315
918 3300035725 Ga0373947_0044253 Ga0373947_0044253_535_1482 315
919 3300035725 Ga0373947_0050934 Ga0373947_0050934_1073_2020 315
920 3300036401 Ga0373937_0053490 Ga0373937_0053490_174_1121 315
921 3300036401 Ga0373937_0096791 Ga0373937_0096791_1757_2704 315
922 3300036401 Ga0373937_0128821 Ga0373937_0128821_973_1920 315
923 3300036459 Ga0372808_002595 Ga0372808_002595_1032_1979 315
924 3300037068 Ga0373925_0009475 Ga0373925_0009475_3386_4333 315
925 3300037068 Ga0373925_0042948 Ga0373925_0042948_1030_1977 315
926 3300037068 Ga0373925_0053938 Ga0373925_0053938_1896_2843 315
927 3300037068 Ga0373925_0055671 Ga0373925_0055671_507_1454 315
928 3300037068 Ga0373925_0099706 Ga0373925_0099706_181_1128 315
929 3300037312 Ga0395899_0076124 Ga0395899_0076124_49_996 315
930 3300037418 Ga0395900_0102016 Ga0395900_0102016_1596_2543 315
931 3300037418 Ga0395900_0216970 Ga0395900_0216970_299_1246 315
932 3300037418 Ga0395900_0229693 Ga0395900_0229693_579_1526 315
933 3300037418 Ga0395900_0272758 Ga0395900_0272758_73_1020 315
934 3300037466 Ga0395898_0017601 Ga0395898_0017601_1536_2483 315
935 3300037466 Ga0395898_0028587 Ga0395898_0028587_3038_3985 315
936 3300037466 Ga0395898_0088505 Ga0395898_0088505_133_1080 315
937 3300037466 Ga0395898_0152606 Ga0395898_0152606_486_1433 315
938 3300037471 Ga0395905_0020329 Ga0395905_0020329_3154_4101 315
939 3300037471 Ga0395905_0046809 Ga0395905_0046809_2985_3932 315
940 3300037853 Ga0436364_0974159 Ga0436364_0974159_13052_14110 315
941 3300038443 Ga0395901_0230018 Ga0395901_0230018_898_1845 315
942 3300038443 Ga0395901_0248432 Ga0395901_0248432_694_1641 315
943 3300038443 Ga0395901_0305113 Ga0395901_0305113_91_1038 315
944 3300039437 Ga0436365_0902375 Ga0436365_0902375_1955_2902 315
945 3300039437 Ga0436365_1181574 Ga0436365_1181574_229_1176 315
946 3300039437 Ga0436365_1371184 Ga0436365_1371184_3380_4327 315
947 3300039437 Ga0436365_1421230 Ga0436365_1421230_128_1075 315
948 3300039438 Ga0436360_1202522 Ga0436360_1202522_106_1053 315
949 3300039447 Ga0436361_0189402 Ga0436361_0189402_164_1111 315
950 3300039450 Ga0436363_0012099 Ga0436363_0012099_2451_3398 315
951 3300039450 Ga0436363_0300253 Ga0436363_0300253_238_1185 315
952 3300039450 Ga0436363_0351383 Ga0436363_0351383_97_1044 315
953 3300039450 Ga0436363_0717611 Ga0436363_0717611_84_1031 315
954 3300039450 Ga0436363_0972840 Ga0436363_0972840_312_1259 315
955 3300039453 Ga0436362_0993687 Ga0436362_0993687_212_1159 315
956 3300042438 Ga0439459_0027711 Ga0439459_0027711_93_1040 315
957 3300044658 Ga0466972_0000177 Ga0466972_0000177_21508_22455 315
958 3300044658 Ga0466972_0009169 Ga0466972_0009169_597_1544 315
959 3300044683 Ga0466965_0060131 Ga0466965_0060131_13_960 315
960 3300044684 Ga0466966_0008326 Ga0466966_0008326_2881_3828 315
961 3300044684 Ga0466966_0112238 Ga0466966_0112238_230_1177 315
962 3300044684 Ga0466966_0127871 Ga0466966_0127871_61_1008 315
963 3300044693 Ga0466961_0000023 Ga0466961_0000023_91542_92489 315
964 3300044694 Ga0466963_0139531 Ga0466963_0139531_566_1513 315
965 3300044694 Ga0466963_0248798 Ga0466963_0248798_124_1071 315
966 3300044719 Ga0466971_0050539 Ga0466971_0050539_887_1834 315
967 3300044735 Ga0466968_0001025 Ga0466968_0001025_1628_2575 315
968 3300044735 Ga0466968_0063853 Ga0466968_0063853_33_980 315
969 3300044842 Ga0466957_0042855 Ga0466957_0042855_1270_2217 315
970 3300044901 Ga0466960_0039020 Ga0466960_0039020_594_1541 315
971 3300045049 Ga0466959_0011640 Ga0466959_0011640_3465_4412 315
972 3300045049 Ga0466959_0030640 Ga0466959_0030640_1146_2093 315
973 3300045976 Ga0466967_0055936 Ga0466967_0055936_863_1810 315
974 3300045976 Ga0466967_0121122 Ga0466967_0121122_1418_2365 315
975 3300045976 Ga0466967_0184510 Ga0466967_0184510_354_1301 315
976 3300046452 Ga0495617_044644 Ga0495617_044644_95_1042 315
977 3300046454 Ga0495592_0014358 Ga0495592_0014358_2008_2955 315
978 3300046454 Ga0495592_0030040 Ga0495592_0030040_2191_3138 315
979 3300046454 Ga0495592_0041543 Ga0495592_0041543_1897_2844 315
980 3300046454 Ga0495592_0064793 Ga0495592_0064793_132_1079 315
981 3300046455 Ga0495603_0000521 Ga0495603_0000521_15014_15961 315
982 3300046455 Ga0495603_0008860 Ga0495603_0008860_2212_3159 315
983 3300046455 Ga0495603_0025504 Ga0495603_0025504_331_1278 315
984 3300046455 Ga0495603_0028412 Ga0495603_0028412_2070_3017 315
985 3300046455 Ga0495603_0029577 Ga0495603_0029577_70_1017 315
986 3300046455 Ga0495603_0051688 Ga0495603_0051688_786_1733 315
987 3300046459 Ga0495629_0000416 Ga0495629_0000416_25505_26452 315
988 3300046459 Ga0495629_0015774 Ga0495629_0015774_1796_2743 315
