F494083
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1455 | 694 | 1220 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10017804|Ga0105240_100178048 |
| Length | 379 |
| Sequence | VALTRPPSGRAFGCAAFNVSGFETLAAACTKMIWEGTDGVQEGPSALLSPFKPLFSRPFFIGFPMTLVSIPANPVPENVVVGTIKTPDGADLRFARWAPPVGRRGTVCVFTGRGEQIEKYFETVRDLRDRGFAVAMIDWRGQGHSARRLRDPRKGYVRHFSDYEVDAETFVQQVVLPDCPPPFFALAHSMGGAVMLRIAHASKRWFDRIVLSAPMIDLPGRRTSFPVRTLLRTMRLMGQGGRYVPGGNDELVNTAPFVNNPLTSDPVRYARNAAILAEDPTLGIASPTVAWADTAFATMHGFRAVDYPSQIRQPLLMIAASNDTIVSTPAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRAQFWAAFDAFVPGTPLFQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 49 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 50 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 51 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 74 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 75 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 76 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 77 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 78 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 79 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 80 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 81 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 82 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 83 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 84 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 85 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 86 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 87 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 88 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 89 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 90 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 91 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 92 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 93 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 94 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 95 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 96 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 97 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 98 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904699407 | |||
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 106 | 2906610324 | |||
| 107 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 108 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 109 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 110 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 111 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 112 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 113 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 114 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 115 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 116 | 2922368715 | |||
| 117 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 118 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 119 | 2922425934 | |||
| 120 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 121 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 122 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 123 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 124 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 125 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 126 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 127 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 128 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 129 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 130 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 131 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 132 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 133 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 134 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 135 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 136 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 137 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 138 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 139 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 140 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 141 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 142 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 143 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 144 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 145 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 146 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 147 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 148 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 149 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 150 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 151 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 152 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 153 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 154 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 155 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 156 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 157 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 158 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 159 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 160 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 161 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 162 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 163 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 164 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 165 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 166 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 167 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 168 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 169 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 170 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 171 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 172 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 173 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 174 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 175 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 176 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 177 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 178 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 179 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 180 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 181 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 182 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 183 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 184 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 185 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 186 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 187 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 188 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 189 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 190 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 191 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 192 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 193 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 196 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 197 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 200 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 204 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 205 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 206 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 207 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 209 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 218 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 227 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 232 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 233 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 236 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 238 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 239 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 240 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 242 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 243 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 244 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 245 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 246 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 247 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 248 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 249 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 250 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 251 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 252 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 253 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 255 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 256 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 257 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 258 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 259 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 260 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 263 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 264 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 265 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 267 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 268 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 269 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 270 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 271 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 272 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 273 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 276 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 277 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 278 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 279 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 280 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 293 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 310 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 311 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 312 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 313 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 314 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 315 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 317 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 322 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 324 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 379 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 380 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 381 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 382 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 386 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 388 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 389 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 390 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 391 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 392 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 393 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 394 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 395 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 396 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 397 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 398 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 399 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 400 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 401 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 402 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 403 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 404 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 405 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 406 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 407 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 408 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 409 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 410 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 411 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 412 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 413 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 414 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 415 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 416 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 417 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 418 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 419 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 420 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 421 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 422 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 423 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 424 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 425 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 426 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 427 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 428 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 429 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 430 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 431 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 432 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 433 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 434 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 435 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 436 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 437 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 438 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 439 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 440 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 441 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 442 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 443 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 444 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 445 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 446 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 447 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 448 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 449 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 450 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 451 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 452 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 453 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 454 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 455 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 456 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 457 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 458 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 539 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 540 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 541 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 542 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 543 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 544 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 545 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 546 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 547 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 548 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 549 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 550 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 551 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 552 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 553 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 554 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 555 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 556 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 557 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 558 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 559 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 560 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 561 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 562 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 563 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 564 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 573 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 595 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 596 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 597 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 598 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 599 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 600 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 601 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 602 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 606 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 609 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 612 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 613 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 614 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 615 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 617 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 618 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 619 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 621 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 622 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 623 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 624 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 625 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 626 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 627 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 628 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 629 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 630 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 631 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 632 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 633 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 634 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 635 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 636 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 637 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 638 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 639 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 640 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 641 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 642 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 643 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 644 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 645 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 646 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 648 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 649 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 650 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 651 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 653 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 654 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 655 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 656 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 657 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 658 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 659 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 660 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 661 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 662 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 663 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 664 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 665 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 666 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 667 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 668 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 669 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 670 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 671 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 672 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 673 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 674 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 675 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 676 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 677 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 678 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 679 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 680 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 681 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 682 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 683 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 684 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 685 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 686 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 687 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 688 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 689 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 690 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 691 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 692 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 693 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 694 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.06 |
| Metatranscriptomes | 0.14 |
| Isolates | 15.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.75 |
| Nodule | 12.58 |
| Rhizoplane | 6.53 |
| Rhizosphere | 57.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010307 | 3300001979 | Bacteria | 3609 |
| 2 | JGI24739J22299_10060499 | 3300001989 | Bacteria | 1198 |
| 3 | JGI25406J46586_10000118 | 3300003203 | Bacteria | 34503 |
| 4 | JGI25153J46596_10002224 | 3300003215 | Bacteria | 11324 |
| 5 | JGI25153J46596_10006933 | 3300003215 | Bacteria | 5650 |
| 6 | JGI25153J46596_10007072 | 3300003215 | Bacteria | 5576 |
| 7 | JGI25153J46596_10024593 | 3300003215 | Bacteria | 2169 |
| 8 | rootH2_10188699 | 3300003320 | Bacteria | 1166 |
| 9 | JGI25404J52841_10002320 | 3300003659 | Bacteria | 3581 |
| 10 | Ga0055524_1016148 | 3300003775 | Bacteria | 2691 |
| 11 | Ga0055531_10009477 | 3300003794 | Bacteria | 4971 |
| 12 | Ga0065165_1002792 | 3300005262 | Bacteria | 13765 |
| 13 | Ga0065165_1003284 | 3300005262 | Bacteria | 11658 |
| 14 | Ga0065165_1021603 | 3300005262 | Bacteria | 2230 |
| 15 | Ga0070658_10114808 | 3300005327 | Bacteria | 2233 |
| 16 | Ga0070658_10212017 | 3300005327 | Bacteria | 1636 |
| 17 | Ga0070683_100048202 | 3300005329 | Bacteria | 3938 |
| 18 | Ga0070683_100074217 | 3300005329 | Bacteria | 3176 |
| 19 | Ga0070670_100041202 | 3300005331 | Bacteria | 3969 |
| 20 | Ga0068869_100087480 | 3300005334 | Bacteria | 2337 |
| 21 | Ga0070680_100081738 | 3300005336 | Bacteria | 2666 |
| 22 | Ga0070680_100186943 | 3300005336 | Bacteria | 1745 |
| 23 | Ga0070680_100456634 | 3300005336 | Bacteria | 1091 |
| 24 | Ga0070682_100073402 | 3300005337 | Bacteria | 2195 |
| 25 | Ga0068868_100005183 | 3300005338 | Bacteria | 9148 |
| 26 | Ga0068868_100017996 | 3300005338 | Bacteria | 5274 |
| 27 | Ga0068868_100059948 | 3300005338 | Bacteria | 3012 |
| 28 | Ga0068868_100326312 | 3300005338 | Bacteria | 1309 |
| 29 | Ga0070660_100030247 | 3300005339 | Bacteria | 4062 |
| 30 | Ga0070689_100330612 | 3300005340 | Bacteria | 1275 |
| 31 | Ga0070661_100154164 | 3300005344 | Bacteria | 1738 |
| 32 | Ga0070661_100210998 | 3300005344 | Bacteria | 1486 |
| 33 | Ga0070668_100020491 | 3300005347 | Bacteria | 4991 |
| 34 | Ga0070668_100046605 | 3300005347 | Bacteria | 3329 |
| 35 | Ga0070668_100081859 | 3300005347 | Bacteria | 2531 |
| 36 | Ga0070668_100154139 | 3300005347 | Bacteria | 1860 |
| 37 | Ga0070671_100101143 | 3300005355 | Bacteria | 2418 |
| 38 | Ga0070674_100060947 | 3300005356 | Bacteria | 2631 |
| 39 | Ga0070674_100229679 | 3300005356 | Bacteria | 1447 |
| 40 | Ga0070667_100225702 | 3300005367 | Bacteria | 1668 |
| 41 | Ga0070709_10000796 | 3300005434 | Bacteria | 17649 |
| 42 | Ga0070709_10001261 | 3300005434 | Bacteria | 13852 |
| 43 | Ga0070709_10007358 | 3300005434 | Bacteria | 6032 |
| 44 | Ga0070709_10010265 | 3300005434 | Bacteria | 5177 |
| 45 | Ga0070709_10042951 | 3300005434 | Bacteria | 2794 |
| 46 | Ga0070709_10129874 | 3300005434 | Bacteria | 1719 |
| 47 | Ga0070714_100028362 | 3300005435 | Bacteria | 4644 |
| 48 | Ga0070714_100131457 | 3300005435 | Bacteria | 2237 |
| 49 | Ga0070713_100004513 | 3300005436 | Bacteria | 9368 |
| 50 | Ga0070713_100024796 | 3300005436 | Bacteria | 4680 |
| 51 | Ga0070713_100114641 | 3300005436 | Bacteria | 2355 |