989 3300046459 Ga0495629_0027646 Ga0495629_0027646_1761_2708 315
990 3300046459 Ga0495629_0032989 Ga0495629_0032989_1118_2065 315
991 3300046459 Ga0495629_0252456 Ga0495629_0252456_204_1151 315
992 3300046460 Ga0495638_0038240 Ga0495638_0038240_82_1029 315
993 3300046460 Ga0495638_0182674 Ga0495638_0182674_193_1140 315
994 3300046461 Ga0495641_0002593 Ga0495641_0002593_5075_6022 315
995 3300046461 Ga0495641_0140642 Ga0495641_0140642_14_961 315
996 3300046462 Ga0495651_0017227 Ga0495651_0017227_2631_3578 315
997 3300046462 Ga0495651_0019582 Ga0495651_0019582_1470_2417 315
998 3300046462 Ga0495651_0080458 Ga0495651_0080458_1015_1962 315
999 3300046463 Ga0495653_0003573 Ga0495653_0003573_5924_6871 315
1000 3300046463 Ga0495653_0023310 Ga0495653_0023310_1926_2873 315
1001 3300046463 Ga0495653_0210320 Ga0495653_0210320_159_1106 315
1002 3300046471 Ga0495650_0039141 Ga0495650_0039141_623_1570 315
1003 3300046472 Ga0495580_0016728 Ga0495580_0016728_3037_3984 315
1004 3300046472 Ga0495580_0039257 Ga0495580_0039257_795_1742 315
1005 3300046472 Ga0495580_0113133 Ga0495580_0113133_52_999 315
1006 3300046473 Ga0495582_0002376 Ga0495582_0002376_5504_6451 315
1007 3300046473 Ga0495582_0070470 Ga0495582_0070470_590_1537 315
1008 3300046473 Ga0495582_0080684 Ga0495582_0080684_355_1302 315
1009 3300046474 Ga0495605_0065220 Ga0495605_0065220_759_1706 315
1010 3300046475 Ga0495639_0001046 Ga0495639_0001046_2694_3641 315
1011 3300046475 Ga0495639_0061572 Ga0495639_0061572_29_976 315
1012 3300046475 Ga0495639_0096435 Ga0495639_0096435_203_1150 315
1013 3300046476 Ga0495662_0008728 Ga0495662_0008728_278_1225 315
1014 3300046477 Ga0495664_0009023 Ga0495664_0009023_1845_2792 315
1015 3300046477 Ga0495664_0009265 Ga0495664_0009265_2525_3472 315
1016 3300046477 Ga0495664_0050469 Ga0495664_0050469_296_1243 315
1017 3300046477 Ga0495664_0125425 Ga0495664_0125425_584_1531 315
1018 3300046477 Ga0495664_0126090 Ga0495664_0126090_542_1489 315
1019 3300046499 Ga0495594_0000194 Ga0495594_0000194_22428_23375 315
1020 3300046499 Ga0495594_0015448 Ga0495594_0015448_1117_2064 315
1021 3300046499 Ga0495594_0074283 Ga0495594_0074283_199_1146 315
1022 3300046500 Ga0495596_0093615 Ga0495596_0093615_154_1101 315
1023 3300046506 Ga0495583_0028181 Ga0495583_0028181_1113_2060 315
1024 3300046506 Ga0495583_0061572 Ga0495583_0061572_426_1373 315
1025 3300046507 Ga0495606_0002692 Ga0495606_0002692_1983_2930 315
1026 3300046507 Ga0495606_0028857 Ga0495606_0028857_2282_3229 315
1027 3300046507 Ga0495606_0212094 Ga0495606_0212094_72_1019 315
1028 3300046511 Ga0495608_0005104 Ga0495608_0005104_2766_3713 315
1029 3300046511 Ga0495608_0031821 Ga0495608_0031821_830_1777 315
1030 3300046511 Ga0495608_0032235 Ga0495608_0032235_1784_2731 315
1031 3300046511 Ga0495608_0032328 Ga0495608_0032328_360_1307 315
1032 3300046511 Ga0495608_0172333 Ga0495608_0172333_12_959 315
1033 3300046512 Ga0495610_0027743 Ga0495610_0027743_1070_2017 315
1034 3300046514 Ga0495618_0049985 Ga0495618_0049985_898_1845 315
1035 3300046514 Ga0495618_0060411 Ga0495618_0060411_1439_2386 315
1036 3300046514 Ga0495618_0075508 Ga0495618_0075508_362_1309 315
1037 3300046515 Ga0495620_0010396 Ga0495620_0010396_3368_4315 315
1038 3300046515 Ga0495620_0033954 Ga0495620_0033954_491_1438 315
1039 3300046516 Ga0495628_0044263 Ga0495628_0044263_555_1502 315
1040 3300046516 Ga0495628_0058442 Ga0495628_0058442_1819_2766 315
1041 3300046516 Ga0495628_0106350 Ga0495628_0106350_196_1143 315
1042 3300046516 Ga0495628_0321080 Ga0495628_0321080_180_1127 315
1043 3300046517 Ga0495630_0006451 Ga0495630_0006451_6152_7099 315
1044 3300046517 Ga0495630_0097184 Ga0495630_0097184_104_1051 315
1045 3300046517 Ga0495630_0134827 Ga0495630_0134827_237_1184 315
1046 3300046517 Ga0495630_0333958 Ga0495630_0333958_24_971 315
1047 3300046519 Ga0495632_0077742 Ga0495632_0077742_340_1287 315
1048 3300046522 Ga0495643_0076774 Ga0495643_0076774_653_1600 315
1049 3300046522 Ga0495643_0168421 Ga0495643_0168421_35_982 315
1050 3300046523 Ga0495644_0012613 Ga0495644_0012613_584_1531 315
1051 3300046524 Ga0495648_0000640 Ga0495648_0000640_7967_9001 315
1052 3300046524 Ga0495648_0004726 Ga0495648_0004726_5555_6502 315
1053 3300046524 Ga0495648_0031996 Ga0495648_0031996_2307_3254 315
1054 3300046524 Ga0495648_0093792 Ga0495648_0093792_17_964 315
1055 3300046524 Ga0495648_0155220 Ga0495648_0155220_175_1122 315
1056 3300046529 Ga0495652_0010465 Ga0495652_0010465_1328_2275 315
1057 3300046529 Ga0495652_0030338 Ga0495652_0030338_2635_3582 315
1058 3300046529 Ga0495652_0046863 Ga0495652_0046863_1625_2572 315
1059 3300046529 Ga0495652_0062849 Ga0495652_0062849_1607_2554 315