| 52 | Ga0070713_100114913 | 3300005436 | Bacteria | 2352 |
| 53 | Ga0070713_100155528 | 3300005436 | Bacteria | 2038 |
| 54 | Ga0070710_10000991 | 3300005437 | Bacteria | 13505 |
| 55 | Ga0070710_10010597 | 3300005437 | Bacteria | 4531 |
| 56 | Ga0070711_100005239 | 3300005439 | Bacteria | 7737 |
| 57 | Ga0070711_100006676 | 3300005439 | Bacteria | 6977 |
| 58 | Ga0070711_100008277 | 3300005439 | Bacteria | 6363 |
| 59 | Ga0070711_100315304 | 3300005439 | Bacteria | 1247 |
| 60 | Ga0070705_100137382 | 3300005440 | Bacteria | 1604 |
| 61 | Ga0070700_100032431 | 3300005441 | Bacteria | 3139 |
| 62 | Ga0070694_100279741 | 3300005444 | Bacteria | 1272 |
| 63 | Ga0070663_100021710 | 3300005455 | Bacteria | 4276 |
| 64 | Ga0070663_100027837 | 3300005455 | Bacteria | 3842 |
| 65 | Ga0070663_100043121 | 3300005455 | Bacteria | 3173 |
| 66 | Ga0070663_100123124 | 3300005455 | Bacteria | 1961 |
| 67 | Ga0070678_100065174 | 3300005456 | Bacteria | 2703 |
| 68 | Ga0070678_100084703 | 3300005456 | Bacteria | 2414 |
| 69 | Ga0070678_100099892 | 3300005456 | Bacteria | 2246 |
| 70 | Ga0070662_100195353 | 3300005457 | Bacteria | 1602 |
| 71 | Ga0070681_10062271 | 3300005458 | Bacteria | 3704 |
| 72 | Ga0070681_10163471 | 3300005458 | Bacteria | 2149 |
| 73 | Ga0068867_100107078 | 3300005459 | Bacteria | 2142 |
| 74 | Ga0070706_100089246 | 3300005467 | Bacteria | 2858 |
| 75 | Ga0070698_100403197 | 3300005471 | Bacteria | 1301 |
| 76 | Ga0070699_100227522 | 3300005518 | Bacteria | 1663 |
| 77 | Ga0070679_100034610 | 3300005530 | Bacteria | 5006 |
| 78 | Ga0070679_100047353 | 3300005530 | Bacteria | 4285 |
| 79 | Ga0070679_100324799 | 3300005530 | Bacteria | 1488 |
| 80 | Ga0070684_100008848 | 3300005535 | Bacteria | 7895 |
| 81 | Ga0070684_100071224 | 3300005535 | Bacteria | 3060 |
| 82 | Ga0068853_100007083 | 3300005539 | Bacteria | 8970 |
| 83 | Ga0068853_100007085 | 3300005539 | Bacteria | 8969 |
| 84 | Ga0068853_100032710 | 3300005539 | Bacteria | 4408 |
| 85 | Ga0070696_100094591 | 3300005546 | Bacteria | 2133 |
| 86 | Ga0070665_100007326 | 3300005548 | Bacteria | 11223 |
| 87 | Ga0070665_100016280 | 3300005548 | Bacteria | 7461 |
| 88 | Ga0070665_100021701 | 3300005548 | Bacteria | 6457 |
| 89 | Ga0070665_100050261 | 3300005548 | Bacteria | 4183 |
| 90 | Ga0070665_100057391 | 3300005548 | Bacteria | 3902 |
| 91 | Ga0070665_100084638 | 3300005548 | Bacteria | 3176 |
| 92 | Ga0070665_100137569 | 3300005548 | Bacteria | 2445 |
| 93 | Ga0070665_100240889 | 3300005548 | Bacteria | 1809 |
| 94 | Ga0070665_100347802 | 3300005548 | Bacteria | 1488 |
| 95 | Ga0068855_100235778 | 3300005563 | Bacteria | 2046 |
| 96 | Ga0068855_100299148 | 3300005563 | Bacteria | 1782 |
| 97 | Ga0070664_100016211 | 3300005564 | Bacteria | 6108 |
| 98 | Ga0070664_100156175 | 3300005564 | Bacteria | 2016 |
| 99 | Ga0068857_100021428 | 3300005577 | Bacteria | 5689 |
| 100 | Ga0068857_100113770 | 3300005577 | Bacteria | 2433 |
| 101 | Ga0068857_100126040 | 3300005577 | Bacteria | 2307 |
| 102 | Ga0068854_100009851 | 3300005578 | Bacteria | 6181 |
| 103 | Ga0068854_100041116 | 3300005578 | Bacteria | 3265 |
| 104 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 105 | Ga0068856_100010527 | 3300005614 | Bacteria | 8980 |
| 106 | Ga0068856_100030658 | 3300005614 | Bacteria | 5257 |
| 107 | Ga0070702_100055555 | 3300005615 | Bacteria | 2283 |
| 108 | Ga0068852_100020416 | 3300005616 | Bacteria | 5269 |
| 109 | Ga0068852_100067275 | 3300005616 | Bacteria | 3132 |
| 110 | Ga0068852_100341945 | 3300005616 | Bacteria | 1459 |
| 111 | Ga0068859_100304741 | 3300005617 | Bacteria | 1686 |
| 112 | Ga0068859_100643876 | 3300005617 | Bacteria | 1152 |
| 113 | Ga0068864_100313875 | 3300005618 | Bacteria | 1470 |
| 114 | Ga0068861_100088531 | 3300005719 | Bacteria | 2438 |
| 115 | Ga0068851_10047299 | 3300005834 | Bacteria | 2178 |
| 116 | Ga0068858_100127907 | 3300005842 | Bacteria | 2380 |
| 117 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 118 | Ga0068860_100155651 | 3300005843 | Bacteria | 2202 |
| 119 | Ga0068862_100156535 | 3300005844 | Bacteria | 2031 |
| 120 | Ga0068862_100215740 | 3300005844 | Bacteria | 1735 |
| 121 | Ga0068862_100220550 | 3300005844 | Bacteria | 1717 |
| 122 | Ga0081455_10000715 | 3300005937 | Bacteria | 43119 |
| 123 | Ga0081455_10000774 | 3300005937 | Bacteria | 41248 |
| 124 | Ga0081455_10003833 | 3300005937 | Bacteria | 17148 |
| 125 | Ga0081455_10013479 | 3300005937 | Bacteria | 8073 |
| 126 | Ga0081455_10028784 | 3300005937 | Bacteria | 5072 |
| 127 | Ga0081455_10049450 | 3300005937 | Bacteria | 3625 |
| 128 | Ga0081538_10029587 | 3300005981 | Bacteria | 3738 |
| 129 | Ga0081538_10066454 | 3300005981 | Bacteria | 2022 |
| 130 | Ga0081540_1002251 | 3300005983 | Bacteria | 15895 |
| 131 | Ga0081540_1002343 | 3300005983 | Bacteria | 15504 |
| 132 | Ga0081540_1003941 | 3300005983 | Bacteria | 11537 |
| 133 | Ga0081540_1005884 | 3300005983 | Bacteria | 9064 |
| 134 | Ga0081540_1014466 | 3300005983 | Bacteria | 5053 |
| 135 | Ga0081540_1016536 | 3300005983 | Bacteria | 4609 |
| 136 | Ga0081540_1022699 | 3300005983 | Bacteria | 3699 |
| 137 | Ga0081540_1025221 | 3300005983 | Bacteria | 3428 |
| 138 | Ga0081540_1026177 | 3300005983 | Bacteria | 3337 |
| 139 | Ga0081540_1035117 | 3300005983 | Bacteria | 2693 |
| 140 | Ga0081540_1065365 | 3300005983 | Bacteria | 1711 |
| 141 | Ga0081540_1075776 | 3300005983 | Bacteria | 1536 |
| 142 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 143 | Ga0081539_10001114 | 3300005985 | Bacteria | 48756 |
| 144 | Ga0081539_10053002 | 3300005985 | Bacteria | 2274 |
| 145 | Ga0081539_10099924 | 3300005985 | Bacteria | 1481 |
| 146 | Ga0081539_10109976 | 3300005985 | Bacteria | 1389 |
| 147 | Ga0070717_10000325 | 3300006028 | Bacteria | 31034 |
| 148 | Ga0070717_10084579 | 3300006028 | Bacteria | 2669 |
| 149 | Ga0075365_10011659 | 3300006038 | Bacteria | 5179 |
| 150 | Ga0075365_10026252 | 3300006038 | Bacteria | 3695 |
| 151 | Ga0075365_10033426 | 3300006038 | Bacteria | 3314 |
| 152 | Ga0075365_10040469 | 3300006038 | Bacteria | 3039 |
| 153 | Ga0075365_10060412 | 3300006038 | Bacteria | 2529 |
| 154 | Ga0075368_10007800 | 3300006042 | Bacteria | 3792 |
| 155 | Ga0075368_10008135 | 3300006042 | Bacteria | 3723 |
| 156 | Ga0075368_10012725 | 3300006042 | Bacteria | 3082 |
| 157 | Ga0075368_10049183 | 3300006042 | Bacteria | 1672 |
| 158 | Ga0075363_100001726 | 3300006048 | Bacteria | 8492 |
| 159 | Ga0075363_100017481 | 3300006048 | Bacteria | 3557 |
| 160 | Ga0075363_100088419 | 3300006048 | Bacteria | 1703 |
| 161 | Ga0075363_100122224 | 3300006048 | Bacteria | 1455 |
| 162 | Ga0075363_100176997 | 3300006048 | Bacteria | 1212 |
| 163 | Ga0075364_10007861 | 3300006051 | Bacteria | 6347 |
| 164 | Ga0075364_10010966 | 3300006051 | Bacteria | 5495 |
| 165 | Ga0075364_10022059 | 3300006051 | Bacteria | 4018 |
| 166 | Ga0075364_10043166 | 3300006051 | Bacteria | 2931 |
| 167 | Ga0075432_10058339 | 3300006058 | Bacteria | 1371 |
| 168 | Ga0070715_10000561 | 3300006163 | Bacteria | 9783 |
| 169 | Ga0070715_10025862 | 3300006163 | Bacteria | 2329 |
| 170 | Ga0070715_10103424 | 3300006163 | Bacteria | 1332 |
| 171 | Ga0070716_100001763 | 3300006173 | Bacteria | 9784 |
| 172 | Ga0070716_100171349 | 3300006173 | Bacteria | 1416 |
| 173 | Ga0070712_100044490 | 3300006175 | Bacteria | 3062 |
| 174 | Ga0070712_100167104 | 3300006175 | Bacteria | 1704 |
| 175 | Ga0070712_100284740 | 3300006175 | Bacteria | 1332 |
| 176 | Ga0075367_10040235 | 3300006178 | Bacteria | 2729 |
| 177 | Ga0075367_10059339 | 3300006178 | Bacteria | 2278 |
| 178 | Ga0075367_10075447 | 3300006178 | Bacteria | 2034 |
| 179 | Ga0075367_10077676 | 3300006178 | Bacteria | 2004 |
| 180 | Ga0075369_10002297 | 3300006186 | Bacteria | 6796 |
| 181 | Ga0075369_10026891 | 3300006186 | Bacteria | 2401 |
| 182 | Ga0075366_10006775 | 3300006195 | Bacteria | 6295 |
| 183 | Ga0075366_10018597 | 3300006195 | Bacteria | 4013 |
| 184 | Ga0075366_10035098 | 3300006195 | Bacteria | 2956 |
| 185 | Ga0097621_100141141 | 3300006237 | Bacteria | 2058 |
| 186 | Ga0097621_100375741 | 3300006237 | Bacteria | 1269 |
| 187 | Ga0097621_100453462 | 3300006237 | Bacteria | 1156 |
| 188 | Ga0075370_10017731 | 3300006353 | Bacteria | 3850 |
| 189 | Ga0075370_10047609 | 3300006353 | Bacteria | 2428 |
| 190 | Ga0075370_10047964 | 3300006353 | Bacteria | 2419 |
| 191 | Ga0075370_10080144 | 3300006353 | Bacteria | 1876 |
| 192 | Ga0068871_100113220 | 3300006358 | Bacteria | 2285 |
| 193 | Ga0075428_100023204 | 3300006844 | Bacteria | 6862 |
| 194 | Ga0075430_100382451 | 3300006846 | Bacteria | 1161 |
| 195 | Ga0075431_100029253 | 3300006847 | Bacteria | 5669 |
| 196 | Ga0075434_100020473 | 3300006871 | Bacteria | 6418 |
| 197 | Ga0075434_100050474 | 3300006871 | Bacteria | 4133 |
| 198 | Ga0075434_100074720 | 3300006871 | Bacteria | 3382 |
| 199 | Ga0075434_100084478 | 3300006871 | Bacteria | 3173 |
| 200 | Ga0068865_100150267 | 3300006881 | Bacteria | 1766 |
| 201 | Ga0075436_100096406 | 3300006914 | Bacteria | 2058 |
| 202 | Ga0097620_100304731 | 3300006931 | Bacteria | 1686 |
| 203 | Ga0097620_100643933 | 3300006931 | Bacteria | 1152 |
| 204 | Ga0099825_1019128 | 3300006941 | Bacteria | 5158 |
| 205 | Ga0099824_1005278 | 3300006942 | Bacteria | 18259 |
| 206 | Ga0099824_1017855 | 3300006942 | Bacteria | 6007 |
| 207 | Ga0099822_1013722 | 3300006943 | Bacteria | 9448 |
| 208 | Ga0099794_10009088 | 3300007265 | Bacteria | 4156 |
| 209 | Ga0099795_10000836 | 3300007788 | Bacteria | 6125 |
| 210 | Ga0099795_10024305 | 3300007788 | Bacteria | 2020 |
| 211 | Ga0099795_10034455 | 3300007788 | Bacteria | 1764 |
| 212 | Ga0105240_10002968 | 3300009093 | Bacteria | 26700 |
| 213 | Ga0105240_10017804 | 3300009093 | Bacteria | 9563 |
| 214 | Ga0105240_10021771 | 3300009093 | Bacteria | 8518 |
| 215 | Ga0105240_10033109 | 3300009093 | Bacteria | 6682 |
| 216 | Ga0105240_10076367 | 3300009093 | Bacteria | 4130 |
| 217 | Ga0105240_10146029 | 3300009093 | Bacteria | 2822 |
| 218 | Ga0105240_10463304 | 3300009093 | Bacteria | 1416 |
| 219 | Ga0105240_10477187 | 3300009093 | Bacteria | 1391 |
| 220 | Ga0105240_10547751 | 3300009093 | Bacteria | 1280 |
| 221 | Ga0105240_10644663 | 3300009093 | Bacteria | 1162 |
| 222 | Ga0111539_10333654 | 3300009094 | Bacteria | 1765 |
| 223 | Ga0105245_10011836 | 3300009098 | Bacteria | 7588 |
| 224 | Ga0105245_10024933 | 3300009098 | Bacteria | 5256 |
| 225 | Ga0105245_10030674 | 3300009098 | Bacteria | 4755 |
| 226 | Ga0105245_10551186 | 3300009098 | Bacteria | 1175 |
| 227 | Ga0105247_10135573 | 3300009101 | Bacteria | 1608 |
| 228 | Ga0114129_10196005 | 3300009147 | Bacteria | 2739 |
| 229 | Ga0114129_10228379 | 3300009147 | Bacteria | 2508 |
| 230 | Ga0105243_10328556 | 3300009148 | Bacteria | 1396 |
| 231 | Ga0105243_10424563 | 3300009148 | Bacteria | 1241 |
| 232 | Ga0105241_10001388 | 3300009174 | Bacteria | 18512 |
| 233 | Ga0105241_10016444 | 3300009174 | Bacteria | 5427 |
| 234 | Ga0105241_10227892 | 3300009174 | Bacteria | 1570 |
| 235 | Ga0105242_10179201 | 3300009176 | Bacteria | 1868 |
| 236 | Ga0105248_10044195 | 3300009177 | Bacteria | 4996 |
| 237 | Ga0105248_10073680 | 3300009177 | Bacteria | 3837 |
| 238 | Ga0105248_10161310 | 3300009177 | Bacteria | 2529 |
| 239 | Ga0105248_10264975 | 3300009177 | Bacteria | 1934 |
| 240 | Ga0105248_10459244 | 3300009177 | Bacteria | 1436 |
| 241 | Ga0105237_10009401 | 3300009545 | Bacteria | 10469 |
| 242 | Ga0105237_10018051 | 3300009545 | Bacteria | 7307 |
| 243 | Ga0105237_10019256 | 3300009545 | Bacteria | 7050 |
| 244 | Ga0105237_10029341 | 3300009545 | Bacteria | 5593 |
| 245 | Ga0105237_10063125 | 3300009545 | Bacteria | 3702 |
| 246 | Ga0105237_10081504 | 3300009545 | Bacteria | 3227 |
| 247 | Ga0105237_10117726 | 3300009545 | Bacteria | 2650 |
| 248 | Ga0105237_10121493 | 3300009545 | Bacteria | 2606 |
| 249 | Ga0105237_10219525 | 3300009545 | Bacteria | 1901 |
| 250 | Ga0105237_10279682 | 3300009545 | Bacteria | 1671 |
| 251 | Ga0105237_10302610 | 3300009545 | Bacteria | 1602 |
| 252 | Ga0105237_10330910 | 3300009545 | Bacteria | 1527 |
| 253 | Ga0105238_10007201 | 3300009551 | Bacteria | 11135 |
| 254 | Ga0105238_10025146 | 3300009551 | Bacteria | 6068 |
| 255 | Ga0105238_10028995 | 3300009551 | Bacteria | 5638 |
| 256 | Ga0105238_10066871 | 3300009551 | Bacteria | 3595 |
| 257 | Ga0105238_10083975 | 3300009551 | Bacteria | 3174 |
| 258 | Ga0105238_10134821 | 3300009551 | Bacteria | 2447 |
| 259 | Ga0105238_10140056 | 3300009551 | Bacteria | 2396 |
| 260 | Ga0105249_10161283 | 3300009553 | Bacteria | 2167 |
| 261 | Ga0099796_10000143 | 3300010159 | Bacteria | 10566 |
| 262 | Ga0099796_10014081 | 3300010159 | Bacteria | 2301 |
| 263 | Ga0099796_10049573 | 3300010159 | Bacteria | 1452 |
| 264 | Ga0105239_10026237 | 3300010375 | Bacteria | 6414 |
| 265 | Ga0105239_10054242 | 3300010375 | Bacteria | 4396 |
| 266 | Ga0105239_10075076 | 3300010375 | Bacteria | 3717 |
| 267 | Ga0105239_10108752 | 3300010375 | Bacteria | 3072 |
| 268 | Ga0105239_10129571 | 3300010375 | Bacteria | 2805 |
| 269 | Ga0105239_10132265 | 3300010375 | Bacteria | 2776 |
| 270 | Ga0105239_10666468 | 3300010375 | Bacteria | 1189 |
| 271 | Ga0105239_10745374 | 3300010375 | Bacteria | 1121 |
| 272 | Ga0105246_10024946 | 3300011119 | Bacteria | 3893 |
| 273 | Ga0157371_10231668 | 3300013102 | Bacteria | 1327 |
| 274 | Ga0157370_10120699 | 3300013104 | Bacteria | 2447 |
| 275 | Ga0157370_10140019 | 3300013104 | Bacteria | 2254 |
| 276 | Ga0157369_10011069 | 3300013105 | Bacteria | 10263 |
| 277 | Ga0157369_10022494 | 3300013105 | Bacteria | 7032 |
| 278 | Ga0157369_10085496 | 3300013105 | Bacteria | 3370 |
| 279 | Ga0157374_10025945 | 3300013296 | Bacteria | 5268 |
| 280 | Ga0157374_10348201 | 3300013296 | Bacteria | 1472 |
| 281 | Ga0157378_10019128 | 3300013297 | Bacteria | 6017 |
| 282 | Ga0157378_10085139 | 3300013297 | Bacteria | 2864 |
| 283 | Ga0163162_10020858 | 3300013306 | Bacteria | 6443 |
| 284 | Ga0157372_10050306 | 3300013307 | Bacteria | 4636 |
| 285 | Ga0157372_10680296 | 3300013307 | Bacteria | 1198 |
| 286 | Ga0157375_10016660 | 3300013308 | Bacteria | 6610 |
| 287 | Ga0163163_10063284 | 3300014325 | Bacteria | 3667 |
| 288 | Ga0163163_10067838 | 3300014325 | Bacteria | 3548 |
| 289 | Ga0163163_10069545 | 3300014325 | Bacteria | 3505 |
| 290 | Ga0163163_10110804 | 3300014325 | Bacteria | 2773 |
| 291 | Ga0163163_10115145 | 3300014325 | Bacteria | 2720 |
| 292 | Ga0163163_10196568 | 3300014325 | Bacteria | 2065 |
| 293 | Ga0157380_10212424 | 3300014326 | Bacteria | 1725 |
| 294 | Ga0157377_10133442 | 3300014745 | Bacteria | 1519 |
| 295 | Ga0157379_10012889 | 3300014968 | Bacteria | 7313 |
| 296 | Ga0157379_10095943 | 3300014968 | Bacteria | 2661 |
| 297 | Ga0157379_10129426 | 3300014968 | Bacteria | 2271 |
| 298 | Ga0157379_10263968 | 3300014968 | Bacteria | 1565 |
| 299 | Ga0157376_10008369 | 3300014969 | Bacteria | 7461 |
| 300 | Ga0157376_10175361 | 3300014969 | Bacteria | 1955 |
| 301 | Ga0163161_10113270 | 3300017792 | Bacteria | 2030 |
| 302 | Ga0206353_10807201 | 3300020082 | Bacteria | 2646 |
| 303 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 304 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 305 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 306 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 307 | Ga0213876_10008681 | 3300021384 | Bacteria | 5497 |
| 308 | Ga0209563_103763 | 3300025230 | Bacteria | 3051 |
| 309 | Ga0207425_1007458 | 3300025245 | Bacteria | 2883 |
| 310 | Ga0209677_103733 | 3300025253 | Bacteria | 4760 |
| 311 | Ga0209148_1000316 | 3300025254 | Bacteria | 68104 |
| 312 | Ga0209148_1007100 | 3300025254 | Bacteria | 2356 |
| 313 | Ga0209233_1016979 | 3300025261 | Bacteria | 1992 |
| 314 | Ga0209455_1006070 | 3300025272 | Bacteria | 3631 |
| 315 | Ga0209564_1000407 | 3300025295 | Bacteria | 76572 |
| 316 | Ga0209564_1002075 | 3300025295 | Bacteria | 17222 |
| 317 | Ga0209564_1005161 | 3300025295 | Bacteria | 7581 |
| 318 | Ga0209564_1023569 | 3300025295 | Bacteria | 2132 |
| 319 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 320 | Ga0209758_1001012 | 3300025297 | Bacteria | 37211 |
| 321 | Ga0209758_1001683 | 3300025297 | Bacteria | 24919 |
| 322 | Ga0209758_1002332 | 3300025297 | Bacteria | 19594 |
| 323 | Ga0209758_1002396 | 3300025297 | Bacteria | 19259 |
| 324 | Ga0209758_1003816 | 3300025297 | Bacteria | 13250 |
| 325 | Ga0209758_1007915 | 3300025297 | Bacteria | 7053 |
| 326 | Ga0209758_1014959 | 3300025297 | Bacteria | 4065 |
| 327 | Ga0209758_1029030 | 3300025297 | Bacteria | 2324 |
| 328 | Ga0209758_1037061 | 3300025297 | Bacteria | 1891 |
| 329 | Ga0209256_1002946 | 3300025299 | Bacteria | 12776 |
| 330 | Ga0207426_1000374 | 3300025302 | Bacteria | 78498 |
| 331 | Ga0207426_1001007 | 3300025302 | Bacteria | 27365 |
| 332 | Ga0207426_1004033 | 3300025302 | Bacteria | 7438 |
| 333 | Ga0209257_1001741 | 3300025304 | Bacteria | 24170 |
| 334 | Ga0207692_10005299 | 3300025898 | Bacteria | 5157 |
| 335 | Ga0207710_10086053 | 3300025900 | Bacteria | 1464 |
| 336 | Ga0207688_10204097 | 3300025901 | Bacteria | 1186 |
| 337 | Ga0207680_10221195 | 3300025903 | Bacteria | 1298 |
| 338 | Ga0207647_10000972 | 3300025904 | Bacteria | 22175 |
| 339 | Ga0207685_10018879 | 3300025905 | Bacteria | 2261 |
| 340 | Ga0207685_10023611 | 3300025905 | Bacteria | 2096 |
| 341 | Ga0207685_10077029 | 3300025905 | Bacteria | 1369 |
| 342 | Ga0207699_10000363 | 3300025906 | Bacteria | 24040 |
| 343 | Ga0207699_10002914 | 3300025906 | Bacteria | 8131 |
| 344 | Ga0207699_10041739 | 3300025906 | Bacteria | 2652 |
| 345 | Ga0207699_10082273 | 3300025906 | Bacteria | 2000 |
| 346 | Ga0207645_10182413 | 3300025907 | Bacteria | 1377 |
| 347 | Ga0207645_10192206 | 3300025907 | Bacteria | 1342 |
| 348 | Ga0207645_10265271 | 3300025907 | Bacteria | 1138 |
| 349 | Ga0207705_10033327 | 3300025909 | Bacteria | 3679 |
| 350 | Ga0207705_10075543 | 3300025909 | Bacteria | 2447 |
| 351 | Ga0207705_10194066 | 3300025909 | Bacteria | 1536 |
| 352 | Ga0207684_10174378 | 3300025910 | Bacteria | 1854 |
| 353 | Ga0207654_10000729 | 3300025911 | Bacteria | 18348 |
| 354 | Ga0207654_10028175 | 3300025911 | Bacteria | 3061 |
| 355 | Ga0207654_10030934 | 3300025911 | Bacteria | 2944 |
| 356 | Ga0207654_10061268 | 3300025911 | Bacteria | 2201 |
| 357 | Ga0207707_10000541 | 3300025912 | Bacteria | 38481 |
| 358 | Ga0207707_10050125 | 3300025912 | Bacteria | 3638 |
| 359 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 360 | Ga0207695_10004497 | 3300025913 | Bacteria | 18978 |
| 361 | Ga0207695_10017775 | 3300025913 | Bacteria | 8252 |
| 362 | Ga0207695_10024109 | 3300025913 | Bacteria | 6854 |
| 363 | Ga0207695_10191850 | 3300025913 | Bacteria | 1961 |
| 364 | Ga0207671_10003084 | 3300025914 | Bacteria | 17008 |
| 365 | Ga0207671_10133861 | 3300025914 | Bacteria | 1905 |
| 366 | Ga0207671_10151954 | 3300025914 | Bacteria | 1789 |
| 367 | Ga0207671_10184623 | 3300025914 | Bacteria | 1624 |
| 368 | Ga0207693_10005512 | 3300025915 | Bacteria | 10533 |
| 369 | Ga0207693_10008188 | 3300025915 | Bacteria | 8565 |
| 370 | Ga0207693_10008624 | 3300025915 | Bacteria | 8342 |
| 371 | Ga0207693_10020448 | 3300025915 | Bacteria | 5266 |
| 372 | Ga0207693_10024640 | 3300025915 | Bacteria | 4772 |
| 373 | Ga0207693_10076040 | 3300025915 | Bacteria | 2630 |
| 374 | Ga0207663_10000425 | 3300025916 | Bacteria | 18308 |
| 375 | Ga0207663_10031078 | 3300025916 | Bacteria | 3156 |
| 376 | Ga0207663_10038050 | 3300025916 | Bacteria | 2905 |
| 377 | Ga0207663_10069893 | 3300025916 | Bacteria | 2260 |
| 378 | Ga0207660_10009028 | 3300025917 | Bacteria | 6454 |
| 379 | Ga0207660_10210524 | 3300025917 | Bacteria | 1522 |
| 380 | Ga0207657_10002950 | 3300025919 | Bacteria | 18254 |
| 381 | Ga0207657_10014763 | 3300025919 | Bacteria | 7605 |
| 382 | Ga0207657_10029326 | 3300025919 | Bacteria | 5010 |
| 383 | Ga0207657_10080145 | 3300025919 | Bacteria | 2745 |
| 384 | Ga0207649_10251963 | 3300025920 | Bacteria | 1272 |
| 385 | Ga0207652_10007298 | 3300025921 | Bacteria | 8902 |
| 386 | Ga0207652_10205326 | 3300025921 | Bacteria | 1773 |
| 387 | Ga0207694_10000849 | 3300025924 | Bacteria | 27168 |
| 388 | Ga0207694_10009743 | 3300025924 | Bacteria | 7248 |
| 389 | Ga0207694_10049921 | 3300025924 | Bacteria | 3239 |
| 390 | Ga0207694_10103254 | 3300025924 | Bacteria | 2260 |
| 391 | Ga0207687_10106472 | 3300025927 | Bacteria | 2073 |
| 392 | Ga0207687_10125264 | 3300025927 | Bacteria | 1928 |
| 393 | Ga0207700_10008743 | 3300025928 | Bacteria | 6290 |
| 394 | Ga0207700_10021069 | 3300025928 | Bacteria | 4443 |
| 395 | Ga0207700_10077617 | 3300025928 | Bacteria | 2581 |
| 396 | Ga0207700_10085514 | 3300025928 | Bacteria | 2476 |
| 397 | Ga0207700_10095006 | 3300025928 | Bacteria | 2364 |
| 398 | Ga0207700_10135559 | 3300025928 | Bacteria | 2016 |
| 399 | Ga0207664_10006763 | 3300025929 | Bacteria | 7918 |
| 400 | Ga0207664_10111058 | 3300025929 | Bacteria | 2280 |
| 401 | Ga0207664_10209590 | 3300025929 | Bacteria | 1686 |
| 402 | Ga0207644_10197868 | 3300025931 | Bacteria | 1584 |
| 403 | Ga0207706_10033954 | 3300025933 | Bacteria | 4541 |
| 404 | Ga0207706_10410092 | 3300025933 | Bacteria | 1174 |
| 405 | Ga0207686_10040719 | 3300025934 | Bacteria | 2827 |
| 406 | Ga0207709_10256227 | 3300025935 | Bacteria | 1281 |
| 407 | Ga0207669_10240701 | 3300025937 | Bacteria | 1341 |
| 408 | Ga0207669_10339047 | 3300025937 | Bacteria | 1157 |
| 409 | Ga0207665_10003367 | 3300025939 | Bacteria | 10702 |
| 410 | Ga0207665_10008013 | 3300025939 | Bacteria | 6969 |
| 411 | Ga0207665_10009754 | 3300025939 | Bacteria | 6304 |
| 412 | Ga0207665_10055096 | 3300025939 | Bacteria | 2682 |
| 413 | Ga0207665_10186442 | 3300025939 | Bacteria | 1505 |
| 414 | Ga0207665_10270161 | 3300025939 | Bacteria | 1262 |
| 415 | Ga0207665_10275786 | 3300025939 | Bacteria | 1250 |
| 416 | Ga0207691_10323914 | 3300025940 | Bacteria | 1321 |
| 417 | Ga0207711_10061206 | 3300025941 | Bacteria | 3246 |
| 418 | Ga0207689_10047666 | 3300025942 | Bacteria | 3536 |
| 419 | Ga0207689_10073080 | 3300025942 | Bacteria | 2817 |
| 420 | Ga0207689_10103200 | 3300025942 | Bacteria | 2343 |
| 421 | Ga0207689_10343547 | 3300025942 | Bacteria | 1240 |
| 422 | Ga0207661_10000109 | 3300025944 | Bacteria | 52179 |
| 423 | Ga0207661_10029282 | 3300025944 | Bacteria | 4227 |
| 424 | Ga0207661_10035452 | 3300025944 | Bacteria | 3888 |
| 425 | Ga0207667_10003413 | 3300025949 | Bacteria | 19620 |
| 426 | Ga0207667_10090006 | 3300025949 | Bacteria | 3171 |
| 427 | Ga0207667_10139182 | 3300025949 | Bacteria | 2499 |
| 428 | Ga0207667_10148280 | 3300025949 | Bacteria | 2415 |
| 429 | Ga0207667_10193729 | 3300025949 | Bacteria | 2085 |
| 430 | Ga0207651_10229428 | 3300025960 | Bacteria | 1506 |
| 431 | Ga0207712_10162993 | 3300025961 | Bacteria | 1735 |
| 432 | Ga0207668_10067563 | 3300025972 | Bacteria | 2538 |
| 433 | Ga0207668_10070947 | 3300025972 | Bacteria | 2486 |
| 434 | Ga0207668_10354060 | 3300025972 | Bacteria | 1228 |
| 435 | Ga0207668_10442358 | 3300025972 | Bacteria | 1107 |
| 436 | Ga0207640_10039426 | 3300025981 | Bacteria | 2990 |
| 437 | Ga0207640_10101239 | 3300025981 | Bacteria | 2021 |
| 438 | Ga0207640_10206678 | 3300025981 | Bacteria | 1492 |
| 439 | Ga0207640_10272708 | 3300025981 | Bacteria | 1324 |
| 440 | Ga0207658_10150905 | 3300025986 | Bacteria | 1893 |
| 441 | Ga0207658_10280329 | 3300025986 | Bacteria | 1428 |
| 442 | Ga0207677_10003182 | 3300026023 | Bacteria | 8665 |
| 443 | Ga0207677_10008230 | 3300026023 | Bacteria | 5812 |
| 444 | Ga0207677_10011875 | 3300026023 | Bacteria | 4984 |
| 445 | Ga0207677_10023110 | 3300026023 | Bacteria | 3834 |
| 446 | Ga0207677_10453452 | 3300026023 | Bacteria | 1099 |
| 447 | Ga0207639_10025543 | 3300026041 | Bacteria | 4283 |
| 448 | Ga0207639_10188415 | 3300026041 | Bacteria | 1760 |
| 449 | Ga0207639_10418632 | 3300026041 | Bacteria | 1211 |
| 450 | Ga0207678_10006080 | 3300026067 | Bacteria | 10738 |
| 451 | Ga0207678_10025278 | 3300026067 | Bacteria | 5185 |
| 452 | Ga0207678_10035705 | 3300026067 | Bacteria | 4328 |
| 453 | Ga0207678_10045068 | 3300026067 | Bacteria | 3813 |
| 454 | Ga0207678_10106641 | 3300026067 | Bacteria | 2390 |
| 455 | Ga0207708_10117190 | 3300026075 | Bacteria | 2072 |
| 456 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 457 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 458 | Ga0207702_10059058 | 3300026078 | Bacteria | 3266 |
| 459 | Ga0207702_10108328 | 3300026078 | Bacteria | 2465 |
| 460 | Ga0207641_10519200 | 3300026088 | Bacteria | 1158 |
| 461 | Ga0207648_10011805 | 3300026089 | Bacteria | 8209 |
| 462 | Ga0207648_10074325 | 3300026089 | Bacteria | 2962 |
| 463 | Ga0207676_10104985 | 3300026095 | Bacteria | 2351 |
| 464 | Ga0207674_10029977 | 3300026116 | Bacteria | 5723 |
| 465 | Ga0207674_10033474 | 3300026116 | Bacteria | 5380 |
| 466 | Ga0207674_10033728 | 3300026116 | Bacteria | 5358 |
| 467 | Ga0207674_10064316 | 3300026116 | Bacteria | 3700 |
| 468 | Ga0207675_100049152 | 3300026118 | Bacteria | 3937 |
| 469 | Ga0207675_100067188 | 3300026118 | Bacteria | 3351 |