1060 3300046529 Ga0495652_0075223 Ga0495652_0075223_642_1589 315
1061 3300046529 Ga0495652_0094913 Ga0495652_0094913_736_1683 315
1062 3300046531 Ga0495665_0028025 Ga0495665_0028025_775_1722 315
1063 3300046533 Ga0495640_0006591 Ga0495640_0006591_4029_4976 315
1064 3300046533 Ga0495640_0011385 Ga0495640_0011385_3298_4245 315
1065 3300046533 Ga0495640_0020972 Ga0495640_0020972_3341_4288 315
1066 3300046533 Ga0495640_0030206 Ga0495640_0030206_1752_2699 315
1067 3300046535 Ga0495586_0175358 Ga0495586_0175358_70_1017 315
1068 3300046536 Ga0495587_0010857 Ga0495587_0010857_3793_4740 315
1069 3300046536 Ga0495587_0035814 Ga0495587_0035814_1328_2275 315
1070 3300046536 Ga0495587_0082267 Ga0495587_0082267_731_1678 315
1071 3300046537 Ga0495598_0080814 Ga0495598_0080814_35_982 315
1072 3300046538 Ga0495609_0024989 Ga0495609_0024989_1273_2220 315
1073 3300046543 Ga0495645_0012719 Ga0495645_0012719_3394_4341 315
1074 3300046543 Ga0495645_0012763 Ga0495645_0012763_943_1890 315
1075 3300046557 Ga0495622_0002024 Ga0495622_0002024_5505_6452 315
1076 3300046557 Ga0495622_0060394 Ga0495622_0060394_748_1695 315
1077 3300046558 Ga0495633_0035962 Ga0495633_0035962_1070_2017 315
1078 3300046559 Ga0495667_0009312 Ga0495667_0009312_2766_3713 315
1079 3300046559 Ga0495667_0020357 Ga0495667_0020357_1438_2385 315
1080 3300046559 Ga0495667_0030759 Ga0495667_0030759_619_1566 315
1081 3300046559 Ga0495667_0114893 Ga0495667_0114893_325_1272 315
1082 3300046559 Ga0495667_0196348 Ga0495667_0196348_240_1187 315
1083 3300046559 Ga0495667_0256126 Ga0495667_0256126_95_1042 315
1084 3300046615 Ga0495656_0005884 Ga0495656_0005884_1036_1983 315
1085 3300046615 Ga0495656_0014228 Ga0495656_0014228_580_1527 315
1086 3300046615 Ga0495656_0021610 Ga0495656_0021610_288_1235 315
1087 3300046615 Ga0495656_0038955 Ga0495656_0038955_130_1077 315
1088 3300046616 Ga0495668_0091403 Ga0495668_0091403_352_1299 315
1089 3300046642 Ga0495634_0000602 Ga0495634_0000602_8401_9348 315
1090 3300046642 Ga0495634_0029561 Ga0495634_0029561_1663_2610 315
1091 3300046642 Ga0495634_0031702 Ga0495634_0031702_323_1270 315
1092 3300046660 Ga0495625_0012900 Ga0495625_0012900_1844_2791 315
1093 3300046660 Ga0495625_0068905 Ga0495625_0068905_399_1346 315
1094 3300046663 Ga0495635_0002469 Ga0495635_0002469_11194_12141 315
1095 3300046663 Ga0495635_0003077 Ga0495635_0003077_4735_5682 315
1096 3300046663 Ga0495635_0047928 Ga0495635_0047928_1814_2761 315
1097 3300046663 Ga0495635_0116781 Ga0495635_0116781_219_1166 315
1098 3300046663 Ga0495635_0247729 Ga0495635_0247729_197_1144 315
1099 3300046665 Ga0495661_0078336 Ga0495661_0078336_537_1484 315
1100 3300046674 Ga0495588_0037312 Ga0495588_0037312_928_1875 315
1101 3300046674 Ga0495588_0119203 Ga0495588_0119203_73_1020 315
1102 3300046675 Ga0495657_0004929 Ga0495657_0004929_9441_10388 315
1103 3300046675 Ga0495657_0021231 Ga0495657_0021231_2741_3688 315
1104 3300046675 Ga0495657_0026420 Ga0495657_0026420_973_1920 315
1105 3300046675 Ga0495657_0044079 Ga0495657_0044079_1950_2897 315
1106 3300046678 Ga0495599_0006110 Ga0495599_0006110_4020_4967 315
1107 3300046678 Ga0495599_0006329 Ga0495599_0006329_5554_6501 315
1108 3300046678 Ga0495599_0011625 Ga0495599_0011625_2420_3367 315
1109 3300046679 Ga0495623_0004956 Ga0495623_0004956_5090_6037 315
1110 3300046679 Ga0495623_0011109 Ga0495623_0011109_4089_5036 315
1111 3300046679 Ga0495623_0016712 Ga0495623_0016712_1523_2470 315
1112 3300046680 Ga0495646_0048818 Ga0495646_0048818_834_1781 315
1113 3300046680 Ga0495646_0060074 Ga0495646_0060074_19_966 315
1114 3300046680 Ga0495646_0076660 Ga0495646_0076660_583_1530 315
1115 3300046680 Ga0495646_0108652 Ga0495646_0108652_382_1329 315
1116 3300046681 Ga0495647_0000414 Ga0495647_0000414_6516_7463 315
1117 3300046683 Ga0495658_0002719 Ga0495658_0002719_5200_6147 315
1118 3300046683 Ga0495658_0028724 Ga0495658_0028724_1241_2188 315
1119 3300046683 Ga0495658_0183068 Ga0495658_0183068_239_1186 315
1120 3300046684 Ga0495669_0044936 Ga0495669_0044936_789_1736 315
1121 3300046689 Ga0495613_0022972 Ga0495613_0022972_173_1120 315
1122 3300046689 Ga0495613_0033323 Ga0495613_0033323_1726_2673 315
1123 3300046689 Ga0495613_0148239 Ga0495613_0148239_664_1611 315
1124 3300046689 Ga0495613_0188071 Ga0495613_0188071_416_1363 315
1125 3300046689 Ga0495613_0208217 Ga0495613_0208217_348_1295 315
1126 3300046690 Ga0495624_0003072 Ga0495624_0003072_2435_3382 315
1127 3300046690 Ga0495624_0038315 Ga0495624_0038315_1149_2096 315
1128 3300046690 Ga0495624_0068957 Ga0495624_0068957_522_1469 315
1129 3300046691 Ga0495670_0001065 Ga0495670_0001065_279_1226 315