| 470 | Ga0207683_10085838 | 3300026121 | Bacteria | 2798 |
| 471 | Ga0207683_10102982 | 3300026121 | Bacteria | 2549 |
| 472 | Ga0207683_10156685 | 3300026121 | Bacteria | 2057 |
| 473 | Ga0207683_10186779 | 3300026121 | Bacteria | 1881 |
| 474 | Ga0207698_10042042 | 3300026142 | Bacteria | 3411 |
| 475 | Ga0207698_10274298 | 3300026142 | Bacteria | 1556 |
| 476 | Ga0207698_10340597 | 3300026142 | Bacteria | 1412 |
| 477 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 478 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 479 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 480 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 481 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 482 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 483 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 484 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 485 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 486 | Ga0268266_10004891 | 3300028379 | Bacteria | 12707 |
| 487 | Ga0268266_10013890 | 3300028379 | Bacteria | 6934 |
| 488 | Ga0268266_10029751 | 3300028379 | Bacteria | 4640 |
| 489 | Ga0268266_10150134 | 3300028379 | Bacteria | 2099 |
| 490 | Ga0268266_10239949 | 3300028379 | Bacteria | 1672 |
| 491 | Ga0268266_10251298 | 3300028379 | Bacteria | 1635 |
| 492 | Ga0268265_10031565 | 3300028380 | Bacteria | 3826 |
| 493 | Ga0268265_10204273 | 3300028380 | Bacteria | 1716 |
| 494 | Ga0268265_10287455 | 3300028380 | Bacteria | 1474 |
| 495 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 496 | Ga0265337_1033706 | 3300028556 | Bacteria | 1510 |
| 497 | Ga0265323_10004217 | 3300028653 | Bacteria | 6219 |
| 498 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 499 | Ga0307515_10170151 | 3300028794 | Bacteria | 2176 |
| 500 | Ga0307515_10170492 | 3300028794 | Bacteria | 2172 |
| 501 | Ga0307515_10320650 | 3300028794 | Bacteria | 1216 |
| 502 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 503 | Ga0307511_10109053 | 3300030521 | Bacteria | 1772 |
| 504 | Ga0265330_10017820 | 3300031235 | Bacteria | 3267 |
| 505 | Ga0265332_10009331 | 3300031238 | Bacteria | 4382 |
| 506 | Ga0265325_10005802 | 3300031241 | Bacteria | 7568 |
| 507 | Ga0265340_10001337 | 3300031247 | Bacteria | 14130 |
| 508 | Ga0265340_10025601 | 3300031247 | Bacteria | 2987 |
| 509 | Ga0265339_10000383 | 3300031249 | Bacteria | 34934 |
| 510 | Ga0265331_10116621 | 3300031250 | Bacteria | 1222 |
| 511 | Ga0307513_10198053 | 3300031456 | Bacteria | 1853 |
| 512 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 513 | Ga0307508_10094048 | 3300031616 | Bacteria | 2588 |
| 514 | Ga0307508_10208833 | 3300031616 | Bacteria | 1553 |
| 515 | Ga0265314_10006665 | 3300031711 | Bacteria | 10147 |
| 516 | Ga0265314_10008159 | 3300031711 | Bacteria | 9012 |
| 517 | Ga0265342_10005588 | 3300031712 | Bacteria | 9535 |
| 518 | Ga0307516_10010558 | 3300031730 | Bacteria | 10139 |
| 519 | Ga0307516_10052151 | 3300031730 | Bacteria | 4006 |
| 520 | Ga0307516_10159510 | 3300031730 | Bacteria | 2007 |
| 521 | Ga0307516_10334755 | 3300031730 | Bacteria | 1182 |
| 522 | Ga0307405_10126650 | 3300031731 | Bacteria | 1757 |
| 523 | Ga0307413_10027580 | 3300031824 | Bacteria | 3149 |
| 524 | Ga0307518_10172468 | 3300031838 | Bacteria | 1473 |
| 525 | Ga0307407_10204728 | 3300031903 | Bacteria | 1325 |
| 526 | Ga0307412_10317466 | 3300031911 | Bacteria | 1238 |
| 527 | Ga0307409_100111072 | 3300031995 | Bacteria | 2298 |
| 528 | Ga0307414_10206054 | 3300032004 | Bacteria | 1604 |
| 529 | Ga0307415_100059081 | 3300032126 | Bacteria | 2643 |
| 530 | Ga0307415_100255756 | 3300032126 | Bacteria | 1426 |
| 531 | Ga0307507_10018699 | 3300033179 | Bacteria | 7861 |
| 532 | Ga0307510_10010093 | 3300033180 | Bacteria | 11228 |
| 533 | Ga0307510_10016909 | 3300033180 | Bacteria | 8604 |
| 534 | Ga0307510_10069235 | 3300033180 | Bacteria | 3536 |
| 535 | Ga0307510_10082122 | 3300033180 | Bacteria | 3120 |
| 536 | Ga0307510_10092093 | 3300033180 | Bacteria | 2870 |
| 537 | Ga0307510_10287697 | 3300033180 | Bacteria | 1111 |
| 538 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 539 | Ga0316215_1002174 | 3300033544 | Bacteria | 1854 |
| 540 | Ga0373934_0008533 | 3300035086 | Bacteria | 3819 |
| 541 | Ga0373923_0000376 | 3300035111 | Bacteria | 10201 |
| 542 | Ga0373936_0042953 | 3300035113 | Bacteria | 1816 |
| 543 | Ga0373936_0045036 | 3300035113 | Bacteria | 1776 |
| 544 | Ga0373945_0013564 | 3300035116 | Bacteria | 2721 |
| 545 | Ga0373953_0000156 | 3300035117 | Bacteria | 17676 |
| 546 | Ga0373953_0008171 | 3300035117 | Bacteria | 3542 |
| 547 | Ga0373953_0123191 | 3300035117 | Bacteria | 1102 |
| 548 | Ga0373954_0007578 | 3300035118 | Bacteria | 4751 |
| 549 | Ga0373954_0020449 | 3300035118 | Bacteria | 2994 |
| 550 | Ga0373956_0002378 | 3300035119 | Bacteria | 7686 |
| 551 | Ga0373956_0103597 | 3300035119 | Bacteria | 1322 |
| 552 | Ga0373957_0017078 | 3300035120 | Bacteria | 2521 |
| 553 | Ga0373957_0063987 | 3300035120 | Bacteria | 1429 |
| 554 | Ga0373943_0040115 | 3300035170 | Bacteria | 2259 |
| 555 | Ga0373943_0101959 | 3300035170 | Bacteria | 1502 |
| 556 | Ga0373943_0134726 | 3300035170 | Bacteria | 1325 |
| 557 | Ga0373946_0043204 | 3300035171 | Bacteria | 1856 |
| 558 | Ga0373955_0000395 | 3300035172 | Bacteria | 18509 |
| 559 | Ga0373955_0013079 | 3300035172 | Bacteria | 4003 |
| 560 | Ga0373955_0022863 | 3300035172 | Bacteria | 3177 |
| 561 | Ga0373962_0044677 | 3300035242 | Bacteria | 1259 |
| 562 | Ga0373924_0010939 | 3300035410 | Bacteria | 3359 |
| 563 | Ga0373924_0013913 | 3300035410 | Bacteria | 3031 |
| 564 | Ga0373924_0055242 | 3300035410 | Bacteria | 1652 |
| 565 | Ga0373931_0018329 | 3300035691 | Bacteria | 3480 |
| 566 | Ga0373935_0055538 | 3300035692 | Bacteria | 2523 |
| 567 | Ga0373927_0002702 | 3300035695 | Bacteria | 12926 |
| 568 | Ga0373927_0004819 | 3300035695 | Bacteria | 9380 |
| 569 | Ga0373927_0005543 | 3300035695 | Bacteria | 8684 |
| 570 | Ga0373927_0007994 | 3300035695 | Bacteria | 7144 |
| 571 | Ga0373927_0017690 | 3300035695 | Bacteria | 4689 |
| 572 | Ga0373927_0043246 | 3300035695 | Bacteria | 2917 |
| 573 | Ga0373933_0001227 | 3300035724 | Bacteria | 15171 |
| 574 | Ga0373933_0004820 | 3300035724 | Bacteria | 7373 |
| 575 | Ga0373933_0075719 | 3300035724 | Bacteria | 2055 |
| 576 | Ga0373933_0193597 | 3300035724 | Bacteria | 1299 |
| 577 | Ga0373947_0003219 | 3300035725 | Bacteria | 9692 |
| 578 | Ga0373947_0006770 | 3300035725 | Bacteria | 6647 |
| 579 | Ga0373947_0044253 | 3300035725 | Bacteria | 2660 |
| 580 | Ga0373947_0050934 | 3300035725 | Bacteria | 2490 |
| 581 | Ga0373937_0053490 | 3300036401 | Bacteria | 3703 |
| 582 | Ga0373937_0096791 | 3300036401 | Bacteria | 2737 |
| 583 | Ga0373937_0128821 | 3300036401 | Bacteria | 2362 |
| 584 | Ga0372808_002595 | 3300036459 | Bacteria | 2107 |
| 585 | Ga0373925_0009475 | 3300037068 | Bacteria | 7089 |
| 586 | Ga0373925_0042948 | 3300037068 | Bacteria | 3354 |
| 587 | Ga0373925_0053938 | 3300037068 | Bacteria | 3006 |
| 588 | Ga0373925_0055671 | 3300037068 | Bacteria | 2961 |
| 589 | Ga0373925_0099706 | 3300037068 | Bacteria | 2231 |
| 590 | Ga0395899_0076124 | 3300037312 | Bacteria | 2450 |
| 591 | Ga0395900_0047842 | 3300037418 | Bacteria | 4405 |
| 592 | Ga0395900_0102016 | 3300037418 | Bacteria | 2947 |
| 593 | Ga0395900_0112435 | 3300037418 | Bacteria | 2796 |
| 594 | Ga0395900_0216970 | 3300037418 | Bacteria | 1930 |
| 595 | Ga0395900_0229693 | 3300037418 | Bacteria | 1866 |
| 596 | Ga0395900_0272758 | 3300037418 | Bacteria | 1686 |
| 597 | Ga0395898_0017601 | 3300037466 | Bacteria | 7294 |
| 598 | Ga0395898_0028587 | 3300037466 | Bacteria | 5587 |
| 599 | Ga0395898_0088505 | 3300037466 | Bacteria | 2981 |
| 600 | Ga0395898_0152606 | 3300037466 | Bacteria | 2210 |
| 601 | Ga0395898_0195694 | 3300037466 | Bacteria | 1931 |
| 602 | Ga0395905_0020329 | 3300037471 | Bacteria | 6289 |
| 603 | Ga0395905_0046809 | 3300037471 | Bacteria | 4056 |
| 604 | Ga0436364_0974159 | 3300037853 | Bacteria | 22406 |
| 605 | Ga0395901_0008223 | 3300038443 | Bacteria | 10541 |
| 606 | Ga0395901_0230018 | 3300038443 | Bacteria | 1936 |
| 607 | Ga0395901_0248432 | 3300038443 | Bacteria | 1854 |
| 608 | Ga0395901_0305113 | 3300038443 | Bacteria | 1650 |
| 609 | Ga0436365_0902375 | 3300039437 | Bacteria | 4502 |
| 610 | Ga0436365_1181574 | 3300039437 | Bacteria | 1670 |
| 611 | Ga0436365_1371184 | 3300039437 | Bacteria | 10334 |
| 612 | Ga0436365_1421230 | 3300039437 | Bacteria | 2143 |
| 613 | Ga0436360_1202522 | 3300039438 | Bacteria | 1358 |
| 614 | Ga0436361_0189402 | 3300039447 | Bacteria | 1894 |
| 615 | Ga0436363_0012099 | 3300039450 | Bacteria | 11206 |
| 616 | Ga0436363_0300253 | 3300039450 | Bacteria | 1244 |
| 617 | Ga0436363_0351383 | 3300039450 | Bacteria | 1124 |
| 618 | Ga0436363_0717611 | 3300039450 | Bacteria | 1331 |
| 619 | Ga0436363_0972840 | 3300039450 | Bacteria | 1425 |
| 620 | Ga0436362_0993687 | 3300039453 | Bacteria | 2478 |
| 621 | Ga0439459_0027711 | 3300042438 | Bacteria | 1133 |
| 622 | Ga0466972_0000177 | 3300044658 | Bacteria | 49318 |
| 623 | Ga0466972_0009169 | 3300044658 | Bacteria | 4969 |
| 624 | Ga0466965_0060131 | 3300044683 | Bacteria | 1897 |
| 625 | Ga0466966_0008326 | 3300044684 | Bacteria | 6872 |
| 626 | Ga0466966_0112238 | 3300044684 | Bacteria | 1680 |
| 627 | Ga0466966_0127871 | 3300044684 | Bacteria | 1557 |
| 628 | Ga0466961_0000023 | 3300044693 | Bacteria | 97134 |
| 629 | Ga0466963_0139531 | 3300044694 | Bacteria | 1678 |
| 630 | Ga0466963_0248798 | 3300044694 | Bacteria | 1247 |
| 631 | Ga0466971_0050539 | 3300044719 | Bacteria | 1871 |
| 632 | Ga0466968_0001025 | 3300044735 | Bacteria | 9854 |
| 633 | Ga0466968_0063853 | 3300044735 | Bacteria | 1592 |
| 634 | Ga0466957_0042855 | 3300044842 | Bacteria | 2739 |
| 635 | Ga0466960_0039020 | 3300044901 | Bacteria | 2237 |
| 636 | Ga0466959_0011640 | 3300045049 | Bacteria | 6326 |
| 637 | Ga0466959_0030640 | 3300045049 | Bacteria | 3983 |
| 638 | Ga0466967_0055936 | 3300045976 | Bacteria | 3477 |
| 639 | Ga0466967_0121122 | 3300045976 | Bacteria | 2417 |
| 640 | Ga0466967_0184510 | 3300045976 | Bacteria | 1969 |
| 641 | Ga0466967_0235009 | 3300045976 | Bacteria | 1746 |
| 642 | Ga0495617_022025 | 3300046452 | Bacteria | 2153 |
| 643 | Ga0495617_044644 | 3300046452 | Bacteria | 1478 |
| 644 | Ga0495592_0014358 | 3300046454 | Bacteria | 6013 |
| 645 | Ga0495592_0030040 | 3300046454 | Bacteria | 4110 |
| 646 | Ga0495592_0041543 | 3300046454 | Bacteria | 3446 |
| 647 | Ga0495592_0064793 | 3300046454 | Bacteria | 2677 |
| 648 | Ga0495603_0000521 | 3300046455 | Bacteria | 21337 |
| 649 | Ga0495603_0001754 | 3300046455 | Bacteria | 12775 |
| 650 | Ga0495603_0008860 | 3300046455 | Bacteria | 6082 |
| 651 | Ga0495603_0025504 | 3300046455 | Bacteria | 3575 |
| 652 | Ga0495603_0028412 | 3300046455 | Bacteria | 3373 |
| 653 | Ga0495603_0029577 | 3300046455 | Bacteria | 3303 |
| 654 | Ga0495603_0051688 | 3300046455 | Bacteria | 2441 |
| 655 | Ga0495629_0000416 | 3300046459 | Bacteria | 35794 |
| 656 | Ga0495629_0015774 | 3300046459 | Bacteria | 5425 |
| 657 | Ga0495629_0027646 | 3300046459 | Bacteria | 4027 |
| 658 | Ga0495629_0032989 | 3300046459 | Bacteria | 3664 |
| 659 | Ga0495629_0252456 | 3300046459 | Bacteria | 1213 |
| 660 | Ga0495638_0022170 | 3300046460 | Bacteria | 4171 |
| 661 | Ga0495638_0038240 | 3300046460 | Bacteria | 3050 |
| 662 | Ga0495638_0182674 | 3300046460 | Bacteria | 1195 |
| 663 | Ga0495641_0002593 | 3300046461 | Bacteria | 14172 |
| 664 | Ga0495641_0140642 | 3300046461 | Bacteria | 1078 |
| 665 | Ga0495651_0017227 | 3300046462 | Bacteria | 5599 |
| 666 | Ga0495651_0019582 | 3300046462 | Bacteria | 5248 |
| 667 | Ga0495651_0080458 | 3300046462 | Bacteria | 2461 |
| 668 | Ga0495653_0003573 | 3300046463 | Bacteria | 12536 |
| 669 | Ga0495653_0023310 | 3300046463 | Bacteria | 5003 |
| 670 | Ga0495653_0210320 | 3300046463 | Bacteria | 1314 |
| 671 | Ga0495650_0039141 | 3300046471 | Bacteria | 2048 |
| 672 | Ga0495580_0016728 | 3300046472 | Bacteria | 5504 |
| 673 | Ga0495580_0039257 | 3300046472 | Bacteria | 3387 |
| 674 | Ga0495580_0113133 | 3300046472 | Bacteria | 1885 |
| 675 | Ga0495582_0002376 | 3300046473 | Bacteria | 10534 |
| 676 | Ga0495582_0070470 | 3300046473 | Bacteria | 1934 |
| 677 | Ga0495582_0080684 | 3300046473 | Bacteria | 1807 |
| 678 | Ga0495605_0065220 | 3300046474 | Bacteria | 1732 |
| 679 | Ga0495639_0001046 | 3300046475 | Bacteria | 12485 |
| 680 | Ga0495639_0061572 | 3300046475 | Bacteria | 1721 |
| 681 | Ga0495639_0096435 | 3300046475 | Bacteria | 1392 |
| 682 | Ga0495662_0008728 | 3300046476 | Bacteria | 4984 |
| 683 | Ga0495664_0009023 | 3300046477 | Bacteria | 5574 |
| 684 | Ga0495664_0009265 | 3300046477 | Bacteria | 5505 |
| 685 | Ga0495664_0050469 | 3300046477 | Bacteria | 2471 |
| 686 | Ga0495664_0125425 | 3300046477 | Bacteria | 1553 |
| 687 | Ga0495664_0126090 | 3300046477 | Bacteria | 1549 |
| 688 | Ga0495584_0016300 | 3300046491 | Bacteria | 3790 |
| 689 | Ga0495584_0080163 | 3300046491 | Bacteria | 1642 |
| 690 | Ga0495585_0035154 | 3300046492 | Bacteria | 2833 |
| 691 | Ga0495594_0000194 | 3300046499 | Bacteria | 29650 |
| 692 | Ga0495594_0015448 | 3300046499 | Bacteria | 4011 |
| 693 | Ga0495594_0074283 | 3300046499 | Bacteria | 1894 |
| 694 | Ga0495596_0093615 | 3300046500 | Bacteria | 1166 |
| 695 | Ga0495583_0028181 | 3300046506 | Bacteria | 2765 |
| 696 | Ga0495583_0061572 | 3300046506 | Bacteria | 1674 |
| 697 | Ga0495606_0002692 | 3300046507 | Bacteria | 20068 |
| 698 | Ga0495606_0028857 | 3300046507 | Bacteria | 3906 |
| 699 | Ga0495606_0212094 | 3300046507 | Bacteria | 1096 |
| 700 | Ga0495608_0005104 | 3300046511 | Bacteria | 9377 |
| 701 | Ga0495608_0031821 | 3300046511 | Bacteria | 3565 |
| 702 | Ga0495608_0032235 | 3300046511 | Bacteria | 3542 |
| 703 | Ga0495608_0032328 | 3300046511 | Bacteria | 3536 |
| 704 | Ga0495608_0172333 | 3300046511 | Bacteria | 1372 |
| 705 | Ga0495610_0027743 | 3300046512 | Bacteria | 3004 |
| 706 | Ga0495610_0037091 | 3300046512 | Bacteria | 2484 |
| 707 | Ga0495618_0049985 | 3300046514 | Bacteria | 2640 |
| 708 | Ga0495618_0060411 | 3300046514 | Bacteria | 2403 |
| 709 | Ga0495618_0075508 | 3300046514 | Bacteria | 2147 |
| 710 | Ga0495620_0010396 | 3300046515 | Bacteria | 4912 |
| 711 | Ga0495620_0033954 | 3300046515 | Bacteria | 2310 |
| 712 | Ga0495628_0044263 | 3300046516 | Bacteria | 3542 |
| 713 | Ga0495628_0058442 | 3300046516 | Bacteria | 3030 |
| 714 | Ga0495628_0106350 | 3300046516 | Bacteria | 2161 |
| 715 | Ga0495628_0321080 | 3300046516 | Bacteria | 1142 |
| 716 | Ga0495630_0006451 | 3300046517 | Bacteria | 8344 |
| 717 | Ga0495630_0097184 | 3300046517 | Bacteria | 2227 |
| 718 | Ga0495630_0134827 | 3300046517 | Bacteria | 1876 |
| 719 | Ga0495630_0333958 | 3300046517 | Bacteria | 1159 |
| 720 | Ga0495632_0077742 | 3300046519 | Bacteria | 1586 |
| 721 | Ga0495643_0076774 | 3300046522 | Bacteria | 1746 |
| 722 | Ga0495643_0168421 | 3300046522 | Bacteria | 1073 |
| 723 | Ga0495644_0012613 | 3300046523 | Bacteria | 3250 |
| 724 | Ga0495644_0028145 | 3300046523 | Bacteria | 2127 |
| 725 | Ga0495644_0052933 | 3300046523 | Bacteria | 1525 |
| 726 | Ga0495648_0000640 | 3300046524 | Bacteria | 37287 |
| 727 | Ga0495648_0004726 | 3300046524 | Bacteria | 11536 |
| 728 | Ga0495648_0031996 | 3300046524 | Bacteria | 3458 |
| 729 | Ga0495648_0093792 | 3300046524 | Bacteria | 1673 |
| 730 | Ga0495648_0155220 | 3300046524 | Bacteria | 1189 |
| 731 | Ga0495652_0010465 | 3300046529 | Bacteria | 8405 |
| 732 | Ga0495652_0030338 | 3300046529 | Bacteria | 4743 |
| 733 | Ga0495652_0046863 | 3300046529 | Bacteria | 3709 |
| 734 | Ga0495652_0062849 | 3300046529 | Bacteria | 3128 |
| 735 | Ga0495652_0075223 | 3300046529 | Bacteria | 2806 |
| 736 | Ga0495652_0094913 | 3300046529 | Bacteria | 2432 |
| 737 | Ga0495665_0028025 | 3300046531 | Bacteria | 3022 |
| 738 | Ga0495640_0006591 | 3300046533 | Bacteria | 9166 |
| 739 | Ga0495640_0011385 | 3300046533 | Bacteria | 6843 |
| 740 | Ga0495640_0020972 | 3300046533 | Bacteria | 4803 |
| 741 | Ga0495640_0030206 | 3300046533 | Bacteria | 3882 |
| 742 | Ga0495586_0175358 | 3300046535 | Bacteria | 1212 |
| 743 | Ga0495587_0010857 | 3300046536 | Bacteria | 5781 |
| 744 | Ga0495587_0035814 | 3300046536 | Bacteria | 2988 |
| 745 | Ga0495587_0082267 | 3300046536 | Bacteria | 1866 |
| 746 | Ga0495598_0080814 | 3300046537 | Bacteria | 1042 |
| 747 | Ga0495609_0024989 | 3300046538 | Bacteria | 2739 |
| 748 | Ga0495621_0045917 | 3300046539 | Bacteria | 1548 |
| 749 | Ga0495597_0089847 | 3300046542 | Bacteria | 1305 |
| 750 | Ga0495645_0012719 | 3300046543 | Bacteria | 5938 |
| 751 | Ga0495645_0012763 | 3300046543 | Bacteria | 5928 |
| 752 | Ga0495622_0002024 | 3300046557 | Bacteria | 9908 |
| 753 | Ga0495622_0060394 | 3300046557 | Bacteria | 1755 |
| 754 | Ga0495633_0035962 | 3300046558 | Bacteria | 2375 |
| 755 | Ga0495633_0036957 | 3300046558 | Bacteria | 2338 |
| 756 | Ga0495667_0009312 | 3300046559 | Bacteria | 6655 |
| 757 | Ga0495667_0020357 | 3300046559 | Bacteria | 4477 |
| 758 | Ga0495667_0030759 | 3300046559 | Bacteria | 3607 |
| 759 | Ga0495667_0114893 | 3300046559 | Bacteria | 1739 |
| 760 | Ga0495667_0196348 | 3300046559 | Bacteria | 1292 |
| 761 | Ga0495667_0256126 | 3300046559 | Bacteria | 1113 |
| 762 | Ga0495656_0005884 | 3300046615 | Bacteria | 4266 |
| 763 | Ga0495656_0014228 | 3300046615 | Bacteria | 2979 |
| 764 | Ga0495656_0021610 | 3300046615 | Bacteria | 2507 |
| 765 | Ga0495656_0038955 | 3300046615 | Bacteria | 1972 |
| 766 | Ga0495668_0013742 | 3300046616 | Bacteria | 4764 |
| 767 | Ga0495668_0091403 | 3300046616 | Bacteria | 1668 |
| 768 | Ga0495668_0099536 | 3300046616 | Bacteria | 1590 |
| 769 | Ga0495634_0000602 | 3300046642 | Bacteria | 34812 |
| 770 | Ga0495634_0029561 | 3300046642 | Bacteria | 3793 |
| 771 | Ga0495634_0031702 | 3300046642 | Bacteria | 3639 |
| 772 | Ga0495625_0012900 | 3300046660 | Bacteria | 6751 |
| 773 | Ga0495625_0068905 | 3300046660 | Bacteria | 2486 |
| 774 | Ga0495635_0002469 | 3300046663 | Bacteria | 12625 |
| 775 | Ga0495635_0003077 | 3300046663 | Bacteria | 11477 |
| 776 | Ga0495635_0047928 | 3300046663 | Bacteria | 2945 |
| 777 | Ga0495635_0116781 | 3300046663 | Bacteria | 1821 |
| 778 | Ga0495635_0247729 | 3300046663 | Bacteria | 1201 |
| 779 | Ga0495659_0025775 | 3300046664 | Bacteria | 2014 |
| 780 | Ga0495661_0078336 | 3300046665 | Bacteria | 1912 |
| 781 | Ga0495661_0108046 | 3300046665 | Bacteria | 1555 |
| 782 | Ga0495588_0025303 | 3300046674 | Bacteria | 2956 |
| 783 | Ga0495588_0037312 | 3300046674 | Bacteria | 2468 |
| 784 | Ga0495588_0119203 | 3300046674 | Bacteria | 1391 |
| 785 | Ga0495657_0004929 | 3300046675 | Bacteria | 10619 |
| 786 | Ga0495657_0021231 | 3300046675 | Bacteria | 4660 |
| 787 | Ga0495657_0026420 | 3300046675 | Bacteria | 4110 |
| 788 | Ga0495657_0044079 | 3300046675 | Bacteria | 3037 |
| 789 | Ga0495599_0006110 | 3300046678 | Bacteria | 7252 |
| 790 | Ga0495599_0006329 | 3300046678 | Bacteria | 7136 |
| 791 | Ga0495599_0011625 | 3300046678 | Bacteria | 5415 |
| 792 | Ga0495623_0004956 | 3300046679 | Bacteria | 8733 |
| 793 | Ga0495623_0011109 | 3300046679 | Bacteria | 5828 |
| 794 | Ga0495623_0016712 | 3300046679 | Bacteria | 4740 |
| 795 | Ga0495646_0048818 | 3300046680 | Bacteria | 2570 |
| 796 | Ga0495646_0060074 | 3300046680 | Bacteria | 2268 |
| 797 | Ga0495646_0076660 | 3300046680 | Bacteria | 1957 |
| 798 | Ga0495646_0108652 | 3300046680 | Bacteria | 1581 |
| 799 | Ga0495647_0000414 | 3300046681 | Bacteria | 12222 |
| 800 | Ga0495658_0002719 | 3300046683 | Bacteria | 8895 |
| 801 | Ga0495658_0028724 | 3300046683 | Bacteria | 3004 |
| 802 | Ga0495658_0183068 | 3300046683 | Bacteria | 1300 |
| 803 | Ga0495669_0044936 | 3300046684 | Bacteria | 1968 |
| 804 | Ga0495613_0022972 | 3300046689 | Bacteria | 4647 |
| 805 | Ga0495613_0033323 | 3300046689 | Bacteria | 3828 |
| 806 | Ga0495613_0148239 | 3300046689 | Bacteria | 1674 |
| 807 | Ga0495613_0188071 | 3300046689 | Bacteria | 1460 |
| 808 | Ga0495613_0208217 | 3300046689 | Bacteria | 1376 |
| 809 | Ga0495624_0003072 | 3300046690 | Bacteria | 12498 |
| 810 | Ga0495624_0038315 | 3300046690 | Bacteria | 3080 |
| 811 | Ga0495624_0068957 | 3300046690 | Bacteria | 2204 |
| 812 | Ga0495670_0001065 | 3300046691 | Bacteria | 13316 |
| 813 | Ga0495670_0043819 | 3300046691 | Bacteria | 2233 |
| 814 | Ga0495671_0065512 | 3300046692 | Bacteria | 1788 |
| 815 | Ga0495649_0026167 | 3300046694 | Bacteria | 3247 |
| 816 | Ga0495649_0046915 | 3300046694 | Bacteria | 2351 |
| 817 | Ga0495589_0022229 | 3300046794 | Bacteria | 3238 |
| 818 | Ga0495600_0012415 | 3300046809 | Bacteria | 5326 |
| 819 | Ga0495600_0012561 | 3300046809 | Bacteria | 5298 |
| 820 | Ga0495600_0038915 | 3300046809 | Bacteria | 3096 |
| 821 | Ga0495600_0081594 | 3300046809 | Bacteria | 2111 |
| 822 | Ga0495581_0000133 | 3300047315 | Bacteria | 32384 |
| 823 | Ga0495581_0132153 | 3300047315 | Bacteria | 1454 |
| 824 | Ga0495581_0150227 | 3300047315 | Bacteria | 1360 |
| 825 | Ga0495581_0202051 | 3300047315 | Bacteria | 1162 |
| 826 | Ga0495581_0256787 | 3300047315 | Bacteria | 1022 |
| 827 | Ga0495604_0013217 | 3300047317 | Bacteria | 6575 |
| 828 | Ga0495604_0054319 | 3300047317 | Bacteria | 3091 |
| 829 | Ga0495604_0089599 | 3300047317 | Bacteria | 2286 |
| 830 | Ga0495674_0000874 | 3300047319 | Bacteria | 28828 |
| 831 | Ga0495674_0012220 | 3300047319 | Bacteria | 8091 |
| 832 | Ga0495674_0054204 | 3300047319 | Bacteria | 3522 |
| 833 | Ga0495674_0317188 | 3300047319 | Bacteria | 1271 |
| 834 | Ga0495672_0025641 | 3300047320 | Bacteria | 3768 |
| 835 | Ga0495672_0035311 | 3300047320 | Bacteria | 3079 |
| 836 | Ga0495676_0015692 | 3300047321 | Bacteria | 6736 |
| 837 | Ga0495676_0064310 | 3300047321 | Bacteria | 2854 |
| 838 | Ga0495676_0120501 | 3300047321 | Bacteria | 1909 |
| 839 | Ga0495676_0134248 | 3300047321 | Bacteria | 1782 |
| 840 | Ga0495680_0017277 | 3300047322 | Bacteria | 6164 |
| 841 | Ga0495680_0053089 | 3300047322 | Bacteria | 3156 |
| 842 | Ga0495680_0258365 | 3300047322 | Bacteria | 1232 |
| 843 | Ga0495687_013529 | 3300047443 | Bacteria | 4253 |
| 844 | Ga0495675_0001856 | 3300047444 | Bacteria | 12578 |
| 845 | Ga0495675_0014102 | 3300047444 | Bacteria | 5052 |
| 846 | Ga0495675_0014120 | 3300047444 | Bacteria | 5049 |
| 847 | Ga0495673_0004092 | 3300047469 | Bacteria | 9261 |
| 848 | Ga0495684_0000294 | 3300047471 | Bacteria | 40596 |
| 849 | Ga0495684_0020080 | 3300047471 | Bacteria | 5146 |
| 850 | Ga0495684_0025060 | 3300047471 | Bacteria | 4588 |
| 851 | Ga0495684_0049052 | 3300047471 | Bacteria | 3227 |
| 852 | Ga0495686_0180977 | 3300047472 | Bacteria | 1221 |
| 853 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 854 | Ga0495593_0000744 | 3300047673 | Bacteria | 18938 |
| 855 | Ga0495593_0009120 | 3300047673 | Bacteria | 5754 |
| 856 | Ga0495593_0016629 | 3300047673 | Bacteria | 4147 |
| 857 | Ga0495593_0032757 | 3300047673 | Bacteria | 2832 |
| 858 | Ga0495602_0030626 | 3300048088 | Bacteria | 5100 |
| 859 | Ga0495602_0060623 | 3300048088 | Bacteria | 3295 |
| 860 | Ga0495602_0156786 | 3300048088 | Bacteria | 1782 |
| 861 | Ga0495602_0209035 | 3300048088 | Bacteria | 1483 |
| 862 | Ga0495602_0230461 | 3300048088 | Bacteria | 1392 |
| 863 | Ga0495602_0271777 | 3300048088 | Bacteria | 1252 |
| 864 | Ga0495614_0022860 | 3300048089 | Bacteria | 2695 |
| 865 | Ga0496100_0003499 | 3300048903 | Bacteria | 8201 |
| 866 | Ga0496100_0147031 | 3300048903 | Bacteria | 1677 |
| 867 | Ga0496101_0009124 | 3300048904 | Bacteria | 6509 |
| 868 | Ga0496101_0056421 | 3300048904 | Bacteria | 2840 |
| 869 | Ga0496101_0153683 | 3300048904 | Bacteria | 1761 |
| 870 | Ga0496101_0349734 | 3300048904 | Bacteria | 1161 |
| 871 | Ga0496102_0006184 | 3300048905 | Bacteria | 10206 |
| 872 | Ga0496102_0029606 | 3300048905 | Bacteria | 4900 |
| 873 | Ga0496102_0059757 | 3300048905 | Bacteria | 3486 |
| 874 | Ga0496102_0073409 | 3300048905 | Bacteria | 3144 |
| 875 | Ga0496102_0159376 | 3300048905 | Bacteria | 2122 |
| 876 | Ga0496102_0160810 | 3300048905 | Bacteria | 2113 |
| 877 | Ga0496102_0307848 | 3300048905 | Bacteria | 1493 |
| 878 | Ga0496103_0006862 | 3300048906 | Bacteria | 6799 |
| 879 | Ga0496103_0061923 | 3300048906 | Bacteria | 2328 |
| 880 | Ga0496103_0165405 | 3300048906 | Bacteria | 1419 |
| 881 | Ga0496103_0210261 | 3300048906 | Bacteria | 1251 |
| 882 | Ga0496104_0002005 | 3300048907 | Bacteria | 17670 |
| 883 | Ga0496104_0030942 | 3300048907 | Bacteria | 4976 |
| 884 | Ga0496104_0039125 | 3300048907 | Bacteria | 4439 |
| 885 | Ga0496104_0043721 | 3300048907 | Bacteria | 4207 |
| 886 | Ga0496104_0070616 | 3300048907 | Bacteria | 3320 |
| 887 | Ga0496104_0110978 | 3300048907 | Bacteria | 2629 |
| 888 | Ga0496104_0164368 | 3300048907 | Bacteria | 2128 |
| 889 | Ga0496104_0166508 | 3300048907 | Bacteria | 2114 |
| 890 | Ga0496105_0015812 | 3300048908 | Bacteria | 6019 |
| 891 | Ga0496105_0018819 | 3300048908 | Bacteria | 5561 |
| 892 | Ga0496105_0026728 | 3300048908 | Bacteria | 4710 |
| 893 | Ga0496105_0127943 | 3300048908 | Bacteria | 2094 |
| 894 | Ga0496105_0239545 | 3300048908 | Bacteria | 1473 |
| 895 | Ga0496106_0003691 | 3300048909 | Bacteria | 11418 |
| 896 | Ga0496106_0007852 | 3300048909 | Bacteria | 7895 |
| 897 | Ga0496106_0009940 | 3300048909 | Bacteria | 7024 |
| 898 | Ga0496106_0010150 | 3300048909 | Bacteria | 6957 |
| 899 | Ga0496106_0038934 | 3300048909 | Bacteria | 3560 |
| 900 | Ga0496106_0309438 | 3300048909 | Bacteria | 1267 |
| 901 | Ga0496106_0413790 | 3300048909 | Bacteria | 1084 |
| 902 | Ga0496107_0020799 | 3300048910 | Bacteria | 4637 |
| 903 | Ga0496107_0042505 | 3300048910 | Bacteria | 3264 |
| 904 | Ga0496107_0063392 | 3300048910 | Bacteria | 2678 |
| 905 | Ga0496107_0122472 | 3300048910 | Bacteria | 1916 |
| 906 | Ga0496107_0315214 | 3300048910 | Bacteria | 1164 |
| 907 | Ga0496108_0024899 | 3300048911 | Bacteria | 4929 |
| 908 | Ga0496108_0068090 | 3300048911 | Bacteria | 3003 |
| 909 | Ga0496108_0079127 | 3300048911 | Bacteria | 2783 |
| 910 | Ga0496108_0150464 | 3300048911 | Bacteria | 2008 |
| 911 | Ga0496108_0215261 | 3300048911 | Bacteria | 1668 |
| 912 | Ga0496109_0000910 | 3300048912 | Bacteria | 24624 |
| 913 | Ga0496109_0010481 | 3300048912 | Bacteria | 7919 |
| 914 | Ga0496109_0016308 | 3300048912 | Bacteria | 6493 |
| 915 | Ga0496109_0016600 | 3300048912 | Bacteria | 6439 |
| 916 | Ga0496109_0061904 | 3300048912 | Bacteria | 3422 |
| 917 | Ga0496109_0157729 | 3300048912 | Bacteria | 2126 |
| 918 | Ga0496109_0593720 | 3300048912 | Bacteria | 1043 |
| 919 | Ga0496110_0039029 | 3300048913 | Bacteria | 4134 |
| 920 | Ga0496110_0074770 | 3300048913 | Bacteria | 3010 |
| 921 | Ga0496110_0145765 | 3300048913 | Bacteria | 2141 |
| 922 | Ga0496110_0275393 | 3300048913 | Bacteria | 1532 |
| 923 | Ga0496111_0011896 | 3300048914 | Bacteria | 5879 |
| 924 | Ga0496111_0094046 | 3300048914 | Bacteria | 2198 |
| 925 | Ga0496111_0267495 | 3300048914 | Bacteria | 1268 |
| 926 | Ga0496111_0361996 | 3300048914 | Bacteria | 1073 |
| 927 | Ga0496112_0000022 | 3300048915 | Bacteria | 156255 |
| 928 | Ga0496112_0008650 | 3300048915 | Bacteria | 9128 |
| 929 | Ga0496112_0020467 | 3300048915 | Bacteria | 6273 |
| 930 | Ga0496112_0020945 | 3300048915 | Bacteria | 6208 |
| 931 | Ga0496112_0029523 | 3300048915 | Bacteria | 5303 |
| 932 | Ga0496112_0035183 | 3300048915 | Bacteria | 4877 |
| 933 | Ga0496112_0039089 | 3300048915 | Bacteria | 4634 |
| 934 | Ga0496112_0067762 | 3300048915 | Bacteria | 3523 |
| 935 | Ga0496112_0113658 | 3300048915 | Bacteria | 2678 |
| 936 | Ga0496112_0162367 | 3300048915 | Bacteria | 2201 |
| 937 | Ga0496112_0318263 | 3300048915 | Bacteria | 1500 |
| 938 | Ga0496113_0001596 | 3300048916 | Bacteria | 12741 |
| 939 | Ga0496113_0021222 | 3300048916 | Bacteria | 4579 |
| 940 | Ga0496113_0026536 | 3300048916 | Bacteria | 4142 |
| 941 | Ga0496113_0094105 | 3300048916 | Bacteria | 2314 |
| 942 | Ga0496113_0131651 | 3300048916 | Bacteria | 1963 |
| 943 | Ga0496114_0072883 | 3300048917 | Bacteria | 2889 |
| 944 | Ga0496114_0116982 | 3300048917 | Bacteria | 2289 |
| 945 | Ga0496114_0310704 | 3300048917 | Bacteria | 1392 |
| 946 | Ga0496114_0397536 | 3300048917 | Bacteria | 1220 |
| 947 | Ga0496115_0032084 | 3300048918 | Bacteria | 4143 |
| 948 | Ga0496115_0037994 | 3300048918 | Bacteria | 3819 |
| 949 | Ga0496115_0043743 | 3300048918 | Bacteria | 3571 |
| 950 | Ga0496115_0043883 | 3300048918 | Bacteria | 3565 |
| 951 | Ga0496115_0047207 | 3300048918 | Bacteria | 3443 |
| 952 | Ga0496115_0083801 | 3300048918 | Bacteria | 2599 |
| 953 | Ga0496115_0122982 | 3300048918 | Bacteria | 2136 |
| 954 | Ga0496115_0126130 | 3300048918 | Bacteria | 2108 |
| 955 | Ga0496115_0133100 | 3300048918 | Bacteria | 2050 |
| 956 | Ga0496115_0161714 | 3300048918 | Bacteria | 1850 |
| 957 | Ga0496115_0328247 | 3300048918 | Bacteria | 1250 |
| 958 | Ga0496116_0004251 | 3300048919 | Bacteria | 13742 |
| 959 | Ga0496117_0012698 | 3300048920 | Bacteria | 7397 |
| 960 | Ga0496117_0028820 | 3300048920 | Bacteria | 4292 |
| 961 | Ga0496118_0016505 | 3300048921 | Bacteria | 6773 |
| 962 | Ga0496118_0031958 | 3300048921 | Bacteria | 4348 |
| 963 | Ga0496118_0032185 | 3300048921 | Bacteria | 4328 |
| 964 | Ga0496119_0022613 | 3300048922 | Bacteria | 4493 |
| 965 | Ga0496119_0022773 | 3300048922 | Bacteria | 4471 |
| 966 | Ga0496119_0023433 | 3300048922 | Bacteria | 4377 |
| 967 | Ga0496120_0021002 | 3300048923 | Bacteria | 4133 |
| 968 | Ga0496120_0059770 | 3300048923 | Bacteria | 2135 |
| 969 | Ga0496120_0076022 | 3300048923 | Bacteria | 1831 |
| 970 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 971 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 972 | Ga0496121_0001567 | 3300048924 | Bacteria | 38104 |
| 973 | Ga0496121_0019232 | 3300048924 | Bacteria | 6840 |
| 974 | Ga0496121_0024814 | 3300048924 | Bacteria | 5718 |
| 975 | Ga0496121_0069007 | 3300048924 | Bacteria | 2856 |
| 976 | Ga0496121_0080649 | 3300048924 | Bacteria | 2579 |
| 977 | Ga0496121_0094782 | 3300048924 | Bacteria | 2321 |
| 978 | Ga0496121_0099020 | 3300048924 | Bacteria | 2254 |
| 979 | Ga0496121_0111711 | 3300048924 | Bacteria | 2083 |
| 980 | Ga0496121_0123657 | 3300048924 | Bacteria | 1949 |
| 981 | Ga0496121_0157723 | 3300048924 | Bacteria | 1663 |
| 982 | Ga0496121_0170222 | 3300048924 | Bacteria | 1583 |
| 983 | Ga0496121_0258583 | 3300048924 | Bacteria | 1203 |
| 984 | Ga0496121_0300586 | 3300048924 | Bacteria | 1089 |
| 985 | Ga0496122_0009335 | 3300048925 | Bacteria | 10359 |
| 986 | Ga0496122_0044528 | 3300048925 | Bacteria | 3461 |
| 987 | Ga0496122_0051764 | 3300048925 | Bacteria | 3116 |
| 988 | Ga0496122_0194241 | 3300048925 | Bacteria | 1194 |
| 989 | Ga0496124_0001236 | 3300048927 | Bacteria | 39269 |
| 990 | Ga0496124_0067274 | 3300048927 | Bacteria | 2982 |
| 991 | Ga0496124_0102995 | 3300048927 | Bacteria | 2309 |
| 992 | Ga0496124_0340978 | 3300048927 | Bacteria | 1064 |
| 993 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 994 | Ga0496125_0002791 | 3300048928 | Bacteria | 22081 |
| 995 | Ga0496125_0010906 | 3300048928 | Bacteria | 9137 |
| 996 | Ga0496125_0015991 | 3300048928 | Bacteria | 7225 |
| 997 | Ga0496125_0029525 | 3300048928 | Bacteria | 4926 |
| 998 | Ga0496125_0043420 | 3300048928 | Bacteria | 3816 |
| 999 | Ga0496125_0053712 | 3300048928 | Bacteria | 3300 |
| 1000 | Ga0496126_0007002 | 3300048929 | Bacteria | 12454 |
| 1001 | Ga0496126_0012504 | 3300048929 | Bacteria | 8690 |
| 1002 | Ga0496126_0017287 | 3300048929 | Bacteria | 7187 |
| 1003 | Ga0496126_0027699 | 3300048929 | Bacteria | 5408 |
| 1004 | Ga0496126_0031094 | 3300048929 | Bacteria | 5048 |
| 1005 | Ga0496126_0038428 | 3300048929 | Bacteria | 4454 |
| 1006 | Ga0496126_0039889 | 3300048929 | Bacteria | 4354 |
| 1007 | Ga0496126_0043377 | 3300048929 | Bacteria | 4149 |
| 1008 | Ga0496126_0047403 | 3300048929 | Bacteria | 3934 |
| 1009 | Ga0496126_0052470 | 3300048929 | Bacteria | 3705 |
| 1010 | Ga0496126_0054860 | 3300048929 | Bacteria | 3607 |
| 1011 | Ga0496126_0072997 | 3300048929 | Bacteria | 3051 |
| 1012 | Ga0496126_0074489 | 3300048929 | Bacteria | 3015 |
| 1013 | Ga0496126_0085828 | 3300048929 | Bacteria | 2774 |
| 1014 | Ga0496126_0088703 | 3300048929 | Bacteria | 2724 |
| 1015 | Ga0496126_0117052 | 3300048929 | Bacteria | 2315 |
| 1016 | Ga0496126_0157571 | 3300048929 | Bacteria | 1942 |
| 1017 | Ga0496126_0181511 | 3300048929 | Bacteria | 1788 |
| 1018 | Ga0496126_0228793 | 3300048929 | Bacteria | 1558 |
| 1019 | Ga0496126_0277747 | 3300048929 | Bacteria | 1388 |
| 1020 | Ga0495678_045022 | 3300049459 | Bacteria | 1743 |
| 1021 | Ga0495678_076933 | 3300049459 | Bacteria | 1208 |
| 1022 | Ga0495682_0054436 | 3300049460 | Bacteria | 1452 |
| 1023 | Ga0495682_0074821 | 3300049460 | Bacteria | 1218 |
| 1024 | Ga0501031_0038957 | 3300049568 | Bacteria | 3100 |
| 1025 | Ga0501031_0128997 | 3300049568 | Bacteria | 1652 |
| 1026 | Ga0501033_0017918 | 3300049570 | Bacteria | 5347 |
| 1027 | Ga0501033_0152040 | 3300049570 | Bacteria | 1669 |
| 1028 | Ga0501033_0301708 | 3300049570 | Bacteria | 1127 |
| 1029 | Ga0501034_0051004 | 3300049571 | Bacteria | 4173 |
| 1030 | Ga0501034_0076053 | 3300049571 | Bacteria | 3364 |
| 1031 | Ga0501034_0140986 | 3300049571 | Bacteria | 2390 |
| 1032 | Ga0501034_0190086 | 3300049571 | Bacteria | 2016 |
| 1033 | Ga0501034_0290059 | 3300049571 | Bacteria | 1574 |
| 1034 | Ga0501034_0425660 | 3300049571 | Bacteria | 1248 |
| 1035 | Ga0501036_0080538 | 3300049572 | Bacteria | 2753 |
| 1036 | Ga0501036_0427198 | 3300049572 | Bacteria | 1104 |
| 1037 | Ga0501037_0045907 | 3300049573 | Bacteria | 3205 |
| 1038 | Ga0501037_0063104 | 3300049573 | Bacteria | 2701 |
| 1039 | Ga0501037_0170333 | 3300049573 | Bacteria | 1548 |
| 1040 | Ga0501037_0233594 | 3300049573 | Bacteria | 1290 |
| 1041 | Ga0501038_0003347 | 3300049574 | Bacteria | 14952 |
| 1042 | Ga0501038_0127264 | 3300049574 | Bacteria | 2095 |
| 1043 | Ga0501038_0265321 | 3300049574 | Bacteria | 1355 |
| 1044 | Ga0501039_0058689 | 3300049575 | Bacteria | 2980 |
| 1045 | Ga0501039_0132838 | 3300049575 | Bacteria | 1953 |
| 1046 | Ga0501039_0154459 | 3300049575 | Bacteria | 1803 |
| 1047 | Ga0501039_0173689 | 3300049575 | Bacteria | 1694 |
| 1048 | Ga0501040_0024640 | 3300049576 | Bacteria | 4039 |
| 1049 | Ga0501042_0092237 | 3300049578 | Bacteria | 2174 |
| 1050 | Ga0501043_0022652 | 3300049579 | Bacteria | 4925 |
| 1051 | Ga0501043_0035798 | 3300049579 | Bacteria | 3906 |
| 1052 | Ga0501043_0063091 | 3300049579 | Bacteria | 2909 |
| 1053 | Ga0501043_0115915 | 3300049579 | Bacteria | 2103 |
| 1054 | Ga0501046_0080691 | 3300049580 | Bacteria | 2513 |
| 1055 | Ga0501046_0097458 | 3300049580 | Bacteria | 2259 |
| 1056 | Ga0501046_0104382 | 3300049580 | Bacteria | 2172 |
| 1057 | Ga0501046_0123973 | 3300049580 | Bacteria | 1964 |
| 1058 | Ga0501047_0074414 | 3300049581 | Bacteria | 3270 |
| 1059 | Ga0501048_0048652 | 3300049582 | Bacteria | 3023 |
| 1060 | Ga0501048_0064298 | 3300049582 | Bacteria | 2595 |
| 1061 | Ga0501067_0002459 | 3300049583 | Bacteria | 10222 |
| 1062 | Ga0501067_0042939 | 3300049583 | Bacteria | 2511 |
| 1063 | Ga0501068_0014532 | 3300049584 | Bacteria | 4502 |
| 1064 | Ga0501069_0066775 | 3300049585 | Bacteria | 2011 |
| 1065 | Ga0501069_0085199 | 3300049585 | Bacteria | 1783 |
| 1066 | Ga0501070_0057445 | 3300049586 | Bacteria | 3225 |
| 1067 | Ga0501070_0080344 | 3300049586 | Bacteria | 2698 |
| 1068 | Ga0501070_0150891 | 3300049586 | Bacteria | 1917 |
| 1069 | Ga0501071_0013466 | 3300049587 | Bacteria | 5575 |
| 1070 | Ga0501072_0032282 | 3300049588 | Bacteria | 4101 |
| 1071 | Ga0501072_0135256 | 3300049588 | Bacteria | 1965 |
| 1072 | Ga0501073_0028457 | 3300049589 | Bacteria | 3994 |
| 1073 | Ga0501073_0032066 | 3300049589 | Bacteria | 3747 |
| 1074 | Ga0501073_0194538 | 3300049589 | Bacteria | 1403 |
| 1075 | Ga0501073_0203203 | 3300049589 | Bacteria | 1370 |
| 1076 | Ga0501074_0064390 | 3300049590 | Bacteria | 2639 |
| 1077 | Ga0501077_0077753 | 3300049593 | Bacteria | 2102 |
| 1078 | Ga0501079_0118133 | 3300049741 | Bacteria | 2061 |
| 1079 | Ga0501080_0063191 | 3300049742 | Bacteria | 3446 |
| 1080 | Ga0501083_0041501 | 3300049744 | Bacteria | 3120 |
| 1081 | Ga0501035_0084000 | 3300049822 | Bacteria | 2809 |
| 1082 | Ga0501035_0090339 | 3300049822 | Bacteria | 2696 |
| 1083 | Ga0501035_0110125 | 3300049822 | Bacteria | 2413 |
| 1084 | Ga0501035_0170282 | 3300049822 | Bacteria | 1882 |
| 1085 | Ga0501035_0411886 | 3300049822 | Bacteria | 1123 |
| 1086 | Ga0501044_0032392 | 3300049823 | Bacteria | 5496 |
| 1087 | Ga0501044_0037782 | 3300049823 | Bacteria | 5046 |
| 1088 | Ga0501044_0038321 | 3300049823 | Bacteria | 5005 |
| 1089 | Ga0501044_0088359 | 3300049823 | Bacteria | 3128 |
| 1090 | Ga0501044_0138564 | 3300049823 | Bacteria | 2422 |
| 1091 | Ga0501044_0223236 | 3300049823 | Bacteria | 1834 |
| 1092 | Ga0501044_0240445 | 3300049823 | Bacteria | 1754 |
| 1093 | Ga0501044_0565022 | 3300049823 | Bacteria | 1033 |
| 1094 | Ga0501045_0024317 | 3300049824 | Bacteria | 4348 |
| 1095 | nmdc:mga03683_101559_c1 | 3300050489 | Bacteria | 1264 |
| 1096 | nmdc:mga03683_60325_c1 | 3300050489 | Bacteria | 1602 |
| 1097 | nmdc:mga03n38_2791_c1 | 3300050490 | Bacteria | 5486 |
| 1098 | nmdc:mga03n38_71308_c1 | 3300050490 | Bacteria | 1609 |
| 1099 | nmdc:mga00v17_4195_c1 | 3300050491 | Bacteria | 6144 |
| 1100 | nmdc:mga00v17_70029_c1 | 3300050491 | Bacteria | 2172 |
| 1101 | nmdc:mga00v17_7814_c1 | 3300050491 | Bacteria | 5733 |
| 1102 | nmdc:mga0yw44_27245_c1 | 3300050492 | Bacteria | 3271 |
| 1103 | nmdc:mga0yw44_51316_c1 | 3300050492 | Bacteria | 2497 |
| 1104 | nmdc:mga0yw44_66487_c1 | 3300050492 | Bacteria | 2225 |
| 1105 | nmdc:mga0yw44_69816_c1 | 3300050492 | Bacteria | 2177 |
| 1106 | nmdc:mga0yw44_73238_c1 | 3300050492 | Bacteria | 2131 |
| 1107 | nmdc:mga0yw44_8369_c1 | 3300050492 | Bacteria | 5149 |
| 1108 | nmdc:mga0yw44_97315_c1 | 3300050492 | Bacteria | 1869 |
| 1109 | nmdc:mga0k408_100867_c1 | 3300050493 | Bacteria | 1702 |
| 1110 | nmdc:mga0k408_40338_c1 | 3300050493 | Bacteria | 2686 |
| 1111 | nmdc:mga0k408_60219_c1 | 3300050493 | Bacteria | 2206 |
| 1112 | nmdc:mga06z11_12111_c1 | 3300050494 | Bacteria | 3741 |
| 1113 | nmdc:mga06z11_22737_c1 | 3300050494 | Bacteria | 2933 |
| 1114 | nmdc:mga06z11_228368_c1 | 3300050494 | Bacteria | 1090 |
| 1115 | nmdc:mga06z11_2940_c1 | 3300050494 | Bacteria | 6558 |
| 1116 | nmdc:mga06z11_63873_c1 | 3300050494 | Bacteria | 1928 |
| 1117 | nmdc:mga07m45_104960_c1 | 3300050496 | Bacteria | 1625 |
| 1118 | nmdc:mga07m45_14891_c1 | 3300050496 | Bacteria | 4153 |
| 1119 | nmdc:mga07m45_4272_c1 | 3300050496 | Bacteria | 6990 |
| 1120 | nmdc:mga07m45_66119_c1 | 3300050496 | Bacteria | 2054 |
| 1121 | nmdc:mga07m45_6917_c1 | 3300050496 | Bacteria | 5770 |
| 1122 | nmdc:mga05p37_20147_c1 | 3300050507 | Bacteria | 8072 |
| 1123 | nmdc:mga05p37_72277_c1 | 3300050507 | Bacteria | 4244 |
| 1124 | nmdc:mga0qj67_101885_c1 | 3300050509 | Bacteria | 2315 |
| 1125 | nmdc:mga06r32_56945_c1 | 3300050510 | Bacteria | 3754 |
| 1126 | nmdc:mga0n895_33569_c1 | 3300050512 | Bacteria | 4933 |
| 1127 | nmdc:mga0n895_348159_c1 | 3300050512 | Bacteria | 1500 |
| 1128 | nmdc:mga0n895_71602_c1 | 3300050512 | Bacteria | 3438 |
| 1129 | nmdc:mga0sz30_1155_c1 | 3300050516 | Bacteria | 9461 |
| 1130 | nmdc:mga0sz30_2482_c1 | 3300050516 | Bacteria | 6223 |
| 1131 | Ga0495601_0004994 | 3300053077 | Bacteria | 7698 |
| 1132 | Ga0495601_0013942 | 3300053077 | Bacteria | 4840 |
| 1133 | Ga0495601_0170591 | 3300053077 | Bacteria | 1422 |
| 1134 | Ga0495601_0187674 | 3300053077 | Bacteria | 1351 |
| 1135 | Ga0495612_0011892 | 3300053078 | Bacteria | 3508 |
| 1136 | Ga0495612_0030072 | 3300053078 | Bacteria | 2188 |
| 1137 | Ga0500635_0011261 | 3300053080 | Bacteria | 2537 |
| 1138 | Ga0495595_0000670 | 3300053084 | Bacteria | 13076 |
| 1139 | Ga0495595_0016585 | 3300053084 | Bacteria | 3155 |
| 1140 | Ga0495619_0026443 | 3300053085 | Bacteria | 3733 |
| 1141 | Ga0495619_0035364 | 3300053085 | Bacteria | 3248 |
| 1142 | Ga0495619_0095687 | 3300053085 | Bacteria | 2015 |
| 1143 | Ga0500578_0206155 | 3300053086 | Bacteria | 1201 |
| 1144 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 1145 | Ga0500651_0014169 | 3300053093 | Bacteria | 4875 |
| 1146 | Ga0500566_0002331 | 3300053094 | Bacteria | 11235 |
| 1147 | Ga0500566_0002512 | 3300053094 | Bacteria | 10894 |
| 1148 | Ga0500566_0002754 | 3300053094 | Bacteria | 10472 |
| 1149 | Ga0500566_0011017 | 3300053094 | Bacteria | 5327 |
| 1150 | Ga0500566_0054199 | 3300053094 | Bacteria | 2287 |
| 1151 | Ga0500641_0037727 | 3300053096 | Bacteria | 1938 |
| 1152 | Ga0500641_0091352 | 3300053096 | Bacteria | 1300 |
| 1153 | Ga0500556_0000035 | 3300053104 | Bacteria | 145357 |
| 1154 | Ga0500557_000057 | 3300053105 | Bacteria | 47849 |
| 1155 | Ga0500562_019096 | 3300053108 | Bacteria | 1771 |
| 1156 | Ga0500572_000655 | 3300053111 | Bacteria | 11430 |
| 1157 | Ga0500572_003541 | 3300053111 | Bacteria | 3557 |
| 1158 | Ga0500591_058871 | 3300053115 | Bacteria | 1778 |
| 1159 | Ga0500594_0002896 | 3300053118 | Bacteria | 3744 |
| 1160 | Ga0500595_002818 | 3300053119 | Bacteria | 8361 |
| 1161 | Ga0500595_004352 | 3300053119 | Bacteria | 6371 |
| 1162 | Ga0500595_028193 | 3300053119 | Bacteria | 1916 |
| 1163 | Ga0500595_034967 | 3300053119 | Bacteria | 1658 |
| 1164 | Ga0500595_062917 | 3300053119 | Bacteria | 1116 |
| 1165 | Ga0500607_109387 | 3300053121 | Bacteria | 1357 |
| 1166 | Ga0500608_000780 | 3300053122 | Bacteria | 11633 |
| 1167 | Ga0500614_003528 | 3300053123 | Bacteria | 3363 |
| 1168 | Ga0500618_004716 | 3300053125 | Bacteria | 4280 |
| 1169 | Ga0500642_0000027 | 3300053130 | Bacteria | 119688 |
| 1170 | Ga0500642_0000263 | 3300053130 | Bacteria | 19627 |
| 1171 | Ga0500642_0112543 | 3300053130 | Bacteria | 1271 |
| 1172 | Ga0500652_000934 | 3300053131 | Bacteria | 9664 |
| 1173 | Ga0500559_0000064 | 3300053136 | Bacteria | 85844 |
| 1174 | Ga0500559_0000486 | 3300053136 | Bacteria | 28052 |
| 1175 | Ga0500559_0003342 | 3300053136 | Bacteria | 7941 |
| 1176 | Ga0500559_0015332 | 3300053136 | Bacteria | 3236 |
| 1177 | Ga0500559_0070038 | 3300053136 | Bacteria | 1577 |
| 1178 | Ga0500568_0001465 | 3300053139 | Bacteria | 15127 |
| 1179 | Ga0500568_0022037 | 3300053139 | Bacteria | 2732 |
| 1180 | Ga0500577_0000035 | 3300053142 | Bacteria | 31742 |
| 1181 | Ga0500588_0053235 | 3300053146 | Bacteria | 1270 |
| 1182 | Ga0500589_041912 | 3300053147 | Bacteria | 2135 |
| 1183 | Ga0500590_017886 | 3300053148 | Bacteria | 3666 |
| 1184 | Ga0500590_054044 | 3300053148 | Bacteria | 2034 |
| 1185 | Ga0500603_000667 | 3300053150 | Bacteria | 8359 |
| 1186 | Ga0500603_001350 | 3300053150 | Bacteria | 5626 |
| 1187 | Ga0500604_0002237 | 3300053151 | Bacteria | 5296 |
| 1188 | Ga0500604_0053553 | 3300053151 | Bacteria | 1251 |
| 1189 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1190 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1191 | Ga0500622_0003626 | 3300053156 | Bacteria | 10145 |
| 1192 | Ga0500622_0006780 | 3300053156 | Bacteria | 6591 |
| 1193 | Ga0500627_0002332 | 3300053158 | Bacteria | 5603 |
| 1194 | Ga0500634_0017216 | 3300053161 | Bacteria | 3868 |
| 1195 | Ga0500634_0042983 | 3300053161 | Bacteria | 2450 |
| 1196 | Ga0500634_0121455 | 3300053161 | Bacteria | 1270 |
| 1197 | Ga0500638_044057 | 3300053162 | Bacteria | 2166 |
| 1198 | Ga0500639_001074 | 3300053163 | Bacteria | 13945 |
| 1199 | Ga0500639_132718 | 3300053163 | Bacteria | 1177 |
| 1200 | Ga0500636_0026615 | 3300053177 | Bacteria | 3416 |
| 1201 | Ga0500636_0030405 | 3300053177 | Bacteria | 3193 |
| 1202 | Ga0500636_0043902 | 3300053177 | Bacteria | 2638 |
| 1203 | Ga0500636_0067038 | 3300053177 | Bacteria | 2085 |
| 1204 | Ga0500636_0126036 | 3300053177 | Bacteria | 1431 |
| 1205 | Ga0500636_0220568 | 3300053177 | Bacteria | 988 |
| 1206 | Ga0500637_0001280 | 3300053178 | Bacteria | 10539 |
| 1207 | Ga0500637_0001814 | 3300053178 | Bacteria | 9236 |
| 1208 | Ga0500637_0138128 | 3300053178 | Bacteria | 1411 |
| 1209 | Ga0500625_118975 | 3300053729 | Bacteria | 1066 |
| 1210 | Ga0500645_014952 | 3300053730 | Bacteria | 2466 |
| 1211 | Ga0500645_041853 | 3300053730 | Bacteria | 1352 |
| 1212 | Ga0500609_006142 | 3300053731 | Bacteria | 1637 |
| 1213 | Ga0500596_000644 | 3300053735 | Bacteria | 6723 |
| 1214 | Ga0500596_008419 | 3300053735 | Bacteria | 1645 |
| 1215 | Ga0500599_002539 | 3300053736 | Bacteria | 2191 |
| 1216 | Ga0500601_003142 | 3300053737 | Bacteria | 1785 |
| 1217 | Ga0501084_0005438 | 3300054114 | Bacteria | 10447 |
| 1218 | Ga0500661_001546 | 3300055283 | Bacteria | 4330 |
| 1219 | Ga0501082_0000040 | 3300060353 | Bacteria | 91596 |
| 1220 | Ga0501082_0018483 | 3300060353 | Bacteria | 6004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046616 | Ga0495668_0099536 | Ga0495668_0099536_188_1120 | 305 |
| 2 | 3300048924 | Ga0496121_0300586 | Ga0496121_0300586_12_929 | 305 |
| 3 | iso_pu_bacteria | 2791355199 | 2793077886 | 306 |
| 4 | iso_pu_bacteria | 2879110137 | 2879114941 | 306 |
| 5 | iso_pu_bacteria | 2889033259 | 2889037708 | 306 |
| 6 | iso_pu_bacteria | 8006984368 | 8006984730 | 306 |
| 7 | 3300005530 | Ga0070679_100034610 | Ga0070679_1000346103 | 307 |
| 8 | 3300013104 | Ga0157370_10140019 | Ga0157370_101400191 | 307 |
| 9 | 3300046674 | Ga0495588_0025303 | Ga0495588_0025303_1788_2717 | 309 |
| 10 | 3300003320 | rootH2_10188699 | rootH2_101886991 | 310 |
| 11 | 3300005334 | Ga0068869_100087480 | Ga0068869_1000874804 | 310 |
| 12 | 3300005338 | Ga0068868_100005183 | Ga0068868_1000051836 | 310 |
| 13 | 3300005347 | Ga0070668_100046605 | Ga0070668_1000466052 | 310 |
| 14 | 3300005347 | Ga0070668_100081859 | Ga0070668_1000818594 | 310 |
| 15 | 3300005456 | Ga0070678_100084703 | Ga0070678_1000847033 | 310 |
| 16 | 3300005546 | Ga0070696_100094591 | Ga0070696_1000945912 | 310 |
| 17 | 3300005548 | Ga0070665_100021701 | Ga0070665_1000217012 | 310 |
| 18 | 3300005548 | Ga0070665_100057391 | Ga0070665_1000573913 | 310 |
| 19 | 3300005548 | Ga0070665_100084638 | Ga0070665_1000846383 | 310 |
| 20 | 3300005617 | Ga0068859_100304741 | Ga0068859_1003047412 | 310 |
| 21 | 3300005618 | Ga0068864_100313875 | Ga0068864_1003138752 | 310 |
| 22 | 3300005719 | Ga0068861_100088531 | Ga0068861_1000885312 | 310 |
| 23 | 3300005842 | Ga0068858_100127907 | Ga0068858_1001279072 | 310 |
| 24 | 3300005844 | Ga0068862_100220550 | Ga0068862_1002205502 | 310 |
| 25 | 3300005937 | Ga0081455_10000715 | Ga0081455_1000071537 | 310 |
| 26 | 3300005937 | Ga0081455_10049450 | Ga0081455_100494502 | 310 |
| 27 | 3300005983 | Ga0081540_1014466 | Ga0081540_10144662 | 310 |
| 28 | 3300006042 | Ga0075368_10008135 | Ga0075368_100081353 | 310 |
| 29 | 3300006051 | Ga0075364_10043166 | Ga0075364_100431662 | 310 |
| 30 | 3300006358 | Ga0068871_100113220 | Ga0068871_1001132203 | 310 |
| 31 | 3300006931 | Ga0097620_100304731 | Ga0097620_1003047312 | 310 |
| 32 | 3300009147 | Ga0114129_10196005 | Ga0114129_101960053 | 310 |
| 33 | 3300009148 | Ga0105243_10328556 | Ga0105243_103285562 | 310 |
| 34 | 3300009174 | Ga0105241_10016444 | Ga0105241_100164445 | 310 |
| 35 | 3300009177 | Ga0105248_10073680 | Ga0105248_100736803 | 310 |
| 36 | 3300009177 | Ga0105248_10161310 | Ga0105248_101613104 | 310 |
| 37 | 3300009551 | Ga0105238_10066871 | Ga0105238_100668714 | 310 |
| 38 | 3300010375 | Ga0105239_10666468 | Ga0105239_106664682 | 310 |
| 39 | 3300011119 | Ga0105246_10024946 | Ga0105246_100249465 | 310 |
| 40 | 3300013297 | Ga0157378_10085139 | Ga0157378_100851392 | 310 |
| 41 | 3300014325 | Ga0163163_10069545 | Ga0163163_100695452 | 310 |
| 42 | 3300014968 | Ga0157379_10095943 | Ga0157379_100959432 | 310 |
| 43 | 3300014969 | Ga0157376_10175361 | Ga0157376_101753612 | 310 |
| 44 | 3300025907 | Ga0207645_10182413 | Ga0207645_101824131 | 310 |
| 45 | 3300025911 | Ga0207654_10061268 | Ga0207654_100612682 | 310 |
| 46 | 3300025933 | Ga0207706_10410092 | Ga0207706_104100921 | 310 |
| 47 | 3300025937 | Ga0207669_10240701 | Ga0207669_102407012 | 310 |
| 48 | 3300025942 | Ga0207689_10047666 | Ga0207689_100476662 | 310 |
| 49 | 3300025942 | Ga0207689_10103200 | Ga0207689_101032002 | 310 |
| 50 | 3300025949 | Ga0207667_10148280 | Ga0207667_101482802 | 310 |
| 51 | 3300025972 | Ga0207668_10067563 | Ga0207668_100675632 | 310 |
| 52 | 3300025972 | Ga0207668_10354060 | Ga0207668_103540601 | 310 |
| 53 | 3300025972 | Ga0207668_10442358 | Ga0207668_104423581 | 310 |
| 54 | 3300026023 | Ga0207677_10003182 | Ga0207677_100031825 | 310 |
| 55 | 3300026067 | Ga0207678_10045068 | Ga0207678_100450683 | 310 |
| 56 | 3300026118 | Ga0207675_100067188 | Ga0207675_1000671882 | 310 |
| 57 | 3300026121 | Ga0207683_10102982 | Ga0207683_101029822 | 310 |
| 58 | 3300028379 | Ga0268266_10004891 | Ga0268266_100048916 | 310 |
| 59 | 3300028379 | Ga0268266_10029751 | Ga0268266_100297513 | 310 |
| 60 | 3300031616 | Ga0307508_10094048 | Ga0307508_100940482 | 310 |
| 61 | 3300033180 | Ga0307510_10082122 | Ga0307510_100821222 | 310 |
| 62 | 3300046452 | Ga0495617_022025 | Ga0495617_022025_819_1751 | 310 |
| 63 | 3300046455 | Ga0495603_0001754 | Ga0495603_0001754_6700_7632 | 310 |
| 64 | 3300046460 | Ga0495638_0022170 | Ga0495638_0022170_487_1419 | 310 |
| 65 | 3300046491 | Ga0495584_0016300 | Ga0495584_0016300_684_1616 | 310 |
| 66 | 3300046491 | Ga0495584_0080163 | Ga0495584_0080163_68_1000 | 310 |
| 67 | 3300046492 | Ga0495585_0035154 | Ga0495585_0035154_590_1522 | 310 |
| 68 | 3300046512 | Ga0495610_0037091 | Ga0495610_0037091_148_1080 | 310 |
| 69 | 3300046523 | Ga0495644_0028145 | Ga0495644_0028145_780_1712 | 310 |
| 70 | 3300046523 | Ga0495644_0052933 | Ga0495644_0052933_553_1485 | 310 |
| 71 | 3300046539 | Ga0495621_0045917 | Ga0495621_0045917_550_1482 | 310 |
| 72 | 3300046542 | Ga0495597_0089847 | Ga0495597_0089847_313_1245 | 310 |
| 73 | 3300046558 | Ga0495633_0036957 | Ga0495633_0036957_569_1501 | 310 |
| 74 | 3300046616 | Ga0495668_0013742 | Ga0495668_0013742_1290_2222 | 310 |
| 75 | 3300046664 | Ga0495659_0025775 | Ga0495659_0025775_444_1376 | 310 |
| 76 | 3300046665 | Ga0495661_0108046 | Ga0495661_0108046_426_1358 | 310 |
| 77 | 3300046692 | Ga0495671_0065512 | Ga0495671_0065512_616_1548 | 310 |