1130 3300046691 Ga0495670_0043819 Ga0495670_0043819_537_1484 315
1131 3300046694 Ga0495649_0026167 Ga0495649_0026167_586_1533 315
1132 3300046694 Ga0495649_0046915 Ga0495649_0046915_463_1410 315
1133 3300046794 Ga0495589_0022229 Ga0495589_0022229_1118_2065 315
1134 3300046809 Ga0495600_0012415 Ga0495600_0012415_2193_3140 315
1135 3300046809 Ga0495600_0012561 Ga0495600_0012561_1796_2743 315
1136 3300046809 Ga0495600_0038915 Ga0495600_0038915_269_1216 315
1137 3300046809 Ga0495600_0081594 Ga0495600_0081594_28_975 315
1138 3300047315 Ga0495581_0000133 Ga0495581_0000133_5505_6452 315
1139 3300047315 Ga0495581_0132153 Ga0495581_0132153_135_1082 315
1140 3300047315 Ga0495581_0150227 Ga0495581_0150227_43_990 315
1141 3300047315 Ga0495581_0202051 Ga0495581_0202051_86_1033 315
1142 3300047315 Ga0495581_0256787 Ga0495581_0256787_30_977 315
1143 3300047317 Ga0495604_0013217 Ga0495604_0013217_715_1662 315
1144 3300047317 Ga0495604_0054319 Ga0495604_0054319_1804_2751 315
1145 3300047317 Ga0495604_0089599 Ga0495604_0089599_216_1163 315
1146 3300047319 Ga0495674_0000874 Ga0495674_0000874_25462_26409 315
1147 3300047319 Ga0495674_0012220 Ga0495674_0012220_6311_7258 315
1148 3300047319 Ga0495674_0054204 Ga0495674_0054204_763_1710 315
1149 3300047319 Ga0495674_0317188 Ga0495674_0317188_233_1180 315
1150 3300047320 Ga0495672_0025641 Ga0495672_0025641_210_1157 315
1151 3300047320 Ga0495672_0035311 Ga0495672_0035311_798_1745 315
1152 3300047321 Ga0495676_0015692 Ga0495676_0015692_1198_2145 315
1153 3300047321 Ga0495676_0064310 Ga0495676_0064310_192_1139 315
1154 3300047321 Ga0495676_0120501 Ga0495676_0120501_757_1704 315
1155 3300047321 Ga0495676_0134248 Ga0495676_0134248_87_1034 315
1156 3300047322 Ga0495680_0017277 Ga0495680_0017277_4503_5450 315
1157 3300047322 Ga0495680_0053089 Ga0495680_0053089_909_1856 315
1158 3300047322 Ga0495680_0258365 Ga0495680_0258365_40_987 315
1159 3300047443 Ga0495687_013529 Ga0495687_013529_45_992 315
1160 3300047444 Ga0495675_0001856 Ga0495675_0001856_10863_11810 315
1161 3300047444 Ga0495675_0014102 Ga0495675_0014102_2638_3585 315
1162 3300047444 Ga0495675_0014120 Ga0495675_0014120_3871_4818 315
1163 3300047469 Ga0495673_0004092 Ga0495673_0004092_4360_5307 315
1164 3300047471 Ga0495684_0000294 Ga0495684_0000294_9432_10379 315
1165 3300047471 Ga0495684_0020080 Ga0495684_0020080_3493_4440 315
1166 3300047471 Ga0495684_0025060 Ga0495684_0025060_2049_2996 315
1167 3300047471 Ga0495684_0049052 Ga0495684_0049052_1598_2545 315
1168 3300047472 Ga0495686_0180977 Ga0495686_0180977_77_1024 315
1169 3300047673 Ga0495593_0000022 Ga0495593_0000022_8153_9100 315
1170 3300047673 Ga0495593_0000744 Ga0495593_0000744_16664_17611 315
1171 3300047673 Ga0495593_0009120 Ga0495593_0009120_1824_2771 315
1172 3300047673 Ga0495593_0016629 Ga0495593_0016629_2215_3162 315
1173 3300047673 Ga0495593_0032757 Ga0495593_0032757_64_1011 315
1174 3300048088 Ga0495602_0030626 Ga0495602_0030626_1598_2545 315
1175 3300048088 Ga0495602_0060623 Ga0495602_0060623_41_988 315
1176 3300048088 Ga0495602_0156786 Ga0495602_0156786_666_1613 315
1177 3300048088 Ga0495602_0209035 Ga0495602_0209035_444_1391 315
1178 3300048088 Ga0495602_0230461 Ga0495602_0230461_348_1295 315
1179 3300048088 Ga0495602_0271777 Ga0495602_0271777_173_1120 315
1180 3300048089 Ga0495614_0022860 Ga0495614_0022860_202_1149 315
1181 3300048903 Ga0496100_0003499 Ga0496100_0003499_4325_5272 315
1182 3300048903 Ga0496100_0147031 Ga0496100_0147031_510_1457 315
1183 3300048904 Ga0496101_0009124 Ga0496101_0009124_3516_4463 315
1184 3300048904 Ga0496101_0056421 Ga0496101_0056421_802_1749 315
1185 3300048904 Ga0496101_0153683 Ga0496101_0153683_22_969 315
1186 3300048904 Ga0496101_0349734 Ga0496101_0349734_75_1022 315
1187 3300048905 Ga0496102_0006184 Ga0496102_0006184_3903_4850 315
1188 3300048905 Ga0496102_0029606 Ga0496102_0029606_1605_2552 315
1189 3300048905 Ga0496102_0059757 Ga0496102_0059757_2017_2964 315
1190 3300048905 Ga0496102_0073409 Ga0496102_0073409_638_1585 315
1191 3300048905 Ga0496102_0159376 Ga0496102_0159376_158_1105 315
1192 3300048906 Ga0496103_0006862 Ga0496103_0006862_4160_5107 315
1193 3300048906 Ga0496103_0061923 Ga0496103_0061923_800_1747 315
1194 3300048906 Ga0496103_0165405 Ga0496103_0165405_158_1105 315
1195 3300048906 Ga0496103_0210261 Ga0496103_0210261_209_1156 315
1196 3300048907 Ga0496104_0002005 Ga0496104_0002005_14407_15354 315
1197 3300048907 Ga0496104_0030942 Ga0496104_0030942_2078_3025 315
1198 3300048907 Ga0496104_0039125 Ga0496104_0039125_2984_3931 315
1199 3300048907 Ga0496104_0043721 Ga0496104_0043721_2860_3807 315
1200 3300048907 Ga0496104_0070616 Ga0496104_0070616_1417_2364 315
1201 3300048907 Ga0496104_0110978 Ga0496104_0110978_35_982 315
1202 3300048907 Ga0496104_0164368 Ga0496104_0164368_664_1611 315
1203 3300048907 Ga0496104_0166508 Ga0496104_0166508_274_1221 315
1204 3300048908 Ga0496105_0015812 Ga0496105_0015812_3648_4595 315
1205 3300048908 Ga0496105_0018819 Ga0496105_0018819_2979_3926 315
1206 3300048908 Ga0496105_0026728 Ga0496105_0026728_1989_2936 315
1207 3300048908 Ga0496105_0127943 Ga0496105_0127943_917_1864 315
1208 3300048909 Ga0496106_0003691 Ga0496106_0003691_5752_6699 315
1209 3300048909 Ga0496106_0007852 Ga0496106_0007852_1015_1962 315
1210 3300048909 Ga0496106_0009940 Ga0496106_0009940_2387_3334 315
1211 3300048909 Ga0496106_0038934 Ga0496106_0038934_1014_1961 315
1212 3300048909 Ga0496106_0309438 Ga0496106_0309438_273_1220 315
1213 3300048910 Ga0496107_0020799 Ga0496107_0020799_2244_3191 315
1214 3300048910 Ga0496107_0042505 Ga0496107_0042505_256_1203 315
1215 3300048910 Ga0496107_0063392 Ga0496107_0063392_1657_2604 315
1216 3300048910 Ga0496107_0122472 Ga0496107_0122472_353_1300 315
1217 3300048910 Ga0496107_0315214 Ga0496107_0315214_151_1098 315
1218 3300048911 Ga0496108_0024899 Ga0496108_0024899_3491_4438 315
1219 3300048911 Ga0496108_0068090 Ga0496108_0068090_1999_2946 315
1220 3300048911 Ga0496108_0079127 Ga0496108_0079127_1320_2267 315
1221 3300048911 Ga0496108_0215261 Ga0496108_0215261_679_1626 315
1222 3300048912 Ga0496109_0000910 Ga0496109_0000910_6154_7101 315
1223 3300048912 Ga0496109_0010481 Ga0496109_0010481_5466_6413 315
1224 3300048912 Ga0496109_0016308 Ga0496109_0016308_4364_5311 315
1225 3300048912 Ga0496109_0016600 Ga0496109_0016600_240_1187 315
1226 3300048912 Ga0496109_0061904 Ga0496109_0061904_1605_2552 315
1227 3300048912 Ga0496109_0593720 Ga0496109_0593720_57_1004 315
1228 3300048913 Ga0496110_0039029 Ga0496110_0039029_2462_3409 315
1229 3300048913 Ga0496110_0145765 Ga0496110_0145765_946_1893 315
1230 3300048913 Ga0496110_0275393 Ga0496110_0275393_529_1476 315
1231 3300048914 Ga0496111_0011896 Ga0496111_0011896_3263_4210 315
1232 3300048914 Ga0496111_0094046 Ga0496111_0094046_423_1370 315
1233 3300048914 Ga0496111_0267495 Ga0496111_0267495_47_994 315
1234 3300048914 Ga0496111_0361996 Ga0496111_0361996_41_988 315
1235 3300048915 Ga0496112_0000022 Ga0496112_0000022_19662_20609 315
1236 3300048915 Ga0496112_0008650 Ga0496112_0008650_2979_3926 315
1237 3300048915 Ga0496112_0020467 Ga0496112_0020467_5245_6192 315
1238 3300048915 Ga0496112_0020945 Ga0496112_0020945_4620_5567 315
1239 3300048915 Ga0496112_0029523 Ga0496112_0029523_4008_4955 315
1240 3300048915 Ga0496112_0035183 Ga0496112_0035183_1773_2720 315
1241 3300048915 Ga0496112_0039089 Ga0496112_0039089_3058_4005 315
1242 3300048915 Ga0496112_0067762 Ga0496112_0067762_1645_2592 315
1243 3300048915 Ga0496112_0113658 Ga0496112_0113658_1705_2652 315
1244 3300048915 Ga0496112_0162367 Ga0496112_0162367_930_1877 315
1245 3300048916 Ga0496113_0001596 Ga0496113_0001596_507_1454 315
1246 3300048916 Ga0496113_0021222 Ga0496113_0021222_728_1675 315
1247 3300048916 Ga0496113_0026536 Ga0496113_0026536_535_1482 315
1248 3300048916 Ga0496113_0094105 Ga0496113_0094105_444_1391 315
1249 3300048916 Ga0496113_0131651 Ga0496113_0131651_882_1829 315
1250 3300048917 Ga0496114_0072883 Ga0496114_0072883_1032_1979 315
1251 3300048917 Ga0496114_0116982 Ga0496114_0116982_300_1247 315
1252 3300048917 Ga0496114_0310704 Ga0496114_0310704_273_1220 315
1253 3300048917 Ga0496114_0397536 Ga0496114_0397536_252_1199 315
1254 3300048918 Ga0496115_0032084 Ga0496115_0032084_1666_2613 315
1255 3300048918 Ga0496115_0037994 Ga0496115_0037994_249_1196 315
1256 3300048918 Ga0496115_0043743 Ga0496115_0043743_1696_2643 315
1257 3300048918 Ga0496115_0043883 Ga0496115_0043883_920_1867 315
1258 3300048918 Ga0496115_0047207 Ga0496115_0047207_1695_2642 315
1259 3300048918 Ga0496115_0083801 Ga0496115_0083801_448_1395 315
1260 3300048918 Ga0496115_0122982 Ga0496115_0122982_1124_2071 315
1261 3300048918 Ga0496115_0126130 Ga0496115_0126130_525_1472 315
1262 3300048918 Ga0496115_0133100 Ga0496115_0133100_225_1172 315
1263 3300048918 Ga0496115_0161714 Ga0496115_0161714_835_1782 315
1264 3300048918 Ga0496115_0328247 Ga0496115_0328247_52_999 315
1265 3300048919 Ga0496116_0004251 Ga0496116_0004251_7365_8312 315
1266 3300048920 Ga0496117_0012698 Ga0496117_0012698_183_1130 315
1267 3300048920 Ga0496117_0028820 Ga0496117_0028820_1092_2039 315
1268 3300048921 Ga0496118_0031958 Ga0496118_0031958_3217_4164 315
1269 3300048921 Ga0496118_0032185 Ga0496118_0032185_1548_2495 315
1270 3300048922 Ga0496119_0022613 Ga0496119_0022613_2257_3204 315
1271 3300048922 Ga0496119_0022773 Ga0496119_0022773_1761_2708 315
1272 3300048922 Ga0496119_0023433 Ga0496119_0023433_2883_3830 315
1273 3300048923 Ga0496120_0021002 Ga0496120_0021002_1573_2520 315
1274 3300048923 Ga0496120_0059770 Ga0496120_0059770_247_1194 315
1275 3300048923 Ga0496120_0076022 Ga0496120_0076022_814_1761 315
1276 3300048924 Ga0496121_0000146 Ga0496121_0000146_15100_16047 315
1277 3300048924 Ga0496121_0000254 Ga0496121_0000254_59884_60831 315
1278 3300048924 Ga0496121_0019232 Ga0496121_0019232_5232_6179 315
1279 3300048924 Ga0496121_0024814 Ga0496121_0024814_1221_2168 315
1280 3300048924 Ga0496121_0069007 Ga0496121_0069007_301_1248 315
1281 3300048924 Ga0496121_0080649 Ga0496121_0080649_25_972 315
1282 3300048924 Ga0496121_0099020 Ga0496121_0099020_1119_2066 315
1283 3300048924 Ga0496121_0111711 Ga0496121_0111711_569_1516 315
1284 3300048924 Ga0496121_0123657 Ga0496121_0123657_209_1156 315
1285 3300048924 Ga0496121_0170222 Ga0496121_0170222_264_1211 315
1286 3300048924 Ga0496121_0258583 Ga0496121_0258583_28_975 315
1287 3300048925 Ga0496122_0009335 Ga0496122_0009335_4233_5180 315
1288 3300048925 Ga0496122_0044528 Ga0496122_0044528_930_1877 315
1289 3300048925 Ga0496122_0051764 Ga0496122_0051764_1050_1997 315
1290 3300048925 Ga0496122_0194241 Ga0496122_0194241_94_1041 315
1291 3300048927 Ga0496124_0001236 Ga0496124_0001236_15877_16824 315
1292 3300048927 Ga0496124_0067274 Ga0496124_0067274_702_1649 315
1293 3300048927 Ga0496124_0102995 Ga0496124_0102995_941_1888 315
1294 3300048927 Ga0496124_0340978 Ga0496124_0340978_100_1047 315
1295 3300048928 Ga0496125_0000099 Ga0496125_0000099_47034_47981 315
1296 3300048928 Ga0496125_0002791 Ga0496125_0002791_15381_16328 315
1297 3300048928 Ga0496125_0010906 Ga0496125_0010906_2244_3191 315
1298 3300048928 Ga0496125_0015991 Ga0496125_0015991_5249_6196 315
1299 3300048928 Ga0496125_0029525 Ga0496125_0029525_44_991 315
1300 3300048928 Ga0496125_0043420 Ga0496125_0043420_186_1133 315
1301 3300048928 Ga0496125_0053712 Ga0496125_0053712_760_1707 315
1302 3300048929 Ga0496126_0007002 Ga0496126_0007002_9714_10661 315
1303 3300048929 Ga0496126_0017287 Ga0496126_0017287_4470_5417 315
1304 3300048929 Ga0496126_0038428 Ga0496126_0038428_2258_3205 315
1305 3300048929 Ga0496126_0039889 Ga0496126_0039889_513_1460 315
1306 3300048929 Ga0496126_0043377 Ga0496126_0043377_29_976 315
1307 3300048929 Ga0496126_0047403 Ga0496126_0047403_2651_3598 315
1308 3300048929 Ga0496126_0052470 Ga0496126_0052470_109_1056 315
1309 3300048929 Ga0496126_0054860 Ga0496126_0054860_611_1558 315
1310 3300048929 Ga0496126_0072997 Ga0496126_0072997_1716_2663 315
1311 3300048929 Ga0496126_0085828 Ga0496126_0085828_1332_2279 315
1312 3300048929 Ga0496126_0088703 Ga0496126_0088703_1246_2193 315
1313 3300048929 Ga0496126_0117052 Ga0496126_0117052_1218_2165 315
1314 3300048929 Ga0496126_0157571 Ga0496126_0157571_820_1767 315
1315 3300048929 Ga0496126_0181511 Ga0496126_0181511_573_1520 315
1316 3300048929 Ga0496126_0228793 Ga0496126_0228793_136_1083 315
1317 3300048929 Ga0496126_0277747 Ga0496126_0277747_300_1247 315
1318 3300049459 Ga0495678_076933 Ga0495678_076933_85_1032 315
1319 3300049460 Ga0495682_0054436 Ga0495682_0054436_137_1084 315
1320 3300049460 Ga0495682_0074821 Ga0495682_0074821_70_1017 315
1321 3300049571 Ga0501034_0425660 Ga0501034_0425660_94_1041 315
1322 3300049572 Ga0501036_0080538 Ga0501036_0080538_1001_1948 315
1323 3300049573 Ga0501037_0170333 Ga0501037_0170333_521_1468 315
1324 3300049574 Ga0501038_0127264 Ga0501038_0127264_752_1699 315
1325 3300049575 Ga0501039_0154459 Ga0501039_0154459_39_986 315
1326 3300049579 Ga0501043_0115915 Ga0501043_0115915_183_1130 315
1327 3300049580 Ga0501046_0097458 Ga0501046_0097458_1220_2167 315
1328 3300049580 Ga0501046_0123973 Ga0501046_0123973_604_1551 315
1329 3300049581 Ga0501047_0074414 Ga0501047_0074414_875_1822 315
1330 3300049582 Ga0501048_0064298 Ga0501048_0064298_670_1617 315
1331 3300049583 Ga0501067_0042939 Ga0501067_0042939_1148_2095 315
1332 3300049585 Ga0501069_0085199 Ga0501069_0085199_294_1241 315
1333 3300049586 Ga0501070_0057445 Ga0501070_0057445_1318_2265 315
1334 3300049586 Ga0501070_0080344 Ga0501070_0080344_806_1753 315
1335 3300049589 Ga0501073_0203203 Ga0501073_0203203_158_1105 315
1336 3300049590 Ga0501074_0064390 Ga0501074_0064390_147_1094 315
1337 3300049822 Ga0501035_0411886 Ga0501035_0411886_50_997 315
1338 3300049823 Ga0501044_0032392 Ga0501044_0032392_1633_2580 315
1339 3300049823 Ga0501044_0037782 Ga0501044_0037782_2571_3518 315
1340 3300050489 nmdc:mga03683_101559_c1 nmdc:mga03683_101559_c1_99_1046 315
1341 3300050490 nmdc:mga03n38_2791_c1 nmdc:mga03n38_2791_c1_2960_3907 315
1342 3300050490 nmdc:mga03n38_71308_c1 nmdc:mga03n38_71308_c1_380_1327 315
1343 3300050491 nmdc:mga00v17_4195_c1 nmdc:mga00v17_4195_c1_4194_5141 315
1344 3300050491 nmdc:mga00v17_70029_c1 nmdc:mga00v17_70029_c1_927_1874 315
1345 3300050491 nmdc:mga00v17_7814_c1 nmdc:mga00v17_7814_c1_4547_5494 315
1346 3300050492 nmdc:mga0yw44_51316_c1 nmdc:mga0yw44_51316_c1_943_1890 315
1347 3300050492 nmdc:mga0yw44_69816_c1 nmdc:mga0yw44_69816_c1_966_1913 315
1348 3300050492 nmdc:mga0yw44_73238_c1 nmdc:mga0yw44_73238_c1_1038_1985 315
1349 3300050492 nmdc:mga0yw44_8369_c1 nmdc:mga0yw44_8369_c1_2505_3452 315
1350 3300050492 nmdc:mga0yw44_97315_c1 nmdc:mga0yw44_97315_c1_618_1565 315
1351 3300050493 nmdc:mga0k408_40338_c1 nmdc:mga0k408_40338_c1_1521_2468 315
1352 3300050493 nmdc:mga0k408_60219_c1 nmdc:mga0k408_60219_c1_1122_2069 315
1353 3300050494 nmdc:mga06z11_12111_c1 nmdc:mga06z11_12111_c1_2575_3522 315
1354 3300050494 nmdc:mga06z11_22737_c1 nmdc:mga06z11_22737_c1_1122_2069 315
1355 3300050494 nmdc:mga06z11_228368_c1 nmdc:mga06z11_228368_c1_27_974 315
1356 3300050494 nmdc:mga06z11_2940_c1 nmdc:mga06z11_2940_c1_253_1200 315
1357 3300050494 nmdc:mga06z11_63873_c1 nmdc:mga06z11_63873_c1_54_1001 315
1358 3300050496 nmdc:mga07m45_104960_c1 nmdc:mga07m45_104960_c1_269_1216 315
1359 3300050496 nmdc:mga07m45_14891_c1 nmdc:mga07m45_14891_c1_2567_3514 315
1360 3300050496 nmdc:mga07m45_4272_c1 nmdc:mga07m45_4272_c1_211_1158 315
1361 3300050496 nmdc:mga07m45_66119_c1 nmdc:mga07m45_66119_c1_420_1367 315
1362 3300050496 nmdc:mga07m45_6917_c1 nmdc:mga07m45_6917_c1_1994_2941 315
1363 3300050507 nmdc:mga05p37_20147_c1 nmdc:mga05p37_20147_c1_6015_6962 315
1364 3300050509 nmdc:mga0qj67_101885_c1 nmdc:mga0qj67_101885_c1_157_1104 315
1365 3300050510 nmdc:mga06r32_56945_c1 nmdc:mga06r32_56945_c1_584_1531 315
1366 3300050512 nmdc:mga0n895_33569_c1 nmdc:mga0n895_33569_c1_976_1923 315
1367 3300050512 nmdc:mga0n895_71602_c1 nmdc:mga0n895_71602_c1_768_1715 315
1368 3300050516 nmdc:mga0sz30_1155_c1 nmdc:mga0sz30_1155_c1_7447_8394 315
1369 3300050516 nmdc:mga0sz30_2482_c1 nmdc:mga0sz30_2482_c1_3892_4839 315
1370 3300053077 Ga0495601_0004994 Ga0495601_0004994_4200_5147 315
1371 3300053077 Ga0495601_0013942 Ga0495601_0013942_165_1112 315
1372 3300053077 Ga0495601_0170591 Ga0495601_0170591_290_1237 315
1373 3300053077 Ga0495601_0187674 Ga0495601_0187674_289_1236 315
1374 3300053078 Ga0495612_0011892 Ga0495612_0011892_78_1025 315
1375 3300053078 Ga0495612_0030072 Ga0495612_0030072_481_1428 315
1376 3300053080 Ga0500635_0011261 Ga0500635_0011261_974_1921 315
1377 3300053084 Ga0495595_0000670 Ga0495595_0000670_2697_3644 315
1378 3300053084 Ga0495595_0016585 Ga0495595_0016585_1632_2579 315
1379 3300053085 Ga0495619_0026443 Ga0495619_0026443_2088_3035 315
1380 3300053085 Ga0495619_0035364 Ga0495619_0035364_973_1920 315
1381 3300053085 Ga0495619_0095687 Ga0495619_0095687_610_1557 315
1382 3300053086 Ga0500578_0206155 Ga0500578_0206155_207_1154 315
1383 3300053087 Ga0500643_000052 Ga0500643_000052_56479_57426 315
1384 3300053093 Ga0500651_0014169 Ga0500651_0014169_279_1226 315
1385 3300053094 Ga0500566_0002331 Ga0500566_0002331_4960_5907 315
1386 3300053094 Ga0500566_0002512 Ga0500566_0002512_8696_9643 315
1387 3300053094 Ga0500566_0002754 Ga0500566_0002754_3977_4924 315
1388 3300053094 Ga0500566_0011017 Ga0500566_0011017_1848_2795 315
1389 3300053094 Ga0500566_0054199 Ga0500566_0054199_216_1163 315
1390 3300053096 Ga0500641_0037727 Ga0500641_0037727_219_1166 315
1391 3300053104 Ga0500556_0000035 Ga0500556_0000035_89814_90761 315
1392 3300053105 Ga0500557_000057 Ga0500557_000057_27567_28514 315
1393 3300053111 Ga0500572_000655 Ga0500572_000655_5025_5972 315
1394 3300053111 Ga0500572_003541 Ga0500572_003541_806_1753 315
1395 3300053115 Ga0500591_058871 Ga0500591_058871_120_1067 315
1396 3300053118 Ga0500594_0002896 Ga0500594_0002896_509_1456 315
1397 3300053119 Ga0500595_004352 Ga0500595_004352_2612_3559 315
1398 3300053119 Ga0500595_028193 Ga0500595_028193_444_1391 315
1399 3300053119 Ga0500595_034967 Ga0500595_034967_86_1033 315
1400 3300053119 Ga0500595_062917 Ga0500595_062917_146_1093 315
1401 3300053121 Ga0500607_109387 Ga0500607_109387_58_1005 315
1402 3300053122 Ga0500608_000780 Ga0500608_000780_8096_9043 315
1403 3300053123 Ga0500614_003528 Ga0500614_003528_1211_2158 315
1404 3300053125 Ga0500618_004716 Ga0500618_004716_1215_2162 315
1405 3300053130 Ga0500642_0000027 Ga0500642_0000027_106522_107469 315
1406 3300053130 Ga0500642_0000263 Ga0500642_0000263_7605_8552 315
1407 3300053130 Ga0500642_0112543 Ga0500642_0112543_103_1050 315
1408 3300053131 Ga0500652_000934 Ga0500652_000934_8629_9576 315
1409 3300053136 Ga0500559_0000064 Ga0500559_0000064_5947_6894 315
1410 3300053136 Ga0500559_0000486 Ga0500559_0000486_20799_21746 315
1411 3300053136 Ga0500559_0003342 Ga0500559_0003342_5453_6400 315
1412 3300053136 Ga0500559_0015332 Ga0500559_0015332_1444_2391 315
1413 3300053136 Ga0500559_0070038 Ga0500559_0070038_553_1500 315
1414 3300053139 Ga0500568_0001465 Ga0500568_0001465_9422_10369 315
1415 3300053139 Ga0500568_0022037 Ga0500568_0022037_1192_2139 315
1416 3300053142 Ga0500577_0000035 Ga0500577_0000035_5839_6786 315
1417 3300053146 Ga0500588_0053235 Ga0500588_0053235_104_1051 315
1418 3300053147 Ga0500589_041912 Ga0500589_041912_183_1130 315
1419 3300053148 Ga0500590_017886 Ga0500590_017886_1658_2605 315
1420 3300053148 Ga0500590_054044 Ga0500590_054044_506_1453 315
1421 3300053150 Ga0500603_000667 Ga0500603_000667_4620_5567 315
1422 3300053150 Ga0500603_001350 Ga0500603_001350_2999_3946 315
1423 3300053151 Ga0500604_0002237 Ga0500604_0002237_1148_2095 315
1424 3300053151 Ga0500604_0053553 Ga0500604_0053553_62_1009 315
1425 3300053153 Ga0500616_0000028 Ga0500616_0000028_380136_381083 315
1426 3300053153 Ga0500616_0000054 Ga0500616_0000054_196606_197553 315
1427 3300053156 Ga0500622_0003626 Ga0500622_0003626_4334_5281 315
1428 3300053156 Ga0500622_0006780 Ga0500622_0006780_3590_4537 315
1429 3300053158 Ga0500627_0002332 Ga0500627_0002332_3957_4904 315
1430 3300053161 Ga0500634_0017216 Ga0500634_0017216_1009_1956 315
1431 3300053161 Ga0500634_0042983 Ga0500634_0042983_251_1198 315
1432 3300053161 Ga0500634_0121455 Ga0500634_0121455_100_1047 315
1433 3300053162 Ga0500638_044057 Ga0500638_044057_824_1771 315
1434 3300053163 Ga0500639_001074 Ga0500639_001074_11111_12058 315
1435 3300053163 Ga0500639_132718 Ga0500639_132718_79_1026 315
1436 3300053177 Ga0500636_0026615 Ga0500636_0026615_967_1914 315
1437 3300053177 Ga0500636_0030405 Ga0500636_0030405_1266_2213 315
1438 3300053177 Ga0500636_0043902 Ga0500636_0043902_936_1883 315
1439 3300053177 Ga0500636_0067038 Ga0500636_0067038_751_1698 315
1440 3300053177 Ga0500636_0126036 Ga0500636_0126036_444_1391 315
1441 3300053177 Ga0500636_0220568 Ga0500636_0220568_18_965 315
1442 3300053178 Ga0500637_0001280 Ga0500637_0001280_2124_3071 315
1443 3300053178 Ga0500637_0001814 Ga0500637_0001814_4160_5107 315
1444 3300053178 Ga0500637_0138128 Ga0500637_0138128_192_1139 315
1445 3300053729 Ga0500625_118975 Ga0500625_118975_69_1016 315
1446 3300053730 Ga0500645_014952 Ga0500645_014952_425_1372 315
1447 3300053730 Ga0500645_041853 Ga0500645_041853_28_975 315
1448 3300053731 Ga0500609_006142 Ga0500609_006142_627_1574 315
1449 3300053735 Ga0500596_000644 Ga0500596_000644_4998_5945 315
1450 3300053735 Ga0500596_008419 Ga0500596_008419_156_1103 315
1451 3300053736 Ga0500599_002539 Ga0500599_002539_1131_2078 315
1452 3300053737 Ga0500601_003142 Ga0500601_003142_734_1681 315
1453 3300055283 Ga0500661_001546 Ga0500661_001546_656_1603 315
1454 3300060353 Ga0501082_0000040 Ga0501082_0000040_89713_90660 315
1455 iso_pu_bacteria 8006964411 8006965879 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

102

358

0.94

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

105

358

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

114

364

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8617 15 306
7l4u-assembly1.cif.gz_A crystal structure of human monoacylglycerol lipase in complex with compound 1h 0.8539 17 309
3jw8-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase 0.852 17 309
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.8453 16 306
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8418 15 306
ID Description Score Start End Superfamily
af_P07000_24_333_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9237 14 312 3.40.50.1820
af_P07000_24_333_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8894 14 312 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8779 16 151 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8634 15 306 3.40.50.1820
3hjuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8468 17 309 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A8B6M5C1-F1-model_v4 Alpha/beta hydrolase 0.9808 1 314 GO:0016787
AF-A0A2H6J2D2-F1-model_v4 Lysophospholipase L2 0.9782 20 311
AF-A0A7X3MT80-F1-model_v4 Alpha/beta fold hydrolase 0.9761 1 312 GO:0016787
AF-A0A4R2GU98-F1-model_v4 Lysophospholipase 0.9752 1 311
AF-A0A8B6M5C1-F1-model_v4 Alpha/beta hydrolase 0.9747 1 314 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map