| 78 | 3300048905 | Ga0496102_0160810 | Ga0496102_0160810_766_1698 | 310 |
| 79 | 3300048908 | Ga0496105_0239545 | Ga0496105_0239545_416_1348 | 310 |
| 80 | 3300048911 | Ga0496108_0150464 | Ga0496108_0150464_78_1010 | 310 |
| 81 | 3300048912 | Ga0496109_0157729 | Ga0496109_0157729_722_1654 | 310 |
| 82 | 3300048913 | Ga0496110_0074770 | Ga0496110_0074770_1125_2057 | 310 |
| 83 | 3300048915 | Ga0496112_0318263 | Ga0496112_0318263_382_1314 | 310 |
| 84 | 3300048924 | Ga0496121_0094782 | Ga0496121_0094782_1244_2176 | 310 |
| 85 | 3300048924 | Ga0496121_0157723 | Ga0496121_0157723_614_1546 | 310 |
| 86 | 3300048929 | Ga0496126_0012504 | Ga0496126_0012504_2668_3600 | 310 |
| 87 | 3300048929 | Ga0496126_0074489 | Ga0496126_0074489_1587_2519 | 310 |
| 88 | 3300049459 | Ga0495678_045022 | Ga0495678_045022_292_1224 | 310 |
| 89 | 3300050489 | nmdc:mga03683_60325_c1 | nmdc:mga03683_60325_c1_396_1328 | 310 |
| 90 | 3300050492 | nmdc:mga0yw44_27245_c1 | nmdc:mga0yw44_27245_c1_322_1254 | 310 |
| 91 | 3300050492 | nmdc:mga0yw44_66487_c1 | nmdc:mga0yw44_66487_c1_884_1864 | 310 |
| 92 | 3300050493 | nmdc:mga0k408_100867_c1 | nmdc:mga0k408_100867_c1_620_1552 | 310 |
| 93 | 3300050507 | nmdc:mga05p37_72277_c1 | nmdc:mga05p37_72277_c1_774_1706 | 310 |
| 94 | 3300050512 | nmdc:mga0n895_348159_c1 | nmdc:mga0n895_348159_c1_72_1004 | 310 |
| 95 | 3300053096 | Ga0500641_0091352 | Ga0500641_0091352_148_1080 | 310 |
| 96 | 3300053108 | Ga0500562_019096 | Ga0500562_019096_454_1386 | 310 |
| 97 | 3300053119 | Ga0500595_002818 | Ga0500595_002818_6657_7589 | 310 |
| 98 | 3300005843 | Ga0068860_100155651 | Ga0068860_1001556512 | 311 |
| 99 | 3300035117 | Ga0373953_0123191 | Ga0373953_0123191_96_1031 | 311 |
| 100 | iso_pu_bacteria | 2507262055 | 2507504329 | 311 |
| 101 | iso_pu_bacteria | 2508501009 | 2508545763 | 311 |
| 102 | iso_pu_bacteria | 2508501042 | 2508694588 | 311 |
| 103 | iso_pu_bacteria | 2511231028 | 2511398407 | 311 |
| 104 | iso_pu_bacteria | 2513237092 | 2513624499 | 311 |
| 105 | iso_pu_bacteria | 2513237094 | 2513638637 | 311 |
| 106 | iso_pu_bacteria | 2513237095 | 2513649974 | 311 |
| 107 | iso_pu_bacteria | 2513237096 | 2513655412 | 311 |
| 108 | iso_pu_bacteria | 2513237101 | 2513697537 | 311 |
| 109 | iso_pu_bacteria | 2513237102 | 2513703218 | 311 |
| 110 | iso_pu_bacteria | 2513237104 | 2513716819 | 311 |
| 111 | iso_pu_bacteria | 2513237137 | 2513860024 | 311 |
| 112 | iso_pu_bacteria | 2513237139 | 2513874267 | 311 |
| 113 | iso_pu_bacteria | 2513237141 | 2513892378 | 311 |
| 114 | iso_pu_bacteria | 2513237145 | 2513916510 | 311 |
| 115 | iso_pu_bacteria | 2513237161 | 2514009967 | 311 |
| 116 | iso_pu_bacteria | 2515154112 | 2515624483 | 311 |
| 117 | iso_pu_bacteria | 2517093001 | 2517104587 | 311 |
| 118 | iso_pu_bacteria | 2517572143 | 2517889899 | 311 |
| 119 | iso_pu_bacteria | 2524023205 | 2524438544 | 311 |
| 120 | iso_pu_bacteria | 2524023210 | 2524470516 | 311 |
| 121 | iso_pu_bacteria | 2524023228 | 2524532912 | 311 |
| 122 | iso_pu_bacteria | 2528768022 | 2528850393 | 311 |
| 123 | iso_pu_bacteria | 2602042107 | 2603860613 | 311 |
| 124 | iso_pu_bacteria | 2617270735 | 2617354172 | 311 |
| 125 | iso_pu_bacteria | 2617270741 | 2617374670 | 311 |
| 126 | iso_pu_bacteria | 2643221651 | 2644290205 | 311 |
| 127 | iso_pu_bacteria | 2667528175 | 2671121077 | 311 |
| 128 | iso_pu_bacteria | 2721755755 | 2723842580 | 311 |
| 129 | iso_pu_bacteria | 2728368998 | 2728751703 | 311 |
| 130 | iso_pu_bacteria | 2744054633 | 2745077231 | 311 |
| 131 | iso_pu_bacteria | 2791355196 | 2793059402 | 311 |
| 132 | iso_pu_bacteria | 2791355197 | 2793068153 | 311 |
| 133 | iso_pu_bacteria | 2791355199 | 2793078549 | 311 |
| 134 | iso_pu_bacteria | 2802429603 | 2805916033 | 311 |
| 135 | iso_pu_bacteria | 2816332527 | 2818240974 | 311 |
| 136 | iso_pu_bacteria | 2824600985 | 2824604424 | 311 |
| 137 | iso_pu_bacteria | 2824609381 | 2824615035 | 311 |
| 138 | iso_pu_bacteria | 2824617872 | 2824626176 | 311 |
| 139 | iso_pu_bacteria | 2824626560 | 2824633229 | 311 |
| 140 | iso_pu_bacteria | 2824635225 | 2824643189 | 311 |
| 141 | iso_pu_bacteria | 2824644064 | 2824651380 | 311 |
| 142 | iso_pu_bacteria | 2824653114 | 2824659181 | 311 |
| 143 | iso_pu_bacteria | 2824661429 | 2824665225 | 311 |
| 144 | iso_pu_bacteria | 2824671348 | 2824676380 | 311 |
| 145 | iso_pu_bacteria | 2824679649 | 2824687070 | 311 |
| 146 | iso_pu_bacteria | 2824687955 | 2824692702 | 311 |
| 147 | iso_pu_bacteria | 2824696289 | 2824703725 | 311 |
| 148 | iso_pu_bacteria | 2824704595 | 2824713910 | 311 |
| 149 | iso_pu_bacteria | 2824714736 | 2824722721 | 311 |
| 150 | iso_pu_bacteria | 2824723954 | 2824731413 | 311 |
| 151 | iso_pu_bacteria | 2824732956 | 2824738367 | 311 |
| 152 | iso_pu_bacteria | 2824746037 | 2824751268 | 311 |
| 153 | iso_pu_bacteria | 2824753945 | 2824761105 | 311 |
| 154 | iso_pu_bacteria | 2824763712 | 2824771778 | 311 |
| 155 | iso_pu_bacteria | 2824773399 | 2824778250 | 311 |
| 156 | iso_pu_bacteria | 2838122688 | 2838126128 | 311 |
| 157 | iso_pu_bacteria | 2841941048 | 2841942479 | 311 |
| 158 | iso_pu_bacteria | 2841949485 | 2841953174 | 311 |
| 159 | iso_pu_bacteria | 2841957949 | 2841960681 | 311 |
| 160 | iso_pu_bacteria | 2841966195 | 2841970801 | 311 |
| 161 | iso_pu_bacteria | 2841974524 | 2841977940 | 311 |
| 162 | iso_pu_bacteria | 2841983080 | 2841984499 | 311 |
| 163 | iso_pu_bacteria | 2844315083 | 2844321335 | 311 |
| 164 | iso_pu_bacteria | 2847939898 | 2847943312 | 311 |
| 165 | iso_pu_bacteria | 2849076700 | 2849077040 | 311 |
| 166 | iso_pu_bacteria | 2857509624 | 2857514686 | 311 |
| 167 | iso_pu_bacteria | 2857524615 | 2857525571 | 311 |
| 168 | iso_pu_bacteria | 2874590934 | 2874595714 | 311 |
| 169 | iso_pu_bacteria | 2874604998 | 2874606736 | 311 |
| 170 | iso_pu_bacteria | 2874612657 | 2874620286 | 311 |
| 171 | iso_pu_bacteria | 2874620515 | 2874624222 | 311 |
| 172 | iso_pu_bacteria | 2874628541 | 2874630306 | 311 |
| 173 | iso_pu_bacteria | 2874645413 | 2874651654 | 311 |
| 174 | iso_pu_bacteria | 2876761206 | 2876767662 | 311 |
| 175 | iso_pu_bacteria | 2876771140 | 2876775909 | 311 |
| 176 | iso_pu_bacteria | 2876808645 | 2876816682 | 311 |
| 177 | iso_pu_bacteria | 2876818435 | 2876821549 | 311 |
| 178 | iso_pu_bacteria | 2879074833 | 2879080000 | 311 |
| 179 | iso_pu_bacteria | 2879099564 | 2879100582 | 311 |
| 180 | iso_pu_bacteria | 2879110137 | 2879113553 | 311 |
| 181 | iso_pu_bacteria | 2879127579 | 2879134083 | 311 |
| 182 | iso_pu_bacteria | 2879142872 | 2879148568 | 311 |
| 183 | iso_pu_bacteria | 2881364244 | 2881367722 | 311 |
| 184 | iso_pu_bacteria | 2881665667 | 2881669315 | 311 |
| 185 | iso_pu_bacteria | 2885366525 | 2885374483 | 311 |
| 186 | iso_pu_bacteria | 2885374607 | 2885379427 | 311 |
| 187 | iso_pu_bacteria | 2885383462 | 2885388230 | 311 |
| 188 | iso_pu_bacteria | 2885409591 | 2885412168 | 311 |
| 189 | iso_pu_bacteria | 2888378607 | 2888387633 | 311 |
| 190 | iso_pu_bacteria | 2888388044 | 2888391529 | 311 |
| 191 | iso_pu_bacteria | 2888419890 | 2888426849 | 311 |
| 192 | iso_pu_bacteria | 2889033259 | 2889034135 | 311 |
| 193 | iso_pu_bacteria | 2893066018 | 2893070710 | 311 |
| 194 | iso_pu_bacteria | 2903727486 | 2903731475 | 311 |
| 195 | iso_pu_bacteria | 2903748898 | 2903750746 | 311 |
| 196 | iso_pu_bacteria | 2904666416 | 2904670933 | 311 |
| 197 | iso_pu_bacteria | 2904690495 | 2904692663 | 311 |
| 198 | iso_pu_bacteria | 2904699407 | 2904711120 | 311 |
| 199 | iso_pu_bacteria | 2904711408 | 2904713561 | 311 |
| 200 | iso_pu_bacteria | 2906602504 | 2906607949 | 311 |
| 201 | iso_pu_bacteria | 2906610324 | 2906612363 | 311 |
| 202 | iso_pu_bacteria | 2906626472 | 2906633079 | 311 |
| 203 | iso_pu_bacteria | 2906635258 | 2906638311 | 311 |
| 204 | iso_pu_bacteria | 2906660503 | 2906663404 | 311 |
| 205 | iso_pu_bacteria | 2908739725 | 2908739764 | 311 |
| 206 | iso_pu_bacteria | 2908756301 | 2908757875 | 311 |
| 207 | iso_pu_bacteria | 2908775508 | 2908777151 | 311 |
| 208 | iso_pu_bacteria | 2919073203 | 2919074621 | 311 |
| 209 | iso_pu_bacteria | 2922361189 | 2922367533 | 311 |
| 210 | iso_pu_bacteria | 2922368715 | 2922376617 | 311 |
| 211 | iso_pu_bacteria | 2922386360 | 2922391508 | 311 |
| 212 | iso_pu_bacteria | 2922393267 | 2922398567 | 311 |
| 213 | iso_pu_bacteria | 2922425934 | 2922426932 | 311 |
| 214 | iso_pu_bacteria | 2929615660 | 2929619878 | 311 |
| 215 | iso_pu_bacteria | 2929624759 | 2929629190 | 311 |
| 216 | iso_pu_bacteria | 2932784394 | 2932789677 | 311 |
| 217 | iso_pu_bacteria | 2932794094 | 2932796655 | 311 |
| 218 | iso_pu_bacteria | 2932801729 | 2932802565 | 311 |
| 219 | iso_pu_bacteria | 2932809354 | 2932814816 | 311 |
| 220 | iso_pu_bacteria | 2932818245 | 2932824327 | 311 |
| 221 | iso_pu_bacteria | 2932828146 | 2932833946 | 311 |
| 222 | iso_pu_bacteria | 2933577622 | 2933581796 | 311 |
| 223 | iso_pu_bacteria | 2935608549 | 2935613256 | 311 |
| 224 | iso_pu_bacteria | 2935616580 | 2935623664 | 311 |
| 225 | iso_pu_bacteria | 2935630451 | 2935633091 | 311 |
| 226 | iso_pu_bacteria | 2935638405 | 2935645052 | 311 |
| 227 | iso_pu_bacteria | 2935648319 | 2935656630 | 311 |
| 228 | iso_pu_bacteria | 2935656913 | 2935665446 | 311 |
| 229 | iso_pu_bacteria | 2935665750 | 2935672101 | 311 |
| 230 | iso_pu_bacteria | 2935675223 | 2935684093 | 311 |
| 231 | iso_pu_bacteria | 2935684952 | 2935689141 | 311 |
| 232 | iso_pu_bacteria | 2935694250 | 2935697598 | 311 |
| 233 | iso_pu_bacteria | 2935703347 | 2935711377 | 311 |
| 234 | iso_pu_bacteria | 2935713505 | 2935720087 | 311 |
| 235 | iso_pu_bacteria | 2935722832 | 2935728296 | 311 |
| 236 | iso_pu_bacteria | 2935732158 | 2935737107 | 311 |
| 237 | iso_pu_bacteria | 2935741537 | 2935746832 | 311 |
| 238 | iso_pu_bacteria | 2935750917 | 2935757799 | 311 |
| 239 | iso_pu_bacteria | 2935760218 | 2935764178 | 311 |
| 240 | iso_pu_bacteria | 2935769743 | 2935775195 | 311 |
| 241 | iso_pu_bacteria | 2935777560 | 2935780097 | 311 |
| 242 | iso_pu_bacteria | 2935785616 | 2935790219 | 311 |
| 243 | iso_pu_bacteria | 2935793552 | 2935798739 | 311 |
| 244 | iso_pu_bacteria | 2935801545 | 2935808764 | 311 |
| 245 | iso_pu_bacteria | 2935810662 | 2935817561 | 311 |
| 246 | iso_pu_bacteria | 2935819856 | 2935824890 | 311 |
| 247 | iso_pu_bacteria | 2935827899 | 2935834102 | 311 |
| 248 | iso_pu_bacteria | 2935837841 | 2935844705 | 311 |
| 249 | iso_pu_bacteria | 2935847175 | 2935852110 | 311 |
| 250 | iso_pu_bacteria | 2935855204 | 2935861729 | 311 |
| 251 | iso_pu_bacteria | 2935864058 | 2935868635 | 311 |
| 252 | iso_pu_bacteria | 2935873716 | 2935879409 | 311 |
| 253 | iso_pu_bacteria | 2935883170 | 2935886995 | 311 |
| 254 | iso_pu_bacteria | 2935908558 | 2935911457 | 311 |
| 255 | iso_pu_bacteria | 2935916978 | 2935920992 | 311 |
| 256 | iso_pu_bacteria | 2935926038 | 2935928486 | 311 |
| 257 | iso_pu_bacteria | 2935934488 | 2935938131 | 311 |
| 258 | iso_pu_bacteria | 2935942939 | 2935945413 | 311 |
| 259 | iso_pu_bacteria | 2935951376 | 2935954081 | 311 |
| 260 | iso_pu_bacteria | 2935959822 | 2935965460 | 311 |
| 261 | iso_pu_bacteria | 2935967501 | 2935971651 | 311 |
| 262 | iso_pu_bacteria | 2935975950 | 2935980055 | 311 |
| 263 | iso_pu_bacteria | 2935984226 | 2935989483 | 311 |
| 264 | iso_pu_bacteria | 2935992306 | 2935998423 | 311 |
| 265 | iso_pu_bacteria | 2936002035 | 2936009116 | 311 |
| 266 | iso_pu_bacteria | 2936011229 | 2936019493 | 311 |
| 267 | iso_pu_bacteria | 2936019824 | 2936028097 | 311 |
| 268 | iso_pu_bacteria | 2936028420 | 2936036931 | 311 |
| 269 | iso_pu_bacteria | 2936037263 | 2936044358 | 311 |
| 270 | iso_pu_bacteria | 2936046547 | 2936054954 | 311 |
| 271 | iso_pu_bacteria | 2936055302 | 2936060739 | 311 |
| 272 | iso_pu_bacteria | 2940556831 | 2940563379 | 311 |
| 273 | iso_pu_bacteria | 2941507105 | 2941509607 | 311 |
| 274 | iso_pu_bacteria | 2941515067 | 2941517436 | 311 |
| 275 | iso_pu_bacteria | 2941523033 | 2941526611 | 311 |
| 276 | iso_pu_bacteria | 2941531003 | 2941531908 | 311 |
| 277 | iso_pu_bacteria | 2941538514 | 2941545400 | 311 |
| 278 | iso_pu_bacteria | 3005474847 | 3005476116 | 311 |
| 279 | iso_pu_bacteria | 3005483717 | 3005486005 | 311 |
| 280 | iso_pu_bacteria | 3005506211 | 3005506672 | 311 |
| 281 | iso_pu_bacteria | 3005587118 | 3005592743 | 311 |
| 282 | iso_pu_bacteria | 3005594810 | 3005601687 | 311 |
| 283 | iso_pu_bacteria | 3005710791 | 3005717424 | 311 |
| 284 | iso_pu_bacteria | 3005718088 | 3005724369 | 311 |
| 285 | iso_pu_bacteria | 8006926726 | 8006932549 | 311 |
| 286 | iso_pu_bacteria | 8006933436 | 8006937430 | 311 |
| 287 | iso_pu_bacteria | 8006973647 | 8006977459 | 311 |
| 288 | iso_pu_bacteria | 8006984368 | 8006986203 | 311 |
| 289 | iso_pu_bacteria | 8006994254 | 8006999143 | 311 |
| 290 | iso_pu_bacteria | 8016511872 | 8016519220 | 311 |
| 291 | iso_pu_bacteria | 8016522445 | 8016525102 | 311 |
| 292 | iso_pu_bacteria | 8016530956 | 8016538678 | 311 |
| 293 | iso_pu_bacteria | 8016539877 | 8016542967 | 311 |
| 294 | iso_pu_bacteria | 8016548790 | 8016550326 | 311 |
| 295 | iso_pu_bacteria | 8016557553 | 8016558733 | 311 |
| 296 | iso_pu_bacteria | 8016566248 | 8016568365 | 311 |
| 297 | iso_pu_bacteria | 8016575299 | 8016581023 | 311 |
| 298 | iso_pu_bacteria | 8016583857 | 8016587702 | 311 |
| 299 | iso_pu_bacteria | 8016595262 | 8016596708 | 311 |
| 300 | iso_pu_bacteria | 8016603502 | 8016607583 | 311 |
| 301 | iso_pu_bacteria | 8016613128 | 8016619376 | 311 |
| 302 | iso_pu_bacteria | 8016622563 | 8016630216 | 311 |
| 303 | iso_pu_bacteria | 8016630954 | 8016636935 | 311 |
| 304 | iso_pu_bacteria | 8017057580 | 8017066289 | 311 |
| 305 | iso_pu_bacteria | 8019530166 | 8019538350 | 311 |
| 306 | iso_pu_bacteria | 8019538911 | 8019541472 | 311 |
| 307 | iso_pu_bacteria | 8019547302 | 8019549156 | 311 |
| 308 | iso_pu_bacteria | 8019555841 | 8019561195 | 311 |
| 309 | iso_pu_bacteria | 8019565922 | 8019571285 | 311 |
| 310 | iso_pu_bacteria | 8019586578 | 8019596371 | 311 |
| 311 | iso_pu_bacteria | 8019597564 | 8019605331 | 311 |
| 312 | iso_pu_bacteria | 8019608314 | 8019613211 | 311 |
| 313 | iso_pu_bacteria | 8019619141 | 8019623895 | 311 |
| 314 | iso_pu_bacteria | 8019629233 | 8019638146 | 311 |
| 315 | iso_pu_bacteria | 8019638758 | 8019641490 | 311 |
| 316 | iso_pu_bacteria | 8019648815 | 8019651551 | 311 |
| 317 | iso_pu_bacteria | 8019659431 | 8019666061 | 311 |
| 318 | iso_pu_bacteria | 8019668869 | 8019675578 | 311 |
| 319 | iso_pu_bacteria | 8019678201 | 8019680521 | 311 |
| 320 | iso_pu_bacteria | 8055742211 | 8055750370 | 311 |
| 321 | iso_pu_bacteria | 8056673599 | 8056678862 | 311 |
| 322 | iso_pu_bacteria | 8056681323 | 8056685977 | 311 |
| 323 | iso_pu_bacteria | 8056689827 | 8056691991 | 311 |
| 324 | iso_pu_bacteria | 8056967851 | 8056976139 | 311 |
| 325 | 3300048921 | Ga0496118_0016505 | Ga0496118_0016505_939_1877 | 312 |
| 326 | 3300003203 | JGI25406J46586_10000118 | JGI25406J46586_1000011810 | 313 |
| 327 | 3300005437 | Ga0070710_10010597 | Ga0070710_100105974 | 313 |
| 328 | 3300005439 | Ga0070711_100315304 | Ga0070711_1003153041 | 313 |
| 329 | 3300005983 | Ga0081540_1022699 | Ga0081540_10226993 | 313 |
| 330 | 3300005985 | Ga0081539_10000425 | Ga0081539_1000042566 | 313 |
| 331 | 3300006163 | Ga0070715_10000561 | Ga0070715_100005616 | 313 |
| 332 | 3300006871 | Ga0075434_100084478 | Ga0075434_1000844782 | 313 |
| 333 | 3300006914 | Ga0075436_100096406 | Ga0075436_1000964062 | 313 |
| 334 | 3300025905 | Ga0207685_10023611 | Ga0207685_100236112 | 313 |
| 335 | 3300025915 | Ga0207693_10008624 | Ga0207693_100086245 | 313 |
| 336 | 3300025928 | Ga0207700_10021069 | Ga0207700_100210692 | 313 |
| 337 | 3300025939 | Ga0207665_10009754 | Ga0207665_100097545 | 313 |
| 338 | 3300048909 | Ga0496106_0010150 | Ga0496106_0010150_4399_5340 | 313 |
| 339 | 3300005327 | Ga0070658_10212017 | Ga0070658_102120172 | 314 |
| 340 | 3300013102 | Ga0157371_10231668 | Ga0157371_102316682 | 314 |
| 341 | 3300025909 | Ga0207705_10033327 | Ga0207705_100333274 | 314 |
| 342 | 3300025917 | Ga0207660_10210524 | Ga0207660_102105242 | 314 |
| 343 | 3300025919 | Ga0207657_10014763 | Ga0207657_100147634 | 314 |
| 344 | 3300025933 | Ga0207706_10033954 | Ga0207706_100339544 | 314 |
| 345 | 3300037418 | Ga0395900_0047842 | Ga0395900_0047842_3339_4283 | 314 |
| 346 | 3300037418 | Ga0395900_0112435 | Ga0395900_0112435_799_1743 | 314 |
| 347 | 3300037466 | Ga0395898_0195694 | Ga0395898_0195694_833_1777 | 314 |
| 348 | 3300038443 | Ga0395901_0008223 | Ga0395901_0008223_6511_7455 | 314 |
| 349 | 3300045976 | Ga0466967_0235009 | Ga0466967_0235009_203_1147 | 314 |
| 350 | 3300048905 | Ga0496102_0307848 | Ga0496102_0307848_425_1369 | 314 |
| 351 | 3300048909 | Ga0496106_0413790 | Ga0496106_0413790_82_1026 | 314 |
| 352 | 3300048924 | Ga0496121_0001567 | Ga0496121_0001567_20756_21700 | 314 |
| 353 | 3300048929 | Ga0496126_0027699 | Ga0496126_0027699_2900_3844 | 314 |
| 354 | 3300048929 | Ga0496126_0031094 | Ga0496126_0031094_1216_2160 | 314 |
| 355 | 3300049568 | Ga0501031_0038957 | Ga0501031_0038957_1893_2837 | 314 |
| 356 | 3300049568 | Ga0501031_0128997 | Ga0501031_0128997_54_998 | 314 |
| 357 | 3300049570 | Ga0501033_0017918 | Ga0501033_0017918_761_1705 | 314 |
| 358 | 3300049570 | Ga0501033_0152040 | Ga0501033_0152040_57_1001 | 314 |
| 359 | 3300049570 | Ga0501033_0301708 | Ga0501033_0301708_41_1087 | 314 |
| 360 | 3300049571 | Ga0501034_0051004 | Ga0501034_0051004_1165_2112 | 314 |
| 361 | 3300049571 | Ga0501034_0076053 | Ga0501034_0076053_669_1613 | 314 |
| 362 | 3300049571 | Ga0501034_0140986 | Ga0501034_0140986_514_1458 | 314 |
| 363 | 3300049571 | Ga0501034_0190086 | Ga0501034_0190086_391_1437 | 314 |
| 364 | 3300049571 | Ga0501034_0290059 | Ga0501034_0290059_283_1227 | 314 |
| 365 | 3300049572 | Ga0501036_0427198 | Ga0501036_0427198_104_1048 | 314 |
| 366 | 3300049573 | Ga0501037_0045907 | Ga0501037_0045907_2221_3165 | 314 |
| 367 | 3300049573 | Ga0501037_0063104 | Ga0501037_0063104_1675_2619 | 314 |
| 368 | 3300049573 | Ga0501037_0233594 | Ga0501037_0233594_264_1208 | 314 |
| 369 | 3300049574 | Ga0501038_0003347 | Ga0501038_0003347_2199_3143 | 314 |
| 370 | 3300049574 | Ga0501038_0265321 | Ga0501038_0265321_314_1258 | 314 |
| 371 | 3300049575 | Ga0501039_0058689 | Ga0501039_0058689_1849_2793 | 314 |
| 372 | 3300049575 | Ga0501039_0132838 | Ga0501039_0132838_940_1884 | 314 |
| 373 | 3300049575 | Ga0501039_0173689 | Ga0501039_0173689_591_1535 | 314 |
| 374 | 3300049576 | Ga0501040_0024640 | Ga0501040_0024640_2102_3046 | 314 |
| 375 | 3300049578 | Ga0501042_0092237 | Ga0501042_0092237_198_1142 | 314 |
| 376 | 3300049579 | Ga0501043_0022652 | Ga0501043_0022652_1393_2439 | 314 |
| 377 | 3300049579 | Ga0501043_0035798 | Ga0501043_0035798_824_1768 | 314 |
| 378 | 3300049579 | Ga0501043_0063091 | Ga0501043_0063091_1152_2096 | 314 |
| 379 | 3300049580 | Ga0501046_0080691 | Ga0501046_0080691_453_1397 | 314 |
| 380 | 3300049580 | Ga0501046_0104382 | Ga0501046_0104382_793_1836 | 314 |
| 381 | 3300049582 | Ga0501048_0048652 | Ga0501048_0048652_210_1154 | 314 |
| 382 | 3300049583 | Ga0501067_0002459 | Ga0501067_0002459_5926_6870 | 314 |
| 383 | 3300049584 | Ga0501068_0014532 | Ga0501068_0014532_1893_2837 | 314 |
| 384 | 3300049585 | Ga0501069_0066775 | Ga0501069_0066775_991_1935 | 314 |
| 385 | 3300049586 | Ga0501070_0150891 | Ga0501070_0150891_493_1437 | 314 |
| 386 | 3300049587 | Ga0501071_0013466 | Ga0501071_0013466_3151_4095 | 314 |
| 387 | 3300049588 | Ga0501072_0032282 | Ga0501072_0032282_1099_2043 | 314 |
| 388 | 3300049588 | Ga0501072_0135256 | Ga0501072_0135256_455_1399 | 314 |
| 389 | 3300049589 | Ga0501073_0028457 | Ga0501073_0028457_1812_2756 | 314 |
| 390 | 3300049589 | Ga0501073_0032066 | Ga0501073_0032066_540_1484 | 314 |
| 391 | 3300049589 | Ga0501073_0194538 | Ga0501073_0194538_417_1361 | 314 |
| 392 | 3300049593 | Ga0501077_0077753 | Ga0501077_0077753_154_1098 | 314 |
| 393 | 3300049741 | Ga0501079_0118133 | Ga0501079_0118133_104_1048 | 314 |
| 394 | 3300049742 | Ga0501080_0063191 | Ga0501080_0063191_26_970 | 314 |
| 395 | 3300049744 | Ga0501083_0041501 | Ga0501083_0041501_284_1228 | 314 |
| 396 | 3300049822 | Ga0501035_0084000 | Ga0501035_0084000_320_1264 | 314 |
| 397 | 3300049822 | Ga0501035_0090339 | Ga0501035_0090339_1433_2479 | 314 |
| 398 | 3300049822 | Ga0501035_0110125 | Ga0501035_0110125_1259_2203 | 314 |
| 399 | 3300049822 | Ga0501035_0170282 | Ga0501035_0170282_546_1490 | 314 |
| 400 | 3300049823 | Ga0501044_0038321 | Ga0501044_0038321_2288_3334 | 314 |
| 401 | 3300049823 | Ga0501044_0088359 | Ga0501044_0088359_692_1636 | 314 |
| 402 | 3300049823 | Ga0501044_0138564 | Ga0501044_0138564_608_1552 | 314 |
| 403 | 3300049823 | Ga0501044_0223236 | Ga0501044_0223236_291_1235 | 314 |
| 404 | 3300049823 | Ga0501044_0240445 | Ga0501044_0240445_409_1353 | 314 |
| 405 | 3300049823 | Ga0501044_0565022 | Ga0501044_0565022_47_991 | 314 |
| 406 | 3300049824 | Ga0501045_0024317 | Ga0501045_0024317_104_1048 | 314 |
| 407 | 3300054114 | Ga0501084_0005438 | Ga0501084_0005438_7104_8048 | 314 |
| 408 | 3300060353 | Ga0501082_0018483 | Ga0501082_0018483_2874_3818 | 314 |
| 409 | iso_pu_bacteria | 2842038055 | 2842041781 | 314 |
| 410 | iso_pu_bacteria | 2842045827 | 2842049823 | 314 |
| 411 | iso_pu_bacteria | 2847930680 | 2847932075 | 314 |
| 412 | iso_pu_bacteria | 2879083081 | 2879085750 | 314 |
| 413 | iso_pu_bacteria | 2906643746 | 2906650128 | 314 |
| 414 | 3300001979 | JGI24740J21852_10010307 | JGI24740J21852_100103073 | 315 |
| 415 | 3300001989 | JGI24739J22299_10060499 | JGI24739J22299_100604991 | 315 |
| 416 | 3300003215 | JGI25153J46596_10002224 | JGI25153J46596_100022249 | 315 |
| 417 | 3300003215 | JGI25153J46596_10006933 | JGI25153J46596_100069331 | 315 |
| 418 | 3300003215 | JGI25153J46596_10007072 | JGI25153J46596_100070721 | 315 |
| 419 | 3300003215 | JGI25153J46596_10024593 | JGI25153J46596_100245932 | 315 |
| 420 | 3300003659 | JGI25404J52841_10002320 | JGI25404J52841_100023203 | 315 |
| 421 | 3300003775 | Ga0055524_1016148 | Ga0055524_10161482 | 315 |
| 422 | 3300003794 | Ga0055531_10009477 | Ga0055531_100094772 | 315 |
| 423 | 3300005262 | Ga0065165_1002792 | Ga0065165_10027929 | 315 |
| 424 | 3300005262 | Ga0065165_1003284 | Ga0065165_10032844 | 315 |
| 425 | 3300005262 | Ga0065165_1021603 | Ga0065165_10216032 | 315 |
| 426 | 3300005327 | Ga0070658_10114808 | Ga0070658_101148082 | 315 |
| 427 | 3300005329 | Ga0070683_100048202 | Ga0070683_1000482021 | 315 |
| 428 | 3300005329 | Ga0070683_100074217 | Ga0070683_1000742173 | 315 |
| 429 | 3300005331 | Ga0070670_100041202 | Ga0070670_1000412025 | 315 |
| 430 | 3300005336 | Ga0070680_100081738 | Ga0070680_1000817382 | 315 |
| 431 | 3300005336 | Ga0070680_100186943 | Ga0070680_1001869431 | 315 |
| 432 | 3300005336 | Ga0070680_100456634 | Ga0070680_1004566341 | 315 |
| 433 | 3300005337 | Ga0070682_100073402 | Ga0070682_1000734022 | 315 |
| 434 | 3300005338 | Ga0068868_100017996 | Ga0068868_1000179964 | 315 |
| 435 | 3300005338 | Ga0068868_100059948 | Ga0068868_1000599484 | 315 |
| 436 | 3300005338 | Ga0068868_100326312 | Ga0068868_1003263121 | 315 |
| 437 | 3300005339 | Ga0070660_100030247 | Ga0070660_1000302474 | 315 |
| 438 | 3300005340 | Ga0070689_100330612 | Ga0070689_1003306121 | 315 |
| 439 | 3300005344 | Ga0070661_100154164 | Ga0070661_1001541642 | 315 |
| 440 | 3300005344 | Ga0070661_100210998 | Ga0070661_1002109982 | 315 |
| 441 | 3300005347 | Ga0070668_100020491 | Ga0070668_1000204914 | 315 |
| 442 | 3300005347 | Ga0070668_100154139 | Ga0070668_1001541392 | 315 |
| 443 | 3300005355 | Ga0070671_100101143 | Ga0070671_1001011432 | 315 |
| 444 | 3300005356 | Ga0070674_100060947 | Ga0070674_1000609472 | 315 |
| 445 | 3300005356 | Ga0070674_100229679 | Ga0070674_1002296792 | 315 |
| 446 | 3300005367 | Ga0070667_100225702 | Ga0070667_1002257022 | 315 |
| 447 | 3300005434 | Ga0070709_10000796 | Ga0070709_100007969 | 315 |
| 448 | 3300005434 | Ga0070709_10001261 | Ga0070709_100012615 | 315 |
| 449 | 3300005434 | Ga0070709_10007358 | Ga0070709_100073585 | 315 |
| 450 | 3300005434 | Ga0070709_10010265 | Ga0070709_100102653 | 315 |
| 451 | 3300005434 | Ga0070709_10042951 | Ga0070709_100429513 | 315 |
| 452 | 3300005434 | Ga0070709_10129874 | Ga0070709_101298742 | 315 |
| 453 | 3300005435 | Ga0070714_100028362 | Ga0070714_1000283622 | 315 |
| 454 | 3300005435 | Ga0070714_100131457 | Ga0070714_1001314572 | 315 |
| 455 | 3300005436 | Ga0070713_100004513 | Ga0070713_1000045135 | 315 |
| 456 | 3300005436 | Ga0070713_100024796 | Ga0070713_1000247962 | 315 |
| 457 | 3300005436 | Ga0070713_100114641 | Ga0070713_1001146411 | 315 |
| 458 | 3300005436 | Ga0070713_100114913 | Ga0070713_1001149133 | 315 |
| 459 | 3300005436 | Ga0070713_100155528 | Ga0070713_1001555282 | 315 |
| 460 | 3300005437 | Ga0070710_10000991 | Ga0070710_100009915 | 315 |
| 461 | 3300005439 | Ga0070711_100005239 | Ga0070711_1000052395 | 315 |
| 462 | 3300005439 | Ga0070711_100006676 | Ga0070711_1000066767 | 315 |
| 463 | 3300005439 | Ga0070711_100008277 | Ga0070711_1000082772 | 315 |
| 464 | 3300005440 | Ga0070705_100137382 | Ga0070705_1001373821 | 315 |
| 465 | 3300005441 | Ga0070700_100032431 | Ga0070700_1000324313 | 315 |
| 466 | 3300005444 | Ga0070694_100279741 | Ga0070694_1002797411 | 315 |
| 467 | 3300005455 | Ga0070663_100021710 | Ga0070663_1000217104 | 315 |
| 468 | 3300005455 | Ga0070663_100027837 | Ga0070663_1000278373 | 315 |
| 469 | 3300005455 | Ga0070663_100043121 | Ga0070663_1000431212 | 315 |
| 470 | 3300005455 | Ga0070663_100123124 | Ga0070663_1001231242 | 315 |
| 471 | 3300005456 | Ga0070678_100065174 | Ga0070678_1000651742 | 315 |
| 472 | 3300005456 | Ga0070678_100099892 | Ga0070678_1000998922 | 315 |
| 473 | 3300005457 | Ga0070662_100195353 | Ga0070662_1001953531 | 315 |
| 474 | 3300005458 | Ga0070681_10062271 | Ga0070681_100622713 | 315 |
| 475 | 3300005458 | Ga0070681_10163471 | Ga0070681_101634711 | 315 |
| 476 | 3300005459 | Ga0068867_100107078 | Ga0068867_1001070782 | 315 |
| 477 | 3300005467 | Ga0070706_100089246 | Ga0070706_1000892463 | 315 |
| 478 | 3300005471 | Ga0070698_100403197 | Ga0070698_1004031971 | 315 |
| 479 | 3300005518 | Ga0070699_100227522 | Ga0070699_1002275221 | 315 |
| 480 | 3300005530 | Ga0070679_100047353 | Ga0070679_1000473535 | 315 |
| 481 | 3300005530 | Ga0070679_100324799 | Ga0070679_1003247992 | 315 |
| 482 | 3300005535 | Ga0070684_100008848 | Ga0070684_1000088484 | 315 |
| 483 | 3300005535 | Ga0070684_100071224 | Ga0070684_1000712243 | 315 |
| 484 | 3300005539 | Ga0068853_100007083 | Ga0068853_1000070839 | 315 |
| 485 | 3300005539 | Ga0068853_100007085 | Ga0068853_10000708510 | 315 |
| 486 | 3300005539 | Ga0068853_100032710 | Ga0068853_1000327104 | 315 |
| 487 | 3300005548 | Ga0070665_100007326 | Ga0070665_1000073265 | 315 |
| 488 | 3300005548 | Ga0070665_100016280 | Ga0070665_1000162804 | 315 |
| 489 | 3300005548 | Ga0070665_100050261 | Ga0070665_1000502612 | 315 |
| 490 | 3300005548 | Ga0070665_100137569 | Ga0070665_1001375692 | 315 |
| 491 | 3300005548 | Ga0070665_100240889 | Ga0070665_1002408892 | 315 |
| 492 | 3300005548 | Ga0070665_100347802 | Ga0070665_1003478021 | 315 |
| 493 | 3300005563 | Ga0068855_100235778 | Ga0068855_1002357782 | 315 |
| 494 | 3300005563 | Ga0068855_100299148 | Ga0068855_1002991482 | 315 |
| 495 | 3300005564 | Ga0070664_100016211 | Ga0070664_1000162115 | 315 |
| 496 | 3300005564 | Ga0070664_100156175 | Ga0070664_1001561752 | 315 |
| 497 | 3300005577 | Ga0068857_100021428 | Ga0068857_1000214284 | 315 |
| 498 | 3300005577 | Ga0068857_100113770 | Ga0068857_1001137703 | 315 |
| 499 | 3300005577 | Ga0068857_100126040 | Ga0068857_1001260402 | 315 |
| 500 | 3300005578 | Ga0068854_100009851 | Ga0068854_1000098514 | 315 |
| 501 | 3300005578 | Ga0068854_100041116 | Ga0068854_1000411162 | 315 |
| 502 | 3300005614 | Ga0068856_100000522 | Ga0068856_10000052232 | 315 |
| 503 | 3300005614 | Ga0068856_100010527 | Ga0068856_1000105279 | 315 |
| 504 | 3300005614 | Ga0068856_100030658 | Ga0068856_1000306584 | 315 |
| 505 | 3300005615 | Ga0070702_100055555 | Ga0070702_1000555552 | 315 |
| 506 | 3300005616 | Ga0068852_100020416 | Ga0068852_1000204164 | 315 |
| 507 | 3300005616 | Ga0068852_100067275 | Ga0068852_1000672752 | 315 |
| 508 | 3300005616 | Ga0068852_100341945 | Ga0068852_1003419451 | 315 |
| 509 | 3300005617 | Ga0068859_100643876 | Ga0068859_1006438761 | 315 |
| 510 | 3300005834 | Ga0068851_10047299 | Ga0068851_100472993 | 315 |
| 511 | 3300005843 | Ga0068860_100000441 | Ga0068860_1000004415 | 315 |
| 512 | 3300005844 | Ga0068862_100156535 | Ga0068862_1001565352 | 315 |
| 513 | 3300005844 | Ga0068862_100215740 | Ga0068862_1002157402 | 315 |
| 514 | 3300005937 | Ga0081455_10000774 | Ga0081455_100007744 | 315 |
| 515 | 3300005937 | Ga0081455_10003833 | Ga0081455_100038334 | 315 |
| 516 | 3300005937 | Ga0081455_10013479 | Ga0081455_100134798 | 315 |
| 517 | 3300005937 | Ga0081455_10028784 | Ga0081455_100287843 | 315 |
| 518 | 3300005981 | Ga0081538_10029587 | Ga0081538_100295873 | 315 |
| 519 | 3300005981 | Ga0081538_10066454 | Ga0081538_100664542 | 315 |
| 520 | 3300005983 | Ga0081540_1002251 | Ga0081540_10022515 | 315 |
| 521 | 3300005983 | Ga0081540_1002343 | Ga0081540_100234310 | 315 |
| 522 | 3300005983 | Ga0081540_1003941 | Ga0081540_100394112 | 315 |
| 523 | 3300005983 | Ga0081540_1005884 | Ga0081540_10058845 | 315 |
| 524 | 3300005983 | Ga0081540_1016536 | Ga0081540_10165363 | 315 |
| 525 | 3300005983 | Ga0081540_1025221 | Ga0081540_10252213 | 315 |
| 526 | 3300005983 | Ga0081540_1026177 | Ga0081540_10261773 | 315 |
| 527 | 3300005983 | Ga0081540_1035117 | Ga0081540_10351173 | 315 |
| 528 | 3300005983 | Ga0081540_1065365 | Ga0081540_10653652 | 315 |
| 529 | 3300005983 | Ga0081540_1075776 | Ga0081540_10757761 | 315 |
| 530 | 3300005985 | Ga0081539_10001114 | Ga0081539_1000111447 | 315 |
| 531 | 3300005985 | Ga0081539_10053002 | Ga0081539_100530022 | 315 |
| 532 | 3300005985 | Ga0081539_10099924 | Ga0081539_100999242 | 315 |
| 533 | 3300005985 | Ga0081539_10109976 | Ga0081539_101099761 | 315 |
| 534 | 3300006028 | Ga0070717_10000325 | Ga0070717_1000032513 | 315 |
| 535 | 3300006028 | Ga0070717_10084579 | Ga0070717_100845792 | 315 |
| 536 | 3300006038 | Ga0075365_10011659 | Ga0075365_100116594 | 315 |
| 537 | 3300006038 | Ga0075365_10026252 | Ga0075365_100262522 | 315 |
| 538 | 3300006038 | Ga0075365_10033426 | Ga0075365_100334262 | 315 |
| 539 | 3300006038 | Ga0075365_10040469 | Ga0075365_100404692 | 315 |
| 540 | 3300006038 | Ga0075365_10060412 | Ga0075365_100604122 | 315 |
| 541 | 3300006042 | Ga0075368_10007800 | Ga0075368_100078004 | 315 |
| 542 | 3300006042 | Ga0075368_10012725 | Ga0075368_100127252 | 315 |
| 543 | 3300006042 | Ga0075368_10049183 | Ga0075368_100491832 | 315 |
| 544 | 3300006048 | Ga0075363_100001726 | Ga0075363_1000017266 | 315 |
| 545 | 3300006048 | Ga0075363_100017481 | Ga0075363_1000174813 | 315 |
| 546 | 3300006048 | Ga0075363_100088419 | Ga0075363_1000884192 | 315 |
| 547 | 3300006048 | Ga0075363_100122224 | Ga0075363_1001222241 | 315 |
| 548 | 3300006048 | Ga0075363_100176997 | Ga0075363_1001769972 | 315 |
| 549 | 3300006051 | Ga0075364_10007861 | Ga0075364_100078613 | 315 |
| 550 | 3300006051 | Ga0075364_10010966 | Ga0075364_100109663 | 315 |
| 551 | 3300006051 | Ga0075364_10022059 | Ga0075364_100220592 | 315 |
| 552 | 3300006058 | Ga0075432_10058339 | Ga0075432_100583392 | 315 |
| 553 | 3300006163 | Ga0070715_10025862 | Ga0070715_100258622 | 315 |
| 554 | 3300006163 | Ga0070715_10103424 | Ga0070715_101034242 | 315 |
| 555 | 3300006173 | Ga0070716_100001763 | Ga0070716_1000017635 | 315 |
| 556 | 3300006173 | Ga0070716_100171349 | Ga0070716_1001713492 | 315 |
| 557 | 3300006175 | Ga0070712_100044490 | Ga0070712_1000444903 | 315 |
| 558 | 3300006175 | Ga0070712_100167104 | Ga0070712_1001671042 | 315 |
| 559 | 3300006175 | Ga0070712_100284740 | Ga0070712_1002847401 | 315 |
| 560 | 3300006178 | Ga0075367_10040235 | Ga0075367_100402352 | 315 |
| 561 | 3300006178 | Ga0075367_10059339 | Ga0075367_100593392 | 315 |
| 562 | 3300006178 | Ga0075367_10075447 | Ga0075367_100754472 | 315 |
| 563 | 3300006178 | Ga0075367_10077676 | Ga0075367_100776762 | 315 |
| 564 | 3300006186 | Ga0075369_10002297 | Ga0075369_100022973 | 315 |
| 565 | 3300006186 | Ga0075369_10026891 | Ga0075369_100268912 | 315 |
| 566 | 3300006195 | Ga0075366_10006775 | Ga0075366_100067753 | 315 |
| 567 | 3300006195 | Ga0075366_10018597 | Ga0075366_100185972 | 315 |
| 568 | 3300006195 | Ga0075366_10035098 | Ga0075366_100350983 | 315 |
| 569 | 3300006237 | Ga0097621_100141141 | Ga0097621_1001411412 | 315 |
| 570 | 3300006237 | Ga0097621_100375741 | Ga0097621_1003757411 | 315 |
| 571 | 3300006237 | Ga0097621_100453462 | Ga0097621_1004534622 | 315 |
| 572 | 3300006353 | Ga0075370_10017731 | Ga0075370_100177312 | 315 |
| 573 | 3300006353 | Ga0075370_10047609 | Ga0075370_100476092 | 315 |
| 574 | 3300006353 | Ga0075370_10047964 | Ga0075370_100479642 | 315 |
| 575 | 3300006353 | Ga0075370_10080144 | Ga0075370_100801442 | 315 |
| 576 | 3300006844 | Ga0075428_100023204 | Ga0075428_1000232045 | 315 |
| 577 | 3300006846 | Ga0075430_100382451 | Ga0075430_1003824511 | 315 |
| 578 | 3300006847 | Ga0075431_100029253 | Ga0075431_1000292535 | 315 |
| 579 | 3300006871 | Ga0075434_100020473 | Ga0075434_1000204735 | 315 |
| 580 | 3300006871 | Ga0075434_100050474 | Ga0075434_1000504742 | 315 |
| 581 | 3300006871 | Ga0075434_100074720 | Ga0075434_1000747203 | 315 |
| 582 | 3300006881 | Ga0068865_100150267 | Ga0068865_1001502672 | 315 |
| 583 | 3300006931 | Ga0097620_100643933 | Ga0097620_1006439331 | 315 |
| 584 | 3300006941 | Ga0099825_1019128 | Ga0099825_10191281 | 315 |
| 585 | 3300006942 | Ga0099824_1005278 | Ga0099824_10052784 | 315 |
| 586 | 3300006942 | Ga0099824_1017855 | Ga0099824_10178553 | 315 |
| 587 | 3300006943 | Ga0099822_1013722 | Ga0099822_10137229 | 315 |
| 588 | 3300007265 | Ga0099794_10009088 | Ga0099794_100090882 | 315 |
| 589 | 3300007788 | Ga0099795_10000836 | Ga0099795_100008364 | 315 |
| 590 | 3300007788 | Ga0099795_10024305 | Ga0099795_100243052 | 315 |
| 591 | 3300007788 | Ga0099795_10034455 | Ga0099795_100344551 | 315 |
| 592 | 3300009093 | Ga0105240_10002968 | Ga0105240_100029685 | 315 |
| 593 | 3300009093 | Ga0105240_10017804 | Ga0105240_100178048 | 315 |
| 594 | 3300009093 | Ga0105240_10021771 | Ga0105240_100217718 | 315 |
| 595 | 3300009093 | Ga0105240_10033109 | Ga0105240_100331094 | 315 |
| 596 | 3300009093 | Ga0105240_10076367 | Ga0105240_100763672 | 315 |
| 597 | 3300009093 | Ga0105240_10146029 | Ga0105240_101460293 | 315 |
| 598 | 3300009093 | Ga0105240_10463304 | Ga0105240_104633042 | 315 |
| 599 | 3300009093 | Ga0105240_10477187 | Ga0105240_104771872 | 315 |
| 600 | 3300009093 | Ga0105240_10547751 | Ga0105240_105477511 | 315 |
| 601 | 3300009093 | Ga0105240_10644663 | Ga0105240_106446631 | 315 |
| 602 | 3300009094 | Ga0111539_10333654 | Ga0111539_103336542 | 315 |
| 603 | 3300009098 | Ga0105245_10011836 | Ga0105245_100118362 | 315 |
| 604 | 3300009098 | Ga0105245_10024933 | Ga0105245_100249331 | 315 |
| 605 | 3300009098 | Ga0105245_10030674 | Ga0105245_100306744 | 315 |
| 606 | 3300009098 | Ga0105245_10551186 | Ga0105245_105511861 | 315 |
| 607 | 3300009101 | Ga0105247_10135573 | Ga0105247_101355732 | 315 |
| 608 | 3300009147 | Ga0114129_10228379 | Ga0114129_102283792 | 315 |
| 609 | 3300009148 | Ga0105243_10424563 | Ga0105243_104245631 | 315 |
| 610 | 3300009174 | Ga0105241_10001388 | Ga0105241_1000138815 | 315 |
| 611 | 3300009174 | Ga0105241_10227892 | Ga0105241_102278921 | 315 |
| 612 | 3300009176 | Ga0105242_10179201 | Ga0105242_101792012 | 315 |
| 613 | 3300009177 | Ga0105248_10044195 | Ga0105248_100441953 | 315 |
| 614 | 3300009177 | Ga0105248_10264975 | Ga0105248_102649752 | 315 |
| 615 | 3300009177 | Ga0105248_10459244 | Ga0105248_104592441 | 315 |
| 616 | 3300009545 | Ga0105237_10009401 | Ga0105237_100094012 | 315 |
| 617 | 3300009545 | Ga0105237_10018051 | Ga0105237_100180513 | 315 |
| 618 | 3300009545 | Ga0105237_10019256 | Ga0105237_100192565 | 315 |
| 619 | 3300009545 | Ga0105237_10029341 | Ga0105237_100293414 | 315 |
| 620 | 3300009545 | Ga0105237_10063125 | Ga0105237_100631254 | 315 |
| 621 | 3300009545 | Ga0105237_10081504 | Ga0105237_100815043 | 315 |
| 622 | 3300009545 | Ga0105237_10117726 | Ga0105237_101177262 | 315 |
| 623 | 3300009545 | Ga0105237_10121493 | Ga0105237_101214932 | 315 |
| 624 | 3300009545 | Ga0105237_10219525 | Ga0105237_102195252 | 315 |
| 625 | 3300009545 | Ga0105237_10279682 | Ga0105237_102796822 | 315 |
| 626 | 3300009545 | Ga0105237_10302610 | Ga0105237_103026101 | 315 |
| 627 | 3300009545 | Ga0105237_10330910 | Ga0105237_103309102 | 315 |
| 628 | 3300009551 | Ga0105238_10007201 | Ga0105238_1000720114 | 315 |
| 629 | 3300009551 | Ga0105238_10025146 | Ga0105238_100251465 | 315 |
| 630 | 3300009551 | Ga0105238_10028995 | Ga0105238_100289954 | 315 |
| 631 | 3300009551 | Ga0105238_10083975 | Ga0105238_100839753 | 315 |
| 632 | 3300009551 | Ga0105238_10134821 | Ga0105238_101348212 | 315 |
| 633 | 3300009551 | Ga0105238_10140056 | Ga0105238_101400563 | 315 |
| 634 | 3300009553 | Ga0105249_10161283 | Ga0105249_101612832 | 315 |
| 635 | 3300010159 | Ga0099796_10000143 | Ga0099796_100001439 | 315 |
| 636 | 3300010159 | Ga0099796_10014081 | Ga0099796_100140811 | 315 |
| 637 | 3300010159 | Ga0099796_10049573 | Ga0099796_100495732 | 315 |
| 638 | 3300010375 | Ga0105239_10026237 | Ga0105239_100262372 | 315 |
| 639 | 3300010375 | Ga0105239_10054242 | Ga0105239_100542424 | 315 |
| 640 | 3300010375 | Ga0105239_10075076 | Ga0105239_100750762 | 315 |
| 641 | 3300010375 | Ga0105239_10108752 | Ga0105239_101087522 | 315 |
| 642 | 3300010375 | Ga0105239_10129571 | Ga0105239_101295712 | 315 |
| 643 | 3300010375 | Ga0105239_10132265 | Ga0105239_101322651 | 315 |
| 644 | 3300010375 | Ga0105239_10745374 | Ga0105239_107453741 | 315 |
| 645 | 3300013104 | Ga0157370_10120699 | Ga0157370_101206993 | 315 |
| 646 | 3300013105 | Ga0157369_10011069 | Ga0157369_100110697 | 315 |
| 647 | 3300013105 | Ga0157369_10022494 | Ga0157369_100224944 | 315 |
| 648 | 3300013105 | Ga0157369_10085496 | Ga0157369_100854963 | 315 |
| 649 | 3300013296 | Ga0157374_10025945 | Ga0157374_100259452 | 315 |
| 650 | 3300013296 | Ga0157374_10348201 | Ga0157374_103482011 | 315 |
| 651 | 3300013297 | Ga0157378_10019128 | Ga0157378_100191282 | 315 |
| 652 | 3300013306 | Ga0163162_10020858 | Ga0163162_100208584 | 315 |
| 653 | 3300013307 | Ga0157372_10050306 | Ga0157372_100503062 | 315 |
| 654 | 3300013307 | Ga0157372_10680296 | Ga0157372_106802961 | 315 |
| 655 | 3300013308 | Ga0157375_10016660 | Ga0157375_100166605 | 315 |
| 656 | 3300014325 | Ga0163163_10063284 | Ga0163163_100632841 | 315 |
| 657 | 3300014325 | Ga0163163_10067838 | Ga0163163_100678382 | 315 |
| 658 | 3300014325 | Ga0163163_10110804 | Ga0163163_101108043 | 315 |
| 659 | 3300014325 | Ga0163163_10115145 | Ga0163163_101151453 | 315 |
| 660 | 3300014325 | Ga0163163_10196568 | Ga0163163_101965682 | 315 |
| 661 | 3300014326 | Ga0157380_10212424 | Ga0157380_102124243 | 315 |
| 662 | 3300014745 | Ga0157377_10133442 | Ga0157377_101334422 | 315 |
| 663 | 3300014968 | Ga0157379_10012889 | Ga0157379_100128897 | 315 |
| 664 | 3300014968 | Ga0157379_10129426 | Ga0157379_101294263 | 315 |
| 665 | 3300014968 | Ga0157379_10263968 | Ga0157379_102639682 | 315 |
| 666 | 3300014969 | Ga0157376_10008369 | Ga0157376_100083695 | 315 |
| 667 | 3300017792 | Ga0163161_10113270 | Ga0163161_101132702 | 315 |
| 668 | 3300020082 | Ga0206353_10807201 | Ga0206353_108072013 | 315 |
| 669 | 3300021320 | Ga0214544_1000011 | Ga0214544_100001156 | 315 |
| 670 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009186 | 315 |
| 671 | 3300021324 | Ga0214545_1000007 | Ga0214545_100000756 | 315 |
| 672 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020186 | 315 |
| 673 | 3300021384 | Ga0213876_10008681 | Ga0213876_100086814 | 315 |
| 674 | 3300025230 | Ga0209563_103763 | Ga0209563_1037632 | 315 |
| 675 | 3300025245 | Ga0207425_1007458 | Ga0207425_10074583 | 315 |
| 676 | 3300025253 | Ga0209677_103733 | Ga0209677_1037332 | 315 |
| 677 | 3300025254 | Ga0209148_1000316 | Ga0209148_100031661 | 315 |
| 678 | 3300025254 | Ga0209148_1007100 | Ga0209148_10071003 | 315 |
| 679 | 3300025261 | Ga0209233_1016979 | Ga0209233_10169791 | 315 |
| 680 | 3300025272 | Ga0209455_1006070 | Ga0209455_10060702 | 315 |
| 681 | 3300025295 | Ga0209564_1000407 | Ga0209564_10004076 | 315 |
| 682 | 3300025295 | Ga0209564_1002075 | Ga0209564_10020759 | 315 |
| 683 | 3300025295 | Ga0209564_1005161 | Ga0209564_10051614 | 315 |
| 684 | 3300025295 | Ga0209564_1023569 | Ga0209564_10235691 | 315 |
| 685 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106128 | 315 |
| 686 | 3300025297 | Ga0209758_1001012 | Ga0209758_10010125 | 315 |
| 687 | 3300025297 | Ga0209758_1001683 | Ga0209758_100168321 | 315 |
| 688 | 3300025297 | Ga0209758_1002332 | Ga0209758_100233219 | 315 |
| 689 | 3300025297 | Ga0209758_1002396 | Ga0209758_100239611 | 315 |
| 690 | 3300025297 | Ga0209758_1003816 | Ga0209758_10038168 | 315 |
| 691 | 3300025297 | Ga0209758_1007915 | Ga0209758_10079153 | 315 |
| 692 | 3300025297 | Ga0209758_1014959 | Ga0209758_10149592 | 315 |
| 693 | 3300025297 | Ga0209758_1029030 | Ga0209758_10290302 | 315 |
| 694 | 3300025297 | Ga0209758_1037061 | Ga0209758_10370612 | 315 |
| 695 | 3300025299 | Ga0209256_1002946 | Ga0209256_10029463 | 315 |
| 696 | 3300025302 | Ga0207426_1000374 | Ga0207426_10003745 | 315 |
| 697 | 3300025302 | Ga0207426_1001007 | Ga0207426_10010075 | 315 |
| 698 | 3300025302 | Ga0207426_1004033 | Ga0207426_10040335 | 315 |
| 699 | 3300025304 | Ga0209257_1001741 | Ga0209257_100174119 | 315 |
| 700 | 3300025898 | Ga0207692_10005299 | Ga0207692_100052994 | 315 |
| 701 | 3300025900 | Ga0207710_10086053 | Ga0207710_100860532 | 315 |
| 702 | 3300025901 | Ga0207688_10204097 | Ga0207688_102040972 | 315 |
| 703 | 3300025903 | Ga0207680_10221195 | Ga0207680_102211952 | 315 |
| 704 | 3300025904 | Ga0207647_10000972 | Ga0207647_1000097213 | 315 |
| 705 | 3300025905 | Ga0207685_10018879 | Ga0207685_100188792 | 315 |
| 706 | 3300025905 | Ga0207685_10077029 | Ga0207685_100770292 | 315 |
| 707 | 3300025906 | Ga0207699_10000363 | Ga0207699_100003635 | 315 |
| 708 | 3300025906 | Ga0207699_10002914 | Ga0207699_100029144 | 315 |
| 709 | 3300025906 | Ga0207699_10041739 | Ga0207699_100417392 | 315 |
| 710 | 3300025906 | Ga0207699_10082273 | Ga0207699_100822733 | 315 |
| 711 | 3300025907 | Ga0207645_10192206 | Ga0207645_101922062 | 315 |
| 712 | 3300025907 | Ga0207645_10265271 | Ga0207645_102652711 | 315 |
| 713 | 3300025909 | Ga0207705_10075543 | Ga0207705_100755432 | 315 |
| 714 | 3300025909 | Ga0207705_10194066 | Ga0207705_101940662 | 315 |
| 715 | 3300025910 | Ga0207684_10174378 | Ga0207684_101743782 | 315 |
| 716 | 3300025911 | Ga0207654_10000729 | Ga0207654_100007297 | 315 |
| 717 | 3300025911 | Ga0207654_10028175 | Ga0207654_100281753 | 315 |
| 718 | 3300025911 | Ga0207654_10030934 | Ga0207654_100309341 | 315 |
| 719 | 3300025912 | Ga0207707_10000541 | Ga0207707_1000054131 | 315 |
| 720 | 3300025912 | Ga0207707_10050125 | Ga0207707_100501252 | 315 |
| 721 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047844 | 315 |
| 722 | 3300025913 | Ga0207695_10004497 | Ga0207695_100044974 | 315 |
| 723 | 3300025913 | Ga0207695_10017775 | Ga0207695_100177754 | 315 |
| 724 | 3300025913 | Ga0207695_10024109 | Ga0207695_100241095 | 315 |
| 725 | 3300025913 | Ga0207695_10191850 | Ga0207695_101918502 | 315 |
| 726 | 3300025914 | Ga0207671_10003084 | Ga0207671_100030843 | 315 |
| 727 | 3300025914 | Ga0207671_10133861 | Ga0207671_101338611 | 315 |
| 728 | 3300025914 | Ga0207671_10151954 | Ga0207671_101519542 | 315 |
| 729 | 3300025914 | Ga0207671_10184623 | Ga0207671_101846232 | 315 |
| 730 | 3300025915 | Ga0207693_10005512 | Ga0207693_100055124 | 315 |
| 731 | 3300025915 | Ga0207693_10008188 | Ga0207693_100081885 | 315 |
| 732 | 3300025915 | Ga0207693_10020448 | Ga0207693_100204482 | 315 |
| 733 | 3300025915 | Ga0207693_10024640 | Ga0207693_100246402 | 315 |
| 734 | 3300025915 | Ga0207693_10076040 | Ga0207693_100760403 | 315 |
| 735 | 3300025916 | Ga0207663_10000425 | Ga0207663_100004258 | 315 |
| 736 | 3300025916 | Ga0207663_10031078 | Ga0207663_100310782 | 315 |
| 737 | 3300025916 | Ga0207663_10038050 | Ga0207663_100380503 | 315 |
| 738 | 3300025916 | Ga0207663_10069893 | Ga0207663_100698931 | 315 |
| 739 | 3300025917 | Ga0207660_10009028 | Ga0207660_100090284 | 315 |
| 740 | 3300025919 | Ga0207657_10002950 | Ga0207657_1000295018 | 315 |
| 741 | 3300025919 | Ga0207657_10029326 | Ga0207657_100293263 | 315 |
| 742 | 3300025919 | Ga0207657_10080145 | Ga0207657_100801452 | 315 |
| 743 | 3300025920 | Ga0207649_10251963 | Ga0207649_102519631 | 315 |
| 744 | 3300025921 | Ga0207652_10007298 | Ga0207652_100072984 | 315 |
| 745 | 3300025921 | Ga0207652_10205326 | Ga0207652_102053261 | 315 |
| 746 | 3300025924 | Ga0207694_10000849 | Ga0207694_1000084918 | 315 |
| 747 | 3300025924 | Ga0207694_10009743 | Ga0207694_100097434 | 315 |
| 748 | 3300025924 | Ga0207694_10049921 | Ga0207694_100499214 | 315 |
| 749 | 3300025924 | Ga0207694_10103254 | Ga0207694_101032542 | 315 |
| 750 | 3300025927 | Ga0207687_10106472 | Ga0207687_101064723 | 315 |
| 751 | 3300025927 | Ga0207687_10125264 | Ga0207687_101252643 | 315 |
| 752 | 3300025928 | Ga0207700_10008743 | Ga0207700_100087435 | 315 |
| 753 | 3300025928 | Ga0207700_10077617 | Ga0207700_100776172 | 315 |
| 754 | 3300025928 | Ga0207700_10085514 | Ga0207700_100855142 | 315 |
| 755 | 3300025928 | Ga0207700_10095006 | Ga0207700_100950063 | 315 |
| 756 | 3300025928 | Ga0207700_10135559 | Ga0207700_101355592 | 315 |
| 757 | 3300025929 | Ga0207664_10006763 | Ga0207664_100067634 | 315 |
| 758 | 3300025929 | Ga0207664_10111058 | Ga0207664_101110582 | 315 |
| 759 | 3300025929 | Ga0207664_10209590 | Ga0207664_102095902 | 315 |
| 760 | 3300025931 | Ga0207644_10197868 | Ga0207644_101978682 | 315 |
| 761 | 3300025934 | Ga0207686_10040719 | Ga0207686_100407192 | 315 |
| 762 | 3300025935 | Ga0207709_10256227 | Ga0207709_102562271 | 315 |
| 763 | 3300025937 | Ga0207669_10339047 | Ga0207669_103390471 | 315 |
| 764 | 3300025939 | Ga0207665_10003367 | Ga0207665_100033674 | 315 |
| 765 | 3300025939 | Ga0207665_10008013 | Ga0207665_100080135 | 315 |
| 766 | 3300025939 | Ga0207665_10055096 | Ga0207665_100550962 | 315 |
| 767 | 3300025939 | Ga0207665_10186442 | Ga0207665_101864422 | 315 |
| 768 | 3300025939 | Ga0207665_10270161 | Ga0207665_102701611 | 315 |
| 769 | 3300025939 | Ga0207665_10275786 | Ga0207665_102757861 | 315 |
| 770 | 3300025940 | Ga0207691_10323914 | Ga0207691_103239142 | 315 |
| 771 | 3300025941 | Ga0207711_10061206 | Ga0207711_100612062 | 315 |
| 772 | 3300025942 | Ga0207689_10073080 | Ga0207689_100730803 | 315 |
| 773 | 3300025942 | Ga0207689_10343547 | Ga0207689_103435471 | 315 |
| 774 | 3300025944 | Ga0207661_10000109 | Ga0207661_1000010912 | 315 |
| 775 | 3300025944 | Ga0207661_10029282 | Ga0207661_100292823 | 315 |
| 776 | 3300025944 | Ga0207661_10035452 | Ga0207661_100354523 | 315 |
| 777 | 3300025949 | Ga0207667_10003413 | Ga0207667_100034137 | 315 |
| 778 | 3300025949 | Ga0207667_10090006 | Ga0207667_100900062 | 315 |
| 779 | 3300025949 | Ga0207667_10139182 | Ga0207667_101391823 | 315 |
| 780 | 3300025949 | Ga0207667_10193729 | Ga0207667_101937292 | 315 |
| 781 | 3300025960 | Ga0207651_10229428 | Ga0207651_102294281 | 315 |
| 782 | 3300025961 | Ga0207712_10162993 | Ga0207712_101629932 | 315 |
| 783 | 3300025972 | Ga0207668_10070947 | Ga0207668_100709473 | 315 |
| 784 | 3300025981 | Ga0207640_10039426 | Ga0207640_100394263 | 315 |
| 785 | 3300025981 | Ga0207640_10101239 | Ga0207640_101012392 | 315 |
| 786 | 3300025981 | Ga0207640_10206678 | Ga0207640_102066782 | 315 |
| 787 | 3300025981 | Ga0207640_10272708 | Ga0207640_102727082 | 315 |
| 788 | 3300025986 | Ga0207658_10150905 | Ga0207658_101509052 | 315 |
| 789 | 3300025986 | Ga0207658_10280329 | Ga0207658_102803291 | 315 |
| 790 | 3300026023 | Ga0207677_10008230 | Ga0207677_100082304 | 315 |
| 791 | 3300026023 | Ga0207677_10011875 | Ga0207677_100118753 | 315 |
| 792 | 3300026023 | Ga0207677_10023110 | Ga0207677_100231103 | 315 |
| 793 | 3300026023 | Ga0207677_10453452 | Ga0207677_104534521 | 315 |
| 794 | 3300026041 | Ga0207639_10025543 | Ga0207639_100255434 | 315 |
| 795 | 3300026041 | Ga0207639_10188415 | Ga0207639_101884152 | 315 |
| 796 | 3300026041 | Ga0207639_10418632 | Ga0207639_104186322 | 315 |
| 797 | 3300026067 | Ga0207678_10006080 | Ga0207678_100060808 | 315 |
| 798 | 3300026067 | Ga0207678_10025278 | Ga0207678_100252782 | 315 |
| 799 | 3300026067 | Ga0207678_10035705 | Ga0207678_100357053 | 315 |
| 800 | 3300026067 | Ga0207678_10106641 | Ga0207678_101066413 | 315 |
| 801 | 3300026075 | Ga0207708_10117190 | Ga0207708_101171902 | 315 |
| 802 | 3300026078 | Ga0207702_10000003 | Ga0207702_1000000355 | 315 |
| 803 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014230 | 315 |
| 804 | 3300026078 | Ga0207702_10059058 | Ga0207702_100590583 | 315 |
| 805 | 3300026078 | Ga0207702_10108328 | Ga0207702_101083283 | 315 |
| 806 | 3300026088 | Ga0207641_10519200 | Ga0207641_105192001 | 315 |
| 807 | 3300026089 | Ga0207648_10011805 | Ga0207648_100118051 | 315 |
| 808 | 3300026089 | Ga0207648_10074325 | Ga0207648_100743253 | 315 |
| 809 | 3300026095 | Ga0207676_10104985 | Ga0207676_101049852 | 315 |
| 810 | 3300026116 | Ga0207674_10029977 | Ga0207674_100299774 | 315 |
| 811 | 3300026116 | Ga0207674_10033474 | Ga0207674_100334744 | 315 |
| 812 | 3300026116 | Ga0207674_10033728 | Ga0207674_100337283 | 315 |
| 813 | 3300026116 | Ga0207674_10064316 | Ga0207674_100643163 | 315 |
| 814 | 3300026118 | Ga0207675_100049152 | Ga0207675_1000491523 | 315 |
| 815 | 3300026121 | Ga0207683_10085838 | Ga0207683_100858382 | 315 |
| 816 | 3300026121 | Ga0207683_10156685 | Ga0207683_101566852 | 315 |
| 817 | 3300026121 | Ga0207683_10186779 | Ga0207683_101867792 | 315 |
| 818 | 3300026142 | Ga0207698_10042042 | Ga0207698_100420421 | 315 |
| 819 | 3300026142 | Ga0207698_10274298 | Ga0207698_102742981 | 315 |
| 820 | 3300026142 | Ga0207698_10340597 | Ga0207698_103405972 | 315 |
| 821 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001675 | 315 |
| 822 | 3300027296 | Ga0209389_1000027 | Ga0209389_100002770 | 315 |
| 823 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005334 | 315 |
| 824 | 3300027357 | Ga0209589_1000031 | Ga0209589_100003182 | 315 |
| 825 | 3300027361 | Ga0209489_100005 | Ga0209489_100005334 | 315 |
| 826 | 3300027361 | Ga0209489_100057 | Ga0209489_10005765 | 315 |
| 827 | 3300027361 | Ga0209489_100063 | Ga0209489_10006333 | 315 |
| 828 | 3300027363 | Ga0209700_100006 | Ga0209700_100006334 | 315 |
| 829 | 3300027363 | Ga0209700_100012 | Ga0209700_10001276 | 315 |
| 830 | 3300028379 | Ga0268266_10013890 | Ga0268266_100138903 | 315 |
| 831 | 3300028379 | Ga0268266_10150134 | Ga0268266_101501342 | 315 |
| 832 | 3300028379 | Ga0268266_10239949 | Ga0268266_102399491 | 315 |
| 833 | 3300028379 | Ga0268266_10251298 | Ga0268266_102512981 | 315 |
| 834 | 3300028380 | Ga0268265_10031565 | Ga0268265_100315654 | 315 |
| 835 | 3300028380 | Ga0268265_10204273 | Ga0268265_102042732 | 315 |
| 836 | 3300028380 | Ga0268265_10287455 | Ga0268265_102874552 | 315 |
| 837 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004254 | 315 |
| 838 | 3300028556 | Ga0265337_1033706 | Ga0265337_10337062 | 315 |
| 839 | 3300028653 | Ga0265323_10004217 | Ga0265323_100042172 | 315 |
| 840 | 3300028786 | Ga0307517_10000176 | Ga0307517_1000017622 | 315 |
| 841 | 3300028794 | Ga0307515_10170151 | Ga0307515_101701513 | 315 |
| 842 | 3300028794 | Ga0307515_10170492 | Ga0307515_101704923 | 315 |
| 843 | 3300028794 | Ga0307515_10320650 | Ga0307515_103206502 | 315 |
| 844 | 3300028800 | Ga0265338_10000018 | Ga0265338_10000018298 | 315 |
| 845 | 3300030521 | Ga0307511_10109053 | Ga0307511_101090532 | 315 |
| 846 | 3300031235 | Ga0265330_10017820 | Ga0265330_100178203 | 315 |
| 847 | 3300031238 | Ga0265332_10009331 | Ga0265332_100093312 | 315 |
| 848 | 3300031241 | Ga0265325_10005802 | Ga0265325_100058024 | 315 |
| 849 | 3300031247 | Ga0265340_10001337 | Ga0265340_100013377 | 315 |
| 850 | 3300031247 | Ga0265340_10025601 | Ga0265340_100256013 | 315 |
| 851 | 3300031249 | Ga0265339_10000383 | Ga0265339_100003834 | 315 |
| 852 | 3300031250 | Ga0265331_10116621 | Ga0265331_101166211 | 315 |
| 853 | 3300031456 | Ga0307513_10198053 | Ga0307513_101980532 | 315 |
| 854 | 3300031616 | Ga0307508_10000029 | Ga0307508_10000029101 | 315 |
| 855 | 3300031616 | Ga0307508_10208833 | Ga0307508_102088331 | 315 |
| 856 | 3300031711 | Ga0265314_10006665 | Ga0265314_100066654 | 315 |
| 857 | 3300031711 | Ga0265314_10008159 | Ga0265314_100081594 | 315 |
| 858 | 3300031712 | Ga0265342_10005588 | Ga0265342_100055887 | 315 |
| 859 | 3300031730 | Ga0307516_10010558 | Ga0307516_1001055812 | 315 |
| 860 | 3300031730 | Ga0307516_10052151 | Ga0307516_100521512 | 315 |
| 861 | 3300031730 | Ga0307516_10159510 | Ga0307516_101595102 | 315 |
| 862 | 3300031730 | Ga0307516_10334755 | Ga0307516_103347551 | 315 |
| 863 | 3300031731 | Ga0307405_10126650 | Ga0307405_101266503 | 315 |
| 864 | 3300031824 | Ga0307413_10027580 | Ga0307413_100275801 | 315 |
| 865 | 3300031838 | Ga0307518_10172468 | Ga0307518_101724682 | 315 |
| 866 | 3300031903 | Ga0307407_10204728 | Ga0307407_102047282 | 315 |
| 867 | 3300031911 | Ga0307412_10317466 | Ga0307412_103174661 | 315 |
| 868 | 3300031995 | Ga0307409_100111072 | Ga0307409_1001110722 | 315 |
| 869 | 3300032004 | Ga0307414_10206054 | Ga0307414_102060542 | 315 |
| 870 | 3300032126 | Ga0307415_100059081 | Ga0307415_1000590812 | 315 |
| 871 | 3300032126 | Ga0307415_100255756 | Ga0307415_1002557561 | 315 |
| 872 | 3300033179 | Ga0307507_10018699 | Ga0307507_100186997 | 315 |
| 873 | 3300033180 | Ga0307510_10010093 | Ga0307510_100100939 | 315 |
| 874 | 3300033180 | Ga0307510_10016909 | Ga0307510_100169094 | 315 |
| 875 | 3300033180 | Ga0307510_10069235 | Ga0307510_100692352 | 315 |
| 876 | 3300033180 | Ga0307510_10092093 | Ga0307510_100920932 | 315 |
| 877 | 3300033180 | Ga0307510_10287697 | Ga0307510_102876971 | 315 |
| 878 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005297 | 315 |
| 879 | 3300033544 | Ga0316215_1002174 | Ga0316215_10021742 | 315 |
| 880 | 3300035086 | Ga0373934_0008533 | Ga0373934_0008533_2084_3031 | 315 |
| 881 | 3300035111 | Ga0373923_0000376 | Ga0373923_0000376_6181_7128 | 315 |
| 882 | 3300035113 | Ga0373936_0042953 | Ga0373936_0042953_778_1725 | 315 |
| 883 | 3300035113 | Ga0373936_0045036 | Ga0373936_0045036_668_1615 | 315 |
| 884 | 3300035116 | Ga0373945_0013564 | Ga0373945_0013564_747_1694 | 315 |
| 885 | 3300035117 | Ga0373953_0000156 | Ga0373953_0000156_8880_9827 | 315 |
| 886 | 3300035117 | Ga0373953_0008171 | Ga0373953_0008171_676_1623 | 315 |
| 887 | 3300035118 | Ga0373954_0007578 | Ga0373954_0007578_3296_4243 | 315 |
| 888 | 3300035118 | Ga0373954_0020449 | Ga0373954_0020449_716_1663 | 315 |
| 889 | 3300035119 | Ga0373956_0002378 | Ga0373956_0002378_5242_6189 | 315 |
| 890 | 3300035119 | Ga0373956_0103597 | Ga0373956_0103597_196_1143 | 315 |
| 891 | 3300035120 | Ga0373957_0017078 | Ga0373957_0017078_603_1550 | 315 |
| 892 | 3300035120 | Ga0373957_0063987 | Ga0373957_0063987_262_1209 | 315 |
| 893 | 3300035170 | Ga0373943_0040115 | Ga0373943_0040115_486_1433 | 315 |
| 894 | 3300035170 | Ga0373943_0101959 | Ga0373943_0101959_74_1021 | 315 |
| 895 | 3300035170 | Ga0373943_0134726 | Ga0373943_0134726_26_973 | 315 |
| 896 | 3300035171 | Ga0373946_0043204 | Ga0373946_0043204_175_1122 | 315 |
| 897 | 3300035172 | Ga0373955_0000395 | Ga0373955_0000395_14618_15565 | 315 |
| 898 | 3300035172 | Ga0373955_0013079 | Ga0373955_0013079_54_1001 | 315 |
| 899 | 3300035172 | Ga0373955_0022863 | Ga0373955_0022863_867_1814 | 315 |
| 900 | 3300035242 | Ga0373962_0044677 | Ga0373962_0044677_28_975 | 315 |
| 901 | 3300035410 | Ga0373924_0010939 | Ga0373924_0010939_1853_2800 | 315 |
| 902 | 3300035410 | Ga0373924_0013913 | Ga0373924_0013913_1807_2754 | 315 |
| 903 | 3300035410 | Ga0373924_0055242 | Ga0373924_0055242_78_1025 | 315 |
| 904 | 3300035691 | Ga0373931_0018329 | Ga0373931_0018329_2277_3224 | 315 |
| 905 | 3300035692 | Ga0373935_0055538 | Ga0373935_0055538_1377_2324 | 315 |
| 906 | 3300035695 | Ga0373927_0002702 | Ga0373927_0002702_8120_9067 | 315 |
| 907 | 3300035695 | Ga0373927_0004819 | Ga0373927_0004819_7165_8112 | 315 |
| 908 | 3300035695 | Ga0373927_0005543 | Ga0373927_0005543_840_1787 | 315 |
| 909 | 3300035695 | Ga0373927_0007994 | Ga0373927_0007994_4716_5663 | 315 |
| 910 | 3300035695 | Ga0373927_0017690 | Ga0373927_0017690_1600_2547 | 315 |
| 911 | 3300035695 | Ga0373927_0043246 | Ga0373927_0043246_1712_2659 | 315 |
| 912 | 3300035724 | Ga0373933_0001227 | Ga0373933_0001227_11339_12286 | 315 |
| 913 | 3300035724 | Ga0373933_0004820 | Ga0373933_0004820_1924_2871 | 315 |
| 914 | 3300035724 | Ga0373933_0075719 | Ga0373933_0075719_172_1119 | 315 |
| 915 | 3300035724 | Ga0373933_0193597 | Ga0373933_0193597_78_1025 | 315 |
| 916 | 3300035725 | Ga0373947_0003219 | Ga0373947_0003219_823_1770 | 315 |
| 917 | 3300035725 | Ga0373947_0006770 | Ga0373947_0006770_3047_3994 | 315 |
| 918 | 3300035725 | Ga0373947_0044253 | Ga0373947_0044253_535_1482 | 315 |
| 919 | 3300035725 | Ga0373947_0050934 | Ga0373947_0050934_1073_2020 | 315 |
| 920 | 3300036401 | Ga0373937_0053490 | Ga0373937_0053490_174_1121 | 315 |
| 921 | 3300036401 | Ga0373937_0096791 | Ga0373937_0096791_1757_2704 | 315 |
| 922 | 3300036401 | Ga0373937_0128821 | Ga0373937_0128821_973_1920 | 315 |
| 923 | 3300036459 | Ga0372808_002595 | Ga0372808_002595_1032_1979 | 315 |
| 924 | 3300037068 | Ga0373925_0009475 | Ga0373925_0009475_3386_4333 | 315 |
| 925 | 3300037068 | Ga0373925_0042948 | Ga0373925_0042948_1030_1977 | 315 |
| 926 | 3300037068 | Ga0373925_0053938 | Ga0373925_0053938_1896_2843 | 315 |
| 927 | 3300037068 | Ga0373925_0055671 | Ga0373925_0055671_507_1454 | 315 |
| 928 | 3300037068 | Ga0373925_0099706 | Ga0373925_0099706_181_1128 | 315 |
| 929 | 3300037312 | Ga0395899_0076124 | Ga0395899_0076124_49_996 | 315 |
| 930 | 3300037418 | Ga0395900_0102016 | Ga0395900_0102016_1596_2543 | 315 |
| 931 | 3300037418 | Ga0395900_0216970 | Ga0395900_0216970_299_1246 | 315 |
| 932 | 3300037418 | Ga0395900_0229693 | Ga0395900_0229693_579_1526 | 315 |
| 933 | 3300037418 | Ga0395900_0272758 | Ga0395900_0272758_73_1020 | 315 |
| 934 | 3300037466 | Ga0395898_0017601 | Ga0395898_0017601_1536_2483 | 315 |
| 935 | 3300037466 | Ga0395898_0028587 | Ga0395898_0028587_3038_3985 | 315 |
| 936 | 3300037466 | Ga0395898_0088505 | Ga0395898_0088505_133_1080 | 315 |
| 937 | 3300037466 | Ga0395898_0152606 | Ga0395898_0152606_486_1433 | 315 |
| 938 | 3300037471 | Ga0395905_0020329 | Ga0395905_0020329_3154_4101 | 315 |
| 939 | 3300037471 | Ga0395905_0046809 | Ga0395905_0046809_2985_3932 | 315 |
| 940 | 3300037853 | Ga0436364_0974159 | Ga0436364_0974159_13052_14110 | 315 |
| 941 | 3300038443 | Ga0395901_0230018 | Ga0395901_0230018_898_1845 | 315 |
| 942 | 3300038443 | Ga0395901_0248432 | Ga0395901_0248432_694_1641 | 315 |
| 943 | 3300038443 | Ga0395901_0305113 | Ga0395901_0305113_91_1038 | 315 |
| 944 | 3300039437 | Ga0436365_0902375 | Ga0436365_0902375_1955_2902 | 315 |
| 945 | 3300039437 | Ga0436365_1181574 | Ga0436365_1181574_229_1176 | 315 |
| 946 | 3300039437 | Ga0436365_1371184 | Ga0436365_1371184_3380_4327 | 315 |
| 947 | 3300039437 | Ga0436365_1421230 | Ga0436365_1421230_128_1075 | 315 |
| 948 | 3300039438 | Ga0436360_1202522 | Ga0436360_1202522_106_1053 | 315 |
| 949 | 3300039447 | Ga0436361_0189402 | Ga0436361_0189402_164_1111 | 315 |
| 950 | 3300039450 | Ga0436363_0012099 | Ga0436363_0012099_2451_3398 | 315 |
| 951 | 3300039450 | Ga0436363_0300253 | Ga0436363_0300253_238_1185 | 315 |
| 952 | 3300039450 | Ga0436363_0351383 | Ga0436363_0351383_97_1044 | 315 |
| 953 | 3300039450 | Ga0436363_0717611 | Ga0436363_0717611_84_1031 | 315 |
| 954 | 3300039450 | Ga0436363_0972840 | Ga0436363_0972840_312_1259 | 315 |
| 955 | 3300039453 | Ga0436362_0993687 | Ga0436362_0993687_212_1159 | 315 |
| 956 | 3300042438 | Ga0439459_0027711 | Ga0439459_0027711_93_1040 | 315 |
| 957 | 3300044658 | Ga0466972_0000177 | Ga0466972_0000177_21508_22455 | 315 |
| 958 | 3300044658 | Ga0466972_0009169 | Ga0466972_0009169_597_1544 | 315 |
| 959 | 3300044683 | Ga0466965_0060131 | Ga0466965_0060131_13_960 | 315 |
| 960 | 3300044684 | Ga0466966_0008326 | Ga0466966_0008326_2881_3828 | 315 |
| 961 | 3300044684 | Ga0466966_0112238 | Ga0466966_0112238_230_1177 | 315 |
| 962 | 3300044684 | Ga0466966_0127871 | Ga0466966_0127871_61_1008 | 315 |
| 963 | 3300044693 | Ga0466961_0000023 | Ga0466961_0000023_91542_92489 | 315 |
| 964 | 3300044694 | Ga0466963_0139531 | Ga0466963_0139531_566_1513 | 315 |
| 965 | 3300044694 | Ga0466963_0248798 | Ga0466963_0248798_124_1071 | 315 |
| 966 | 3300044719 | Ga0466971_0050539 | Ga0466971_0050539_887_1834 | 315 |
| 967 | 3300044735 | Ga0466968_0001025 | Ga0466968_0001025_1628_2575 | 315 |
| 968 | 3300044735 | Ga0466968_0063853 | Ga0466968_0063853_33_980 | 315 |
| 969 | 3300044842 | Ga0466957_0042855 | Ga0466957_0042855_1270_2217 | 315 |
| 970 | 3300044901 | Ga0466960_0039020 | Ga0466960_0039020_594_1541 | 315 |
| 971 | 3300045049 | Ga0466959_0011640 | Ga0466959_0011640_3465_4412 | 315 |
| 972 | 3300045049 | Ga0466959_0030640 | Ga0466959_0030640_1146_2093 | 315 |
| 973 | 3300045976 | Ga0466967_0055936 | Ga0466967_0055936_863_1810 | 315 |
| 974 | 3300045976 | Ga0466967_0121122 | Ga0466967_0121122_1418_2365 | 315 |
| 975 | 3300045976 | Ga0466967_0184510 | Ga0466967_0184510_354_1301 | 315 |
| 976 | 3300046452 | Ga0495617_044644 | Ga0495617_044644_95_1042 | 315 |
| 977 | 3300046454 | Ga0495592_0014358 | Ga0495592_0014358_2008_2955 | 315 |
| 978 | 3300046454 | Ga0495592_0030040 | Ga0495592_0030040_2191_3138 | 315 |
| 979 | 3300046454 | Ga0495592_0041543 | Ga0495592_0041543_1897_2844 | 315 |
| 980 | 3300046454 | Ga0495592_0064793 | Ga0495592_0064793_132_1079 | 315 |
| 981 | 3300046455 | Ga0495603_0000521 | Ga0495603_0000521_15014_15961 | 315 |
| 982 | 3300046455 | Ga0495603_0008860 | Ga0495603_0008860_2212_3159 | 315 |
| 983 | 3300046455 | Ga0495603_0025504 | Ga0495603_0025504_331_1278 | 315 |
| 984 | 3300046455 | Ga0495603_0028412 | Ga0495603_0028412_2070_3017 | 315 |
| 985 | 3300046455 | Ga0495603_0029577 | Ga0495603_0029577_70_1017 | 315 |
| 986 | 3300046455 | Ga0495603_0051688 | Ga0495603_0051688_786_1733 | 315 |
| 987 | 3300046459 | Ga0495629_0000416 | Ga0495629_0000416_25505_26452 | 315 |
| 988 | 3300046459 | Ga0495629_0015774 | Ga0495629_0015774_1796_2743 | 315 |
| 989 | 3300046459 | Ga0495629_0027646 | Ga0495629_0027646_1761_2708 | 315 |
| 990 | 3300046459 | Ga0495629_0032989 | Ga0495629_0032989_1118_2065 | 315 |
| 991 | 3300046459 | Ga0495629_0252456 | Ga0495629_0252456_204_1151 | 315 |
| 992 | 3300046460 | Ga0495638_0038240 | Ga0495638_0038240_82_1029 | 315 |
| 993 | 3300046460 | Ga0495638_0182674 | Ga0495638_0182674_193_1140 | 315 |
| 994 | 3300046461 | Ga0495641_0002593 | Ga0495641_0002593_5075_6022 | 315 |
| 995 | 3300046461 | Ga0495641_0140642 | Ga0495641_0140642_14_961 | 315 |
| 996 | 3300046462 | Ga0495651_0017227 | Ga0495651_0017227_2631_3578 | 315 |
| 997 | 3300046462 | Ga0495651_0019582 | Ga0495651_0019582_1470_2417 | 315 |
| 998 | 3300046462 | Ga0495651_0080458 | Ga0495651_0080458_1015_1962 | 315 |
| 999 | 3300046463 | Ga0495653_0003573 | Ga0495653_0003573_5924_6871 | 315 |
| 1000 | 3300046463 | Ga0495653_0023310 | Ga0495653_0023310_1926_2873 | 315 |
| 1001 | 3300046463 | Ga0495653_0210320 | Ga0495653_0210320_159_1106 | 315 |
| 1002 | 3300046471 | Ga0495650_0039141 | Ga0495650_0039141_623_1570 | 315 |
| 1003 | 3300046472 | Ga0495580_0016728 | Ga0495580_0016728_3037_3984 | 315 |
| 1004 | 3300046472 | Ga0495580_0039257 | Ga0495580_0039257_795_1742 | 315 |
| 1005 | 3300046472 | Ga0495580_0113133 | Ga0495580_0113133_52_999 | 315 |
| 1006 | 3300046473 | Ga0495582_0002376 | Ga0495582_0002376_5504_6451 | 315 |
| 1007 | 3300046473 | Ga0495582_0070470 | Ga0495582_0070470_590_1537 | 315 |
| 1008 | 3300046473 | Ga0495582_0080684 | Ga0495582_0080684_355_1302 | 315 |
| 1009 | 3300046474 | Ga0495605_0065220 | Ga0495605_0065220_759_1706 | 315 |
| 1010 | 3300046475 | Ga0495639_0001046 | Ga0495639_0001046_2694_3641 | 315 |
| 1011 | 3300046475 | Ga0495639_0061572 | Ga0495639_0061572_29_976 | 315 |
| 1012 | 3300046475 | Ga0495639_0096435 | Ga0495639_0096435_203_1150 | 315 |
| 1013 | 3300046476 | Ga0495662_0008728 | Ga0495662_0008728_278_1225 | 315 |
| 1014 | 3300046477 | Ga0495664_0009023 | Ga0495664_0009023_1845_2792 | 315 |
| 1015 | 3300046477 | Ga0495664_0009265 | Ga0495664_0009265_2525_3472 | 315 |
| 1016 | 3300046477 | Ga0495664_0050469 | Ga0495664_0050469_296_1243 | 315 |
| 1017 | 3300046477 | Ga0495664_0125425 | Ga0495664_0125425_584_1531 | 315 |
| 1018 | 3300046477 | Ga0495664_0126090 | Ga0495664_0126090_542_1489 | 315 |
| 1019 | 3300046499 | Ga0495594_0000194 | Ga0495594_0000194_22428_23375 | 315 |
| 1020 | 3300046499 | Ga0495594_0015448 | Ga0495594_0015448_1117_2064 | 315 |
| 1021 | 3300046499 | Ga0495594_0074283 | Ga0495594_0074283_199_1146 | 315 |
| 1022 | 3300046500 | Ga0495596_0093615 | Ga0495596_0093615_154_1101 | 315 |
| 1023 | 3300046506 | Ga0495583_0028181 | Ga0495583_0028181_1113_2060 | 315 |
| 1024 | 3300046506 | Ga0495583_0061572 | Ga0495583_0061572_426_1373 | 315 |
| 1025 | 3300046507 | Ga0495606_0002692 | Ga0495606_0002692_1983_2930 | 315 |
| 1026 | 3300046507 | Ga0495606_0028857 | Ga0495606_0028857_2282_3229 | 315 |
| 1027 | 3300046507 | Ga0495606_0212094 | Ga0495606_0212094_72_1019 | 315 |
| 1028 | 3300046511 | Ga0495608_0005104 | Ga0495608_0005104_2766_3713 | 315 |
| 1029 | 3300046511 | Ga0495608_0031821 | Ga0495608_0031821_830_1777 | 315 |
| 1030 | 3300046511 | Ga0495608_0032235 | Ga0495608_0032235_1784_2731 | 315 |
| 1031 | 3300046511 | Ga0495608_0032328 | Ga0495608_0032328_360_1307 | 315 |
| 1032 | 3300046511 | Ga0495608_0172333 | Ga0495608_0172333_12_959 | 315 |
| 1033 | 3300046512 | Ga0495610_0027743 | Ga0495610_0027743_1070_2017 | 315 |
| 1034 | 3300046514 | Ga0495618_0049985 | Ga0495618_0049985_898_1845 | 315 |
| 1035 | 3300046514 | Ga0495618_0060411 | Ga0495618_0060411_1439_2386 | 315 |
| 1036 | 3300046514 | Ga0495618_0075508 | Ga0495618_0075508_362_1309 | 315 |
| 1037 | 3300046515 | Ga0495620_0010396 | Ga0495620_0010396_3368_4315 | 315 |
| 1038 | 3300046515 | Ga0495620_0033954 | Ga0495620_0033954_491_1438 | 315 |
| 1039 | 3300046516 | Ga0495628_0044263 | Ga0495628_0044263_555_1502 | 315 |
| 1040 | 3300046516 | Ga0495628_0058442 | Ga0495628_0058442_1819_2766 | 315 |
| 1041 | 3300046516 | Ga0495628_0106350 | Ga0495628_0106350_196_1143 | 315 |
| 1042 | 3300046516 | Ga0495628_0321080 | Ga0495628_0321080_180_1127 | 315 |
| 1043 | 3300046517 | Ga0495630_0006451 | Ga0495630_0006451_6152_7099 | 315 |
| 1044 | 3300046517 | Ga0495630_0097184 | Ga0495630_0097184_104_1051 | 315 |
| 1045 | 3300046517 | Ga0495630_0134827 | Ga0495630_0134827_237_1184 | 315 |
| 1046 | 3300046517 | Ga0495630_0333958 | Ga0495630_0333958_24_971 | 315 |
| 1047 | 3300046519 | Ga0495632_0077742 | Ga0495632_0077742_340_1287 | 315 |
| 1048 | 3300046522 | Ga0495643_0076774 | Ga0495643_0076774_653_1600 | 315 |
| 1049 | 3300046522 | Ga0495643_0168421 | Ga0495643_0168421_35_982 | 315 |
| 1050 | 3300046523 | Ga0495644_0012613 | Ga0495644_0012613_584_1531 | 315 |
| 1051 | 3300046524 | Ga0495648_0000640 | Ga0495648_0000640_7967_9001 | 315 |
| 1052 | 3300046524 | Ga0495648_0004726 | Ga0495648_0004726_5555_6502 | 315 |
| 1053 | 3300046524 | Ga0495648_0031996 | Ga0495648_0031996_2307_3254 | 315 |
| 1054 | 3300046524 | Ga0495648_0093792 | Ga0495648_0093792_17_964 | 315 |
| 1055 | 3300046524 | Ga0495648_0155220 | Ga0495648_0155220_175_1122 | 315 |
| 1056 | 3300046529 | Ga0495652_0010465 | Ga0495652_0010465_1328_2275 | 315 |
| 1057 | 3300046529 | Ga0495652_0030338 | Ga0495652_0030338_2635_3582 | 315 |
| 1058 | 3300046529 | Ga0495652_0046863 | Ga0495652_0046863_1625_2572 | 315 |
| 1059 | 3300046529 | Ga0495652_0062849 | Ga0495652_0062849_1607_2554 | 315 |
| 1060 | 3300046529 | Ga0495652_0075223 | Ga0495652_0075223_642_1589 | 315 |
| 1061 | 3300046529 | Ga0495652_0094913 | Ga0495652_0094913_736_1683 | 315 |
| 1062 | 3300046531 | Ga0495665_0028025 | Ga0495665_0028025_775_1722 | 315 |
| 1063 | 3300046533 | Ga0495640_0006591 | Ga0495640_0006591_4029_4976 | 315 |
| 1064 | 3300046533 | Ga0495640_0011385 | Ga0495640_0011385_3298_4245 | 315 |
| 1065 | 3300046533 | Ga0495640_0020972 | Ga0495640_0020972_3341_4288 | 315 |
| 1066 | 3300046533 | Ga0495640_0030206 | Ga0495640_0030206_1752_2699 | 315 |
| 1067 | 3300046535 | Ga0495586_0175358 | Ga0495586_0175358_70_1017 | 315 |
| 1068 | 3300046536 | Ga0495587_0010857 | Ga0495587_0010857_3793_4740 | 315 |
| 1069 | 3300046536 | Ga0495587_0035814 | Ga0495587_0035814_1328_2275 | 315 |
| 1070 | 3300046536 | Ga0495587_0082267 | Ga0495587_0082267_731_1678 | 315 |
| 1071 | 3300046537 | Ga0495598_0080814 | Ga0495598_0080814_35_982 | 315 |
| 1072 | 3300046538 | Ga0495609_0024989 | Ga0495609_0024989_1273_2220 | 315 |
| 1073 | 3300046543 | Ga0495645_0012719 | Ga0495645_0012719_3394_4341 | 315 |
| 1074 | 3300046543 | Ga0495645_0012763 | Ga0495645_0012763_943_1890 | 315 |
| 1075 | 3300046557 | Ga0495622_0002024 | Ga0495622_0002024_5505_6452 | 315 |
| 1076 | 3300046557 | Ga0495622_0060394 | Ga0495622_0060394_748_1695 | 315 |
| 1077 | 3300046558 | Ga0495633_0035962 | Ga0495633_0035962_1070_2017 | 315 |
| 1078 | 3300046559 | Ga0495667_0009312 | Ga0495667_0009312_2766_3713 | 315 |
| 1079 | 3300046559 | Ga0495667_0020357 | Ga0495667_0020357_1438_2385 | 315 |
| 1080 | 3300046559 | Ga0495667_0030759 | Ga0495667_0030759_619_1566 | 315 |
| 1081 | 3300046559 | Ga0495667_0114893 | Ga0495667_0114893_325_1272 | 315 |
| 1082 | 3300046559 | Ga0495667_0196348 | Ga0495667_0196348_240_1187 | 315 |
| 1083 | 3300046559 | Ga0495667_0256126 | Ga0495667_0256126_95_1042 | 315 |
| 1084 | 3300046615 | Ga0495656_0005884 | Ga0495656_0005884_1036_1983 | 315 |
| 1085 | 3300046615 | Ga0495656_0014228 | Ga0495656_0014228_580_1527 | 315 |
| 1086 | 3300046615 | Ga0495656_0021610 | Ga0495656_0021610_288_1235 | 315 |
| 1087 | 3300046615 | Ga0495656_0038955 | Ga0495656_0038955_130_1077 | 315 |
| 1088 | 3300046616 | Ga0495668_0091403 | Ga0495668_0091403_352_1299 | 315 |
| 1089 | 3300046642 | Ga0495634_0000602 | Ga0495634_0000602_8401_9348 | 315 |
| 1090 | 3300046642 | Ga0495634_0029561 | Ga0495634_0029561_1663_2610 | 315 |
| 1091 | 3300046642 | Ga0495634_0031702 | Ga0495634_0031702_323_1270 | 315 |
| 1092 | 3300046660 | Ga0495625_0012900 | Ga0495625_0012900_1844_2791 | 315 |
| 1093 | 3300046660 | Ga0495625_0068905 | Ga0495625_0068905_399_1346 | 315 |
| 1094 | 3300046663 | Ga0495635_0002469 | Ga0495635_0002469_11194_12141 | 315 |
| 1095 | 3300046663 | Ga0495635_0003077 | Ga0495635_0003077_4735_5682 | 315 |
| 1096 | 3300046663 | Ga0495635_0047928 | Ga0495635_0047928_1814_2761 | 315 |
| 1097 | 3300046663 | Ga0495635_0116781 | Ga0495635_0116781_219_1166 | 315 |
| 1098 | 3300046663 | Ga0495635_0247729 | Ga0495635_0247729_197_1144 | 315 |
| 1099 | 3300046665 | Ga0495661_0078336 | Ga0495661_0078336_537_1484 | 315 |
| 1100 | 3300046674 | Ga0495588_0037312 | Ga0495588_0037312_928_1875 | 315 |
| 1101 | 3300046674 | Ga0495588_0119203 | Ga0495588_0119203_73_1020 | 315 |
| 1102 | 3300046675 | Ga0495657_0004929 | Ga0495657_0004929_9441_10388 | 315 |
| 1103 | 3300046675 | Ga0495657_0021231 | Ga0495657_0021231_2741_3688 | 315 |
| 1104 | 3300046675 | Ga0495657_0026420 | Ga0495657_0026420_973_1920 | 315 |
| 1105 | 3300046675 | Ga0495657_0044079 | Ga0495657_0044079_1950_2897 | 315 |
| 1106 | 3300046678 | Ga0495599_0006110 | Ga0495599_0006110_4020_4967 | 315 |
| 1107 | 3300046678 | Ga0495599_0006329 | Ga0495599_0006329_5554_6501 | 315 |
| 1108 | 3300046678 | Ga0495599_0011625 | Ga0495599_0011625_2420_3367 | 315 |
| 1109 | 3300046679 | Ga0495623_0004956 | Ga0495623_0004956_5090_6037 | 315 |
| 1110 | 3300046679 | Ga0495623_0011109 | Ga0495623_0011109_4089_5036 | 315 |
| 1111 | 3300046679 | Ga0495623_0016712 | Ga0495623_0016712_1523_2470 | 315 |
| 1112 | 3300046680 | Ga0495646_0048818 | Ga0495646_0048818_834_1781 | 315 |
| 1113 | 3300046680 | Ga0495646_0060074 | Ga0495646_0060074_19_966 | 315 |
| 1114 | 3300046680 | Ga0495646_0076660 | Ga0495646_0076660_583_1530 | 315 |
| 1115 | 3300046680 | Ga0495646_0108652 | Ga0495646_0108652_382_1329 | 315 |
| 1116 | 3300046681 | Ga0495647_0000414 | Ga0495647_0000414_6516_7463 | 315 |
| 1117 | 3300046683 | Ga0495658_0002719 | Ga0495658_0002719_5200_6147 | 315 |
| 1118 | 3300046683 | Ga0495658_0028724 | Ga0495658_0028724_1241_2188 | 315 |
| 1119 | 3300046683 | Ga0495658_0183068 | Ga0495658_0183068_239_1186 | 315 |
| 1120 | 3300046684 | Ga0495669_0044936 | Ga0495669_0044936_789_1736 | 315 |
| 1121 | 3300046689 | Ga0495613_0022972 | Ga0495613_0022972_173_1120 | 315 |
| 1122 | 3300046689 | Ga0495613_0033323 | Ga0495613_0033323_1726_2673 | 315 |
| 1123 | 3300046689 | Ga0495613_0148239 | Ga0495613_0148239_664_1611 | 315 |
| 1124 | 3300046689 | Ga0495613_0188071 | Ga0495613_0188071_416_1363 | 315 |
| 1125 | 3300046689 | Ga0495613_0208217 | Ga0495613_0208217_348_1295 | 315 |
| 1126 | 3300046690 | Ga0495624_0003072 | Ga0495624_0003072_2435_3382 | 315 |
| 1127 | 3300046690 | Ga0495624_0038315 | Ga0495624_0038315_1149_2096 | 315 |
| 1128 | 3300046690 | Ga0495624_0068957 | Ga0495624_0068957_522_1469 | 315 |
| 1129 | 3300046691 | Ga0495670_0001065 | Ga0495670_0001065_279_1226 | 315 |
| 1130 | 3300046691 | Ga0495670_0043819 | Ga0495670_0043819_537_1484 | 315 |
| 1131 | 3300046694 | Ga0495649_0026167 | Ga0495649_0026167_586_1533 | 315 |
| 1132 | 3300046694 | Ga0495649_0046915 | Ga0495649_0046915_463_1410 | 315 |
| 1133 | 3300046794 | Ga0495589_0022229 | Ga0495589_0022229_1118_2065 | 315 |
| 1134 | 3300046809 | Ga0495600_0012415 | Ga0495600_0012415_2193_3140 | 315 |
| 1135 | 3300046809 | Ga0495600_0012561 | Ga0495600_0012561_1796_2743 | 315 |
| 1136 | 3300046809 | Ga0495600_0038915 | Ga0495600_0038915_269_1216 | 315 |
| 1137 | 3300046809 | Ga0495600_0081594 | Ga0495600_0081594_28_975 | 315 |
| 1138 | 3300047315 | Ga0495581_0000133 | Ga0495581_0000133_5505_6452 | 315 |
| 1139 | 3300047315 | Ga0495581_0132153 | Ga0495581_0132153_135_1082 | 315 |
| 1140 | 3300047315 | Ga0495581_0150227 | Ga0495581_0150227_43_990 | 315 |
| 1141 | 3300047315 | Ga0495581_0202051 | Ga0495581_0202051_86_1033 | 315 |
| 1142 | 3300047315 | Ga0495581_0256787 | Ga0495581_0256787_30_977 | 315 |
| 1143 | 3300047317 | Ga0495604_0013217 | Ga0495604_0013217_715_1662 | 315 |
| 1144 | 3300047317 | Ga0495604_0054319 | Ga0495604_0054319_1804_2751 | 315 |
| 1145 | 3300047317 | Ga0495604_0089599 | Ga0495604_0089599_216_1163 | 315 |
| 1146 | 3300047319 | Ga0495674_0000874 | Ga0495674_0000874_25462_26409 | 315 |
| 1147 | 3300047319 | Ga0495674_0012220 | Ga0495674_0012220_6311_7258 | 315 |
| 1148 | 3300047319 | Ga0495674_0054204 | Ga0495674_0054204_763_1710 | 315 |
| 1149 | 3300047319 | Ga0495674_0317188 | Ga0495674_0317188_233_1180 | 315 |
| 1150 | 3300047320 | Ga0495672_0025641 | Ga0495672_0025641_210_1157 | 315 |
| 1151 | 3300047320 | Ga0495672_0035311 | Ga0495672_0035311_798_1745 | 315 |
| 1152 | 3300047321 | Ga0495676_0015692 | Ga0495676_0015692_1198_2145 | 315 |
| 1153 | 3300047321 | Ga0495676_0064310 | Ga0495676_0064310_192_1139 | 315 |
| 1154 | 3300047321 | Ga0495676_0120501 | Ga0495676_0120501_757_1704 | 315 |
| 1155 | 3300047321 | Ga0495676_0134248 | Ga0495676_0134248_87_1034 | 315 |
| 1156 | 3300047322 | Ga0495680_0017277 | Ga0495680_0017277_4503_5450 | 315 |
| 1157 | 3300047322 | Ga0495680_0053089 | Ga0495680_0053089_909_1856 | 315 |
| 1158 | 3300047322 | Ga0495680_0258365 | Ga0495680_0258365_40_987 | 315 |
| 1159 | 3300047443 | Ga0495687_013529 | Ga0495687_013529_45_992 | 315 |
| 1160 | 3300047444 | Ga0495675_0001856 | Ga0495675_0001856_10863_11810 | 315 |
| 1161 | 3300047444 | Ga0495675_0014102 | Ga0495675_0014102_2638_3585 | 315 |
| 1162 | 3300047444 | Ga0495675_0014120 | Ga0495675_0014120_3871_4818 | 315 |
| 1163 | 3300047469 | Ga0495673_0004092 | Ga0495673_0004092_4360_5307 | 315 |
| 1164 | 3300047471 | Ga0495684_0000294 | Ga0495684_0000294_9432_10379 | 315 |
| 1165 | 3300047471 | Ga0495684_0020080 | Ga0495684_0020080_3493_4440 | 315 |
| 1166 | 3300047471 | Ga0495684_0025060 | Ga0495684_0025060_2049_2996 | 315 |
| 1167 | 3300047471 | Ga0495684_0049052 | Ga0495684_0049052_1598_2545 | 315 |
| 1168 | 3300047472 | Ga0495686_0180977 | Ga0495686_0180977_77_1024 | 315 |
| 1169 | 3300047673 | Ga0495593_0000022 | Ga0495593_0000022_8153_9100 | 315 |
| 1170 | 3300047673 | Ga0495593_0000744 | Ga0495593_0000744_16664_17611 | 315 |
| 1171 | 3300047673 | Ga0495593_0009120 | Ga0495593_0009120_1824_2771 | 315 |
| 1172 | 3300047673 | Ga0495593_0016629 | Ga0495593_0016629_2215_3162 | 315 |
| 1173 | 3300047673 | Ga0495593_0032757 | Ga0495593_0032757_64_1011 | 315 |
| 1174 | 3300048088 | Ga0495602_0030626 | Ga0495602_0030626_1598_2545 | 315 |
| 1175 | 3300048088 | Ga0495602_0060623 | Ga0495602_0060623_41_988 | 315 |
| 1176 | 3300048088 | Ga0495602_0156786 | Ga0495602_0156786_666_1613 | 315 |
| 1177 | 3300048088 | Ga0495602_0209035 | Ga0495602_0209035_444_1391 | 315 |
| 1178 | 3300048088 | Ga0495602_0230461 | Ga0495602_0230461_348_1295 | 315 |
| 1179 | 3300048088 | Ga0495602_0271777 | Ga0495602_0271777_173_1120 | 315 |
| 1180 | 3300048089 | Ga0495614_0022860 | Ga0495614_0022860_202_1149 | 315 |
| 1181 | 3300048903 | Ga0496100_0003499 | Ga0496100_0003499_4325_5272 | 315 |
| 1182 | 3300048903 | Ga0496100_0147031 | Ga0496100_0147031_510_1457 | 315 |
| 1183 | 3300048904 | Ga0496101_0009124 | Ga0496101_0009124_3516_4463 | 315 |
| 1184 | 3300048904 | Ga0496101_0056421 | Ga0496101_0056421_802_1749 | 315 |
| 1185 | 3300048904 | Ga0496101_0153683 | Ga0496101_0153683_22_969 | 315 |
| 1186 | 3300048904 | Ga0496101_0349734 | Ga0496101_0349734_75_1022 | 315 |
| 1187 | 3300048905 | Ga0496102_0006184 | Ga0496102_0006184_3903_4850 | 315 |
| 1188 | 3300048905 | Ga0496102_0029606 | Ga0496102_0029606_1605_2552 | 315 |
| 1189 | 3300048905 | Ga0496102_0059757 | Ga0496102_0059757_2017_2964 | 315 |
| 1190 | 3300048905 | Ga0496102_0073409 | Ga0496102_0073409_638_1585 | 315 |
| 1191 | 3300048905 | Ga0496102_0159376 | Ga0496102_0159376_158_1105 | 315 |
| 1192 | 3300048906 | Ga0496103_0006862 | Ga0496103_0006862_4160_5107 | 315 |
| 1193 | 3300048906 | Ga0496103_0061923 | Ga0496103_0061923_800_1747 | 315 |
| 1194 | 3300048906 | Ga0496103_0165405 | Ga0496103_0165405_158_1105 | 315 |
| 1195 | 3300048906 | Ga0496103_0210261 | Ga0496103_0210261_209_1156 | 315 |
| 1196 | 3300048907 | Ga0496104_0002005 | Ga0496104_0002005_14407_15354 | 315 |
| 1197 | 3300048907 | Ga0496104_0030942 | Ga0496104_0030942_2078_3025 | 315 |
| 1198 | 3300048907 | Ga0496104_0039125 | Ga0496104_0039125_2984_3931 | 315 |
| 1199 | 3300048907 | Ga0496104_0043721 | Ga0496104_0043721_2860_3807 | 315 |
| 1200 | 3300048907 | Ga0496104_0070616 | Ga0496104_0070616_1417_2364 | 315 |
| 1201 | 3300048907 | Ga0496104_0110978 | Ga0496104_0110978_35_982 | 315 |
| 1202 | 3300048907 | Ga0496104_0164368 | Ga0496104_0164368_664_1611 | 315 |
| 1203 | 3300048907 | Ga0496104_0166508 | Ga0496104_0166508_274_1221 | 315 |
| 1204 | 3300048908 | Ga0496105_0015812 | Ga0496105_0015812_3648_4595 | 315 |
| 1205 | 3300048908 | Ga0496105_0018819 | Ga0496105_0018819_2979_3926 | 315 |
| 1206 | 3300048908 | Ga0496105_0026728 | Ga0496105_0026728_1989_2936 | 315 |
| 1207 | 3300048908 | Ga0496105_0127943 | Ga0496105_0127943_917_1864 | 315 |
| 1208 | 3300048909 | Ga0496106_0003691 | Ga0496106_0003691_5752_6699 | 315 |
| 1209 | 3300048909 | Ga0496106_0007852 | Ga0496106_0007852_1015_1962 | 315 |
| 1210 | 3300048909 | Ga0496106_0009940 | Ga0496106_0009940_2387_3334 | 315 |
| 1211 | 3300048909 | Ga0496106_0038934 | Ga0496106_0038934_1014_1961 | 315 |
| 1212 | 3300048909 | Ga0496106_0309438 | Ga0496106_0309438_273_1220 | 315 |
| 1213 | 3300048910 | Ga0496107_0020799 | Ga0496107_0020799_2244_3191 | 315 |
| 1214 | 3300048910 | Ga0496107_0042505 | Ga0496107_0042505_256_1203 | 315 |
| 1215 | 3300048910 | Ga0496107_0063392 | Ga0496107_0063392_1657_2604 | 315 |
| 1216 | 3300048910 | Ga0496107_0122472 | Ga0496107_0122472_353_1300 | 315 |
| 1217 | 3300048910 | Ga0496107_0315214 | Ga0496107_0315214_151_1098 | 315 |
| 1218 | 3300048911 | Ga0496108_0024899 | Ga0496108_0024899_3491_4438 | 315 |
| 1219 | 3300048911 | Ga0496108_0068090 | Ga0496108_0068090_1999_2946 | 315 |
| 1220 | 3300048911 | Ga0496108_0079127 | Ga0496108_0079127_1320_2267 | 315 |
| 1221 | 3300048911 | Ga0496108_0215261 | Ga0496108_0215261_679_1626 | 315 |
| 1222 | 3300048912 | Ga0496109_0000910 | Ga0496109_0000910_6154_7101 | 315 |
| 1223 | 3300048912 | Ga0496109_0010481 | Ga0496109_0010481_5466_6413 | 315 |
| 1224 | 3300048912 | Ga0496109_0016308 | Ga0496109_0016308_4364_5311 | 315 |
| 1225 | 3300048912 | Ga0496109_0016600 | Ga0496109_0016600_240_1187 | 315 |
| 1226 | 3300048912 | Ga0496109_0061904 | Ga0496109_0061904_1605_2552 | 315 |
| 1227 | 3300048912 | Ga0496109_0593720 | Ga0496109_0593720_57_1004 | 315 |
| 1228 | 3300048913 | Ga0496110_0039029 | Ga0496110_0039029_2462_3409 | 315 |
| 1229 | 3300048913 | Ga0496110_0145765 | Ga0496110_0145765_946_1893 | 315 |
| 1230 | 3300048913 | Ga0496110_0275393 | Ga0496110_0275393_529_1476 | 315 |
| 1231 | 3300048914 | Ga0496111_0011896 | Ga0496111_0011896_3263_4210 | 315 |
| 1232 | 3300048914 | Ga0496111_0094046 | Ga0496111_0094046_423_1370 | 315 |
| 1233 | 3300048914 | Ga0496111_0267495 | Ga0496111_0267495_47_994 | 315 |
| 1234 | 3300048914 | Ga0496111_0361996 | Ga0496111_0361996_41_988 | 315 |
| 1235 | 3300048915 | Ga0496112_0000022 | Ga0496112_0000022_19662_20609 | 315 |
| 1236 | 3300048915 | Ga0496112_0008650 | Ga0496112_0008650_2979_3926 | 315 |
| 1237 | 3300048915 | Ga0496112_0020467 | Ga0496112_0020467_5245_6192 | 315 |
| 1238 | 3300048915 | Ga0496112_0020945 | Ga0496112_0020945_4620_5567 | 315 |
| 1239 | 3300048915 | Ga0496112_0029523 | Ga0496112_0029523_4008_4955 | 315 |
| 1240 | 3300048915 | Ga0496112_0035183 | Ga0496112_0035183_1773_2720 | 315 |
| 1241 | 3300048915 | Ga0496112_0039089 | Ga0496112_0039089_3058_4005 | 315 |
| 1242 | 3300048915 | Ga0496112_0067762 | Ga0496112_0067762_1645_2592 | 315 |
| 1243 | 3300048915 | Ga0496112_0113658 | Ga0496112_0113658_1705_2652 | 315 |
| 1244 | 3300048915 | Ga0496112_0162367 | Ga0496112_0162367_930_1877 | 315 |
| 1245 | 3300048916 | Ga0496113_0001596 | Ga0496113_0001596_507_1454 | 315 |
| 1246 | 3300048916 | Ga0496113_0021222 | Ga0496113_0021222_728_1675 | 315 |
| 1247 | 3300048916 | Ga0496113_0026536 | Ga0496113_0026536_535_1482 | 315 |
| 1248 | 3300048916 | Ga0496113_0094105 | Ga0496113_0094105_444_1391 | 315 |
| 1249 | 3300048916 | Ga0496113_0131651 | Ga0496113_0131651_882_1829 | 315 |
| 1250 | 3300048917 | Ga0496114_0072883 | Ga0496114_0072883_1032_1979 | 315 |
| 1251 | 3300048917 | Ga0496114_0116982 | Ga0496114_0116982_300_1247 | 315 |
| 1252 | 3300048917 | Ga0496114_0310704 | Ga0496114_0310704_273_1220 | 315 |
| 1253 | 3300048917 | Ga0496114_0397536 | Ga0496114_0397536_252_1199 | 315 |
| 1254 | 3300048918 | Ga0496115_0032084 | Ga0496115_0032084_1666_2613 | 315 |
| 1255 | 3300048918 | Ga0496115_0037994 | Ga0496115_0037994_249_1196 | 315 |
| 1256 | 3300048918 | Ga0496115_0043743 | Ga0496115_0043743_1696_2643 | 315 |
| 1257 | 3300048918 | Ga0496115_0043883 | Ga0496115_0043883_920_1867 | 315 |
| 1258 | 3300048918 | Ga0496115_0047207 | Ga0496115_0047207_1695_2642 | 315 |
| 1259 | 3300048918 | Ga0496115_0083801 | Ga0496115_0083801_448_1395 | 315 |
| 1260 | 3300048918 | Ga0496115_0122982 | Ga0496115_0122982_1124_2071 | 315 |
| 1261 | 3300048918 | Ga0496115_0126130 | Ga0496115_0126130_525_1472 | 315 |
| 1262 | 3300048918 | Ga0496115_0133100 | Ga0496115_0133100_225_1172 | 315 |
| 1263 | 3300048918 | Ga0496115_0161714 | Ga0496115_0161714_835_1782 | 315 |
| 1264 | 3300048918 | Ga0496115_0328247 | Ga0496115_0328247_52_999 | 315 |
| 1265 | 3300048919 | Ga0496116_0004251 | Ga0496116_0004251_7365_8312 | 315 |
| 1266 | 3300048920 | Ga0496117_0012698 | Ga0496117_0012698_183_1130 | 315 |
| 1267 | 3300048920 | Ga0496117_0028820 | Ga0496117_0028820_1092_2039 | 315 |
| 1268 | 3300048921 | Ga0496118_0031958 | Ga0496118_0031958_3217_4164 | 315 |
| 1269 | 3300048921 | Ga0496118_0032185 | Ga0496118_0032185_1548_2495 | 315 |
| 1270 | 3300048922 | Ga0496119_0022613 | Ga0496119_0022613_2257_3204 | 315 |
| 1271 | 3300048922 | Ga0496119_0022773 | Ga0496119_0022773_1761_2708 | 315 |
| 1272 | 3300048922 | Ga0496119_0023433 | Ga0496119_0023433_2883_3830 | 315 |
| 1273 | 3300048923 | Ga0496120_0021002 | Ga0496120_0021002_1573_2520 | 315 |
| 1274 | 3300048923 | Ga0496120_0059770 | Ga0496120_0059770_247_1194 | 315 |
| 1275 | 3300048923 | Ga0496120_0076022 | Ga0496120_0076022_814_1761 | 315 |
| 1276 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_15100_16047 | 315 |
| 1277 | 3300048924 | Ga0496121_0000254 | Ga0496121_0000254_59884_60831 | 315 |
| 1278 | 3300048924 | Ga0496121_0019232 | Ga0496121_0019232_5232_6179 | 315 |
| 1279 | 3300048924 | Ga0496121_0024814 | Ga0496121_0024814_1221_2168 | 315 |
| 1280 | 3300048924 | Ga0496121_0069007 | Ga0496121_0069007_301_1248 | 315 |
| 1281 | 3300048924 | Ga0496121_0080649 | Ga0496121_0080649_25_972 | 315 |
| 1282 | 3300048924 | Ga0496121_0099020 | Ga0496121_0099020_1119_2066 | 315 |
| 1283 | 3300048924 | Ga0496121_0111711 | Ga0496121_0111711_569_1516 | 315 |
| 1284 | 3300048924 | Ga0496121_0123657 | Ga0496121_0123657_209_1156 | 315 |
| 1285 | 3300048924 | Ga0496121_0170222 | Ga0496121_0170222_264_1211 | 315 |
| 1286 | 3300048924 | Ga0496121_0258583 | Ga0496121_0258583_28_975 | 315 |
| 1287 | 3300048925 | Ga0496122_0009335 | Ga0496122_0009335_4233_5180 | 315 |
| 1288 | 3300048925 | Ga0496122_0044528 | Ga0496122_0044528_930_1877 | 315 |
| 1289 | 3300048925 | Ga0496122_0051764 | Ga0496122_0051764_1050_1997 | 315 |
| 1290 | 3300048925 | Ga0496122_0194241 | Ga0496122_0194241_94_1041 | 315 |
| 1291 | 3300048927 | Ga0496124_0001236 | Ga0496124_0001236_15877_16824 | 315 |
| 1292 | 3300048927 | Ga0496124_0067274 | Ga0496124_0067274_702_1649 | 315 |
| 1293 | 3300048927 | Ga0496124_0102995 | Ga0496124_0102995_941_1888 | 315 |
| 1294 | 3300048927 | Ga0496124_0340978 | Ga0496124_0340978_100_1047 | 315 |
| 1295 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_47034_47981 | 315 |
| 1296 | 3300048928 | Ga0496125_0002791 | Ga0496125_0002791_15381_16328 | 315 |
| 1297 | 3300048928 | Ga0496125_0010906 | Ga0496125_0010906_2244_3191 | 315 |
| 1298 | 3300048928 | Ga0496125_0015991 | Ga0496125_0015991_5249_6196 | 315 |
| 1299 | 3300048928 | Ga0496125_0029525 | Ga0496125_0029525_44_991 | 315 |
| 1300 | 3300048928 | Ga0496125_0043420 | Ga0496125_0043420_186_1133 | 315 |
| 1301 | 3300048928 | Ga0496125_0053712 | Ga0496125_0053712_760_1707 | 315 |
| 1302 | 3300048929 | Ga0496126_0007002 | Ga0496126_0007002_9714_10661 | 315 |
| 1303 | 3300048929 | Ga0496126_0017287 | Ga0496126_0017287_4470_5417 | 315 |
| 1304 | 3300048929 | Ga0496126_0038428 | Ga0496126_0038428_2258_3205 | 315 |
| 1305 | 3300048929 | Ga0496126_0039889 | Ga0496126_0039889_513_1460 | 315 |
| 1306 | 3300048929 | Ga0496126_0043377 | Ga0496126_0043377_29_976 | 315 |
| 1307 | 3300048929 | Ga0496126_0047403 | Ga0496126_0047403_2651_3598 | 315 |
| 1308 | 3300048929 | Ga0496126_0052470 | Ga0496126_0052470_109_1056 | 315 |
| 1309 | 3300048929 | Ga0496126_0054860 | Ga0496126_0054860_611_1558 | 315 |
| 1310 | 3300048929 | Ga0496126_0072997 | Ga0496126_0072997_1716_2663 | 315 |
| 1311 | 3300048929 | Ga0496126_0085828 | Ga0496126_0085828_1332_2279 | 315 |
| 1312 | 3300048929 | Ga0496126_0088703 | Ga0496126_0088703_1246_2193 | 315 |
| 1313 | 3300048929 | Ga0496126_0117052 | Ga0496126_0117052_1218_2165 | 315 |
| 1314 | 3300048929 | Ga0496126_0157571 | Ga0496126_0157571_820_1767 | 315 |
| 1315 | 3300048929 | Ga0496126_0181511 | Ga0496126_0181511_573_1520 | 315 |
| 1316 | 3300048929 | Ga0496126_0228793 | Ga0496126_0228793_136_1083 | 315 |
| 1317 | 3300048929 | Ga0496126_0277747 | Ga0496126_0277747_300_1247 | 315 |
| 1318 | 3300049459 | Ga0495678_076933 | Ga0495678_076933_85_1032 | 315 |
| 1319 | 3300049460 | Ga0495682_0054436 | Ga0495682_0054436_137_1084 | 315 |
| 1320 | 3300049460 | Ga0495682_0074821 | Ga0495682_0074821_70_1017 | 315 |
| 1321 | 3300049571 | Ga0501034_0425660 | Ga0501034_0425660_94_1041 | 315 |
| 1322 | 3300049572 | Ga0501036_0080538 | Ga0501036_0080538_1001_1948 | 315 |
| 1323 | 3300049573 | Ga0501037_0170333 | Ga0501037_0170333_521_1468 | 315 |
| 1324 | 3300049574 | Ga0501038_0127264 | Ga0501038_0127264_752_1699 | 315 |
| 1325 | 3300049575 | Ga0501039_0154459 | Ga0501039_0154459_39_986 | 315 |
| 1326 | 3300049579 | Ga0501043_0115915 | Ga0501043_0115915_183_1130 | 315 |
| 1327 | 3300049580 | Ga0501046_0097458 | Ga0501046_0097458_1220_2167 | 315 |
| 1328 | 3300049580 | Ga0501046_0123973 | Ga0501046_0123973_604_1551 | 315 |
| 1329 | 3300049581 | Ga0501047_0074414 | Ga0501047_0074414_875_1822 | 315 |
| 1330 | 3300049582 | Ga0501048_0064298 | Ga0501048_0064298_670_1617 | 315 |
| 1331 | 3300049583 | Ga0501067_0042939 | Ga0501067_0042939_1148_2095 | 315 |
| 1332 | 3300049585 | Ga0501069_0085199 | Ga0501069_0085199_294_1241 | 315 |
| 1333 | 3300049586 | Ga0501070_0057445 | Ga0501070_0057445_1318_2265 | 315 |
| 1334 | 3300049586 | Ga0501070_0080344 | Ga0501070_0080344_806_1753 | 315 |
| 1335 | 3300049589 | Ga0501073_0203203 | Ga0501073_0203203_158_1105 | 315 |
| 1336 | 3300049590 | Ga0501074_0064390 | Ga0501074_0064390_147_1094 | 315 |
| 1337 | 3300049822 | Ga0501035_0411886 | Ga0501035_0411886_50_997 | 315 |
| 1338 | 3300049823 | Ga0501044_0032392 | Ga0501044_0032392_1633_2580 | 315 |
| 1339 | 3300049823 | Ga0501044_0037782 | Ga0501044_0037782_2571_3518 | 315 |
| 1340 | 3300050489 | nmdc:mga03683_101559_c1 | nmdc:mga03683_101559_c1_99_1046 | 315 |
| 1341 | 3300050490 | nmdc:mga03n38_2791_c1 | nmdc:mga03n38_2791_c1_2960_3907 | 315 |
| 1342 | 3300050490 | nmdc:mga03n38_71308_c1 | nmdc:mga03n38_71308_c1_380_1327 | 315 |
| 1343 | 3300050491 | nmdc:mga00v17_4195_c1 | nmdc:mga00v17_4195_c1_4194_5141 | 315 |
| 1344 | 3300050491 | nmdc:mga00v17_70029_c1 | nmdc:mga00v17_70029_c1_927_1874 | 315 |
| 1345 | 3300050491 | nmdc:mga00v17_7814_c1 | nmdc:mga00v17_7814_c1_4547_5494 | 315 |
| 1346 | 3300050492 | nmdc:mga0yw44_51316_c1 | nmdc:mga0yw44_51316_c1_943_1890 | 315 |
| 1347 | 3300050492 | nmdc:mga0yw44_69816_c1 | nmdc:mga0yw44_69816_c1_966_1913 | 315 |
| 1348 | 3300050492 | nmdc:mga0yw44_73238_c1 | nmdc:mga0yw44_73238_c1_1038_1985 | 315 |
| 1349 | 3300050492 | nmdc:mga0yw44_8369_c1 | nmdc:mga0yw44_8369_c1_2505_3452 | 315 |
| 1350 | 3300050492 | nmdc:mga0yw44_97315_c1 | nmdc:mga0yw44_97315_c1_618_1565 | 315 |
| 1351 | 3300050493 | nmdc:mga0k408_40338_c1 | nmdc:mga0k408_40338_c1_1521_2468 | 315 |
| 1352 | 3300050493 | nmdc:mga0k408_60219_c1 | nmdc:mga0k408_60219_c1_1122_2069 | 315 |
| 1353 | 3300050494 | nmdc:mga06z11_12111_c1 | nmdc:mga06z11_12111_c1_2575_3522 | 315 |
| 1354 | 3300050494 | nmdc:mga06z11_22737_c1 | nmdc:mga06z11_22737_c1_1122_2069 | 315 |
| 1355 | 3300050494 | nmdc:mga06z11_228368_c1 | nmdc:mga06z11_228368_c1_27_974 | 315 |
| 1356 | 3300050494 | nmdc:mga06z11_2940_c1 | nmdc:mga06z11_2940_c1_253_1200 | 315 |
| 1357 | 3300050494 | nmdc:mga06z11_63873_c1 | nmdc:mga06z11_63873_c1_54_1001 | 315 |
| 1358 | 3300050496 | nmdc:mga07m45_104960_c1 | nmdc:mga07m45_104960_c1_269_1216 | 315 |
| 1359 | 3300050496 | nmdc:mga07m45_14891_c1 | nmdc:mga07m45_14891_c1_2567_3514 | 315 |
| 1360 | 3300050496 | nmdc:mga07m45_4272_c1 | nmdc:mga07m45_4272_c1_211_1158 | 315 |
| 1361 | 3300050496 | nmdc:mga07m45_66119_c1 | nmdc:mga07m45_66119_c1_420_1367 | 315 |
| 1362 | 3300050496 | nmdc:mga07m45_6917_c1 | nmdc:mga07m45_6917_c1_1994_2941 | 315 |
| 1363 | 3300050507 | nmdc:mga05p37_20147_c1 | nmdc:mga05p37_20147_c1_6015_6962 | 315 |
| 1364 | 3300050509 | nmdc:mga0qj67_101885_c1 | nmdc:mga0qj67_101885_c1_157_1104 | 315 |
| 1365 | 3300050510 | nmdc:mga06r32_56945_c1 | nmdc:mga06r32_56945_c1_584_1531 | 315 |
| 1366 | 3300050512 | nmdc:mga0n895_33569_c1 | nmdc:mga0n895_33569_c1_976_1923 | 315 |
| 1367 | 3300050512 | nmdc:mga0n895_71602_c1 | nmdc:mga0n895_71602_c1_768_1715 | 315 |
| 1368 | 3300050516 | nmdc:mga0sz30_1155_c1 | nmdc:mga0sz30_1155_c1_7447_8394 | 315 |
| 1369 | 3300050516 | nmdc:mga0sz30_2482_c1 | nmdc:mga0sz30_2482_c1_3892_4839 | 315 |
| 1370 | 3300053077 | Ga0495601_0004994 | Ga0495601_0004994_4200_5147 | 315 |
| 1371 | 3300053077 | Ga0495601_0013942 | Ga0495601_0013942_165_1112 | 315 |
| 1372 | 3300053077 | Ga0495601_0170591 | Ga0495601_0170591_290_1237 | 315 |
| 1373 | 3300053077 | Ga0495601_0187674 | Ga0495601_0187674_289_1236 | 315 |
| 1374 | 3300053078 | Ga0495612_0011892 | Ga0495612_0011892_78_1025 | 315 |
| 1375 | 3300053078 | Ga0495612_0030072 | Ga0495612_0030072_481_1428 | 315 |
| 1376 | 3300053080 | Ga0500635_0011261 | Ga0500635_0011261_974_1921 | 315 |
| 1377 | 3300053084 | Ga0495595_0000670 | Ga0495595_0000670_2697_3644 | 315 |
| 1378 | 3300053084 | Ga0495595_0016585 | Ga0495595_0016585_1632_2579 | 315 |
| 1379 | 3300053085 | Ga0495619_0026443 | Ga0495619_0026443_2088_3035 | 315 |
| 1380 | 3300053085 | Ga0495619_0035364 | Ga0495619_0035364_973_1920 | 315 |
| 1381 | 3300053085 | Ga0495619_0095687 | Ga0495619_0095687_610_1557 | 315 |
| 1382 | 3300053086 | Ga0500578_0206155 | Ga0500578_0206155_207_1154 | 315 |
| 1383 | 3300053087 | Ga0500643_000052 | Ga0500643_000052_56479_57426 | 315 |
| 1384 | 3300053093 | Ga0500651_0014169 | Ga0500651_0014169_279_1226 | 315 |
| 1385 | 3300053094 | Ga0500566_0002331 | Ga0500566_0002331_4960_5907 | 315 |
| 1386 | 3300053094 | Ga0500566_0002512 | Ga0500566_0002512_8696_9643 | 315 |
| 1387 | 3300053094 | Ga0500566_0002754 | Ga0500566_0002754_3977_4924 | 315 |
| 1388 | 3300053094 | Ga0500566_0011017 | Ga0500566_0011017_1848_2795 | 315 |
| 1389 | 3300053094 | Ga0500566_0054199 | Ga0500566_0054199_216_1163 | 315 |
| 1390 | 3300053096 | Ga0500641_0037727 | Ga0500641_0037727_219_1166 | 315 |
| 1391 | 3300053104 | Ga0500556_0000035 | Ga0500556_0000035_89814_90761 | 315 |
| 1392 | 3300053105 | Ga0500557_000057 | Ga0500557_000057_27567_28514 | 315 |
| 1393 | 3300053111 | Ga0500572_000655 | Ga0500572_000655_5025_5972 | 315 |
| 1394 | 3300053111 | Ga0500572_003541 | Ga0500572_003541_806_1753 | 315 |
| 1395 | 3300053115 | Ga0500591_058871 | Ga0500591_058871_120_1067 | 315 |
| 1396 | 3300053118 | Ga0500594_0002896 | Ga0500594_0002896_509_1456 | 315 |
| 1397 | 3300053119 | Ga0500595_004352 | Ga0500595_004352_2612_3559 | 315 |
| 1398 | 3300053119 | Ga0500595_028193 | Ga0500595_028193_444_1391 | 315 |
| 1399 | 3300053119 | Ga0500595_034967 | Ga0500595_034967_86_1033 | 315 |
| 1400 | 3300053119 | Ga0500595_062917 | Ga0500595_062917_146_1093 | 315 |
| 1401 | 3300053121 | Ga0500607_109387 | Ga0500607_109387_58_1005 | 315 |
| 1402 | 3300053122 | Ga0500608_000780 | Ga0500608_000780_8096_9043 | 315 |
| 1403 | 3300053123 | Ga0500614_003528 | Ga0500614_003528_1211_2158 | 315 |
| 1404 | 3300053125 | Ga0500618_004716 | Ga0500618_004716_1215_2162 | 315 |
| 1405 | 3300053130 | Ga0500642_0000027 | Ga0500642_0000027_106522_107469 | 315 |
| 1406 | 3300053130 | Ga0500642_0000263 | Ga0500642_0000263_7605_8552 | 315 |
| 1407 | 3300053130 | Ga0500642_0112543 | Ga0500642_0112543_103_1050 | 315 |
| 1408 | 3300053131 | Ga0500652_000934 | Ga0500652_000934_8629_9576 | 315 |
| 1409 | 3300053136 | Ga0500559_0000064 | Ga0500559_0000064_5947_6894 | 315 |
| 1410 | 3300053136 | Ga0500559_0000486 | Ga0500559_0000486_20799_21746 | 315 |
| 1411 | 3300053136 | Ga0500559_0003342 | Ga0500559_0003342_5453_6400 | 315 |
| 1412 | 3300053136 | Ga0500559_0015332 | Ga0500559_0015332_1444_2391 | 315 |
| 1413 | 3300053136 | Ga0500559_0070038 | Ga0500559_0070038_553_1500 | 315 |
| 1414 | 3300053139 | Ga0500568_0001465 | Ga0500568_0001465_9422_10369 | 315 |
| 1415 | 3300053139 | Ga0500568_0022037 | Ga0500568_0022037_1192_2139 | 315 |
| 1416 | 3300053142 | Ga0500577_0000035 | Ga0500577_0000035_5839_6786 | 315 |
| 1417 | 3300053146 | Ga0500588_0053235 | Ga0500588_0053235_104_1051 | 315 |
| 1418 | 3300053147 | Ga0500589_041912 | Ga0500589_041912_183_1130 | 315 |
| 1419 | 3300053148 | Ga0500590_017886 | Ga0500590_017886_1658_2605 | 315 |
| 1420 | 3300053148 | Ga0500590_054044 | Ga0500590_054044_506_1453 | 315 |
| 1421 | 3300053150 | Ga0500603_000667 | Ga0500603_000667_4620_5567 | 315 |
| 1422 | 3300053150 | Ga0500603_001350 | Ga0500603_001350_2999_3946 | 315 |
| 1423 | 3300053151 | Ga0500604_0002237 | Ga0500604_0002237_1148_2095 | 315 |
| 1424 | 3300053151 | Ga0500604_0053553 | Ga0500604_0053553_62_1009 | 315 |
| 1425 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_380136_381083 | 315 |
| 1426 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_196606_197553 | 315 |
| 1427 | 3300053156 | Ga0500622_0003626 | Ga0500622_0003626_4334_5281 | 315 |
| 1428 | 3300053156 | Ga0500622_0006780 | Ga0500622_0006780_3590_4537 | 315 |
| 1429 | 3300053158 | Ga0500627_0002332 | Ga0500627_0002332_3957_4904 | 315 |
| 1430 | 3300053161 | Ga0500634_0017216 | Ga0500634_0017216_1009_1956 | 315 |
| 1431 | 3300053161 | Ga0500634_0042983 | Ga0500634_0042983_251_1198 | 315 |
| 1432 | 3300053161 | Ga0500634_0121455 | Ga0500634_0121455_100_1047 | 315 |
| 1433 | 3300053162 | Ga0500638_044057 | Ga0500638_044057_824_1771 | 315 |
| 1434 | 3300053163 | Ga0500639_001074 | Ga0500639_001074_11111_12058 | 315 |
| 1435 | 3300053163 | Ga0500639_132718 | Ga0500639_132718_79_1026 | 315 |
| 1436 | 3300053177 | Ga0500636_0026615 | Ga0500636_0026615_967_1914 | 315 |
| 1437 | 3300053177 | Ga0500636_0030405 | Ga0500636_0030405_1266_2213 | 315 |
| 1438 | 3300053177 | Ga0500636_0043902 | Ga0500636_0043902_936_1883 | 315 |
| 1439 | 3300053177 | Ga0500636_0067038 | Ga0500636_0067038_751_1698 | 315 |
| 1440 | 3300053177 | Ga0500636_0126036 | Ga0500636_0126036_444_1391 | 315 |
| 1441 | 3300053177 | Ga0500636_0220568 | Ga0500636_0220568_18_965 | 315 |
| 1442 | 3300053178 | Ga0500637_0001280 | Ga0500637_0001280_2124_3071 | 315 |
| 1443 | 3300053178 | Ga0500637_0001814 | Ga0500637_0001814_4160_5107 | 315 |
| 1444 | 3300053178 | Ga0500637_0138128 | Ga0500637_0138128_192_1139 | 315 |
| 1445 | 3300053729 | Ga0500625_118975 | Ga0500625_118975_69_1016 | 315 |
| 1446 | 3300053730 | Ga0500645_014952 | Ga0500645_014952_425_1372 | 315 |
| 1447 | 3300053730 | Ga0500645_041853 | Ga0500645_041853_28_975 | 315 |
| 1448 | 3300053731 | Ga0500609_006142 | Ga0500609_006142_627_1574 | 315 |
| 1449 | 3300053735 | Ga0500596_000644 | Ga0500596_000644_4998_5945 | 315 |
| 1450 | 3300053735 | Ga0500596_008419 | Ga0500596_008419_156_1103 | 315 |
| 1451 | 3300053736 | Ga0500599_002539 | Ga0500599_002539_1131_2078 | 315 |
| 1452 | 3300053737 | Ga0500601_003142 | Ga0500601_003142_734_1681 | 315 |
| 1453 | 3300055283 | Ga0500661_001546 | Ga0500661_001546_656_1603 | 315 |
| 1454 | 3300060353 | Ga0501082_0000040 | Ga0501082_0000040_89713_90660 | 315 |
| 1455 | iso_pu_bacteria | 8006964411 | 8006965879 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p0y-assembly1.cif.gz_A | crystal structure of mtbmgl k74a (substrate analog complex) | 0.8617 | 15 | 306 |
| 7l4u-assembly1.cif.gz_A | crystal structure of human monoacylglycerol lipase in complex with compound 1h | 0.8539 | 17 | 309 |
| 3jw8-assembly1.cif.gz_A | crystal structure of human mono-glyceride lipase | 0.852 | 17 | 309 |
| 7p0y-assembly2.cif.gz_B | crystal structure of mtbmgl k74a (substrate analog complex) | 0.8453 | 16 | 306 |
| 7p0y-assembly1.cif.gz_A | crystal structure of mtbmgl k74a (substrate analog complex) | 0.8418 | 15 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07000_24_333_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9237 | 14 | 312 | 3.40.50.1820 |
| af_P07000_24_333_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8894 | 14 | 312 | 3.40.50.1820 |
| af_A0A1D6K8I4_16_172_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8779 | 16 | 151 | 3.40.50.1820 |
| af_O07427_2_279_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8634 | 15 | 306 | 3.40.50.1820 |
| 3hjuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8468 | 17 | 309 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B6M5C1-F1-model_v4 | Alpha/beta hydrolase | 0.9808 | 1 | 314 |
GO:0016787
|
| AF-A0A2H6J2D2-F1-model_v4 | Lysophospholipase L2 | 0.9782 | 20 | 311 |
|
| AF-A0A7X3MT80-F1-model_v4 | Alpha/beta fold hydrolase | 0.9761 | 1 | 312 |
GO:0016787
|
| AF-A0A4R2GU98-F1-model_v4 | Lysophospholipase | 0.9752 | 1 | 311 |
|
| AF-A0A8B6M5C1-F1-model_v4 | Alpha/beta hydrolase | 0.9747 | 1 | 314 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar