F493867
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1425 | 621 | 1263 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300033442|Ga0315911_1000021|Ga0315911_100002115 |
| Length | 404 |
| Sequence | MSVASSRRIGPGALPAAQGGHSGRVRPDAGIGRGPGAKARRLLPAATYDTIQSPICFRLWKPMPRRKFDWEKLTDEQLLAQPLSRLRVAVEGTWLADCVNTLYEELEERGVRLRPHTWISSEWFSPADVPGIAIPFYLAHPRLMKLEKKMMLDVEGASWSECMAILRHEAGHAVQHGYQLQRRRRWQQLFGPSSQHYPRYYRPNPASRNYVQHLRLWYAQSHPDEDFAETFAVWLRPRSNWRTRYAGWPALKKLEYVDELMGEIAGKRPLLATRERVDPLHTLKQTLAEHYRKKQAFYAFTPPKTYDRDLSKLFSADPRHYRRPPAAAFIRRHRAQIRQLVARWTGENQLTLDAVLDDMISRCRELNLRAVGPEQKLVTNFTILLTAKTMHALFGPSRRKWIAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 19 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 20 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 21 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 24 | 2791355199 | |||
| 25 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 26 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 27 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 28 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 29 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 32 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 33 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 34 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 35 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 36 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 37 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 38 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 39 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 40 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 41 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 42 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 43 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 44 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 45 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 46 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 47 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 48 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 49 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 50 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 51 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 52 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 53 | 2904699407 | |||
| 54 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 55 | 2906610324 | |||
| 56 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 57 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 58 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 59 | 2922368715 | |||
| 60 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 61 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 62 | 2922425934 | |||
| 63 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 64 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 65 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 66 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 67 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 68 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 69 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 70 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 71 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 72 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 73 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 74 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 75 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 76 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 77 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 78 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 79 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 80 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 81 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 82 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 83 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 84 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 85 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 86 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 87 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 88 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 89 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 90 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 91 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 92 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 93 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 94 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 95 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 96 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 97 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 98 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 99 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 100 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 101 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 102 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 103 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 104 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 105 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 106 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 107 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 108 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 109 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 110 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 111 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 112 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 113 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 114 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 115 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 116 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 117 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 118 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 119 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 120 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 121 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 122 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 123 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 124 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 125 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 126 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 127 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 128 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 129 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 130 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 131 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 132 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 133 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 135 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 136 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 137 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 138 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 142 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 144 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 145 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 147 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 149 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 151 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 175 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 179 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 186 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 188 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 189 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 190 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 191 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 192 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 193 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 194 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 195 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 196 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 197 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 198 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 199 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 200 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 201 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 202 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 203 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 204 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 206 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 207 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 208 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 209 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 213 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 214 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 215 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 217 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 218 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 219 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 220 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 221 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 222 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 223 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 224 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 225 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 227 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 228 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 229 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 230 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 245 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 261 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 263 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 266 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 334 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 337 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 341 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 342 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 343 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 344 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 345 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 346 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 347 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 348 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 350 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 351 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 352 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 353 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 354 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 355 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 356 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 357 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 358 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 359 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 360 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 361 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 362 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 363 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 364 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 365 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 366 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 367 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 368 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 369 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 370 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 372 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 373 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 374 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 375 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 376 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 377 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 378 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 379 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 380 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 382 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 383 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 384 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 385 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 386 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 387 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 388 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 389 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 390 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 391 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 392 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 393 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 394 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 395 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 396 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 397 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 398 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 399 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 480 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 481 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 482 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 483 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 484 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 485 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 488 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 489 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 490 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 491 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 492 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 493 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 494 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 495 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 496 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 497 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 498 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 499 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 500 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 501 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 502 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 503 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 533 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 534 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 535 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 536 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 537 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 538 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 539 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 540 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 549 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 553 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 557 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 558 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 559 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 560 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 561 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 562 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 564 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 565 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 566 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 567 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 568 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 569 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 570 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 571 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 573 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 574 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 575 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 576 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 577 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 579 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 580 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 581 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 582 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 583 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 586 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 587 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 588 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 589 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 590 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 591 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 592 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 593 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 594 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 595 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 596 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 597 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 598 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 599 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 600 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 601 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 602 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 603 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 604 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 605 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 606 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 607 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 608 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 609 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 610 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 611 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 612 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 613 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 614 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 615 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 616 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 617 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 618 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 619 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 620 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 621 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.94 |
| Metatranscriptomes | 0 |
| Isolates | 11.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.93 |
| Nodule | 10.04 |
| Rhizoplane | 6.74 |
| Rhizosphere | 70.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10019573 | 3300001990 | Bacteria | 2164 |
| 2 | JGI24743J22301_10011395 | 3300001991 | Bacteria | 1601 |
| 3 | JGI24750J21931_1007354 | 3300002070 | Bacteria | 1386 |
| 4 | JGI24738J21930_10019661 | 3300002075 | Bacteria | 1407 |
| 5 | JGI24744J21845_10006724 | 3300002077 | Bacteria | 2379 |
| 6 | JGI25406J46586_10000068 | 3300003203 | Bacteria | 47530 |
| 7 | JGI25153J46596_10005581 | 3300003215 | Bacteria | 6577 |
| 8 | Ga0055542_1005310 | 3300003762 | Bacteria | 2935 |
| 9 | Ga0065165_1001267 | 3300005262 | Bacteria | 28574 |
| 10 | Ga0065165_1002212 | 3300005262 | Bacteria | 17380 |
| 11 | Ga0065712_10084473 | 3300005290 | Bacteria | 2760 |
| 12 | Ga0070658_10185375 | 3300005327 | Bacteria | 1752 |
| 13 | Ga0070676_10008503 | 3300005328 | Bacteria | 5533 |
| 14 | Ga0070676_10162852 | 3300005328 | Bacteria | 1437 |
| 15 | Ga0070683_100008412 | 3300005329 | Bacteria | 8761 |
| 16 | Ga0070683_100031382 | 3300005329 | Unclassified | 4830 |
| 17 | Ga0070683_100100301 | 3300005329 | Bacteria | 2726 |
| 18 | Ga0070683_100127712 | 3300005329 | Bacteria | 2404 |
| 19 | Ga0070690_100017752 | 3300005330 | Bacteria | 4287 |
| 20 | Ga0070690_100069739 | 3300005330 | Bacteria | 2282 |
| 21 | Ga0070670_100002030 | 3300005331 | Bacteria | 16570 |
| 22 | Ga0070670_100067088 | 3300005331 | Bacteria | 3079 |
| 23 | Ga0070670_100130805 | 3300005331 | Bacteria | 2167 |
| 24 | Ga0068869_100107594 | 3300005334 | Bacteria | 2117 |
| 25 | Ga0070680_100010166 | 3300005336 | Bacteria | 7257 |
| 26 | Ga0070680_100047355 | 3300005336 | Bacteria | 3500 |
| 27 | Ga0070680_100056430 | 3300005336 | Bacteria | 3210 |
| 28 | Ga0070682_100064243 | 3300005337 | Bacteria | 2329 |
| 29 | Ga0070682_100088855 | 3300005337 | Bacteria | 2018 |
| 30 | Ga0070682_100117730 | 3300005337 | Bacteria | 1779 |
| 31 | Ga0070682_100199070 | 3300005337 | Bacteria | 1412 |
| 32 | Ga0068868_100015981 | 3300005338 | Bacteria | 5566 |
| 33 | Ga0068868_100038297 | 3300005338 | Bacteria | 3722 |
| 34 | Ga0068868_100058595 | 3300005338 | Bacteria | 3044 |
| 35 | Ga0068868_100229815 | 3300005338 | Bacteria | 1556 |
| 36 | Ga0070660_100008984 | 3300005339 | Bacteria | 7010 |
| 37 | Ga0070660_100036860 | 3300005339 | Bacteria | 3705 |
| 38 | Ga0070660_100056660 | 3300005339 | Bacteria | 3033 |
| 39 | Ga0070660_100063926 | 3300005339 | Bacteria | 2862 |
| 40 | Ga0070660_100380136 | 3300005339 | Bacteria | 1166 |
| 41 | Ga0070689_100002079 | 3300005340 | Bacteria | 13007 |
| 42 | Ga0070689_100070947 | 3300005340 | Bacteria | 2721 |
| 43 | Ga0070689_100108664 | 3300005340 | Bacteria | 2204 |
| 44 | Ga0070691_10052213 | 3300005341 | Bacteria | 1955 |
| 45 | Ga0070687_100027140 | 3300005343 | Bacteria | 2762 |
| 46 | Ga0070661_100022921 | 3300005344 | Bacteria | 4473 |
| 47 | Ga0070661_100049192 | 3300005344 | Bacteria | 3086 |
| 48 | Ga0070661_100092167 | 3300005344 | Bacteria | 2245 |
| 49 | Ga0070692_10012291 | 3300005345 | Unclassified | 3958 |
| 50 | Ga0070668_100003473 | 3300005347 | Bacteria | 11631 |
| 51 | Ga0070668_100005028 | 3300005347 | Bacteria | 9796 |
| 52 | Ga0070668_100008936 | 3300005347 | Bacteria | 7438 |
| 53 | Ga0070668_100050729 | 3300005347 | Bacteria | 3195 |
| 54 | Ga0070668_100141361 | 3300005347 | Bacteria | 1940 |
| 55 | Ga0070668_100314952 | 3300005347 | Bacteria | 1316 |
| 56 | Ga0070669_100001136 | 3300005353 | Bacteria | 19444 |
| 57 | Ga0070669_100014984 | 3300005353 | Bacteria | 5526 |
| 58 | Ga0070669_100042153 | 3300005353 | Bacteria | 3321 |
| 59 | Ga0070669_100077593 | 3300005353 | Bacteria | 2468 |
| 60 | Ga0070669_100163424 | 3300005353 | Bacteria | 1732 |
| 61 | Ga0070675_100000365 | 3300005354 | Bacteria | 30549 |
| 62 | Ga0070675_100027181 | 3300005354 | Bacteria | 4595 |
| 63 | Ga0070675_100235237 | 3300005354 | Bacteria | 1599 |
| 64 | Ga0070671_100063210 | 3300005355 | Bacteria | 3082 |
| 65 | Ga0070671_100094583 | 3300005355 | Bacteria | 2505 |
| 66 | Ga0070671_100133082 | 3300005355 | Bacteria | 2095 |
| 67 | Ga0070671_100227527 | 3300005355 | Bacteria | 1582 |
| 68 | Ga0070671_100286405 | 3300005355 | Bacteria | 1402 |
| 69 | Ga0070674_100001469 | 3300005356 | Bacteria | 12578 |
| 70 | Ga0070674_100010211 | 3300005356 | Bacteria | 5664 |
| 71 | Ga0070674_100013870 | 3300005356 | Bacteria | 4993 |
| 72 | Ga0070674_100201057 | 3300005356 | Bacteria | 1539 |
| 73 | Ga0070673_100014104 | 3300005364 | Bacteria | 5552 |
| 74 | Ga0070673_100021133 | 3300005364 | Unclassified | 4710 |
| 75 | Ga0070659_100011386 | 3300005366 | Bacteria | 6580 |
| 76 | Ga0070659_100022782 | 3300005366 | Unclassified | 4784 |
| 77 | Ga0070659_100053883 | 3300005366 | Bacteria | 3167 |
| 78 | Ga0070659_100280344 | 3300005366 | Bacteria | 1386 |
| 79 | Ga0070667_100116021 | 3300005367 | Bacteria | 2326 |
| 80 | Ga0070667_100186583 | 3300005367 | Bacteria | 1835 |
| 81 | Ga0070667_100268332 | 3300005367 | Bacteria | 1530 |
| 82 | Ga0070709_10005439 | 3300005434 | Bacteria | 6901 |
| 83 | Ga0070714_100050305 | 3300005435 | Bacteria | 3549 |
| 84 | Ga0070714_100055629 | 3300005435 | Bacteria | 3382 |
| 85 | Ga0070714_100170156 | 3300005435 | Bacteria | 1977 |
| 86 | Ga0070713_100003900 | 3300005436 | Bacteria | 9890 |
| 87 | Ga0070713_100028893 | 3300005436 | Bacteria | 4382 |
| 88 | Ga0070713_100059482 | 3300005436 | Bacteria | 3191 |
| 89 | Ga0070713_100116509 | 3300005436 | Bacteria | 2337 |
| 90 | Ga0070713_100186122 | 3300005436 | Bacteria | 1869 |
| 91 | Ga0070710_10001798 | 3300005437 | Bacteria | 10141 |
| 92 | Ga0070710_10211345 | 3300005437 | Bacteria | 1230 |
| 93 | Ga0070701_10029808 | 3300005438 | Bacteria | 2694 |
| 94 | Ga0070711_100013041 | 3300005439 | Bacteria | 5211 |
| 95 | Ga0070711_100018744 | 3300005439 | Bacteria | 4426 |
| 96 | Ga0070705_100142388 | 3300005440 | Bacteria | 1580 |
| 97 | Ga0070700_100035554 | 3300005441 | Bacteria | 3015 |
| 98 | Ga0070694_100051836 | 3300005444 | Bacteria | 2772 |
| 99 | Ga0070663_100029554 | 3300005455 | Bacteria | 3747 |
| 100 | Ga0070663_100052831 | 3300005455 | Bacteria | 2899 |
| 101 | Ga0070663_100063228 | 3300005455 | Bacteria | 2671 |
| 102 | Ga0070663_100107121 | 3300005455 | Bacteria | 2095 |
| 103 | Ga0070663_100231776 | 3300005455 | Bacteria | 1454 |
| 104 | Ga0070678_100033164 | 3300005456 | Bacteria | 3582 |
| 105 | Ga0070678_100052389 | 3300005456 | Bacteria | 2963 |
| 106 | Ga0070678_100058201 | 3300005456 | Bacteria | 2836 |
| 107 | Ga0070678_100218123 | 3300005456 | Bacteria | 1584 |
| 108 | Ga0070662_100003276 | 3300005457 | Bacteria | 10076 |
| 109 | Ga0070662_100009040 | 3300005457 | Bacteria | 6500 |
| 110 | Ga0070662_100095431 | 3300005457 | Bacteria | 2241 |
| 111 | Ga0070662_100209673 | 3300005457 | Bacteria | 1550 |
| 112 | Ga0070681_10000803 | 3300005458 | Bacteria | 26193 |
| 113 | Ga0070681_10005772 | 3300005458 | Bacteria | 11970 |
| 114 | Ga0070681_10009474 | 3300005458 | Bacteria | 9581 |
| 115 | Ga0070681_10018371 | 3300005458 | Bacteria | 6988 |
| 116 | Ga0070681_10237166 | 3300005458 | Bacteria | 1738 |
| 117 | Ga0068867_100038385 | 3300005459 | Bacteria | 3486 |
| 118 | Ga0068867_100083365 | 3300005459 | Bacteria | 2413 |
| 119 | Ga0070685_10006952 | 3300005466 | Bacteria | 5773 |
| 120 | Ga0070679_100002259 | 3300005530 | Bacteria | 17397 |
| 121 | Ga0070679_100012689 | 3300005530 | Bacteria | 8059 |
| 122 | Ga0070679_100040035 | 3300005530 | Bacteria | 4661 |
| 123 | Ga0070679_100041099 | 3300005530 | Bacteria | 4603 |
| 124 | Ga0070679_100069283 | 3300005530 | Bacteria | 3518 |
| 125 | Ga0070684_100011823 | 3300005535 | Bacteria | 6967 |
| 126 | Ga0070684_100015025 | 3300005535 | Bacteria | 6289 |
| 127 | Ga0070684_100026088 | 3300005535 | Bacteria | 4918 |
| 128 | Ga0070684_100092323 | 3300005535 | Bacteria | 2693 |
| 129 | Ga0068853_100005704 | 3300005539 | Bacteria | 9794 |
| 130 | Ga0068853_100037040 | 3300005539 | Bacteria | 4149 |
| 131 | Ga0068853_100192111 | 3300005539 | Bacteria | 1855 |
| 132 | Ga0070672_100030675 | 3300005543 | Bacteria | 4041 |
| 133 | Ga0070672_100049384 | 3300005543 | Unclassified | 3273 |
| 134 | Ga0070686_100095878 | 3300005544 | Bacteria | 1994 |
| 135 | Ga0070695_100255654 | 3300005545 | Bacteria | 1277 |
| 136 | Ga0070693_100047826 | 3300005547 | Bacteria | 2435 |
| 137 | Ga0070665_100007164 | 3300005548 | Bacteria | 11337 |
| 138 | Ga0070665_100008973 | 3300005548 | Bacteria | 10132 |
| 139 | Ga0070665_100056210 | 3300005548 | Bacteria | 3946 |
| 140 | Ga0070665_100063248 | 3300005548 | Bacteria | 3710 |
| 141 | Ga0070665_100076145 | 3300005548 | Bacteria | 3362 |
| 142 | Ga0070665_100083982 | 3300005548 | Bacteria | 3189 |
| 143 | Ga0070665_100087729 | 3300005548 | Bacteria | 3117 |
| 144 | Ga0070665_100089898 | 3300005548 | Bacteria | 3076 |
| 145 | Ga0070665_100159456 | 3300005548 | Bacteria | 2258 |
| 146 | Ga0070665_100168286 | 3300005548 | Bacteria | 2193 |
| 147 | Ga0070665_100313465 | 3300005548 | Bacteria | 1573 |
| 148 | Ga0070665_100595571 | 3300005548 | Bacteria | 1118 |
| 149 | Ga0070704_100062298 | 3300005549 | Bacteria | 2673 |
| 150 | Ga0068855_100011649 | 3300005563 | Bacteria | 10627 |
| 151 | Ga0068855_100063155 | 3300005563 | Bacteria | 4322 |
| 152 | Ga0068855_100068502 | 3300005563 | Unclassified | 4132 |
| 153 | Ga0068855_100238162 | 3300005563 | Bacteria | 2034 |
| 154 | Ga0070664_100038829 | 3300005564 | Bacteria | 4009 |
| 155 | Ga0068857_100004346 | 3300005577 | Bacteria | 11963 |
| 156 | Ga0068857_100065042 | 3300005577 | Bacteria | 3242 |
| 157 | Ga0068857_100081157 | 3300005577 | Bacteria | 2896 |
| 158 | Ga0068857_100108215 | 3300005577 | Bacteria | 2497 |
| 159 | Ga0068857_100132753 | 3300005577 | Bacteria | 2246 |
| 160 | Ga0068857_100202136 | 3300005577 | Bacteria | 1811 |
| 161 | Ga0068857_100233711 | 3300005577 | Bacteria | 1682 |
| 162 | Ga0068854_100289362 | 3300005578 | Bacteria | 1322 |
| 163 | Ga0068856_100117640 | 3300005614 | Bacteria | 2659 |
| 164 | Ga0068859_100077580 | 3300005617 | Bacteria | 3363 |
| 165 | Ga0068864_100158708 | 3300005618 | Bacteria | 2055 |
| 166 | Ga0068864_100261910 | 3300005618 | Unclassified | 1609 |
| 167 | Ga0068866_10027847 | 3300005718 | Bacteria | 2687 |
| 168 | Ga0068861_100000284 | 3300005719 | Bacteria | 28457 |
| 169 | Ga0068861_100010236 | 3300005719 | Bacteria | 6510 |
| 170 | Ga0068861_100013725 | 3300005719 | Bacteria | 5672 |
| 171 | Ga0068861_100069713 | 3300005719 | Bacteria | 2721 |
| 172 | Ga0068861_100151221 | 3300005719 | Bacteria | 1905 |
| 173 | Ga0068851_10041856 | 3300005834 | Bacteria | 2304 |
| 174 | Ga0068870_10024962 | 3300005840 | Unclassified | 2963 |
| 175 | Ga0068863_100031099 | 3300005841 | Bacteria | 5097 |
| 176 | Ga0068863_100054261 | 3300005841 | Bacteria | 3797 |
| 177 | Ga0068858_100025802 | 3300005842 | Bacteria | 5466 |
| 178 | Ga0068858_100072777 | 3300005842 | Bacteria | 3189 |
| 179 | Ga0068858_100355599 | 3300005842 | Bacteria | 1403 |
| 180 | Ga0068860_100058958 | 3300005843 | Bacteria | 3650 |
| 181 | Ga0068860_100081538 | 3300005843 | Bacteria | 3076 |
| 182 | Ga0068860_100375190 | 3300005843 | Bacteria | 1403 |
| 183 | Ga0068860_100393008 | 3300005843 | Bacteria | 1371 |
| 184 | Ga0068862_100004978 | 3300005844 | Bacteria | 11182 |
| 185 | Ga0068862_100007523 | 3300005844 | Bacteria | 9026 |
| 186 | Ga0068862_100013165 | 3300005844 | Bacteria | 6841 |
| 187 | Ga0068862_100056023 | 3300005844 | Bacteria | 3377 |
| 188 | Ga0068862_100378005 | 3300005844 | Bacteria | 1321 |
| 189 | Ga0081455_10009408 | 3300005937 | Bacteria | 10053 |
| 190 | Ga0081455_10009980 | 3300005937 | Bacteria | 9706 |
| 191 | Ga0081455_10012824 | 3300005937 | Bacteria | 8326 |
| 192 | Ga0081455_10016677 | 3300005937 | Bacteria | 7076 |
| 193 | Ga0081455_10065066 | 3300005937 | Bacteria | 3051 |
| 194 | Ga0081455_10128565 | 3300005937 | Bacteria | 1984 |
| 195 | Ga0081538_10005709 | 3300005981 | Bacteria | 11126 |
| 196 | Ga0081538_10026886 | 3300005981 | Bacteria | 4008 |
| 197 | Ga0081540_1000183 | 3300005983 | Bacteria | 65356 |
| 198 | Ga0081540_1003056 | 3300005983 | Bacteria | 13411 |
| 199 | Ga0081540_1008688 | 3300005983 | Bacteria | 7074 |
| 200 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 201 | Ga0081539_10001182 | 3300005985 | Bacteria | 47183 |
| 202 | Ga0081539_10061942 | 3300005985 | Bacteria | 2047 |
| 203 | Ga0070717_10027462 | 3300006028 | Bacteria | 4549 |
| 204 | Ga0070717_10031115 | 3300006028 | Bacteria | 4291 |
| 205 | Ga0070717_10194695 | 3300006028 | Bacteria | 1773 |
| 206 | Ga0075365_10004659 | 3300006038 | Bacteria | 7303 |
| 207 | Ga0075365_10027773 | 3300006038 | Bacteria | 3604 |
| 208 | Ga0075365_10049112 | 3300006038 | Bacteria | 2779 |
| 209 | Ga0075365_10092380 | 3300006038 | Bacteria | 2063 |
| 210 | Ga0075368_10002227 | 3300006042 | Bacteria | 6299 |
| 211 | Ga0075368_10004796 | 3300006042 | Bacteria | 4608 |
| 212 | Ga0075363_100000166 | 3300006048 | Bacteria | 16960 |
| 213 | Ga0075363_100005847 | 3300006048 | Bacteria | 5531 |
| 214 | Ga0075363_100026460 | 3300006048 | Bacteria | 2968 |
| 215 | Ga0075363_100032687 | 3300006048 | Bacteria | 2704 |
| 216 | Ga0075364_10014523 | 3300006051 | Bacteria | 4868 |
| 217 | Ga0075364_10018041 | 3300006051 | Bacteria | 4414 |
| 218 | Ga0075364_10061957 | 3300006051 | Bacteria | 2454 |
| 219 | Ga0075364_10306447 | 3300006051 | Bacteria | 1081 |
| 220 | Ga0070715_10001747 | 3300006163 | Bacteria | 6466 |
| 221 | Ga0070715_10105233 | 3300006163 | Bacteria | 1323 |
| 222 | Ga0070716_100006717 | 3300006173 | Bacteria | 5634 |
| 223 | Ga0070712_100012868 | 3300006175 | Bacteria | 5330 |
| 224 | Ga0070712_100013408 | 3300006175 | Bacteria | 5239 |
| 225 | Ga0070712_100129971 | 3300006175 | Bacteria | 1907 |
| 226 | Ga0070712_100209200 | 3300006175 | Bacteria | 1537 |
| 227 | Ga0070712_100405114 | 3300006175 | Bacteria | 1127 |
| 228 | Ga0075362_10002371 | 3300006177 | Bacteria | 6305 |
| 229 | Ga0075362_10006411 | 3300006177 | Bacteria | 4386 |
| 230 | Ga0075362_10018509 | 3300006177 | Bacteria | 2883 |
| 231 | Ga0075362_10023654 | 3300006177 | Bacteria | 2601 |
| 232 | Ga0075362_10113389 | 3300006177 | Bacteria | 1278 |
| 233 | Ga0075367_10000604 | 3300006178 | Bacteria | 13811 |
| 234 | Ga0075367_10010376 | 3300006178 | Bacteria | 4893 |
| 235 | Ga0075367_10013424 | 3300006178 | Bacteria | 4403 |
| 236 | Ga0075367_10100784 | 3300006178 | Bacteria | 1765 |
| 237 | Ga0075367_10114927 | 3300006178 | Bacteria | 1655 |
| 238 | Ga0075366_10000580 | 3300006195 | Bacteria | 17184 |
| 239 | Ga0075366_10002268 | 3300006195 | Bacteria | 9819 |
| 240 | Ga0075366_10022553 | 3300006195 | Bacteria | 3663 |
| 241 | Ga0075366_10028218 | 3300006195 | Bacteria | 3294 |
| 242 | Ga0075366_10030929 | 3300006195 | Bacteria | 3148 |
| 243 | Ga0075366_10123396 | 3300006195 | Bacteria | 1562 |
| 244 | Ga0097621_100023425 | 3300006237 | Bacteria | 4809 |
| 245 | Ga0097621_100149457 | 3300006237 | Bacteria | 2002 |
| 246 | Ga0075370_10011797 | 3300006353 | Bacteria | 4601 |
| 247 | Ga0075370_10036607 | 3300006353 | Bacteria | 2757 |
| 248 | Ga0075370_10042391 | 3300006353 | Bacteria | 2571 |
| 249 | Ga0075370_10046819 | 3300006353 | Bacteria | 2448 |
| 250 | Ga0068871_100176216 | 3300006358 | Bacteria | 1836 |
| 251 | Ga0075428_100001227 | 3300006844 | Bacteria | 27447 |
| 252 | Ga0075428_100024804 | 3300006844 | Bacteria | 6634 |
| 253 | Ga0075428_100040276 | 3300006844 | Bacteria | 5141 |
| 254 | Ga0075428_100224006 | 3300006844 | Bacteria | 2030 |
| 255 | Ga0075428_100246218 | 3300006844 | Unclassified | 1927 |
| 256 | Ga0075430_100000015 | 3300006846 | Bacteria | 89952 |
| 257 | Ga0075430_100001819 | 3300006846 | Bacteria | 17456 |
| 258 | Ga0075430_100008228 | 3300006846 | Bacteria | 8810 |
| 259 | Ga0075430_100012216 | 3300006846 | Bacteria | 7312 |
| 260 | Ga0075430_100096955 | 3300006846 | Bacteria | 2464 |
| 261 | Ga0075431_100000169 | 3300006847 | Bacteria | 46379 |
| 262 | Ga0075431_100032668 | 3300006847 | Bacteria | 5363 |
| 263 | Ga0075431_100043586 | 3300006847 | Bacteria | 4628 |
| 264 | Ga0075431_100224885 | 3300006847 | Bacteria | 1913 |
| 265 | Ga0075431_100514629 | 3300006847 | Bacteria | 1187 |
| 266 | Ga0075433_10010808 | 3300006852 | Bacteria | 7342 |
| 267 | Ga0075433_10034944 | 3300006852 | Unclassified | 4320 |
| 268 | Ga0075433_10237533 | 3300006852 | Bacteria | 1618 |
| 269 | Ga0075433_10241602 | 3300006852 | Bacteria | 1603 |
| 270 | Ga0075433_10344231 | 3300006852 | Bacteria | 1318 |
| 271 | Ga0075434_100004164 | 3300006871 | Bacteria | 12962 |
| 272 | Ga0075434_100044403 | 3300006871 | Bacteria | 4409 |
| 273 | Ga0075434_100052054 | 3300006871 | Bacteria | 4068 |
| 274 | Ga0075434_100065245 | 3300006871 | Bacteria | 3626 |
| 275 | Ga0075434_100162467 | 3300006871 | Bacteria | 2253 |
| 276 | Ga0075434_100371631 | 3300006871 | Bacteria | 1451 |
| 277 | Ga0075429_100012855 | 3300006880 | Bacteria | 7262 |
| 278 | Ga0075429_100146323 | 3300006880 | Bacteria | 2068 |
| 279 | Ga0068865_100007637 | 3300006881 | Bacteria | 6658 |
| 280 | Ga0068865_100039365 | 3300006881 | Bacteria | 3206 |
| 281 | Ga0068865_100351172 | 3300006881 | Bacteria | 1195 |
| 282 | Ga0097620_100077578 | 3300006931 | Bacteria | 3363 |
| 283 | Ga0099825_1028576 | 3300006941 | Bacteria | 2695 |
| 284 | Ga0099824_1015348 | 3300006942 | Bacteria | 7278 |
| 285 | Ga0099823_1022490 | 3300006944 | Bacteria | 5831 |
| 286 | Ga0099795_10004625 | 3300007788 | Bacteria | 3573 |
| 287 | Ga0099795_10083585 | 3300007788 | Bacteria | 1226 |
| 288 | Ga0105251_10028427 | 3300009011 | Bacteria | 2824 |
| 289 | Ga0105250_10032821 | 3300009092 | Bacteria | 2084 |
| 290 | Ga0105240_10004107 | 3300009093 | Bacteria | 22352 |
| 291 | Ga0105240_10026526 | 3300009093 | Bacteria | 7602 |
| 292 | Ga0105240_10045477 | 3300009093 | Bacteria | 5568 |
| 293 | Ga0105240_10135542 | 3300009093 | Bacteria | 2949 |
| 294 | Ga0105240_10239306 | 3300009093 | Bacteria | 2105 |
| 295 | Ga0111539_10013148 | 3300009094 | Bacteria | 10352 |
| 296 | Ga0111539_10083128 | 3300009094 | Bacteria | 3766 |
| 297 | Ga0111539_10149736 | 3300009094 | Bacteria | 2732 |
| 298 | Ga0111539_10216621 | 3300009094 | Bacteria | 2230 |
| 299 | Ga0111539_10378641 | 3300009094 | Bacteria | 1648 |
| 300 | Ga0111539_10555105 | 3300009094 | Unclassified | 1338 |
| 301 | Ga0105245_10017466 | 3300009098 | Bacteria | 6258 |
| 302 | Ga0105245_10308143 | 3300009098 | Bacteria | 1556 |
| 303 | Ga0105245_10388370 | 3300009098 | Bacteria | 1392 |
| 304 | Ga0105247_10104863 | 3300009101 | Bacteria | 1812 |
| 305 | Ga0114129_10000539 | 3300009147 | Bacteria | 46397 |
| 306 | Ga0114129_10004331 | 3300009147 | Bacteria | 20067 |
| 307 | Ga0114129_10142212 | 3300009147 | Bacteria | 3288 |
| 308 | Ga0114129_10391778 | 3300009147 | Unclassified | 1832 |
| 309 | Ga0105243_10018265 | 3300009148 | Bacteria | 5310 |
| 310 | Ga0105243_10155513 | 3300009148 | Bacteria | 1966 |
| 311 | Ga0105243_10400426 | 3300009148 | Bacteria | 1275 |
| 312 | Ga0105241_10141983 | 3300009174 | Bacteria | 1956 |
| 313 | Ga0105241_10324383 | 3300009174 | Bacteria | 1329 |
| 314 | Ga0105242_10057384 | 3300009176 | Bacteria | 3188 |
| 315 | Ga0105242_10061315 | 3300009176 | Bacteria | 3093 |
| 316 | Ga0105248_10031690 | 3300009177 | Bacteria | 5906 |
| 317 | Ga0105248_10034403 | 3300009177 | Bacteria | 5665 |
| 318 | Ga0105248_10099062 | 3300009177 | Bacteria | 3284 |
| 319 | Ga0105248_10136802 | 3300009177 | Bacteria | 2764 |
| 320 | Ga0105237_10001334 | 3300009545 | Bacteria | 32733 |
| 321 | Ga0105237_10033636 | 3300009545 | Bacteria | 5195 |
| 322 | Ga0105237_10093492 | 3300009545 | Bacteria | 2996 |
| 323 | Ga0105237_10101046 | 3300009545 | Bacteria | 2876 |
| 324 | Ga0105237_10114249 | 3300009545 | Bacteria | 2693 |
| 325 | Ga0105237_10117998 | 3300009545 | Bacteria | 2647 |
| 326 | Ga0105237_10119001 | 3300009545 | Bacteria | 2635 |
| 327 | Ga0105237_10338413 | 3300009545 | Bacteria | 1509 |
| 328 | Ga0105238_10001553 | 3300009551 | Bacteria | 23043 |
| 329 | Ga0105238_10005684 | 3300009551 | Bacteria | 12325 |
| 330 | Ga0105238_10018456 | 3300009551 | Bacteria | 7099 |
| 331 | Ga0105238_10018513 | 3300009551 | Bacteria | 7088 |
| 332 | Ga0105238_10192947 | 3300009551 | Bacteria | 2013 |
| 333 | Ga0105238_10287986 | 3300009551 | Bacteria | 1624 |
| 334 | Ga0105249_10000856 | 3300009553 | Bacteria | 27157 |
| 335 | Ga0105249_10016849 | 3300009553 | Bacteria | 6484 |
| 336 | Ga0105249_10018300 | 3300009553 | Bacteria | 6229 |
| 337 | Ga0099796_10037762 | 3300010159 | Bacteria | 1616 |
| 338 | Ga0105239_10009663 | 3300010375 | Bacteria | 10847 |
| 339 | Ga0105239_10133472 | 3300010375 | Bacteria | 2763 |
| 340 | Ga0105246_10003290 | 3300011119 | Bacteria | 9789 |
| 341 | Ga0105246_10044929 | 3300011119 | Bacteria | 3005 |
| 342 | Ga0157371_10016750 | 3300013102 | Bacteria | 5460 |
| 343 | Ga0157371_10032500 | 3300013102 | Bacteria | 3754 |
| 344 | Ga0157370_10002576 | 3300013104 | Bacteria | 21765 |
| 345 | Ga0157370_10100170 | 3300013104 | Bacteria | 2715 |
| 346 | Ga0157370_10180961 | 3300013104 | Bacteria | 1959 |
| 347 | Ga0157369_10012266 | 3300013105 | Bacteria | 9733 |
| 348 | Ga0157369_10013341 | 3300013105 | Bacteria | 9293 |
| 349 | Ga0157369_10018334 | 3300013105 | Bacteria | 7848 |
| 350 | Ga0157374_10045869 | 3300013296 | Bacteria | 4045 |
| 351 | Ga0157374_10127784 | 3300013296 | Bacteria | 2458 |
| 352 | Ga0157374_10140533 | 3300013296 | Bacteria | 2344 |
| 353 | Ga0157378_10150969 | 3300013297 | Bacteria | 2165 |
| 354 | Ga0157378_10158715 | 3300013297 | Bacteria | 2113 |
| 355 | Ga0163162_10000455 | 3300013306 | Bacteria | 37915 |
| 356 | Ga0163162_10022365 | 3300013306 | Bacteria | 6231 |
| 357 | Ga0163162_10246500 | 3300013306 | Bacteria | 1918 |
| 358 | Ga0157372_10070340 | 3300013307 | Bacteria | 3937 |
| 359 | Ga0157372_10184582 | 3300013307 | Unclassified | 2415 |
| 360 | Ga0157372_10219938 | 3300013307 | Bacteria | 2201 |
| 361 | Ga0157372_10358922 | 3300013307 | Bacteria | 1698 |
| 362 | Ga0157372_10547214 | 3300013307 | Bacteria | 1349 |
| 363 | Ga0157375_10031985 | 3300013308 | Bacteria | 4984 |
| 364 | Ga0157375_10234318 | 3300013308 | Bacteria | 1995 |
| 365 | Ga0157375_10329444 | 3300013308 | Bacteria | 1692 |
| 366 | Ga0157375_10411469 | 3300013308 | Bacteria | 1519 |
| 367 | Ga0163163_10060550 | 3300014325 | Bacteria | 3749 |
| 368 | Ga0163163_10070084 | 3300014325 | Bacteria | 3491 |
| 369 | Ga0157380_10059354 | 3300014326 | Bacteria | 3052 |
| 370 | Ga0157380_10065377 | 3300014326 | Unclassified | 2923 |
| 371 | Ga0157380_10077742 | 3300014326 | Bacteria | 2705 |
| 372 | Ga0157380_10155538 | 3300014326 | Bacteria | 1981 |
| 373 | Ga0157377_10035023 | 3300014745 | Bacteria | 2751 |
| 374 | Ga0157379_10012701 | 3300014968 | Bacteria | 7361 |
| 375 | Ga0157379_10019593 | 3300014968 | Bacteria | 5976 |
| 376 | Ga0157376_10006200 | 3300014969 | Bacteria | 8427 |
| 377 | Ga0157376_10122174 | 3300014969 | Bacteria | 2310 |
| 378 | Ga0182007_10034088 | 3300015262 | Bacteria | 1722 |
| 379 | Ga0163161_10041355 | 3300017792 | Bacteria | 3313 |
| 380 | Ga0228598_1007512 | 3300024227 | Bacteria | 2217 |
| 381 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 382 | Ga0209455_1004488 | 3300025272 | Bacteria | 4542 |
| 383 | Ga0209564_1000390 | 3300025295 | Bacteria | 78822 |
| 384 | Ga0209758_1012829 | 3300025297 | Bacteria | 4642 |
| 385 | Ga0209758_1013321 | 3300025297 | Bacteria | 4496 |
| 386 | Ga0209758_1015980 | 3300025297 | Bacteria | 3843 |
| 387 | Ga0207426_1002604 | 3300025302 | Bacteria | 11200 |
| 388 | Ga0207426_1007922 | 3300025302 | Bacteria | 4379 |
| 389 | Ga0207426_1023952 | 3300025302 | Bacteria | 2077 |
| 390 | Ga0207697_10007171 | 3300025315 | Unclassified | 4985 |
| 391 | Ga0207697_10045225 | 3300025315 | Bacteria | 1812 |
| 392 | Ga0207697_10045437 | 3300025315 | Bacteria | 1808 |
| 393 | Ga0207656_10007664 | 3300025321 | Bacteria | 3944 |
| 394 | Ga0207692_10021447 | 3300025898 | Bacteria | 2956 |
| 395 | Ga0207642_10008196 | 3300025899 | Bacteria | 3572 |
| 396 | Ga0207710_10012120 | 3300025900 | Bacteria | 3623 |
| 397 | Ga0207688_10000632 | 3300025901 | Bacteria | 17308 |
| 398 | Ga0207688_10008820 | 3300025901 | Bacteria | 5488 |
| 399 | Ga0207688_10046119 | 3300025901 | Bacteria | 2433 |
| 400 | Ga0207688_10048243 | 3300025901 | Bacteria | 2379 |
| 401 | Ga0207647_10011355 | 3300025904 | Bacteria | 6251 |
| 402 | Ga0207647_10017016 | 3300025904 | Bacteria | 4950 |
| 403 | Ga0207699_10002112 | 3300025906 | Bacteria | 9388 |
| 404 | Ga0207645_10001838 | 3300025907 | Bacteria | 17100 |
| 405 | Ga0207645_10089451 | 3300025907 | Bacteria | 1980 |
| 406 | Ga0207643_10005957 | 3300025908 | Bacteria | 6513 |
| 407 | Ga0207643_10063452 | 3300025908 | Bacteria | 2112 |
| 408 | Ga0207705_10086680 | 3300025909 | Bacteria | 2289 |
| 409 | Ga0207705_10117994 | 3300025909 | Bacteria | 1966 |
| 410 | Ga0207654_10002057 | 3300025911 | Bacteria | 10321 |
| 411 | Ga0207654_10016250 | 3300025911 | Bacteria | 3872 |
| 412 | Ga0207707_10001060 | 3300025912 | Bacteria | 26355 |
| 413 | Ga0207707_10003094 | 3300025912 | Bacteria | 14759 |
| 414 | Ga0207707_10005972 | 3300025912 | Bacteria | 10654 |
| 415 | Ga0207707_10023267 | 3300025912 | Bacteria | 5421 |
| 416 | Ga0207707_10036741 | 3300025912 | Bacteria | 4282 |
| 417 | Ga0207707_10125036 | 3300025912 | Bacteria | 2249 |
| 418 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 419 | Ga0207695_10096843 | 3300025913 | Bacteria | 2952 |
| 420 | Ga0207695_10121008 | 3300025913 | Bacteria | 2586 |
| 421 | Ga0207695_10164175 | 3300025913 | Bacteria | 2150 |
| 422 | Ga0207671_10003762 | 3300025914 | Bacteria | 14939 |
| 423 | Ga0207671_10058901 | 3300025914 | Bacteria | 2848 |
| 424 | Ga0207671_10063316 | 3300025914 | Bacteria | 2748 |
| 425 | Ga0207671_10273872 | 3300025914 | Bacteria | 1330 |
| 426 | Ga0207693_10007711 | 3300025915 | Bacteria | 8837 |
| 427 | Ga0207693_10052913 | 3300025915 | Bacteria | 3185 |
| 428 | Ga0207663_10013318 | 3300025916 | Bacteria | 4467 |
| 429 | Ga0207660_10001447 | 3300025917 | Bacteria | 15929 |
| 430 | Ga0207660_10006547 | 3300025917 | Bacteria | 7557 |
| 431 | Ga0207660_10068374 | 3300025917 | Bacteria | 2576 |
| 432 | Ga0207660_10112454 | 3300025917 | Bacteria | 2051 |
| 433 | Ga0207660_10248425 | 3300025917 | Bacteria | 1404 |
| 434 | Ga0207660_10316609 | 3300025917 | Bacteria | 1245 |
| 435 | Ga0207662_10001083 | 3300025918 | Bacteria | 12798 |
| 436 | Ga0207662_10057012 | 3300025918 | Bacteria | 2334 |
| 437 | Ga0207662_10135310 | 3300025918 | Bacteria | 1557 |
| 438 | Ga0207657_10006931 | 3300025919 | Bacteria | 11677 |
| 439 | Ga0207657_10008229 | 3300025919 | Bacteria | 10616 |
| 440 | Ga0207657_10043840 | 3300025919 | Bacteria | 3937 |
| 441 | Ga0207649_10061824 | 3300025920 | Bacteria | 2359 |
| 442 | Ga0207649_10156959 | 3300025920 | Bacteria | 1573 |
| 443 | Ga0207649_10187614 | 3300025920 | Bacteria | 1452 |
| 444 | Ga0207649_10315980 | 3300025920 | Bacteria | 1146 |
| 445 | Ga0207652_10001462 | 3300025921 | Bacteria | 20904 |
| 446 | Ga0207652_10009510 | 3300025921 | Bacteria | 7816 |
| 447 | Ga0207652_10010442 | 3300025921 | Bacteria | 7474 |
| 448 | Ga0207652_10013576 | 3300025921 | Bacteria | 6588 |
| 449 | Ga0207652_10041084 | 3300025921 | Bacteria | 3930 |
| 450 | Ga0207681_10004103 | 3300025923 | Bacteria | 9028 |
| 451 | Ga0207681_10062526 | 3300025923 | Bacteria | 2564 |
| 452 | Ga0207681_10167319 | 3300025923 | Bacteria | 1663 |
| 453 | Ga0207694_10010911 | 3300025924 | Bacteria | 6862 |
| 454 | Ga0207694_10011080 | 3300025924 | Bacteria | 6809 |
| 455 | Ga0207694_10043684 | 3300025924 | Bacteria | 3459 |
| 456 | Ga0207694_10162643 | 3300025924 | Bacteria | 1804 |
| 457 | Ga0207694_10223928 | 3300025924 | Bacteria | 1535 |
| 458 | Ga0207694_10254184 | 3300025924 | Bacteria | 1438 |
| 459 | Ga0207650_10010290 | 3300025925 | Bacteria | 6411 |
| 460 | Ga0207650_10014705 | 3300025925 | Bacteria | 5439 |
| 461 | Ga0207650_10030878 | 3300025925 | Bacteria | 3864 |
| 462 | Ga0207650_10165628 | 3300025925 | Bacteria | 1754 |
| 463 | Ga0207650_10223003 | 3300025925 | Bacteria | 1518 |
| 464 | Ga0207659_10043983 | 3300025926 | Unclassified | 3140 |
| 465 | Ga0207659_10049502 | 3300025926 | Bacteria | 2981 |
| 466 | Ga0207659_10067884 | 3300025926 | Bacteria | 2592 |
| 467 | Ga0207659_10170259 | 3300025926 | Bacteria | 1718 |
| 468 | Ga0207659_10225907 | 3300025926 | Bacteria | 1508 |
| 469 | Ga0207687_10010511 | 3300025927 | Bacteria | 6047 |
| 470 | Ga0207687_10042501 | 3300025927 | Bacteria | 3127 |
| 471 | Ga0207700_10003844 | 3300025928 | Bacteria | 8775 |
| 472 | Ga0207700_10027640 | 3300025928 | Bacteria | 3977 |
| 473 | Ga0207700_10041641 | 3300025928 | Bacteria | 3362 |
| 474 | Ga0207664_10039390 | 3300025929 | Bacteria | 3670 |
| 475 | Ga0207664_10090250 | 3300025929 | Bacteria | 2511 |
| 476 | Ga0207664_10101335 | 3300025929 | Bacteria | 2379 |
| 477 | Ga0207664_10174826 | 3300025929 | Bacteria | 1840 |
| 478 | Ga0207644_10063359 | 3300025931 | Bacteria | 2684 |
| 479 | Ga0207644_10132443 | 3300025931 | Bacteria | 1910 |
| 480 | Ga0207644_10193306 | 3300025931 | Bacteria | 1601 |
| 481 | Ga0207690_10015263 | 3300025932 | Bacteria | 4651 |
| 482 | Ga0207690_10015287 | 3300025932 | Bacteria | 4647 |
| 483 | Ga0207690_10071490 | 3300025932 | Bacteria | 2393 |
| 484 | Ga0207690_10292684 | 3300025932 | Bacteria | 1272 |
| 485 | Ga0207706_10000990 | 3300025933 | Bacteria | 28895 |
| 486 | Ga0207706_10042126 | 3300025933 | Bacteria | 4046 |
| 487 | Ga0207706_10098765 | 3300025933 | Bacteria | 2568 |
| 488 | Ga0207706_10152466 | 3300025933 | Unclassified | 2033 |
| 489 | Ga0207706_10252822 | 3300025933 | Bacteria | 1539 |
| 490 | Ga0207686_10011739 | 3300025934 | Bacteria | 4805 |
| 491 | Ga0207709_10032248 | 3300025935 | Bacteria | 3066 |
| 492 | Ga0207709_10093783 | 3300025935 | Bacteria | 1969 |
| 493 | Ga0207670_10000723 | 3300025936 | Bacteria | 17406 |
| 494 | Ga0207670_10004146 | 3300025936 | Bacteria | 7767 |
| 495 | Ga0207670_10084086 | 3300025936 | Bacteria | 2234 |
| 496 | Ga0207669_10009635 | 3300025937 | Bacteria | 4615 |
| 497 | Ga0207669_10015713 | 3300025937 | Bacteria | 3825 |
| 498 | Ga0207704_10057171 | 3300025938 | Bacteria | 2394 |
| 499 | Ga0207665_10069227 | 3300025939 | Bacteria | 2406 |
| 500 | Ga0207665_10264370 | 3300025939 | Bacteria | 1275 |
| 501 | Ga0207691_10001949 | 3300025940 | Bacteria | 20154 |
| 502 | Ga0207691_10002037 | 3300025940 | Bacteria | 19764 |
| 503 | Ga0207711_10054382 | 3300025941 | Bacteria | 3435 |
| 504 | Ga0207711_10279473 | 3300025941 | Bacteria | 1537 |
| 505 | Ga0207689_10076507 | 3300025942 | Bacteria | 2751 |
| 506 | Ga0207689_10122625 | 3300025942 | Bacteria | 2137 |
| 507 | Ga0207689_10171695 | 3300025942 | Bacteria | 1787 |
| 508 | Ga0207689_10402181 | 3300025942 | Bacteria | 1141 |
| 509 | Ga0207661_10002168 | 3300025944 | Bacteria | 13525 |
| 510 | Ga0207661_10008830 | 3300025944 | Bacteria | 7212 |
| 511 | Ga0207661_10021211 | 3300025944 | Bacteria | 4868 |
| 512 | Ga0207661_10054376 | 3300025944 | Bacteria | 3207 |
| 513 | Ga0207661_10099549 | 3300025944 | Bacteria | 2438 |
| 514 | Ga0207661_10109696 | 3300025944 | Bacteria | 2331 |
| 515 | Ga0207661_10320509 | 3300025944 | Bacteria | 1393 |
| 516 | Ga0207679_10009971 | 3300025945 | Bacteria | 6104 |
| 517 | Ga0207679_10013569 | 3300025945 | Bacteria | 5340 |
| 518 | Ga0207667_10011535 | 3300025949 | Bacteria | 10267 |
| 519 | Ga0207667_10063324 | 3300025949 | Bacteria | 3864 |
| 520 | Ga0207667_10071811 | 3300025949 | Unclassified | 3598 |
| 521 | Ga0207667_10119404 | 3300025949 | Bacteria | 2717 |
| 522 | Ga0207651_10077182 | 3300025960 | Bacteria | 2384 |
| 523 | Ga0207651_10327268 | 3300025960 | Bacteria | 1283 |
| 524 | Ga0207651_10382867 | 3300025960 | Bacteria | 1192 |
| 525 | Ga0207712_10003551 | 3300025961 | Bacteria | 9836 |
| 526 | Ga0207712_10003886 | 3300025961 | Bacteria | 9441 |
| 527 | Ga0207712_10016215 | 3300025961 | Bacteria | 4819 |
| 528 | Ga0207712_10027361 | 3300025961 | Bacteria | 3807 |
| 529 | Ga0207712_10304696 | 3300025961 | Bacteria | 1309 |
| 530 | Ga0207668_10001797 | 3300025972 | Bacteria | 12510 |
| 531 | Ga0207668_10010768 | 3300025972 | Bacteria | 5538 |
| 532 | Ga0207668_10013252 | 3300025972 | Bacteria | 5070 |
| 533 | Ga0207668_10026341 | 3300025972 | Bacteria | 3774 |
| 534 | Ga0207640_10092750 | 3300025981 | Bacteria | 2096 |
| 535 | Ga0207640_10357785 | 3300025981 | Bacteria | 1175 |
| 536 | Ga0207658_10045620 | 3300025986 | Bacteria | 3196 |
| 537 | Ga0207658_10140276 | 3300025986 | Bacteria | 1955 |
| 538 | Ga0207658_10315200 | 3300025986 | Bacteria | 1352 |
| 539 | Ga0207658_10341710 | 3300025986 | Bacteria | 1301 |
| 540 | Ga0207677_10021883 | 3300026023 | Bacteria | 3918 |
| 541 | Ga0207677_10027258 | 3300026023 | Bacteria | 3596 |
| 542 | Ga0207677_10053403 | 3300026023 | Bacteria | 2750 |
| 543 | Ga0207703_10044165 | 3300026035 | Bacteria | 3580 |
| 544 | Ga0207639_10028505 | 3300026041 | Bacteria | 4077 |
| 545 | Ga0207639_10041751 | 3300026041 | Unclassified | 3434 |
| 546 | Ga0207639_10135161 | 3300026041 | Bacteria | 2047 |
| 547 | Ga0207639_10174234 | 3300026041 | Bacteria | 1825 |
| 548 | Ga0207678_10018436 | 3300026067 | Bacteria | 6129 |
| 549 | Ga0207678_10022139 | 3300026067 | Bacteria | 5569 |
| 550 | Ga0207678_10028304 | 3300026067 | Bacteria | 4893 |
| 551 | Ga0207678_10049981 | 3300026067 | Bacteria | 3612 |
| 552 | Ga0207678_10075813 | 3300026067 | Bacteria | 2881 |
| 553 | Ga0207678_10147347 | 3300026067 | Bacteria | 2009 |
| 554 | Ga0207678_10149815 | 3300026067 | Bacteria | 1991 |
| 555 | Ga0207678_10246738 | 3300026067 | Bacteria | 1529 |
| 556 | Ga0207708_10019062 | 3300026075 | Bacteria | 5166 |
| 557 | Ga0207708_10044625 | 3300026075 | Bacteria | 3378 |
| 558 | Ga0207708_10126100 | 3300026075 | Unclassified | 1998 |
| 559 | Ga0207702_10387797 | 3300026078 | Bacteria | 1344 |
| 560 | Ga0207641_10048523 | 3300026088 | Bacteria | 3583 |
| 561 | Ga0207648_10092640 | 3300026089 | Bacteria | 2642 |
| 562 | Ga0207648_10113202 | 3300026089 | Bacteria | 2383 |
| 563 | Ga0207648_10114859 | 3300026089 | Bacteria | 2366 |
| 564 | Ga0207648_10137448 | 3300026089 | Bacteria | 2153 |
| 565 | Ga0207676_10010931 | 3300026095 | Bacteria | 6478 |
| 566 | Ga0207676_10020701 | 3300026095 | Bacteria | 4816 |
| 567 | Ga0207674_10000142 | 3300026116 | Bacteria | 83392 |
| 568 | Ga0207674_10001633 | 3300026116 | Bacteria | 28865 |
| 569 | Ga0207674_10030711 | 3300026116 | Bacteria | 5647 |
| 570 | Ga0207674_10131644 | 3300026116 | Bacteria | 2464 |
| 571 | Ga0207674_10146903 | 3300026116 | Bacteria | 2316 |
| 572 | Ga0207674_10169491 | 3300026116 | Bacteria | 2137 |
| 573 | Ga0207675_100000141 | 3300026118 | Bacteria | 61869 |
| 574 | Ga0207675_100004169 | 3300026118 | Bacteria | 13990 |
| 575 | Ga0207675_100014983 | 3300026118 | Bacteria | 7236 |
| 576 | Ga0207675_100016487 | 3300026118 | Bacteria | 6900 |
| 577 | Ga0207675_100039441 | 3300026118 | Bacteria | 4407 |
| 578 | Ga0207675_100087282 | 3300026118 | Bacteria | 2930 |
| 579 | Ga0207675_100333474 | 3300026118 | Bacteria | 1483 |
| 580 | Ga0207683_10009233 | 3300026121 | Bacteria | 8403 |
| 581 | Ga0207683_10099148 | 3300026121 | Bacteria | 2600 |
| 582 | Ga0207683_10102964 | 3300026121 | Bacteria | 2550 |
| 583 | Ga0207683_10117012 | 3300026121 | Bacteria | 2390 |
| 584 | Ga0207683_10132981 | 3300026121 | Bacteria | 2238 |
| 585 | Ga0207683_10174085 | 3300026121 | Bacteria | 1950 |
| 586 | Ga0207698_10032961 | 3300026142 | Unclassified | 3758 |
| 587 | Ga0207698_10051937 | 3300026142 | Bacteria | 3137 |
| 588 | Ga0207698_10065027 | 3300026142 | Bacteria | 2862 |
| 589 | Ga0207698_10100753 | 3300026142 | Bacteria | 2394 |
| 590 | Ga0207698_10198285 | 3300026142 | Bacteria | 1795 |
| 591 | Ga0207698_10213291 | 3300026142 | Bacteria | 1739 |
| 592 | Ga0209389_1000201 | 3300027296 | Bacteria | 42938 |
| 593 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 594 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 595 | Ga0209489_100035 | 3300027361 | Bacteria | 168255 |
| 596 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 597 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 598 | Ga0209179_1010620 | 3300027512 | Bacteria | 1610 |
| 599 | Ga0209813_10006831 | 3300027866 | Bacteria | 2829 |
| 600 | Ga0209813_10019139 | 3300027866 | Bacteria | 1900 |
| 601 | Ga0207428_10021751 | 3300027907 | Bacteria | 5425 |
| 602 | Ga0207428_10106598 | 3300027907 | Unclassified | 2160 |
| 603 | Ga0268266_10014910 | 3300028379 | Bacteria | 6674 |
| 604 | Ga0268266_10049432 | 3300028379 | Bacteria | 3607 |
| 605 | Ga0268266_10084829 | 3300028379 | Bacteria | 2767 |
| 606 | Ga0268266_10092299 | 3300028379 | Bacteria | 2656 |
| 607 | Ga0268266_10096847 | 3300028379 | Bacteria | 2594 |
| 608 | Ga0268266_10167157 | 3300028379 | Bacteria | 1994 |
| 609 | Ga0268266_10174702 | 3300028379 | Bacteria | 1952 |
| 610 | Ga0268266_10234454 | 3300028379 | Bacteria | 1691 |
| 611 | Ga0268266_10254583 | 3300028379 | Bacteria | 1625 |
| 612 | Ga0268265_10005120 | 3300028380 | Bacteria | 8976 |
| 613 | Ga0268265_10017172 | 3300028380 | Unclassified | 4987 |
| 614 | Ga0268265_10020676 | 3300028380 | Bacteria | 4598 |
| 615 | Ga0268265_10251015 | 3300028380 | Bacteria | 1567 |
| 616 | Ga0268264_10033347 | 3300028381 | Unclassified | 4229 |
| 617 | Ga0307515_10036261 | 3300028794 | Bacteria | 7984 |
| 618 | Ga0265338_10016733 | 3300028800 | Bacteria | 7946 |
| 619 | Ga0265339_10000052 | 3300031249 | Bacteria | 101603 |
| 620 | Ga0265339_10069363 | 3300031249 | Bacteria | 1882 |
| 621 | Ga0265339_10110023 | 3300031249 | Bacteria | 1426 |
| 622 | Ga0265331_10052024 | 3300031250 | Bacteria | 1958 |
| 623 | Ga0265327_10017705 | 3300031251 | Bacteria | 4453 |
| 624 | Ga0265316_10107628 | 3300031344 | Bacteria | 2114 |
| 625 | Ga0307513_10082871 | 3300031456 | Bacteria | 3300 |
| 626 | Ga0307408_100000558 | 3300031548 | Bacteria | 32149 |
| 627 | Ga0265313_10000843 | 3300031595 | Bacteria | 30858 |
| 628 | Ga0307508_10044378 | 3300031616 | Bacteria | 3977 |
| 629 | Ga0307508_10183623 | 3300031616 | Bacteria | 1694 |
| 630 | Ga0265314_10007260 | 3300031711 | Bacteria | 9628 |
| 631 | Ga0265314_10029453 | 3300031711 | Bacteria | 4080 |
| 632 | Ga0265342_10017745 | 3300031712 | Bacteria | 4622 |
| 633 | Ga0265342_10107310 | 3300031712 | Bacteria | 1584 |
| 634 | Ga0307516_10069114 | 3300031730 | Bacteria | 3398 |
| 635 | Ga0307410_10285743 | 3300031852 | Bacteria | 1296 |
| 636 | Ga0307406_10008537 | 3300031901 | Bacteria | 5718 |
| 637 | Ga0307407_10144837 | 3300031903 | Bacteria | 1537 |
| 638 | Ga0307409_100093333 | 3300031995 | Unclassified | 2473 |
| 639 | Ga0307416_100063021 | 3300032002 | Bacteria | 3034 |
| 640 | Ga0307416_100314809 | 3300032002 | Bacteria | 1564 |
| 641 | Ga0307414_10222078 | 3300032004 | Bacteria | 1552 |
| 642 | Ga0307414_10433562 | 3300032004 | Bacteria | 1149 |
| 643 | Ga0307415_100165832 | 3300032126 | Bacteria | 1717 |
| 644 | Ga0307510_10012742 | 3300033180 | Bacteria | 9977 |
| 645 | Ga0307510_10032603 | 3300033180 | Bacteria | 5866 |
| 646 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 647 | Ga0373930_0021115 | 3300034816 | Bacteria | 1275 |
| 648 | Ga0373926_0040292 | 3300035083 | Bacteria | 1667 |
| 649 | Ga0373926_0078249 | 3300035083 | Bacteria | 1220 |
| 650 | Ga0373934_0042137 | 3300035086 | Bacteria | 1803 |
| 651 | Ga0373944_0012879 | 3300035089 | Bacteria | 2313 |
| 652 | Ga0373944_0019033 | 3300035089 | Bacteria | 1967 |
| 653 | Ga0373944_0046784 | 3300035089 | Bacteria | 1353 |
| 654 | Ga0373923_0015134 | 3300035111 | Bacteria | 2908 |
| 655 | Ga0373923_0016016 | 3300035111 | Bacteria | 2840 |
| 656 | Ga0373936_0005865 | 3300035113 | Bacteria | 4624 |
| 657 | Ga0373945_0014426 | 3300035116 | Bacteria | 2648 |
| 658 | Ga0373945_0029335 | 3300035116 | Bacteria | 1932 |
| 659 | Ga0373945_0068268 | 3300035116 | Bacteria | 1340 |
| 660 | Ga0373953_0055861 | 3300035117 | Bacteria | 1604 |
| 661 | Ga0373956_0023627 | 3300035119 | Bacteria | 2640 |
| 662 | Ga0373956_0062661 | 3300035119 | Bacteria | 1686 |
| 663 | Ga0373943_0016082 | 3300035170 | Bacteria | 3407 |
| 664 | Ga0373943_0030683 | 3300035170 | Bacteria | 2546 |
| 665 | Ga0373943_0043377 | 3300035170 | Bacteria | 2184 |
| 666 | Ga0373943_0060103 | 3300035170 | Bacteria | 1896 |
| 667 | Ga0373943_0064413 | 3300035170 | Bacteria | 1840 |
| 668 | Ga0373943_0187169 | 3300035170 | Bacteria | 1140 |
| 669 | Ga0373946_0003500 | 3300035171 | Bacteria | 5571 |
| 670 | Ga0373946_0011732 | 3300035171 | Bacteria | 3275 |
| 671 | Ga0373946_0038734 | 3300035171 | Bacteria | 1943 |
| 672 | Ga0373961_0002074 | 3300035241 | Bacteria | 5339 |
| 673 | Ga0373924_0020510 | 3300035410 | Bacteria | 2570 |
| 674 | Ga0373924_0059470 | 3300035410 | Bacteria | 1596 |
| 675 | Ga0373931_0036553 | 3300035691 | Bacteria | 2560 |
| 676 | Ga0373931_0128212 | 3300035691 | Bacteria | 1457 |
| 677 | Ga0373935_0013096 | 3300035692 | Bacteria | 4999 |
| 678 | Ga0373935_0019770 | 3300035692 | Bacteria | 4108 |
| 679 | Ga0373935_0044947 | 3300035692 | Bacteria | 2785 |
| 680 | Ga0373935_0055404 | 3300035692 | Bacteria | 2526 |
| 681 | Ga0373935_0056552 | 3300035692 | Bacteria | 2501 |
| 682 | Ga0373935_0162554 | 3300035692 | Bacteria | 1523 |
| 683 | Ga0373927_0007278 | 3300035695 | Bacteria | 7504 |
| 684 | Ga0373927_0049323 | 3300035695 | Bacteria | 2722 |
| 685 | Ga0373927_0094899 | 3300035695 | Bacteria | 1938 |
| 686 | Ga0373927_0138302 | 3300035695 | Bacteria | 1592 |
| 687 | Ga0373933_0024090 | 3300035724 | Bacteria | 3484 |
| 688 | Ga0373933_0081210 | 3300035724 | Bacteria | 1988 |
| 689 | Ga0373933_0171821 | 3300035724 | Bacteria | 1379 |
| 690 | Ga0373947_0004180 | 3300035725 | Bacteria | 8476 |
| 691 | Ga0373947_0018731 | 3300035725 | Bacteria | 3987 |
| 692 | Ga0373947_0020227 | 3300035725 | Bacteria | 3842 |
| 693 | Ga0373947_0049538 | 3300035725 | Bacteria | 2523 |
| 694 | Ga0373947_0062433 | 3300035725 | Bacteria | 2267 |
| 695 | Ga0373947_0098134 | 3300035725 | Bacteria | 1837 |
| 696 | Ga0373937_0005300 | 3300036401 | Bacteria | 11020 |
| 697 | Ga0373937_0084401 | 3300036401 | Bacteria | 2938 |
| 698 | Ga0373937_0099098 | 3300036401 | Bacteria | 2703 |
| 699 | Ga0373925_0008589 | 3300037068 | Bacteria | 7443 |
| 700 | Ga0373925_0010602 | 3300037068 | Bacteria | 6681 |
| 701 | Ga0373925_0063800 | 3300037068 | Bacteria | 2772 |
| 702 | Ga0373925_0118544 | 3300037068 | Bacteria | 2052 |
| 703 | Ga0373925_0145775 | 3300037068 | Bacteria | 1856 |
| 704 | Ga0373925_0189922 | 3300037068 | Bacteria | 1629 |
| 705 | Ga0395899_0019733 | 3300037312 | Bacteria | 5118 |
| 706 | Ga0395899_0081185 | 3300037312 | Bacteria | 2360 |
| 707 | Ga0395900_0031496 | 3300037418 | Bacteria | 5450 |
| 708 | Ga0395900_0132004 | 3300037418 | Bacteria | 2559 |
| 709 | Ga0395900_0341087 | 3300037418 | Bacteria | 1474 |
| 710 | Ga0395898_0002361 | 3300037466 | Bacteria | 22461 |
| 711 | Ga0395898_0015190 | 3300037466 | Bacteria | 7904 |
| 712 | Ga0395898_0407053 | 3300037466 | Bacteria | 1297 |
| 713 | Ga0436364_0422894 | 3300037853 | Bacteria | 1409 |
| 714 | Ga0436364_0839082 | 3300037853 | Bacteria | 2981 |
| 715 | Ga0395901_0094760 | 3300038443 | Bacteria | 3128 |
| 716 | Ga0395901_0396539 | 3300038443 | Bacteria | 1418 |
| 717 | Ga0436365_0045906 | 3300039437 | Bacteria | 10690 |
| 718 | Ga0436365_0908986 | 3300039437 | Bacteria | 2500 |
| 719 | Ga0436365_1169629 | 3300039437 | Bacteria | 6807 |
| 720 | Ga0436360_0676143 | 3300039438 | Bacteria | 1428 |
| 721 | Ga0436360_0851383 | 3300039438 | Bacteria | 4013 |
| 722 | Ga0436363_0548376 | 3300039450 | Bacteria | 2935 |
| 723 | Ga0436362_0075180 | 3300039453 | Bacteria | 1153 |
| 724 | Ga0451807_1527043 | 3300041486 | Bacteria | 1542 |
| 725 | Ga0451855_1643489 | 3300041511 | Bacteria | 1102 |
| 726 | Ga0439443_018774 | 3300042003 | Bacteria | 1073 |
| 727 | Ga0466961_0087148 | 3300044693 | Bacteria | 1973 |
| 728 | Ga0466960_0139629 | 3300044901 | Bacteria | 1286 |
| 729 | Ga0466959_0136494 | 3300045049 | Bacteria | 1736 |
| 730 | Ga0451576_0114353 | 3300045051 | Unclassified | 2809 |
| 731 | Ga0466967_0015489 | 3300045976 | Bacteria | 5977 |
| 732 | Ga0466967_0122933 | 3300045976 | Bacteria | 2401 |
| 733 | Ga0495617_047333 | 3300046452 | Bacteria | 1432 |
| 734 | Ga0495592_0065726 | 3300046454 | Bacteria | 2654 |
| 735 | Ga0495592_0085888 | 3300046454 | Bacteria | 2267 |
| 736 | Ga0495592_0092782 | 3300046454 | Bacteria | 2163 |
| 737 | Ga0495603_0048534 | 3300046455 | Bacteria | 2528 |
| 738 | Ga0495603_0074501 | 3300046455 | Bacteria | 1993 |
| 739 | Ga0495603_0167925 | 3300046455 | Bacteria | 1271 |
| 740 | Ga0495590_0022334 | 3300046457 | Bacteria | 2238 |
| 741 | Ga0495590_0034643 | 3300046457 | Bacteria | 1763 |
| 742 | Ga0495629_0005715 | 3300046459 | Bacteria | 9285 |
| 743 | Ga0495629_0024359 | 3300046459 | Bacteria | 4309 |
| 744 | Ga0495629_0035104 | 3300046459 | Bacteria | 3545 |
| 745 | Ga0495629_0075207 | 3300046459 | Bacteria | 2359 |
| 746 | Ga0495629_0078476 | 3300046459 | Bacteria | 2305 |
| 747 | Ga0495629_0124314 | 3300046459 | Bacteria | 1797 |
| 748 | Ga0495638_0012685 | 3300046460 | Bacteria | 5763 |
| 749 | Ga0495638_0127909 | 3300046460 | Bacteria | 1495 |
| 750 | Ga0495641_0028609 | 3300046461 | Bacteria | 2696 |
| 751 | Ga0495641_0083509 | 3300046461 | Bacteria | 1431 |
| 752 | Ga0495651_0004217 | 3300046462 | Bacteria | 11016 |
| 753 | Ga0495651_0004672 | 3300046462 | Bacteria | 10481 |
| 754 | Ga0495651_0017519 | 3300046462 | Bacteria | 5548 |
| 755 | Ga0495651_0021317 | 3300046462 | Bacteria | 5036 |
| 756 | Ga0495651_0040455 | 3300046462 | Bacteria | 3625 |
| 757 | Ga0495651_0093894 | 3300046462 | Bacteria | 2246 |
| 758 | Ga0495653_0013840 | 3300046463 | Bacteria | 6575 |
| 759 | Ga0495653_0021718 | 3300046463 | Bacteria | 5197 |
| 760 | Ga0495653_0056672 | 3300046463 | Bacteria | 2986 |
| 761 | Ga0495653_0086909 | 3300046463 | Bacteria | 2297 |
| 762 | Ga0495653_0166653 | 3300046463 | Bacteria | 1524 |
| 763 | Ga0495653_0167182 | 3300046463 | Bacteria | 1522 |
| 764 | Ga0495580_0010281 | 3300046472 | Bacteria | 7298 |
| 765 | Ga0495580_0025873 | 3300046472 | Bacteria | 4285 |
| 766 | Ga0495580_0212084 | 3300046472 | Bacteria | 1332 |
| 767 | Ga0495582_0008667 | 3300046473 | Bacteria | 5609 |
| 768 | Ga0495582_0015336 | 3300046473 | Bacteria | 4210 |
| 769 | Ga0495582_0043084 | 3300046473 | Bacteria | 2485 |
| 770 | Ga0495582_0058221 | 3300046473 | Bacteria | 2131 |
| 771 | Ga0495582_0078189 | 3300046473 | Bacteria | 1835 |
| 772 | Ga0495605_0022270 | 3300046474 | Bacteria | 3348 |
| 773 | Ga0495605_0060024 | 3300046474 | Bacteria | 1824 |
| 774 | Ga0495639_0004024 | 3300046475 | Bacteria | 6301 |
| 775 | Ga0495639_0008168 | 3300046475 | Bacteria | 4495 |
| 776 | Ga0495639_0010407 | 3300046475 | Bacteria | 4006 |
| 777 | Ga0495662_0002323 | 3300046476 | Bacteria | 9591 |
| 778 | Ga0495662_0013322 | 3300046476 | Bacteria | 4001 |
| 779 | Ga0495662_0015793 | 3300046476 | Bacteria | 3664 |
| 780 | Ga0495662_0045334 | 3300046476 | Bacteria | 2123 |
| 781 | Ga0495664_0013085 | 3300046477 | Bacteria | 4705 |
| 782 | Ga0495664_0019574 | 3300046477 | Bacteria | 3894 |
| 783 | Ga0495664_0020012 | 3300046477 | Bacteria | 3855 |
| 784 | Ga0495664_0025412 | 3300046477 | Bacteria | 3448 |
| 785 | Ga0495664_0033577 | 3300046477 | Bacteria | 3015 |
| 786 | Ga0495664_0110158 | 3300046477 | Bacteria | 1662 |
| 787 | Ga0495585_0023352 | 3300046492 | Bacteria | 3549 |
| 788 | Ga0495594_0005204 | 3300046499 | Bacteria | 6686 |
| 789 | Ga0495594_0049664 | 3300046499 | Bacteria | 2306 |
| 790 | Ga0495606_0031644 | 3300046507 | Bacteria | 3674 |
| 791 | Ga0495606_0076705 | 3300046507 | Bacteria | 2088 |
| 792 | Ga0495608_0007486 | 3300046511 | Bacteria | 7707 |
| 793 | Ga0495608_0019475 | 3300046511 | Bacteria | 4669 |
| 794 | Ga0495608_0037956 | 3300046511 | Bacteria | 3238 |
| 795 | Ga0495608_0076804 | 3300046511 | Bacteria | 2174 |
| 796 | Ga0495608_0090413 | 3300046511 | Bacteria | 1981 |
| 797 | Ga0495616_0078986 | 3300046513 | Bacteria | 1578 |
| 798 | Ga0495618_0001061 | 3300046514 | Bacteria | 18746 |
| 799 | Ga0495618_0024189 | 3300046514 | Bacteria | 3759 |
| 800 | Ga0495618_0048874 | 3300046514 | Bacteria | 2671 |
| 801 | Ga0495618_0062860 | 3300046514 | Bacteria | 2356 |
| 802 | Ga0495628_0036089 | 3300046516 | Bacteria | 3970 |
| 803 | Ga0495628_0082142 | 3300046516 | Bacteria | 2503 |
| 804 | Ga0495628_0283928 | 3300046516 | Bacteria | 1228 |
| 805 | Ga0495630_0037669 | 3300046517 | Bacteria | 3616 |
| 806 | Ga0495630_0041344 | 3300046517 | Bacteria | 3442 |
| 807 | Ga0495630_0054144 | 3300046517 | Bacteria | 3006 |
| 808 | Ga0495630_0068819 | 3300046517 | Bacteria | 2663 |
| 809 | Ga0495630_0122377 | 3300046517 | Bacteria | 1974 |
| 810 | Ga0495630_0302948 | 3300046517 | Bacteria | 1221 |
| 811 | Ga0495631_0024987 | 3300046518 | Bacteria | 2754 |
| 812 | Ga0495632_0028540 | 3300046519 | Bacteria | 2911 |
| 813 | Ga0495643_0095374 | 3300046522 | Bacteria | 1530 |
| 814 | Ga0495644_0055084 | 3300046523 | Bacteria | 1494 |
| 815 | Ga0495648_0005065 | 3300046524 | Bacteria | 11061 |
| 816 | Ga0495648_0075049 | 3300046524 | Bacteria | 1946 |
| 817 | Ga0495663_0027311 | 3300046525 | Bacteria | 1675 |
| 818 | Ga0495666_0043817 | 3300046526 | Bacteria | 2161 |
| 819 | Ga0495652_0016634 | 3300046529 | Bacteria | 6575 |
| 820 | Ga0495652_0019059 | 3300046529 | Bacteria | 6112 |
| 821 | Ga0495652_0124601 | 3300046529 | Bacteria | 2049 |
| 822 | Ga0495652_0158489 | 3300046529 | Bacteria | 1760 |
| 823 | Ga0495665_0007053 | 3300046531 | Bacteria | 6064 |
| 824 | Ga0495665_0039138 | 3300046531 | Bacteria | 2526 |
| 825 | Ga0495640_0001271 | 3300046533 | Bacteria | 19772 |
| 826 | Ga0495640_0009760 | 3300046533 | Bacteria | 7457 |
| 827 | Ga0495640_0011556 | 3300046533 | Bacteria | 6788 |
| 828 | Ga0495640_0064782 | 3300046533 | Bacteria | 2470 |
| 829 | Ga0495640_0067077 | 3300046533 | Bacteria | 2418 |
| 830 | Ga0495640_0102593 | 3300046533 | Bacteria | 1877 |
| 831 | Ga0495640_0124834 | 3300046533 | Bacteria | 1670 |
| 832 | Ga0495640_0206445 | 3300046533 | Bacteria | 1243 |
| 833 | Ga0495586_0049611 | 3300046535 | Bacteria | 2270 |
| 834 | Ga0495587_0009785 | 3300046536 | Bacteria | 6126 |
| 835 | Ga0495587_0018769 | 3300046536 | Bacteria | 4288 |
| 836 | Ga0495587_0030630 | 3300046536 | Bacteria | 3262 |
| 837 | Ga0495587_0063326 | 3300046536 | Bacteria | 2163 |
| 838 | Ga0495609_0014673 | 3300046538 | Bacteria | 3679 |
| 839 | Ga0495645_0060500 | 3300046543 | Bacteria | 2745 |
| 840 | Ga0495645_0084178 | 3300046543 | Bacteria | 2278 |
| 841 | Ga0495645_0098074 | 3300046543 | Bacteria | 2086 |
| 842 | Ga0495645_0140216 | 3300046543 | Bacteria | 1687 |
| 843 | Ga0495645_0214824 | 3300046543 | Bacteria | 1297 |
| 844 | Ga0495633_0121826 | 3300046558 | Bacteria | 1208 |
| 845 | Ga0495667_0011680 | 3300046559 | Bacteria | 5946 |
| 846 | Ga0495667_0015529 | 3300046559 | Bacteria | 5147 |
| 847 | Ga0495667_0019653 | 3300046559 | Bacteria | 4557 |
| 848 | Ga0495667_0073707 | 3300046559 | Bacteria | 2224 |
| 849 | Ga0495656_0017401 | 3300046615 | Bacteria | 2743 |
| 850 | Ga0495668_0028576 | 3300046616 | Bacteria | 3154 |
| 851 | Ga0495634_0006123 | 3300046642 | Bacteria | 9157 |
| 852 | Ga0495634_0033886 | 3300046642 | Bacteria | 3506 |
| 853 | Ga0495634_0070251 | 3300046642 | Bacteria | 2308 |
| 854 | Ga0495634_0093235 | 3300046642 | Bacteria | 1953 |
| 855 | Ga0495634_0105891 | 3300046642 | Bacteria | 1813 |
| 856 | Ga0495611_0009542 | 3300046648 | Bacteria | 4101 |
| 857 | Ga0495625_0105095 | 3300046660 | Bacteria | 1935 |
| 858 | Ga0495635_0004098 | 3300046663 | Bacteria | 10117 |
| 859 | Ga0495635_0005471 | 3300046663 | Bacteria | 8833 |
| 860 | Ga0495635_0036633 | 3300046663 | Bacteria | 3399 |
| 861 | Ga0495635_0063127 | 3300046663 | Bacteria | 2544 |
| 862 | Ga0495659_0024284 | 3300046664 | Bacteria | 2067 |
| 863 | Ga0495661_0160389 | 3300046665 | Bacteria | 1208 |
| 864 | Ga0495588_0065826 | 3300046674 | Bacteria | 1880 |
| 865 | Ga0495657_0016820 | 3300046675 | Bacteria | 5319 |
| 866 | Ga0495657_0027872 | 3300046675 | Bacteria | 3979 |
| 867 | Ga0495599_0025899 | 3300046678 | Bacteria | 3674 |
| 868 | Ga0495623_0003775 | 3300046679 | Bacteria | 9984 |
| 869 | Ga0495623_0014622 | 3300046679 | Bacteria | 5077 |
| 870 | Ga0495623_0111037 | 3300046679 | Bacteria | 1661 |
| 871 | Ga0495623_0134714 | 3300046679 | Bacteria | 1475 |
| 872 | Ga0495646_0010211 | 3300046680 | Bacteria | 5971 |
| 873 | Ga0495646_0027423 | 3300046680 | Bacteria | 3574 |
| 874 | Ga0495646_0059371 | 3300046680 | Bacteria | 2284 |
| 875 | Ga0495647_0011641 | 3300046681 | Bacteria | 3016 |
| 876 | Ga0495658_0002959 | 3300046683 | Bacteria | 8515 |
| 877 | Ga0495658_0032161 | 3300046683 | Bacteria | 2863 |
| 878 | Ga0495658_0037171 | 3300046683 | Bacteria | 2690 |
| 879 | Ga0495658_0140120 | 3300046683 | Bacteria | 1479 |
| 880 | Ga0495658_0158322 | 3300046683 | Bacteria | 1395 |
| 881 | Ga0495669_0010542 | 3300046684 | Bacteria | 3908 |
| 882 | Ga0495613_0036612 | 3300046689 | Bacteria | 3639 |
| 883 | Ga0495613_0062337 | 3300046689 | Bacteria | 2729 |
| 884 | Ga0495613_0166637 | 3300046689 | Bacteria | 1565 |
| 885 | Ga0495624_0020635 | 3300046690 | Bacteria | 4380 |
| 886 | Ga0495624_0052247 | 3300046690 | Bacteria | 2583 |
| 887 | Ga0495624_0096780 | 3300046690 | Bacteria | 1818 |
| 888 | Ga0495624_0097587 | 3300046690 | Bacteria | 1810 |
| 889 | Ga0495670_0082424 | 3300046691 | Bacteria | 1640 |
| 890 | Ga0495671_0025057 | 3300046692 | Bacteria | 3103 |
| 891 | Ga0495671_0055716 | 3300046692 | Bacteria | 1958 |
| 892 | Ga0495649_0043663 | 3300046694 | Bacteria | 2447 |
| 893 | Ga0495649_0046346 | 3300046694 | Bacteria | 2367 |
| 894 | Ga0495649_0067902 | 3300046694 | Bacteria | 1913 |
| 895 | Ga0495589_0061566 | 3300046794 | Bacteria | 1842 |
| 896 | Ga0495600_0006031 | 3300046809 | Bacteria | 7336 |
| 897 | Ga0495600_0075411 | 3300046809 | Bacteria | 2203 |
| 898 | Ga0495600_0075721 | 3300046809 | Bacteria | 2197 |
| 899 | Ga0495581_0007693 | 3300047315 | Bacteria | 6235 |
| 900 | Ga0495581_0008174 | 3300047315 | Bacteria | 6059 |
| 901 | Ga0495581_0076220 | 3300047315 | Bacteria | 1940 |
| 902 | Ga0495604_0015248 | 3300047317 | Bacteria | 6135 |
| 903 | Ga0495604_0031158 | 3300047317 | Bacteria | 4231 |
| 904 | Ga0495604_0032435 | 3300047317 | Bacteria | 4139 |
| 905 | Ga0495604_0046885 | 3300047317 | Bacteria | 3368 |
| 906 | Ga0495604_0067018 | 3300047317 | Bacteria | 2729 |
| 907 | Ga0495604_0091819 | 3300047317 | Bacteria | 2250 |
| 908 | Ga0495604_0116525 | 3300047317 | Bacteria | 1939 |
| 909 | Ga0495674_0011123 | 3300047319 | Bacteria | 8496 |
| 910 | Ga0495674_0017380 | 3300047319 | Bacteria | 6691 |
| 911 | Ga0495674_0034129 | 3300047319 | Bacteria | 4603 |
| 912 | Ga0495674_0051661 | 3300047319 | Bacteria | 3623 |
| 913 | Ga0495674_0076789 | 3300047319 | Bacteria | 2872 |
| 914 | Ga0495672_0021333 | 3300047320 | Bacteria | 4226 |
| 915 | Ga0495672_0065044 | 3300047320 | Bacteria | 2086 |
| 916 | Ga0495676_0036914 | 3300047321 | Bacteria | 4075 |
| 917 | Ga0495676_0068194 | 3300047321 | Bacteria | 2749 |
| 918 | Ga0495676_0095388 | 3300047321 | Bacteria | 2213 |
| 919 | Ga0495676_0142867 | 3300047321 | Bacteria | 1713 |
| 920 | Ga0495676_0231826 | 3300047321 | Bacteria | 1268 |
| 921 | Ga0495680_0006738 | 3300047322 | Bacteria | 10622 |
| 922 | Ga0495680_0032645 | 3300047322 | Bacteria | 4223 |
| 923 | Ga0495680_0073685 | 3300047322 | Bacteria | 2594 |
| 924 | Ga0495680_0079188 | 3300047322 | Bacteria | 2485 |
| 925 | Ga0495683_0039314 | 3300047323 | Bacteria | 2391 |
| 926 | Ga0495687_014453 | 3300047443 | Bacteria | 4063 |
| 927 | Ga0495675_0030949 | 3300047444 | Bacteria | 3415 |
| 928 | Ga0495675_0058848 | 3300047444 | Bacteria | 2436 |
| 929 | Ga0495675_0085587 | 3300047444 | Bacteria | 1982 |
| 930 | Ga0495677_0015402 | 3300047445 | Bacteria | 2778 |
| 931 | Ga0495677_0075179 | 3300047445 | Bacteria | 1262 |
| 932 | Ga0495673_0074325 | 3300047469 | Bacteria | 1422 |
| 933 | Ga0495684_0036766 | 3300047471 | Bacteria | 3754 |
| 934 | Ga0495684_0050588 | 3300047471 | Bacteria | 3172 |
| 935 | Ga0495684_0062922 | 3300047471 | Bacteria | 2822 |
| 936 | Ga0495684_0076364 | 3300047471 | Bacteria | 2544 |
| 937 | Ga0495684_0101594 | 3300047471 | Bacteria | 2174 |
| 938 | Ga0495684_0117501 | 3300047471 | Unclassified | 2004 |
| 939 | Ga0495684_0122289 | 3300047471 | Bacteria | 1959 |
| 940 | Ga0495684_0134132 | 3300047471 | Bacteria | 1858 |
| 941 | Ga0495686_0183405 | 3300047472 | Bacteria | 1211 |
| 942 | Ga0495686_0224303 | 3300047472 | Bacteria | 1067 |
| 943 | Ga0495593_0019768 | 3300047673 | Bacteria | 3774 |
| 944 | Ga0495593_0050796 | 3300047673 | Bacteria | 2196 |
| 945 | Ga0495593_0060529 | 3300047673 | Bacteria | 1982 |
| 946 | Ga0495593_0060901 | 3300047673 | Bacteria | 1975 |
| 947 | Ga0495602_0005817 | 3300048088 | Bacteria | 12942 |
| 948 | Ga0495602_0047118 | 3300048088 | Bacteria | 3887 |
| 949 | Ga0495602_0089562 | 3300048088 | Bacteria | 2558 |
| 950 | Ga0495602_0114921 | 3300048088 | Bacteria | 2178 |
| 951 | Ga0495602_0168536 | 3300048088 | Bacteria | 1702 |
| 952 | Ga0495614_0054843 | 3300048089 | Unclassified | 1710 |
| 953 | Ga0495614_0108878 | 3300048089 | Bacteria | 1216 |
| 954 | Ga0496100_0001434 | 3300048903 | Bacteria | 11668 |
| 955 | Ga0496100_0007637 | 3300048903 | Bacteria | 5980 |
| 956 | Ga0496100_0021279 | 3300048903 | Bacteria | 3903 |
| 957 | Ga0496100_0112566 | 3300048903 | Bacteria | 1893 |
| 958 | Ga0496100_0131773 | 3300048903 | Bacteria | 1762 |
| 959 | Ga0496100_0165090 | 3300048903 | Bacteria | 1590 |
| 960 | Ga0496101_0002254 | 3300048904 | Bacteria | 11787 |
| 961 | Ga0496101_0030531 | 3300048904 | Bacteria | 3780 |
| 962 | Ga0496101_0043909 | 3300048904 | Bacteria | 3196 |
| 963 | Ga0496101_0064417 | 3300048904 | Bacteria | 2670 |
| 964 | Ga0496102_0001340 | 3300048905 | Bacteria | 22086 |
| 965 | Ga0496102_0001732 | 3300048905 | Bacteria | 19108 |
| 966 | Ga0496102_0022395 | 3300048905 | Bacteria | 5597 |
| 967 | Ga0496102_0073493 | 3300048905 | Bacteria | 3142 |
| 968 | Ga0496102_0144298 | 3300048905 | Bacteria | 2233 |
| 969 | Ga0496102_0170195 | 3300048905 | Bacteria | 2051 |
| 970 | Ga0496102_0320985 | 3300048905 | Bacteria | 1459 |
| 971 | Ga0496103_0028828 | 3300048906 | Bacteria | 3371 |
| 972 | Ga0496103_0031135 | 3300048906 | Bacteria | 3250 |
| 973 | Ga0496103_0045510 | 3300048906 | Bacteria | 2708 |
| 974 | Ga0496104_0002060 | 3300048907 | Bacteria | 17457 |
| 975 | Ga0496104_0024607 | 3300048907 | Bacteria | 5538 |
| 976 | Ga0496104_0049168 | 3300048907 | Bacteria | 3976 |
| 977 | Ga0496104_0081984 | 3300048907 | Bacteria | 3076 |
| 978 | Ga0496104_0086015 | 3300048907 | Bacteria | 3001 |
| 979 | Ga0496104_0100245 | 3300048907 | Bacteria | 2772 |
| 980 | Ga0496104_0239864 | 3300048907 | Bacteria | 1725 |
| 981 | Ga0496105_0001290 | 3300048908 | Bacteria | 17532 |
| 982 | Ga0496105_0003659 | 3300048908 | Bacteria | 11426 |
| 983 | Ga0496105_0012783 | 3300048908 | Bacteria | 6651 |
| 984 | Ga0496105_0018396 | 3300048908 | Bacteria | 5614 |
| 985 | Ga0496105_0038693 | 3300048908 | Bacteria | 3929 |
| 986 | Ga0496105_0104257 | 3300048908 | Bacteria | 2342 |
| 987 | Ga0496105_0265635 | 3300048908 | Bacteria | 1387 |
| 988 | Ga0496106_0000749 | 3300048909 | Bacteria | 23393 |
| 989 | Ga0496106_0028512 | 3300048909 | Bacteria | 4158 |
| 990 | Ga0496106_0036966 | 3300048909 | Bacteria | 3652 |
| 991 | Ga0496106_0056039 | 3300048909 | Bacteria | 2980 |
| 992 | Ga0496106_0061778 | 3300048909 | Bacteria | 2843 |
| 993 | Ga0496106_0213394 | 3300048909 | Bacteria | 1538 |
| 994 | Ga0496106_0291456 | 3300048909 | Bacteria | 1308 |
| 995 | Ga0496107_0039367 | 3300048910 | Bacteria | 3391 |
| 996 | Ga0496107_0053993 | 3300048910 | Bacteria | 2899 |
| 997 | Ga0496107_0073563 | 3300048910 | Bacteria | 2486 |
| 998 | Ga0496107_0186327 | 3300048910 | Bacteria | 1541 |
| 999 | Ga0496108_0010203 | 3300048911 | Bacteria | 7628 |
| 1000 | Ga0496108_0011810 | 3300048911 | Bacteria | 7104 |
| 1001 | Ga0496108_0039896 | 3300048911 | Bacteria | 3913 |
| 1002 | Ga0496108_0066552 | 3300048911 | Bacteria | 3038 |
| 1003 | Ga0496108_0207359 | 3300048911 | Bacteria | 1701 |
| 1004 | Ga0496108_0226935 | 3300048911 | Bacteria | 1623 |
| 1005 | Ga0496109_0000643 | 3300048912 | Bacteria | 28967 |
| 1006 | Ga0496109_0000878 | 3300048912 | Bacteria | 25065 |
| 1007 | Ga0496109_0001869 | 3300048912 | Bacteria | 17451 |
| 1008 | Ga0496109_0075469 | 3300048912 | Bacteria | 3100 |
| 1009 | Ga0496109_0089707 | 3300048912 | Bacteria | 2843 |
| 1010 | Ga0496109_0145889 | 3300048912 | Bacteria | 2214 |
| 1011 | Ga0496109_0200080 | 3300048912 | Bacteria | 1878 |
| 1012 | Ga0496109_0216609 | 3300048912 | Bacteria | 1800 |
| 1013 | Ga0496109_0267131 | 3300048912 | Bacteria | 1612 |
| 1014 | Ga0496110_0001735 | 3300048913 | Bacteria | 16067 |
| 1015 | Ga0496110_0003655 | 3300048913 | Bacteria | 11832 |
| 1016 | Ga0496110_0015850 | 3300048913 | Bacteria | 6284 |
| 1017 | Ga0496110_0023944 | 3300048913 | Bacteria | 5199 |
| 1018 | Ga0496110_0024335 | 3300048913 | Bacteria | 5160 |
| 1019 | Ga0496110_0044621 | 3300048913 | Bacteria | 3871 |
| 1020 | Ga0496110_0105229 | 3300048913 | Bacteria | 2531 |
| 1021 | Ga0496111_0000913 | 3300048914 | Bacteria | 16088 |
| 1022 | Ga0496111_0019396 | 3300048914 | Bacteria | 4722 |
| 1023 | Ga0496111_0029686 | 3300048914 | Bacteria | 3884 |
| 1024 | Ga0496111_0059309 | 3300048914 | Bacteria | 2772 |
| 1025 | Ga0496111_0072095 | 3300048914 | Bacteria | 2514 |
| 1026 | Ga0496111_0094951 | 3300048914 | Bacteria | 2187 |
| 1027 | Ga0496112_0000037 | 3300048915 | Bacteria | 96876 |
| 1028 | Ga0496112_0001774 | 3300048915 | Bacteria | 16942 |
| 1029 | Ga0496112_0002522 | 3300048915 | Bacteria | 14782 |
| 1030 | Ga0496112_0013688 | 3300048915 | Bacteria | 7498 |
| 1031 | Ga0496112_0050148 | 3300048915 | Bacteria | 4092 |
| 1032 | Ga0496112_0058286 | 3300048915 | Bacteria | 3802 |
| 1033 | Ga0496112_0063987 | 3300048915 | Bacteria | 3628 |
| 1034 | Ga0496112_0208879 | 3300048915 | Bacteria | 1910 |
| 1035 | Ga0496112_0304835 | 3300048915 | Bacteria | 1538 |
| 1036 | Ga0496113_0003788 | 3300048916 | Bacteria | 9140 |
| 1037 | Ga0496113_0048029 | 3300048916 | Bacteria | 3174 |
| 1038 | Ga0496113_0072488 | 3300048916 | Bacteria | 2621 |
| 1039 | Ga0496113_0078147 | 3300048916 | Bacteria | 2532 |
| 1040 | Ga0496113_0172447 | 3300048916 | Bacteria | 1713 |
| 1041 | Ga0496114_0003687 | 3300048917 | Bacteria | 11784 |
| 1042 | Ga0496114_0076711 | 3300048917 | Bacteria | 2816 |
| 1043 | Ga0496114_0152026 | 3300048917 | Bacteria | 2008 |
| 1044 | Ga0496115_0008406 | 3300048918 | Bacteria | 7639 |
| 1045 | Ga0496115_0041731 | 3300048918 | Bacteria | 3653 |
| 1046 | Ga0496115_0128087 | 3300048918 | Bacteria | 2091 |
| 1047 | Ga0496115_0164149 | 3300048918 | Bacteria | 1836 |
| 1048 | Ga0496117_0030307 | 3300048920 | Bacteria | 4154 |
| 1049 | Ga0496117_0031929 | 3300048920 | Bacteria | 4012 |
| 1050 | Ga0496117_0052997 | 3300048920 | Bacteria | 2854 |
| 1051 | Ga0496118_0020940 | 3300048921 | Bacteria | 5781 |
| 1052 | Ga0496118_0099337 | 3300048921 | Bacteria | 1973 |
| 1053 | Ga0496118_0104805 | 3300048921 | Bacteria | 1897 |
| 1054 | Ga0496118_0160591 | 3300048921 | Bacteria | 1390 |
| 1055 | Ga0496119_0000934 | 3300048922 | Bacteria | 37665 |
| 1056 | Ga0496119_0057082 | 3300048922 | Bacteria | 2362 |
| 1057 | Ga0496120_0007334 | 3300048923 | Bacteria | 8226 |
| 1058 | Ga0496121_0001566 | 3300048924 | Bacteria | 38176 |
| 1059 | Ga0496121_0015424 | 3300048924 | Bacteria | 8009 |
| 1060 | Ga0496121_0021364 | 3300048924 | Bacteria | 6343 |
| 1061 | Ga0496121_0033449 | 3300048924 | Bacteria | 4651 |
| 1062 | Ga0496121_0039187 | 3300048924 | Bacteria | 4181 |
| 1063 | Ga0496121_0054203 | 3300048924 | Bacteria | 3353 |
| 1064 | Ga0496121_0077245 | 3300048924 | Bacteria | 2652 |
| 1065 | Ga0496122_0028857 | 3300048925 | Bacteria | 4694 |
| 1066 | Ga0496122_0165108 | 3300048925 | Bacteria | 1344 |
| 1067 | Ga0496123_0011686 | 3300048926 | Bacteria | 7574 |
| 1068 | Ga0496124_0039476 | 3300048927 | Bacteria | 4092 |
| 1069 | Ga0496124_0063566 | 3300048927 | Bacteria | 3083 |
| 1070 | Ga0496124_0088542 | 3300048927 | Bacteria | 2530 |
| 1071 | Ga0496124_0278801 | 3300048927 | Bacteria | 1220 |
| 1072 | Ga0496125_0175403 | 3300048928 | Bacteria | 1435 |
| 1073 | Ga0496125_0228827 | 3300048928 | Bacteria | 1191 |
| 1074 | Ga0496125_0255429 | 3300048928 | Bacteria | 1102 |
| 1075 | Ga0496126_0002888 | 3300048929 | Bacteria | 22406 |
| 1076 | Ga0496126_0006284 | 3300048929 | Bacteria | 13262 |
| 1077 | Ga0496126_0011492 | 3300048929 | Bacteria | 9157 |
| 1078 | Ga0496126_0015066 | 3300048929 | Bacteria | 7793 |
| 1079 | Ga0496126_0019797 | 3300048929 | Bacteria | 6621 |
| 1080 | Ga0501031_0051468 | 3300049568 | Bacteria | 2682 |
| 1081 | Ga0501032_0000055 | 3300049569 | Bacteria | 99207 |
| 1082 | Ga0501032_0223014 | 3300049569 | Bacteria | 1226 |
| 1083 | Ga0501033_0001478 | 3300049570 | Bacteria | 20801 |
| 1084 | Ga0501034_0001317 | 3300049571 | Bacteria | 33620 |
| 1085 | Ga0501034_0521317 | 3300049571 | Bacteria | 1100 |
| 1086 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 1087 | Ga0501036_0005983 | 3300049572 | Bacteria | 9863 |
| 1088 | Ga0501036_0134104 | 3300049572 | Bacteria | 2090 |
| 1089 | Ga0501037_0001418 | 3300049573 | Bacteria | 17590 |
| 1090 | Ga0501038_0000070 | 3300049574 | Bacteria | 84371 |
| 1091 | Ga0501038_0088596 | 3300049574 | Bacteria | 2597 |
| 1092 | Ga0501038_0221071 | 3300049574 | Bacteria | 1511 |
| 1093 | Ga0501039_0001437 | 3300049575 | Bacteria | 17545 |
| 1094 | Ga0501039_0225438 | 3300049575 | Bacteria | 1473 |
| 1095 | Ga0501040_0094632 | 3300049576 | Bacteria | 2079 |
| 1096 | Ga0501042_0043428 | 3300049578 | Bacteria | 3201 |
| 1097 | Ga0501042_0209952 | 3300049578 | Bacteria | 1404 |
| 1098 | Ga0501043_0000078 | 3300049579 | Bacteria | 85968 |
| 1099 | Ga0501043_0024823 | 3300049579 | Bacteria | 4703 |
| 1100 | Ga0501046_0000627 | 3300049580 | Bacteria | 34652 |
| 1101 | Ga0501046_0015839 | 3300049580 | Bacteria | 6326 |
| 1102 | Ga0501046_0048649 | 3300049580 | Bacteria | 3357 |
| 1103 | Ga0501046_0154282 | 3300049580 | Bacteria | 1731 |
| 1104 | Ga0501047_0000810 | 3300049581 | Bacteria | 32588 |
| 1105 | Ga0501047_0054389 | 3300049581 | Bacteria | 3872 |
| 1106 | Ga0501047_0054608 | 3300049581 | Bacteria | 3864 |
| 1107 | Ga0501047_0087151 | 3300049581 | Bacteria | 3000 |
| 1108 | Ga0501047_0188580 | 3300049581 | Bacteria | 1926 |
| 1109 | Ga0501048_0001060 | 3300049582 | Bacteria | 20590 |
| 1110 | Ga0501067_0000177 | 3300049583 | Bacteria | 35936 |
| 1111 | Ga0501069_0096433 | 3300049585 | Bacteria | 1676 |
| 1112 | Ga0501069_0124527 | 3300049585 | Bacteria | 1473 |
| 1113 | Ga0501070_0001227 | 3300049586 | Bacteria | 22954 |
| 1114 | Ga0501072_0004769 | 3300049588 | Bacteria | 10323 |
| 1115 | Ga0501072_0109122 | 3300049588 | Bacteria | 2202 |
| 1116 | Ga0501072_0218692 | 3300049588 | Bacteria | 1518 |
| 1117 | Ga0501072_0234141 | 3300049588 | Bacteria | 1463 |
| 1118 | Ga0501073_0000039 | 3300049589 | Bacteria | 86080 |
| 1119 | Ga0501074_0000019 | 3300049590 | Bacteria | 72385 |
| 1120 | Ga0501074_0028878 | 3300049590 | Bacteria | 4018 |
| 1121 | Ga0501075_0124073 | 3300049591 | Bacteria | 1966 |
| 1122 | Ga0501076_0031722 | 3300049592 | Bacteria | 4124 |
| 1123 | Ga0501076_0036948 | 3300049592 | Bacteria | 3829 |
| 1124 | Ga0501076_0092578 | 3300049592 | Bacteria | 2432 |
| 1125 | Ga0501079_0060118 | 3300049741 | Bacteria | 2931 |
| 1126 | Ga0501080_0000827 | 3300049742 | Bacteria | 25307 |
| 1127 | Ga0501080_0006935 | 3300049742 | Bacteria | 10221 |
| 1128 | Ga0501080_0214338 | 3300049742 | Bacteria | 1764 |
| 1129 | Ga0501081_0095296 | 3300049743 | Bacteria | 2098 |
| 1130 | Ga0501083_0000242 | 3300049744 | Bacteria | 35191 |
| 1131 | Ga0501083_0087287 | 3300049744 | Bacteria | 2063 |
| 1132 | Ga0501035_0001565 | 3300049822 | Bacteria | 23271 |
| 1133 | Ga0501035_0024129 | 3300049822 | Bacteria | 5579 |
| 1134 | Ga0501035_0149840 | 3300049822 | Bacteria | 2025 |
| 1135 | Ga0501035_0151616 | 3300049822 | Bacteria | 2011 |
| 1136 | Ga0501035_0374161 | 3300049822 | Bacteria | 1189 |
| 1137 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 1138 | Ga0501044_0014456 | 3300049823 | Bacteria | 8522 |
| 1139 | Ga0501044_0029341 | 3300049823 | Bacteria | 5800 |
| 1140 | Ga0501044_0175310 | 3300049823 | Bacteria | 2113 |
| 1141 | Ga0501044_0532181 | 3300049823 | Bacteria | 1074 |
| 1142 | Ga0501045_0003829 | 3300049824 | Bacteria | 10352 |
| 1143 | nmdc:mga03683_18496_c1 | 3300050489 | Bacteria | 2650 |
| 1144 | nmdc:mga03683_25741_c1 | 3300050489 | Bacteria | 2314 |
| 1145 | nmdc:mga03683_37033_c1 | 3300050489 | Bacteria | 1987 |
| 1146 | nmdc:mga03n38_3593_c1 | 3300050490 | Bacteria | 5011 |
| 1147 | nmdc:mga03n38_6145_c1 | 3300050490 | Bacteria | 2353 |
| 1148 | nmdc:mga03n38_6519_c1 | 3300050490 | Bacteria | 4062 |
| 1149 | nmdc:mga00v17_14203_c1 | 3300050491 | Bacteria | 4440 |
| 1150 | nmdc:mga00v17_67617_c1 | 3300050491 | Bacteria | 2208 |
| 1151 | nmdc:mga00v17_74501_c1 | 3300050491 | Bacteria | 2110 |
| 1152 | nmdc:mga00v17_84926_c1 | 3300050491 | Bacteria | 1982 |
| 1153 | nmdc:mga0yw44_103732_c1 | 3300050492 | Bacteria | 1814 |
| 1154 | nmdc:mga0yw44_20795_c1 | 3300050492 | Bacteria | 3649 |
| 1155 | nmdc:mga0yw44_44695_c1 | 3300050492 | Bacteria | 2651 |
| 1156 | nmdc:mga0yw44_46962_c1 | 3300050492 | Bacteria | 2597 |
| 1157 | nmdc:mga0yw44_79520_c1 | 3300050492 | Bacteria | 2052 |
| 1158 | nmdc:mga0yw44_81001_c1 | 3300050492 | Bacteria | 2035 |
| 1159 | nmdc:mga0yw44_82070_c1 | 3300050492 | Bacteria | 2022 |
| 1160 | nmdc:mga0k408_4051_c1 | 3300050493 | Bacteria | 7774 |
| 1161 | nmdc:mga0k408_46879_c1 | 3300050493 | Bacteria | 2497 |
| 1162 | nmdc:mga0k408_70815_c1 | 3300050493 | Bacteria | 2035 |
| 1163 | nmdc:mga06z11_120663_c1 | 3300050494 | Bacteria | 1462 |
| 1164 | nmdc:mga06z11_208593_c1 | 3300050494 | Bacteria | 1138 |
| 1165 | nmdc:mga06z11_65644_c1 | 3300050494 | Bacteria | 1905 |
| 1166 | nmdc:mga06z11_70089_c1 | 3300050494 | Bacteria | 1853 |
| 1167 | nmdc:mga04h51_24192_c1 | 3300050495 | Bacteria | 1858 |
| 1168 | nmdc:mga04h51_7894_c1 | 3300050495 | Bacteria | 2829 |
| 1169 | nmdc:mga07m45_29552_c1 | 3300050496 | Bacteria | 3032 |
| 1170 | nmdc:mga07m45_3594_c1 | 3300050496 | Bacteria | 4314 |
| 1171 | nmdc:mga07m45_4538_c1 | 3300050496 | Bacteria | 6801 |
| 1172 | nmdc:mga05p37_130168_c1 | 3300050507 | Bacteria | 3087 |
| 1173 | nmdc:mga05p37_1334_c1 | 3300050507 | Bacteria | 28685 |
| 1174 | nmdc:mga05p37_142693_c2 | 3300050507 | Unclassified | 2514 |
| 1175 | nmdc:mga05p37_243135_c1 | 3300050507 | Bacteria | 2163 |
| 1176 | nmdc:mga05p37_5239_c2 | 3300050507 | Bacteria | 13210 |
| 1177 | nmdc:mga09592_10920_c1 | 3300050508 | Bacteria | 7391 |
| 1178 | nmdc:mga09592_297237_c1 | 3300050508 | Bacteria | 1400 |
| 1179 | nmdc:mga0qj67_13891_c1 | 3300050509 | Bacteria | 6080 |
| 1180 | nmdc:mga0qj67_20483_c1 | 3300050509 | Bacteria | 5064 |
| 1181 | nmdc:mga0qj67_60_c1 | 3300050509 | Bacteria | 80228 |
| 1182 | nmdc:mga0qj67_7222_c1 | 3300050509 | Bacteria | 8204 |
| 1183 | nmdc:mga06r32_19847_c1 | 3300050510 | Bacteria | 6176 |
| 1184 | nmdc:mga06r32_215358_c1 | 3300050510 | Bacteria | 1908 |
| 1185 | nmdc:mga06r32_872_c1 | 3300050510 | Bacteria | 26841 |
| 1186 | nmdc:mga08y16_193845_c1 | 3300050511 | Bacteria | 2107 |
| 1187 | nmdc:mga08y16_201752_c1 | 3300050511 | Bacteria | 2061 |
| 1188 | nmdc:mga08y16_297343_c1 | 3300050511 | Bacteria | 1664 |
| 1189 | nmdc:mga08y16_9141_c1 | 3300050511 | Bacteria | 10401 |
| 1190 | nmdc:mga08y16_95120_c1 | 3300050511 | Bacteria | 3103 |
| 1191 | nmdc:mga0n895_1132_c1 | 3300050512 | Bacteria | 19499 |
| 1192 | nmdc:mga0n895_159639_c1 | 3300050512 | Bacteria | 2286 |
| 1193 | nmdc:mga0n895_21125_c1 | 3300050512 | Bacteria | 6083 |
| 1194 | nmdc:mga0rr50_67985_c1 | 3300050513 | Bacteria | 2708 |
| 1195 | nmdc:mga0a205_13217_c1 | 3300050515 | Bacteria | 7673 |
| 1196 | nmdc:mga0a205_5869_c2 | 3300050515 | Bacteria | 10044 |
| 1197 | nmdc:mga0a205_78600_c1 | 3300050515 | Unclassified | 2312 |
| 1198 | nmdc:mga0a205_85283_c1 | 3300050515 | Bacteria | 3050 |
| 1199 | nmdc:mga0sz30_13927_c1 | 3300050516 | Bacteria | 3157 |
| 1200 | nmdc:mga0sz30_19236_c1 | 3300050516 | Bacteria | 2743 |
| 1201 | nmdc:mga0sz30_24187_c1 | 3300050516 | Bacteria | 2478 |
| 1202 | nmdc:mga0sz30_56386_c1 | 3300050516 | Bacteria | 1673 |
| 1203 | Ga0495601_0005803 | 3300053077 | Bacteria | 7198 |
| 1204 | Ga0495601_0011057 | 3300053077 | Bacteria | 5392 |
| 1205 | Ga0495601_0049193 | 3300053077 | Bacteria | 2658 |
| 1206 | Ga0495601_0080475 | 3300053077 | Bacteria | 2090 |
| 1207 | Ga0495601_0140465 | 3300053077 | Bacteria | 1575 |
| 1208 | Ga0495601_0169888 | 3300053077 | Bacteria | 1425 |
| 1209 | Ga0495612_0007050 | 3300053078 | Bacteria | 4598 |
| 1210 | Ga0495612_0016525 | 3300053078 | Bacteria | 2956 |
| 1211 | Ga0495612_0053459 | 3300053078 | Bacteria | 1663 |
| 1212 | Ga0495612_0055746 | 3300053078 | Bacteria | 1630 |
| 1213 | Ga0500610_0070254 | 3300053079 | Bacteria | 1826 |
| 1214 | Ga0500635_0002704 | 3300053080 | Bacteria | 4399 |
| 1215 | Ga0495655_0012562 | 3300053083 | Bacteria | 1729 |
| 1216 | Ga0495655_0037016 | 3300053083 | Bacteria | 1223 |
| 1217 | Ga0495595_0001332 | 3300053084 | Bacteria | 9605 |
| 1218 | Ga0495595_0020033 | 3300053084 | Bacteria | 2907 |
| 1219 | Ga0495595_0063076 | 3300053084 | Unclassified | 1739 |
| 1220 | Ga0495619_0001258 | 3300053085 | Bacteria | 16610 |
| 1221 | Ga0495619_0028778 | 3300053085 | Bacteria | 3586 |
| 1222 | Ga0495619_0050904 | 3300053085 | Bacteria | 2735 |
| 1223 | Ga0495619_0058284 | 3300053085 | Bacteria | 2563 |
| 1224 | Ga0495619_0059483 | 3300053085 | Bacteria | 2538 |
| 1225 | Ga0495619_0178144 | 3300053085 | Bacteria | 1470 |
| 1226 | Ga0495619_0295338 | 3300053085 | Bacteria | 1122 |
| 1227 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1228 | Ga0500644_0106857 | 3300053088 | Bacteria | 1072 |
| 1229 | Ga0500647_0009841 | 3300053091 | Bacteria | 4210 |
| 1230 | Ga0500566_0021751 | 3300053094 | Bacteria | 3769 |
| 1231 | Ga0500641_0006994 | 3300053096 | Bacteria | 4017 |
| 1232 | Ga0500641_0116311 | 3300053096 | Bacteria | 1152 |
| 1233 | Ga0500555_005931 | 3300053103 | Bacteria | 3467 |
| 1234 | Ga0500556_0025840 | 3300053104 | Bacteria | 1944 |
| 1235 | Ga0500557_000030 | 3300053105 | Bacteria | 76944 |
| 1236 | Ga0500569_016936 | 3300053109 | Bacteria | 1854 |
| 1237 | Ga0500594_0015471 | 3300053118 | Bacteria | 1841 |
| 1238 | Ga0500595_002714 | 3300053119 | Bacteria | 8575 |
| 1239 | Ga0500626_079396 | 3300053128 | Bacteria | 1452 |
| 1240 | Ga0500642_0000148 | 3300053130 | Bacteria | 30505 |
| 1241 | Ga0500642_0032629 | 3300053130 | Bacteria | 2186 |
| 1242 | Ga0500652_036114 | 3300053131 | Bacteria | 1966 |
| 1243 | Ga0500655_008285 | 3300053133 | Bacteria | 1871 |
| 1244 | Ga0500568_0001375 | 3300053139 | Bacteria | 15794 |
| 1245 | Ga0500577_0029299 | 3300053142 | Bacteria | 1905 |
| 1246 | Ga0500588_0020728 | 3300053146 | Bacteria | 1765 |
| 1247 | Ga0500604_0000076 | 3300053151 | Bacteria | 35570 |
| 1248 | Ga0500616_0125787 | 3300053153 | Bacteria | 1218 |
| 1249 | Ga0500620_004246 | 3300053155 | Bacteria | 3178 |
| 1250 | Ga0500636_0002634 | 3300053177 | Bacteria | 9976 |
| 1251 | Ga0500637_0208125 | 3300053178 | Bacteria | 1111 |
| 1252 | Ga0500611_021128 | 3300053727 | Bacteria | 1239 |
| 1253 | Ga0500645_038077 | 3300053730 | Bacteria | 1427 |
| 1254 | Ga0500552_006385 | 3300053733 | Bacteria | 1321 |
| 1255 | Ga0500601_000287 | 3300053737 | Bacteria | 9581 |
| 1256 | Ga0501084_0045564 | 3300054114 | Bacteria | 3672 |
| 1257 | Ga0501084_0059048 | 3300054114 | Bacteria | 3210 |
| 1258 | Ga0501084_0432468 | 3300054114 | Bacteria | 1113 |
| 1259 | Ga0501082_0371760 | 3300060353 | Bacteria | 1247 |
| 1260 | Ga0501082_0434332 | 3300060353 | Bacteria | 1147 |
| 1261 | Ga0466962_0047456 | 3300061719 | Bacteria | 2052 |
| 1262 | Ga0530510_0150803 | 3300061734 | Bacteria | 1717 |
| 1263 | Ga0530510_0220795 | 3300061734 | Bacteria | 1408 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035241 | Ga0373961_0002074 | Ga0373961_0002074_890_1939 | 321 |
| 2 | 3300005435 | Ga0070714_100170156 | Ga0070714_1001701562 | 326 |
| 3 | 3300006175 | Ga0070712_100405114 | Ga0070712_1004051141 | 326 |
| 4 | 3300006195 | Ga0075366_10022553 | Ga0075366_100225533 | 326 |
| 5 | 3300031251 | Ga0265327_10017705 | Ga0265327_100177055 | 326 |
| 6 | 3300031711 | Ga0265314_10007260 | Ga0265314_100072608 | 326 |
| 7 | 3300041511 | Ga0451855_1643489 | Ga0451855_1643489_48_1067 | 326 |
| 8 | 3300048915 | Ga0496112_0304835 | Ga0496112_0304835_361_1341 | 326 |
| 9 | 3300042003 | Ga0439443_018774 | Ga0439443_018774_62_1045 | 327 |
| 10 | 3300009551 | Ga0105238_10018456 | Ga0105238_1001845610 | 330 |
| 11 | 3300025924 | Ga0207694_10254184 | Ga0207694_102541841 | 330 |
| 12 | 3300048918 | Ga0496115_0164149 | Ga0496115_0164149_267_1295 | 330 |
| 13 | 3300039450 | Ga0436363_0548376 | Ga0436363_0548376_966_2000 | 331 |
| 14 | 3300005347 | Ga0070668_100314952 | Ga0070668_1003149521 | 332 |
| 15 | 3300005356 | Ga0070674_100201057 | Ga0070674_1002010571 | 332 |
| 16 | 3300005456 | Ga0070678_100218123 | Ga0070678_1002181231 | 332 |
| 17 | 3300005548 | Ga0070665_100076145 | Ga0070665_1000761452 | 332 |
| 18 | 3300006038 | Ga0075365_10049112 | Ga0075365_100491121 | 332 |
| 19 | 3300006178 | Ga0075367_10013424 | Ga0075367_100134242 | 332 |
| 20 | 3300009098 | Ga0105245_10308143 | Ga0105245_103081432 | 332 |
| 21 | 3300009545 | Ga0105237_10033636 | Ga0105237_100336364 | 332 |
| 22 | 3300009551 | Ga0105238_10005684 | Ga0105238_1000568411 | 332 |
| 23 | 3300009551 | Ga0105238_10018513 | Ga0105238_100185133 | 332 |
| 24 | 3300009551 | Ga0105238_10192947 | Ga0105238_101929472 | 332 |
| 25 | 3300025914 | Ga0207671_10063316 | Ga0207671_100633162 | 332 |
| 26 | 3300025924 | Ga0207694_10010911 | Ga0207694_100109112 | 332 |
| 27 | 3300025924 | Ga0207694_10043684 | Ga0207694_100436844 | 332 |
| 28 | 3300025924 | Ga0207694_10223928 | Ga0207694_102239281 | 332 |
| 29 | 3300028379 | Ga0268266_10084829 | Ga0268266_100848292 | 332 |
| 30 | 3300031616 | Ga0307508_10044378 | Ga0307508_100443784 | 332 |
| 31 | 3300031730 | Ga0307516_10069114 | Ga0307516_100691142 | 332 |
| 32 | 3300046616 | Ga0495668_0028576 | Ga0495668_0028576_397_1425 | 332 |
| 33 | 3300047317 | Ga0495604_0116525 | Ga0495604_0116525_926_1924 | 332 |
| 34 | 3300048903 | Ga0496100_0131773 | Ga0496100_0131773_561_1589 | 332 |
| 35 | 3300048924 | Ga0496121_0039187 | Ga0496121_0039187_1060_2088 | 332 |
| 36 | 3300048927 | Ga0496124_0063566 | Ga0496124_0063566_1909_2937 | 332 |
| 37 | 3300048928 | Ga0496125_0175403 | Ga0496125_0175403_386_1414 | 332 |
| 38 | 3300050492 | nmdc:mga0yw44_81001_c1 | nmdc:mga0yw44_81001_c1_337_1365 | 332 |
| 39 | 3300050494 | nmdc:mga06z11_65644_c1 | nmdc:mga06z11_65644_c1_41_1069 | 332 |
| 40 | 3300025315 | Ga0207697_10045225 | Ga0207697_100452251 | 333 |
| 41 | 3300046683 | Ga0495658_0037171 | Ga0495658_0037171_211_1221 | 336 |
| 42 | 3300049588 | Ga0501072_0218692 | Ga0501072_0218692_22_1041 | 336 |
| 43 | iso_pu_bacteria | 2507262055 | 2507511923 | 338 |
| 44 | iso_pu_bacteria | 2508501009 | 2508545589 | 338 |
| 45 | iso_pu_bacteria | 2508501042 | 2508694405 | 338 |
| 46 | iso_pu_bacteria | 2511231028 | 2511401229 | 338 |
| 47 | iso_pu_bacteria | 2513237094 | 2513643262 | 338 |
| 48 | iso_pu_bacteria | 2513237095 | 2513651051 | 338 |
| 49 | iso_pu_bacteria | 2513237098 | 2513676776 | 338 |
| 50 | iso_pu_bacteria | 2513237104 | 2513717745 | 338 |
| 51 | iso_pu_bacteria | 2513237141 | 2513891095 | 338 |
| 52 | iso_pu_bacteria | 2515154112 | 2515624667 | 338 |
| 53 | iso_pu_bacteria | 2524023205 | 2524436621 | 338 |
| 54 | iso_pu_bacteria | 2524023210 | 2524464086 | 338 |
| 55 | iso_pu_bacteria | 2524023228 | 2524539893 | 338 |
| 56 | iso_pu_bacteria | 2617270735 | 2617349674 | 338 |
| 57 | iso_pu_bacteria | 2667528175 | 2671123355 | 338 |
| 58 | iso_pu_bacteria | 2728368998 | 2728752241 | 338 |
| 59 | iso_pu_bacteria | 2744054633 | 2745079305 | 338 |
| 60 | iso_pu_bacteria | 2791355197 | 2793067112 | 338 |
| 61 | iso_pu_bacteria | 2791355199 | 2793078362 | 338 |
| 62 | iso_pu_bacteria | 2816332527 | 2818242233 | 338 |
| 63 | iso_pu_bacteria | 2824600985 | 2824607199 | 338 |
| 64 | iso_pu_bacteria | 2824609381 | 2824615101 | 338 |
| 65 | iso_pu_bacteria | 2824653114 | 2824660179 | 338 |
| 66 | iso_pu_bacteria | 2824661429 | 2824668462 | 338 |
| 67 | iso_pu_bacteria | 2824679649 | 2824684330 | 338 |
| 68 | iso_pu_bacteria | 2844315083 | 2844321142 | 338 |
| 69 | iso_pu_bacteria | 2849076700 | 2849077219 | 338 |
| 70 | iso_pu_bacteria | 2857509624 | 2857515206 | 338 |
| 71 | iso_pu_bacteria | 2874590934 | 2874592188 | 338 |
| 72 | iso_pu_bacteria | 2874628541 | 2874630933 | 338 |
| 73 | iso_pu_bacteria | 2874645413 | 2874647022 | 338 |
| 74 | iso_pu_bacteria | 2876761206 | 2876767463 | 338 |
| 75 | iso_pu_bacteria | 2876771140 | 2876772399 | 338 |
| 76 | iso_pu_bacteria | 2876818435 | 2876819668 | 338 |
| 77 | iso_pu_bacteria | 2879074833 | 2879076243 | 338 |
| 78 | iso_pu_bacteria | 2879099564 | 2879100164 | 338 |
| 79 | iso_pu_bacteria | 2879127579 | 2879132576 | 338 |
| 80 | iso_pu_bacteria | 2879142872 | 2879144714 | 338 |
| 81 | iso_pu_bacteria | 2885409591 | 2885414221 | 338 |
| 82 | iso_pu_bacteria | 2888378607 | 2888387430 | 338 |
| 83 | iso_pu_bacteria | 2888388044 | 2888391767 | 338 |
| 84 | iso_pu_bacteria | 2888419890 | 2888426652 | 338 |
| 85 | iso_pu_bacteria | 2903727486 | 2903728566 | 338 |
| 86 | iso_pu_bacteria | 2903748898 | 2903756709 | 338 |
| 87 | iso_pu_bacteria | 2904690495 | 2904692973 | 338 |
| 88 | iso_pu_bacteria | 2904699407 | 2904709784 | 338 |
| 89 | iso_pu_bacteria | 2906602504 | 2906607757 | 338 |
| 90 | iso_pu_bacteria | 2906610324 | 2906614349 | 338 |
| 91 | iso_pu_bacteria | 2906635258 | 2906639154 | 338 |
| 92 | iso_pu_bacteria | 2906660503 | 2906666722 | 338 |
| 93 | iso_pu_bacteria | 2908756301 | 2908758005 | 338 |
| 94 | iso_pu_bacteria | 2922368715 | 2922370509 | 338 |
| 95 | iso_pu_bacteria | 2922386360 | 2922392080 | 338 |
| 96 | iso_pu_bacteria | 2922393267 | 2922396482 | 338 |
| 97 | iso_pu_bacteria | 2922425934 | 2922426178 | 338 |
| 98 | iso_pu_bacteria | 2929615660 | 2929620089 | 338 |
| 99 | iso_pu_bacteria | 2929624759 | 2929629402 | 338 |
| 100 | iso_pu_bacteria | 2932784394 | 2932791445 | 338 |
| 101 | iso_pu_bacteria | 2932809354 | 2932816699 | 338 |
| 102 | iso_pu_bacteria | 2932818245 | 2932824119 | 338 |
| 103 | iso_pu_bacteria | 2932828146 | 2932835347 | 338 |
| 104 | iso_pu_bacteria | 2933577622 | 2933582006 | 338 |
| 105 | iso_pu_bacteria | 2935608549 | 2935613433 | 338 |
| 106 | iso_pu_bacteria | 2935616580 | 2935621090 | 338 |
| 107 | iso_pu_bacteria | 2935630451 | 2935632566 | 338 |
| 108 | iso_pu_bacteria | 2935638405 | 2935643603 | 338 |
| 109 | iso_pu_bacteria | 2935648319 | 2935656500 | 338 |
| 110 | iso_pu_bacteria | 2935656913 | 2935665315 | 338 |
| 111 | iso_pu_bacteria | 2935665750 | 2935671087 | 338 |
| 112 | iso_pu_bacteria | 2935675223 | 2935681307 | 338 |
| 113 | iso_pu_bacteria | 2935684952 | 2935689347 | 338 |
| 114 | iso_pu_bacteria | 2935694250 | 2935699925 | 338 |
| 115 | iso_pu_bacteria | 2935703347 | 2935712144 | 338 |
| 116 | iso_pu_bacteria | 2935713505 | 2935720293 | 338 |
| 117 | iso_pu_bacteria | 2935722832 | 2935728090 | 338 |
| 118 | iso_pu_bacteria | 2935732158 | 2935737313 | 338 |
| 119 | iso_pu_bacteria | 2935741537 | 2935746626 | 338 |
| 120 | iso_pu_bacteria | 2935750917 | 2935757593 | 338 |
| 121 | iso_pu_bacteria | 2935760218 | 2935763969 | 338 |
| 122 | iso_pu_bacteria | 2935769743 | 2935776689 | 338 |
| 123 | iso_pu_bacteria | 2935777560 | 2935784028 | 338 |
| 124 | iso_pu_bacteria | 2935785616 | 2935789900 | 338 |
| 125 | iso_pu_bacteria | 2935793552 | 2935798334 | 338 |
| 126 | iso_pu_bacteria | 2935801545 | 2935807944 | 338 |
| 127 | iso_pu_bacteria | 2935810662 | 2935818720 | 338 |
| 128 | iso_pu_bacteria | 2935819856 | 2935824714 | 338 |
| 129 | iso_pu_bacteria | 2935827899 | 2935833120 | 338 |
| 130 | iso_pu_bacteria | 2935837841 | 2935844224 | 338 |
| 131 | iso_pu_bacteria | 2935847175 | 2935851934 | 338 |
| 132 | iso_pu_bacteria | 2935855204 | 2935859717 | 338 |
| 133 | iso_pu_bacteria | 2935864058 | 2935872115 | 338 |
| 134 | iso_pu_bacteria | 2935873716 | 2935878961 | 338 |
| 135 | iso_pu_bacteria | 2935908558 | 2935911281 | 338 |
| 136 | iso_pu_bacteria | 2935916978 | 2935920813 | 338 |
| 137 | iso_pu_bacteria | 2935926038 | 2935928310 | 338 |
| 138 | iso_pu_bacteria | 2935934488 | 2935937955 | 338 |
| 139 | iso_pu_bacteria | 2935942939 | 2935945237 | 338 |
| 140 | iso_pu_bacteria | 2935951376 | 2935954257 | 338 |
| 141 | iso_pu_bacteria | 2935959822 | 2935965664 | 338 |
| 142 | iso_pu_bacteria | 2935967501 | 2935971475 | 338 |
| 143 | iso_pu_bacteria | 2935975950 | 2935982094 | 338 |
| 144 | iso_pu_bacteria | 2935984226 | 2935990565 | 338 |
| 145 | iso_pu_bacteria | 2935992306 | 2936000308 | 338 |
| 146 | iso_pu_bacteria | 2936002035 | 2936008466 | 338 |
| 147 | iso_pu_bacteria | 2936011229 | 2936019391 | 338 |
| 148 | iso_pu_bacteria | 2936019824 | 2936027973 | 338 |
| 149 | iso_pu_bacteria | 2936028420 | 2936036756 | 338 |
| 150 | iso_pu_bacteria | 2936037263 | 2936045530 | 338 |
| 151 | iso_pu_bacteria | 2936046547 | 2936054817 | 338 |
| 152 | iso_pu_bacteria | 2936055302 | 2936063253 | 338 |
| 153 | iso_pu_bacteria | 2940556831 | 2940563585 | 338 |
| 154 | iso_pu_bacteria | 2941507105 | 2941508770 | 338 |
| 155 | iso_pu_bacteria | 2941515067 | 2941516600 | 338 |
| 156 | iso_pu_bacteria | 2941523033 | 2941524384 | 338 |
| 157 | iso_pu_bacteria | 2941531003 | 2941537315 | 338 |
| 158 | iso_pu_bacteria | 2941538514 | 2941542556 | 338 |
| 159 | iso_pu_bacteria | 3005474847 | 3005483366 | 338 |
| 160 | iso_pu_bacteria | 3005506211 | 3005506864 | 338 |
| 161 | iso_pu_bacteria | 3005594810 | 3005601478 | 338 |
| 162 | iso_pu_bacteria | 3005718088 | 3005724173 | 338 |
| 163 | iso_pu_bacteria | 8006926726 | 8006929307 | 338 |
| 164 | iso_pu_bacteria | 8006933436 | 8006936881 | 338 |
| 165 | iso_pu_bacteria | 8006964411 | 8006968975 | 338 |
| 166 | iso_pu_bacteria | 8006973647 | 8006976851 | 338 |
| 167 | iso_pu_bacteria | 8016511872 | 8016519441 | 338 |
| 168 | iso_pu_bacteria | 8016522445 | 8016524919 | 338 |
| 169 | iso_pu_bacteria | 8016530956 | 8016538493 | 338 |
| 170 | iso_pu_bacteria | 8016548790 | 8016550509 | 338 |
| 171 | iso_pu_bacteria | 8016557553 | 8016558925 | 338 |
| 172 | iso_pu_bacteria | 8016566248 | 8016568162 | 338 |
| 173 | iso_pu_bacteria | 8016575299 | 8016580833 | 338 |
| 174 | iso_pu_bacteria | 8016595262 | 8016596891 | 338 |
| 175 | iso_pu_bacteria | 8016603502 | 8016607794 | 338 |
| 176 | iso_pu_bacteria | 8016613128 | 8016619578 | 338 |
| 177 | iso_pu_bacteria | 8016622563 | 8016630026 | 338 |
| 178 | iso_pu_bacteria | 8016630954 | 8016637139 | 338 |
| 179 | iso_pu_bacteria | 8017057580 | 8017066079 | 338 |
| 180 | iso_pu_bacteria | 8019530166 | 8019538160 | 338 |
| 181 | iso_pu_bacteria | 8019538911 | 8019541826 | 338 |
| 182 | iso_pu_bacteria | 8019547302 | 8019548971 | 338 |
| 183 | iso_pu_bacteria | 8019555841 | 8019561806 | 338 |
| 184 | iso_pu_bacteria | 8019576017 | 8019578555 | 338 |
| 185 | iso_pu_bacteria | 8019597564 | 8019605100 | 338 |
| 186 | iso_pu_bacteria | 8019608314 | 8019613435 | 338 |
| 187 | iso_pu_bacteria | 8019619141 | 8019624106 | 338 |
| 188 | iso_pu_bacteria | 8019638758 | 8019641701 | 338 |
| 189 | iso_pu_bacteria | 8019648815 | 8019653625 | 338 |
| 190 | iso_pu_bacteria | 8019659431 | 8019665853 | 338 |
| 191 | iso_pu_bacteria | 8019668869 | 8019675378 | 338 |
| 192 | iso_pu_bacteria | 8019687851 | 8019695042 | 338 |
| 193 | iso_pu_bacteria | 8055742211 | 8055750158 | 338 |
| 194 | iso_pu_bacteria | 8056673599 | 8056675153 | 338 |
| 195 | iso_pu_bacteria | 8056681323 | 8056683821 | 338 |
| 196 | iso_pu_bacteria | 8056689827 | 8056695508 | 338 |
| 197 | iso_pu_bacteria | 8056967851 | 8056975939 | 338 |
| 198 | 3300006852 | Ga0075433_10241602 | Ga0075433_102416021 | 339 |
| 199 | 3300006871 | Ga0075434_100162467 | Ga0075434_1001624672 | 339 |
| 200 | 3300009147 | Ga0114129_10391778 | Ga0114129_103917782 | 339 |
| 201 | 3300049588 | Ga0501072_0234141 | Ga0501072_0234141_351_1373 | 339 |
| 202 | 3300050507 | nmdc:mga05p37_130168_c1 | nmdc:mga05p37_130168_c1_494_1513 | 339 |
| 203 | 3300050507 | nmdc:mga05p37_243135_c1 | nmdc:mga05p37_243135_c1_18_1037 | 339 |
| 204 | 3300050515 | nmdc:mga0a205_78600_c1 | nmdc:mga0a205_78600_c1_142_1161 | 339 |
| 205 | 3300060353 | Ga0501082_0371760 | Ga0501082_0371760_189_1211 | 339 |
| 206 | 3300005290 | Ga0065712_10084473 | Ga0065712_100844732 | 340 |
| 207 | 3300005328 | Ga0070676_10008503 | Ga0070676_100085032 | 340 |
| 208 | 3300005328 | Ga0070676_10162852 | Ga0070676_101628522 | 340 |
| 209 | 3300005329 | Ga0070683_100031382 | Ga0070683_1000313824 | 340 |
| 210 | 3300005329 | Ga0070683_100127712 | Ga0070683_1001277122 | 340 |
| 211 | 3300005336 | Ga0070680_100056430 | Ga0070680_1000564303 | 340 |
| 212 | 3300005338 | Ga0068868_100015981 | Ga0068868_1000159812 | 340 |
| 213 | 3300005339 | Ga0070660_100056660 | Ga0070660_1000566603 | 340 |
| 214 | 3300005339 | Ga0070660_100063926 | Ga0070660_1000639262 | 340 |
| 215 | 3300005340 | Ga0070689_100070947 | Ga0070689_1000709472 | 340 |
| 216 | 3300005344 | Ga0070661_100049192 | Ga0070661_1000491922 | 340 |
| 217 | 3300005344 | Ga0070661_100092167 | Ga0070661_1000921672 | 340 |
| 218 | 3300005345 | Ga0070692_10012291 | Ga0070692_100122912 | 340 |
| 219 | 3300005347 | Ga0070668_100005028 | Ga0070668_1000050282 | 340 |
| 220 | 3300005353 | Ga0070669_100001136 | Ga0070669_1000011367 | 340 |
| 221 | 3300005353 | Ga0070669_100014984 | Ga0070669_1000149841 | 340 |
| 222 | 3300005354 | Ga0070675_100000365 | Ga0070675_10000036520 | 340 |
| 223 | 3300005355 | Ga0070671_100094583 | Ga0070671_1000945832 | 340 |
| 224 | 3300005355 | Ga0070671_100133082 | Ga0070671_1001330822 | 340 |
| 225 | 3300005364 | Ga0070673_100021133 | Ga0070673_1000211332 | 340 |
| 226 | 3300005366 | Ga0070659_100022782 | Ga0070659_1000227823 | 340 |
| 227 | 3300005366 | Ga0070659_100053883 | Ga0070659_1000538832 | 340 |
| 228 | 3300005367 | Ga0070667_100186583 | Ga0070667_1001865832 | 340 |
| 229 | 3300005438 | Ga0070701_10029808 | Ga0070701_100298082 | 340 |
| 230 | 3300005441 | Ga0070700_100035554 | Ga0070700_1000355542 | 340 |
| 231 | 3300005444 | Ga0070694_100051836 | Ga0070694_1000518362 | 340 |
| 232 | 3300005457 | Ga0070662_100003276 | Ga0070662_1000032762 | 340 |
| 233 | 3300005458 | Ga0070681_10000803 | Ga0070681_1000080312 | 340 |
| 234 | 3300005459 | Ga0068867_100038385 | Ga0068867_1000383853 | 340 |
| 235 | 3300005459 | Ga0068867_100083365 | Ga0068867_1000833652 | 340 |
| 236 | 3300005466 | Ga0070685_10006952 | Ga0070685_100069525 | 340 |
| 237 | 3300005530 | Ga0070679_100040035 | Ga0070679_1000400354 | 340 |
| 238 | 3300005535 | Ga0070684_100015025 | Ga0070684_1000150254 | 340 |
| 239 | 3300005539 | Ga0068853_100037040 | Ga0068853_1000370403 | 340 |
| 240 | 3300005543 | Ga0070672_100049384 | Ga0070672_1000493843 | 340 |
| 241 | 3300005548 | Ga0070665_100063248 | Ga0070665_1000632482 | 340 |
| 242 | 3300005548 | Ga0070665_100168286 | Ga0070665_1001682862 | 340 |
| 243 | 3300005549 | Ga0070704_100062298 | Ga0070704_1000622982 | 340 |
| 244 | 3300005563 | Ga0068855_100068502 | Ga0068855_1000685024 | 340 |
| 245 | 3300005564 | Ga0070664_100038829 | Ga0070664_1000388293 | 340 |
| 246 | 3300005577 | Ga0068857_100004346 | Ga0068857_1000043466 | 340 |
| 247 | 3300005577 | Ga0068857_100065042 | Ga0068857_1000650423 | 340 |
| 248 | 3300005614 | Ga0068856_100117640 | Ga0068856_1001176402 | 340 |
| 249 | 3300005618 | Ga0068864_100261910 | Ga0068864_1002619101 | 340 |
| 250 | 3300005719 | Ga0068861_100000284 | Ga0068861_10000028412 | 340 |
| 251 | 3300005719 | Ga0068861_100010236 | Ga0068861_1000102365 | 340 |
| 252 | 3300005834 | Ga0068851_10041856 | Ga0068851_100418562 | 340 |
| 253 | 3300005840 | Ga0068870_10024962 | Ga0068870_100249622 | 340 |
| 254 | 3300005841 | Ga0068863_100054261 | Ga0068863_1000542613 | 340 |
| 255 | 3300005842 | Ga0068858_100025802 | Ga0068858_1000258022 | 340 |
| 256 | 3300005843 | Ga0068860_100058958 | Ga0068860_1000589582 | 340 |
| 257 | 3300005844 | Ga0068862_100007523 | Ga0068862_1000075235 | 340 |
| 258 | 3300005844 | Ga0068862_100013165 | Ga0068862_1000131655 | 340 |
| 259 | 3300006844 | Ga0075428_100040276 | Ga0075428_1000402763 | 340 |
| 260 | 3300006844 | Ga0075428_100246218 | Ga0075428_1002462182 | 340 |
| 261 | 3300006846 | Ga0075430_100096955 | Ga0075430_1000969553 | 340 |
| 262 | 3300006847 | Ga0075431_100032668 | Ga0075431_1000326684 | 340 |
| 263 | 3300006847 | Ga0075431_100224885 | Ga0075431_1002248852 | 340 |
| 264 | 3300006852 | Ga0075433_10010808 | Ga0075433_100108085 | 340 |
| 265 | 3300006852 | Ga0075433_10034944 | Ga0075433_100349443 | 340 |
| 266 | 3300006871 | Ga0075434_100004164 | Ga0075434_1000041645 | 340 |
| 267 | 3300006871 | Ga0075434_100044403 | Ga0075434_1000444032 | 340 |
| 268 | 3300006881 | Ga0068865_100007637 | Ga0068865_1000076375 | 340 |
| 269 | 3300009094 | Ga0111539_10083128 | Ga0111539_100831282 | 340 |
| 270 | 3300009094 | Ga0111539_10149736 | Ga0111539_101497362 | 340 |
| 271 | 3300009094 | Ga0111539_10555105 | Ga0111539_105551052 | 340 |
| 272 | 3300009147 | Ga0114129_10142212 | Ga0114129_101422122 | 340 |
| 273 | 3300009148 | Ga0105243_10400426 | Ga0105243_104004261 | 340 |
| 274 | 3300009177 | Ga0105248_10031690 | Ga0105248_100316903 | 340 |
| 275 | 3300009553 | Ga0105249_10000856 | Ga0105249_1000085611 | 340 |
| 276 | 3300009553 | Ga0105249_10016849 | Ga0105249_100168495 | 340 |
| 277 | 3300010375 | Ga0105239_10009663 | Ga0105239_100096637 | 340 |
| 278 | 3300013102 | Ga0157371_10016750 | Ga0157371_100167505 | 340 |
| 279 | 3300013296 | Ga0157374_10127784 | Ga0157374_101277842 | 340 |
| 280 | 3300013297 | Ga0157378_10158715 | Ga0157378_101587152 | 340 |
| 281 | 3300013306 | Ga0163162_10000455 | Ga0163162_1000045521 | 340 |
| 282 | 3300013307 | Ga0157372_10184582 | Ga0157372_101845822 | 340 |
| 283 | 3300013308 | Ga0157375_10329444 | Ga0157375_103294442 | 340 |
| 284 | 3300014326 | Ga0157380_10059354 | Ga0157380_100593543 | 340 |
| 285 | 3300014326 | Ga0157380_10065377 | Ga0157380_100653772 | 340 |
| 286 | 3300014745 | Ga0157377_10035023 | Ga0157377_100350232 | 340 |
| 287 | 3300014968 | Ga0157379_10019593 | Ga0157379_100195934 | 340 |
| 288 | 3300025315 | Ga0207697_10007171 | Ga0207697_100071712 | 340 |
| 289 | 3300025901 | Ga0207688_10008820 | Ga0207688_100088202 | 340 |
| 290 | 3300025907 | Ga0207645_10001838 | Ga0207645_100018382 | 340 |
| 291 | 3300025908 | Ga0207643_10005957 | Ga0207643_100059574 | 340 |
| 292 | 3300025912 | Ga0207707_10036741 | Ga0207707_100367412 | 340 |
| 293 | 3300025917 | Ga0207660_10068374 | Ga0207660_100683742 | 340 |
| 294 | 3300025918 | Ga0207662_10001083 | Ga0207662_100010837 | 340 |
| 295 | 3300025920 | Ga0207649_10061824 | Ga0207649_100618242 | 340 |
| 296 | 3300025921 | Ga0207652_10041084 | Ga0207652_100410844 | 340 |
| 297 | 3300025923 | Ga0207681_10004103 | Ga0207681_100041033 | 340 |
| 298 | 3300025925 | Ga0207650_10010290 | Ga0207650_100102903 | 340 |
| 299 | 3300025926 | Ga0207659_10043983 | Ga0207659_100439832 | 340 |
| 300 | 3300025926 | Ga0207659_10067884 | Ga0207659_100678842 | 340 |
| 301 | 3300025932 | Ga0207690_10015263 | Ga0207690_100152634 | 340 |
| 302 | 3300025932 | Ga0207690_10071490 | Ga0207690_100714902 | 340 |
| 303 | 3300025932 | Ga0207690_10292684 | Ga0207690_102926841 | 340 |
| 304 | 3300025933 | Ga0207706_10000990 | Ga0207706_100009902 | 340 |
| 305 | 3300025933 | Ga0207706_10152466 | Ga0207706_101524662 | 340 |
| 306 | 3300025934 | Ga0207686_10011739 | Ga0207686_100117394 | 340 |
| 307 | 3300025940 | Ga0207691_10001949 | Ga0207691_100019492 | 340 |
| 308 | 3300025944 | Ga0207661_10054376 | Ga0207661_100543763 | 340 |
| 309 | 3300025944 | Ga0207661_10109696 | Ga0207661_101096961 | 340 |
| 310 | 3300025945 | Ga0207679_10009971 | Ga0207679_100099713 | 340 |
| 311 | 3300025945 | Ga0207679_10013569 | Ga0207679_100135694 | 340 |
| 312 | 3300025949 | Ga0207667_10071811 | Ga0207667_100718113 | 340 |
| 313 | 3300025960 | Ga0207651_10077182 | Ga0207651_100771822 | 340 |
| 314 | 3300025960 | Ga0207651_10382867 | Ga0207651_103828671 | 340 |
| 315 | 3300025961 | Ga0207712_10003551 | Ga0207712_100035512 | 340 |
| 316 | 3300025961 | Ga0207712_10003886 | Ga0207712_100038861 | 340 |
| 317 | 3300025972 | Ga0207668_10013252 | Ga0207668_100132524 | 340 |
| 318 | 3300025986 | Ga0207658_10045620 | Ga0207658_100456202 | 340 |
| 319 | 3300026023 | Ga0207677_10053403 | Ga0207677_100534032 | 340 |
| 320 | 3300026035 | Ga0207703_10044165 | Ga0207703_100441653 | 340 |
| 321 | 3300026041 | Ga0207639_10041751 | Ga0207639_100417513 | 340 |
| 322 | 3300026075 | Ga0207708_10019062 | Ga0207708_100190624 | 340 |
| 323 | 3300026075 | Ga0207708_10126100 | Ga0207708_101261001 | 340 |
| 324 | 3300026088 | Ga0207641_10048523 | Ga0207641_100485232 | 340 |
| 325 | 3300026089 | Ga0207648_10137448 | Ga0207648_101374481 | 340 |
| 326 | 3300026095 | Ga0207676_10020701 | Ga0207676_100207013 | 340 |
| 327 | 3300026116 | Ga0207674_10000142 | Ga0207674_1000014223 | 340 |
| 328 | 3300026116 | Ga0207674_10001633 | Ga0207674_1000163318 | 340 |
| 329 | 3300026118 | Ga0207675_100000141 | Ga0207675_10000014122 | 340 |
| 330 | 3300026118 | Ga0207675_100014983 | Ga0207675_1000149833 | 340 |
| 331 | 3300026142 | Ga0207698_10032961 | Ga0207698_100329614 | 340 |
| 332 | 3300026142 | Ga0207698_10100753 | Ga0207698_101007531 | 340 |
| 333 | 3300027907 | Ga0207428_10106598 | Ga0207428_101065981 | 340 |
| 334 | 3300028379 | Ga0268266_10174702 | Ga0268266_101747022 | 340 |
| 335 | 3300028380 | Ga0268265_10005120 | Ga0268265_100051206 | 340 |
| 336 | 3300028380 | Ga0268265_10017172 | Ga0268265_100171722 | 340 |
| 337 | 3300028381 | Ga0268264_10033347 | Ga0268264_100333474 | 340 |
| 338 | 3300031548 | Ga0307408_100000558 | Ga0307408_1000005589 | 340 |
| 339 | 3300031852 | Ga0307410_10285743 | Ga0307410_102857432 | 340 |
| 340 | 3300031901 | Ga0307406_10008537 | Ga0307406_100085372 | 340 |
| 341 | 3300031903 | Ga0307407_10144837 | Ga0307407_101448371 | 340 |
| 342 | 3300031995 | Ga0307409_100093333 | Ga0307409_1000933332 | 340 |
| 343 | 3300032004 | Ga0307414_10222078 | Ga0307414_102220782 | 340 |
| 344 | 3300045051 | Ga0451576_0114353 | Ga0451576_0114353_1208_2230 | 340 |
| 345 | 3300048912 | Ga0496109_0089707 | Ga0496109_0089707_1153_2175 | 340 |
| 346 | 3300050507 | nmdc:mga05p37_142693_c2 | nmdc:mga05p37_142693_c2_519_1541 | 340 |
| 347 | 3300050510 | nmdc:mga06r32_19847_c1 | nmdc:mga06r32_19847_c1_4457_5479 | 340 |
| 348 | 3300050511 | nmdc:mga08y16_95120_c1 | nmdc:mga08y16_95120_c1_1594_2616 | 340 |
| 349 | 3300050512 | nmdc:mga0n895_1132_c1 | nmdc:mga0n895_1132_c1_9771_10793 | 340 |
| 350 | 3300050513 | nmdc:mga0rr50_67985_c1 | nmdc:mga0rr50_67985_c1_1226_2248 | 340 |
| 351 | 3300050515 | nmdc:mga0a205_13217_c1 | nmdc:mga0a205_13217_c1_1820_2842 | 340 |
| 352 | 3300050515 | nmdc:mga0a205_5869_c2 | nmdc:mga0a205_5869_c2_4710_5732 | 340 |
| 353 | iso_pu_bacteria | 2721755755 | 2723846965 | 340 |
| 354 | 3300005331 | Ga0070670_100130805 | Ga0070670_1001308052 | 341 |
| 355 | 3300005353 | Ga0070669_100077593 | Ga0070669_1000775932 | 341 |
| 356 | 3300005354 | Ga0070675_100027181 | Ga0070675_1000271814 | 341 |
| 357 | 3300005436 | Ga0070713_100186122 | Ga0070713_1001861222 | 341 |
| 358 | 3300005543 | Ga0070672_100030675 | Ga0070672_1000306752 | 341 |
| 359 | 3300006178 | Ga0075367_10114927 | Ga0075367_101149272 | 341 |
| 360 | 3300006846 | Ga0075430_100001819 | Ga0075430_1000018194 | 341 |
| 361 | 3300006846 | Ga0075430_100012216 | Ga0075430_1000122166 | 341 |
| 362 | 3300006847 | Ga0075431_100043586 | Ga0075431_1000435864 | 341 |
| 363 | 3300006880 | Ga0075429_100146323 | Ga0075429_1001463232 | 341 |
| 364 | 3300009177 | Ga0105248_10099062 | Ga0105248_100990622 | 341 |
| 365 | 3300015262 | Ga0182007_10034088 | Ga0182007_100340881 | 341 |
| 366 | 3300025923 | Ga0207681_10167319 | Ga0207681_101673191 | 341 |
| 367 | 3300025925 | Ga0207650_10030878 | Ga0207650_100308784 | 341 |
| 368 | 3300025940 | Ga0207691_10002037 | Ga0207691_100020377 | 341 |
| 369 | 3300028800 | Ga0265338_10016733 | Ga0265338_100167332 | 341 |
| 370 | 3300031249 | Ga0265339_10000052 | Ga0265339_1000005210 | 341 |
| 371 | 3300031595 | Ga0265313_10000843 | Ga0265313_100008434 | 341 |
| 372 | 3300031712 | Ga0265342_10107310 | Ga0265342_101073101 | 341 |
| 373 | 3300032002 | Ga0307416_100063021 | Ga0307416_1000630212 | 341 |
| 374 | 3300035086 | Ga0373934_0042137 | Ga0373934_0042137_102_1127 | 341 |
| 375 | 3300035171 | Ga0373946_0038734 | Ga0373946_0038734_308_1333 | 341 |
| 376 | 3300035410 | Ga0373924_0059470 | Ga0373924_0059470_424_1449 | 341 |
| 377 | 3300035724 | Ga0373933_0171821 | Ga0373933_0171821_189_1214 | 341 |
| 378 | 3300046463 | Ga0495653_0166653 | Ga0495653_0166653_487_1512 | 341 |
| 379 | 3300046511 | Ga0495608_0019475 | Ga0495608_0019475_2978_4003 | 341 |
| 380 | 3300046514 | Ga0495618_0048874 | Ga0495618_0048874_1538_2563 | 341 |
| 381 | 3300046533 | Ga0495640_0067077 | Ga0495640_0067077_679_1704 | 341 |
| 382 | 3300046543 | Ga0495645_0140216 | Ga0495645_0140216_529_1554 | 341 |
| 383 | 3300046663 | Ga0495635_0036633 | Ga0495635_0036633_1730_2755 | 341 |
| 384 | 3300047317 | Ga0495604_0091819 | Ga0495604_0091819_803_1828 | 341 |
| 385 | 3300047322 | Ga0495680_0079188 | Ga0495680_0079188_1000_2025 | 341 |
| 386 | 3300047444 | Ga0495675_0058848 | Ga0495675_0058848_696_1721 | 341 |
| 387 | 3300047471 | Ga0495684_0122289 | Ga0495684_0122289_378_1403 | 341 |
| 388 | 3300047673 | Ga0495593_0050796 | Ga0495593_0050796_758_1783 | 341 |
| 389 | 3300048088 | Ga0495602_0114921 | Ga0495602_0114921_551_1576 | 341 |
| 390 | 3300048911 | Ga0496108_0226935 | Ga0496108_0226935_374_1474 | 341 |
| 391 | 3300048912 | Ga0496109_0200080 | Ga0496109_0200080_319_1419 | 341 |
| 392 | 3300049576 | Ga0501040_0094632 | Ga0501040_0094632_405_1463 | 341 |
| 393 | 3300049578 | Ga0501042_0043428 | Ga0501042_0043428_1621_2646 | 341 |
| 394 | 3300049588 | Ga0501072_0109122 | Ga0501072_0109122_74_1099 | 341 |
| 395 | 3300049591 | Ga0501075_0124073 | Ga0501075_0124073_240_1265 | 341 |
| 396 | 3300049592 | Ga0501076_0031722 | Ga0501076_0031722_1006_2031 | 341 |
| 397 | 3300049743 | Ga0501081_0095296 | Ga0501081_0095296_55_1080 | 341 |
| 398 | 3300050489 | nmdc:mga03683_25741_c1 | nmdc:mga03683_25741_c1_1146_2225 | 341 |
| 399 | 3300050508 | nmdc:mga09592_297237_c1 | nmdc:mga09592_297237_c1_272_1297 | 341 |
| 400 | 3300050509 | nmdc:mga0qj67_13891_c1 | nmdc:mga0qj67_13891_c1_4987_6012 | 341 |
| 401 | 3300050509 | nmdc:mga0qj67_20483_c1 | nmdc:mga0qj67_20483_c1_3052_4077 | 341 |
| 402 | 3300050510 | nmdc:mga06r32_215358_c1 | nmdc:mga06r32_215358_c1_29_1054 | 341 |
| 403 | 3300050511 | nmdc:mga08y16_297343_c1 | nmdc:mga08y16_297343_c1_470_1549 | 341 |
| 404 | 3300053084 | Ga0495595_0020033 | Ga0495595_0020033_1312_2337 | 341 |
| 405 | 3300053088 | Ga0500644_0106857 | Ga0500644_0106857_19_1044 | 341 |
| 406 | 3300054114 | Ga0501084_0059048 | Ga0501084_0059048_2076_3101 | 341 |
| 407 | 3300061734 | Ga0530510_0220795 | Ga0530510_0220795_245_1270 | 341 |
| 408 | 3300001990 | JGI24737J22298_10019573 | JGI24737J22298_100195732 | 342 |
| 409 | 3300001991 | JGI24743J22301_10011395 | JGI24743J22301_100113952 | 342 |
| 410 | 3300002070 | JGI24750J21931_1007354 | JGI24750J21931_10073542 | 342 |
| 411 | 3300002075 | JGI24738J21930_10019661 | JGI24738J21930_100196612 | 342 |
| 412 | 3300002077 | JGI24744J21845_10006724 | JGI24744J21845_100067242 | 342 |
| 413 | 3300003203 | JGI25406J46586_10000068 | JGI25406J46586_1000006819 | 342 |
| 414 | 3300003215 | JGI25153J46596_10005581 | JGI25153J46596_100055815 | 342 |
| 415 | 3300003762 | Ga0055542_1005310 | Ga0055542_10053102 | 342 |
| 416 | 3300005262 | Ga0065165_1001267 | Ga0065165_10012677 | 342 |
| 417 | 3300005262 | Ga0065165_1002212 | Ga0065165_10022127 | 342 |
| 418 | 3300005327 | Ga0070658_10185375 | Ga0070658_101853751 | 342 |
| 419 | 3300005329 | Ga0070683_100008412 | Ga0070683_1000084124 | 342 |
| 420 | 3300005329 | Ga0070683_100100301 | Ga0070683_1001003012 | 342 |
| 421 | 3300005330 | Ga0070690_100017752 | Ga0070690_1000177525 | 342 |
| 422 | 3300005330 | Ga0070690_100069739 | Ga0070690_1000697392 | 342 |
| 423 | 3300005331 | Ga0070670_100002030 | Ga0070670_10000203014 | 342 |
| 424 | 3300005331 | Ga0070670_100067088 | Ga0070670_1000670882 | 342 |
| 425 | 3300005334 | Ga0068869_100107594 | Ga0068869_1001075941 | 342 |
| 426 | 3300005336 | Ga0070680_100010166 | Ga0070680_1000101665 | 342 |
| 427 | 3300005336 | Ga0070680_100047355 | Ga0070680_1000473552 | 342 |
| 428 | 3300005337 | Ga0070682_100064243 | Ga0070682_1000642432 | 342 |
| 429 | 3300005337 | Ga0070682_100088855 | Ga0070682_1000888552 | 342 |
| 430 | 3300005337 | Ga0070682_100117730 | Ga0070682_1001177303 | 342 |
| 431 | 3300005337 | Ga0070682_100199070 | Ga0070682_1001990701 | 342 |
| 432 | 3300005338 | Ga0068868_100038297 | Ga0068868_1000382974 | 342 |
| 433 | 3300005338 | Ga0068868_100058595 | Ga0068868_1000585952 | 342 |
| 434 | 3300005338 | Ga0068868_100229815 | Ga0068868_1002298151 | 342 |
| 435 | 3300005339 | Ga0070660_100008984 | Ga0070660_1000089844 | 342 |
| 436 | 3300005339 | Ga0070660_100036860 | Ga0070660_1000368604 | 342 |
| 437 | 3300005339 | Ga0070660_100380136 | Ga0070660_1003801361 | 342 |
| 438 | 3300005340 | Ga0070689_100002079 | Ga0070689_1000020792 | 342 |
| 439 | 3300005340 | Ga0070689_100108664 | Ga0070689_1001086644 | 342 |
| 440 | 3300005341 | Ga0070691_10052213 | Ga0070691_100522131 | 342 |
| 441 | 3300005343 | Ga0070687_100027140 | Ga0070687_1000271403 | 342 |
| 442 | 3300005344 | Ga0070661_100022921 | Ga0070661_1000229213 | 342 |
| 443 | 3300005347 | Ga0070668_100003473 | Ga0070668_1000034735 | 342 |
| 444 | 3300005347 | Ga0070668_100008936 | Ga0070668_1000089363 | 342 |
| 445 | 3300005347 | Ga0070668_100050729 | Ga0070668_1000507293 | 342 |
| 446 | 3300005347 | Ga0070668_100141361 | Ga0070668_1001413612 | 342 |
| 447 | 3300005353 | Ga0070669_100042153 | Ga0070669_1000421531 | 342 |
| 448 | 3300005353 | Ga0070669_100163424 | Ga0070669_1001634241 | 342 |
| 449 | 3300005354 | Ga0070675_100235237 | Ga0070675_1002352372 | 342 |
| 450 | 3300005355 | Ga0070671_100063210 | Ga0070671_1000632102 | 342 |
| 451 | 3300005355 | Ga0070671_100227527 | Ga0070671_1002275272 | 342 |
| 452 | 3300005355 | Ga0070671_100286405 | Ga0070671_1002864051 | 342 |
| 453 | 3300005356 | Ga0070674_100001469 | Ga0070674_10000146912 | 342 |
| 454 | 3300005356 | Ga0070674_100010211 | Ga0070674_1000102118 | 342 |
| 455 | 3300005356 | Ga0070674_100013870 | Ga0070674_1000138702 | 342 |
| 456 | 3300005364 | Ga0070673_100014104 | Ga0070673_1000141044 | 342 |
| 457 | 3300005366 | Ga0070659_100011386 | Ga0070659_1000113864 | 342 |
| 458 | 3300005366 | Ga0070659_100280344 | Ga0070659_1002803441 | 342 |
| 459 | 3300005367 | Ga0070667_100116021 | Ga0070667_1001160212 | 342 |
| 460 | 3300005367 | Ga0070667_100268332 | Ga0070667_1002683321 | 342 |
| 461 | 3300005434 | Ga0070709_10005439 | Ga0070709_100054394 | 342 |
| 462 | 3300005435 | Ga0070714_100050305 | Ga0070714_1000503053 | 342 |
| 463 | 3300005435 | Ga0070714_100055629 | Ga0070714_1000556292 | 342 |
| 464 | 3300005436 | Ga0070713_100003900 | Ga0070713_1000039006 | 342 |
| 465 | 3300005436 | Ga0070713_100028893 | Ga0070713_1000288933 | 342 |
| 466 | 3300005436 | Ga0070713_100059482 | Ga0070713_1000594822 | 342 |
| 467 | 3300005436 | Ga0070713_100116509 | Ga0070713_1001165092 | 342 |
| 468 | 3300005437 | Ga0070710_10001798 | Ga0070710_100017984 | 342 |
| 469 | 3300005437 | Ga0070710_10211345 | Ga0070710_102113451 | 342 |
| 470 | 3300005439 | Ga0070711_100013041 | Ga0070711_1000130413 | 342 |
| 471 | 3300005439 | Ga0070711_100018744 | Ga0070711_1000187441 | 342 |
| 472 | 3300005440 | Ga0070705_100142388 | Ga0070705_1001423882 | 342 |
| 473 | 3300005455 | Ga0070663_100029554 | Ga0070663_1000295544 | 342 |
| 474 | 3300005455 | Ga0070663_100052831 | Ga0070663_1000528312 | 342 |
| 475 | 3300005455 | Ga0070663_100063228 | Ga0070663_1000632282 | 342 |
| 476 | 3300005455 | Ga0070663_100107121 | Ga0070663_1001071212 | 342 |
| 477 | 3300005455 | Ga0070663_100231776 | Ga0070663_1002317762 | 342 |
| 478 | 3300005456 | Ga0070678_100033164 | Ga0070678_1000331643 | 342 |
| 479 | 3300005456 | Ga0070678_100052389 | Ga0070678_1000523892 | 342 |
| 480 | 3300005456 | Ga0070678_100058201 | Ga0070678_1000582012 | 342 |
| 481 | 3300005457 | Ga0070662_100009040 | Ga0070662_1000090405 | 342 |
| 482 | 3300005457 | Ga0070662_100095431 | Ga0070662_1000954312 | 342 |
| 483 | 3300005457 | Ga0070662_100209673 | Ga0070662_1002096732 | 342 |
| 484 | 3300005458 | Ga0070681_10005772 | Ga0070681_1000577216 | 342 |
| 485 | 3300005458 | Ga0070681_10009474 | Ga0070681_100094743 | 342 |
| 486 | 3300005458 | Ga0070681_10018371 | Ga0070681_100183715 | 342 |
| 487 | 3300005458 | Ga0070681_10237166 | Ga0070681_102371662 | 342 |
| 488 | 3300005530 | Ga0070679_100002259 | Ga0070679_10000225912 | 342 |
| 489 | 3300005530 | Ga0070679_100012689 | Ga0070679_1000126896 | 342 |
| 490 | 3300005530 | Ga0070679_100041099 | Ga0070679_1000410992 | 342 |
| 491 | 3300005530 | Ga0070679_100069283 | Ga0070679_1000692832 | 342 |
| 492 | 3300005535 | Ga0070684_100011823 | Ga0070684_1000118231 | 342 |
| 493 | 3300005535 | Ga0070684_100026088 | Ga0070684_1000260882 | 342 |
| 494 | 3300005535 | Ga0070684_100092323 | Ga0070684_1000923232 | 342 |
| 495 | 3300005539 | Ga0068853_100005704 | Ga0068853_1000057041 | 342 |
| 496 | 3300005539 | Ga0068853_100192111 | Ga0068853_1001921112 | 342 |
| 497 | 3300005544 | Ga0070686_100095878 | Ga0070686_1000958782 | 342 |
| 498 | 3300005545 | Ga0070695_100255654 | Ga0070695_1002556541 | 342 |
| 499 | 3300005547 | Ga0070693_100047826 | Ga0070693_1000478262 | 342 |
| 500 | 3300005548 | Ga0070665_100007164 | Ga0070665_1000071642 | 342 |
| 501 | 3300005548 | Ga0070665_100008973 | Ga0070665_1000089735 | 342 |
| 502 | 3300005548 | Ga0070665_100056210 | Ga0070665_1000562103 | 342 |
| 503 | 3300005548 | Ga0070665_100083982 | Ga0070665_1000839821 | 342 |
| 504 | 3300005548 | Ga0070665_100087729 | Ga0070665_1000877292 | 342 |
| 505 | 3300005548 | Ga0070665_100089898 | Ga0070665_1000898982 | 342 |
| 506 | 3300005548 | Ga0070665_100159456 | Ga0070665_1001594562 | 342 |
| 507 | 3300005548 | Ga0070665_100313465 | Ga0070665_1003134652 | 342 |
| 508 | 3300005548 | Ga0070665_100595571 | Ga0070665_1005955711 | 342 |
| 509 | 3300005563 | Ga0068855_100011649 | Ga0068855_1000116498 | 342 |
| 510 | 3300005563 | Ga0068855_100063155 | Ga0068855_1000631555 | 342 |
| 511 | 3300005563 | Ga0068855_100238162 | Ga0068855_1002381622 | 342 |
| 512 | 3300005577 | Ga0068857_100081157 | Ga0068857_1000811574 | 342 |
| 513 | 3300005577 | Ga0068857_100108215 | Ga0068857_1001082152 | 342 |
| 514 | 3300005577 | Ga0068857_100132753 | Ga0068857_1001327532 | 342 |
| 515 | 3300005577 | Ga0068857_100202136 | Ga0068857_1002021362 | 342 |
| 516 | 3300005577 | Ga0068857_100233711 | Ga0068857_1002337112 | 342 |
| 517 | 3300005578 | Ga0068854_100289362 | Ga0068854_1002893621 | 342 |
| 518 | 3300005617 | Ga0068859_100077580 | Ga0068859_1000775802 | 342 |
| 519 | 3300005618 | Ga0068864_100158708 | Ga0068864_1001587082 | 342 |
| 520 | 3300005718 | Ga0068866_10027847 | Ga0068866_100278471 | 342 |
| 521 | 3300005719 | Ga0068861_100013725 | Ga0068861_1000137253 | 342 |
| 522 | 3300005719 | Ga0068861_100069713 | Ga0068861_1000697132 | 342 |
| 523 | 3300005719 | Ga0068861_100151221 | Ga0068861_1001512212 | 342 |
| 524 | 3300005841 | Ga0068863_100031099 | Ga0068863_1000310995 | 342 |
| 525 | 3300005842 | Ga0068858_100072777 | Ga0068858_1000727771 | 342 |
| 526 | 3300005842 | Ga0068858_100355599 | Ga0068858_1003555992 | 342 |
| 527 | 3300005843 | Ga0068860_100081538 | Ga0068860_1000815382 | 342 |
| 528 | 3300005843 | Ga0068860_100375190 | Ga0068860_1003751901 | 342 |
| 529 | 3300005843 | Ga0068860_100393008 | Ga0068860_1003930082 | 342 |
| 530 | 3300005844 | Ga0068862_100004978 | Ga0068862_1000049788 | 342 |
| 531 | 3300005844 | Ga0068862_100056023 | Ga0068862_1000560235 | 342 |
| 532 | 3300005844 | Ga0068862_100378005 | Ga0068862_1003780052 | 342 |
| 533 | 3300005937 | Ga0081455_10009408 | Ga0081455_100094086 | 342 |
| 534 | 3300005937 | Ga0081455_10009980 | Ga0081455_100099804 | 342 |
| 535 | 3300005937 | Ga0081455_10012824 | Ga0081455_100128245 | 342 |
| 536 | 3300005937 | Ga0081455_10016677 | Ga0081455_100166773 | 342 |
| 537 | 3300005937 | Ga0081455_10065066 | Ga0081455_100650663 | 342 |
| 538 | 3300005937 | Ga0081455_10128565 | Ga0081455_101285652 | 342 |
| 539 | 3300005981 | Ga0081538_10005709 | Ga0081538_100057093 | 342 |
| 540 | 3300005981 | Ga0081538_10026886 | Ga0081538_100268865 | 342 |
| 541 | 3300005983 | Ga0081540_1000183 | Ga0081540_100018312 | 342 |
| 542 | 3300005983 | Ga0081540_1003056 | Ga0081540_100305616 | 342 |
| 543 | 3300005983 | Ga0081540_1008688 | Ga0081540_10086885 | 342 |
| 544 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032171 | 342 |
| 545 | 3300005985 | Ga0081539_10001182 | Ga0081539_1000118248 | 342 |
| 546 | 3300005985 | Ga0081539_10061942 | Ga0081539_100619422 | 342 |
| 547 | 3300006028 | Ga0070717_10027462 | Ga0070717_100274626 | 342 |
| 548 | 3300006028 | Ga0070717_10031115 | Ga0070717_100311153 | 342 |
| 549 | 3300006028 | Ga0070717_10194695 | Ga0070717_101946952 | 342 |
| 550 | 3300006038 | Ga0075365_10004659 | Ga0075365_100046597 | 342 |
| 551 | 3300006038 | Ga0075365_10027773 | Ga0075365_100277732 | 342 |
| 552 | 3300006038 | Ga0075365_10092380 | Ga0075365_100923802 | 342 |
| 553 | 3300006042 | Ga0075368_10002227 | Ga0075368_100022272 | 342 |
| 554 | 3300006042 | Ga0075368_10004796 | Ga0075368_100047962 | 342 |
| 555 | 3300006048 | Ga0075363_100000166 | Ga0075363_10000016611 | 342 |
| 556 | 3300006048 | Ga0075363_100005847 | Ga0075363_1000058476 | 342 |
| 557 | 3300006048 | Ga0075363_100026460 | Ga0075363_1000264602 | 342 |
| 558 | 3300006048 | Ga0075363_100032687 | Ga0075363_1000326872 | 342 |
| 559 | 3300006051 | Ga0075364_10014523 | Ga0075364_100145235 | 342 |
| 560 | 3300006051 | Ga0075364_10018041 | Ga0075364_100180413 | 342 |
| 561 | 3300006051 | Ga0075364_10061957 | Ga0075364_100619572 | 342 |
| 562 | 3300006051 | Ga0075364_10306447 | Ga0075364_103064471 | 342 |
| 563 | 3300006163 | Ga0070715_10001747 | Ga0070715_100017473 | 342 |
| 564 | 3300006163 | Ga0070715_10105233 | Ga0070715_101052332 | 342 |
| 565 | 3300006173 | Ga0070716_100006717 | Ga0070716_1000067174 | 342 |
| 566 | 3300006175 | Ga0070712_100012868 | Ga0070712_1000128685 | 342 |
| 567 | 3300006175 | Ga0070712_100013408 | Ga0070712_1000134083 | 342 |
| 568 | 3300006175 | Ga0070712_100129971 | Ga0070712_1001299714 | 342 |
| 569 | 3300006175 | Ga0070712_100209200 | Ga0070712_1002092001 | 342 |
| 570 | 3300006177 | Ga0075362_10002371 | Ga0075362_100023714 | 342 |
| 571 | 3300006177 | Ga0075362_10006411 | Ga0075362_100064112 | 342 |
| 572 | 3300006177 | Ga0075362_10018509 | Ga0075362_100185092 | 342 |
| 573 | 3300006177 | Ga0075362_10023654 | Ga0075362_100236542 | 342 |
| 574 | 3300006177 | Ga0075362_10113389 | Ga0075362_101133891 | 342 |
| 575 | 3300006178 | Ga0075367_10000604 | Ga0075367_100006044 | 342 |
| 576 | 3300006178 | Ga0075367_10010376 | Ga0075367_100103766 | 342 |
| 577 | 3300006178 | Ga0075367_10100784 | Ga0075367_101007841 | 342 |
| 578 | 3300006195 | Ga0075366_10000580 | Ga0075366_1000058010 | 342 |
| 579 | 3300006195 | Ga0075366_10002268 | Ga0075366_1000226810 | 342 |
| 580 | 3300006195 | Ga0075366_10028218 | Ga0075366_100282182 | 342 |
| 581 | 3300006195 | Ga0075366_10030929 | Ga0075366_100309293 | 342 |
| 582 | 3300006195 | Ga0075366_10123396 | Ga0075366_101233962 | 342 |
| 583 | 3300006237 | Ga0097621_100023425 | Ga0097621_1000234252 | 342 |
| 584 | 3300006237 | Ga0097621_100149457 | Ga0097621_1001494572 | 342 |
| 585 | 3300006353 | Ga0075370_10011797 | Ga0075370_100117973 | 342 |
| 586 | 3300006353 | Ga0075370_10036607 | Ga0075370_100366071 | 342 |
| 587 | 3300006353 | Ga0075370_10042391 | Ga0075370_100423913 | 342 |
| 588 | 3300006353 | Ga0075370_10046819 | Ga0075370_100468193 | 342 |
| 589 | 3300006358 | Ga0068871_100176216 | Ga0068871_1001762163 | 342 |
| 590 | 3300006844 | Ga0075428_100001227 | Ga0075428_10000122724 | 342 |
| 591 | 3300006844 | Ga0075428_100024804 | Ga0075428_1000248048 | 342 |
| 592 | 3300006844 | Ga0075428_100224006 | Ga0075428_1002240062 | 342 |
| 593 | 3300006846 | Ga0075430_100000015 | Ga0075430_10000001543 | 342 |
| 594 | 3300006846 | Ga0075430_100008228 | Ga0075430_1000082284 | 342 |
| 595 | 3300006847 | Ga0075431_100000169 | Ga0075431_10000016934 | 342 |
| 596 | 3300006847 | Ga0075431_100514629 | Ga0075431_1005146291 | 342 |
| 597 | 3300006852 | Ga0075433_10237533 | Ga0075433_102375332 | 342 |
| 598 | 3300006852 | Ga0075433_10344231 | Ga0075433_103442312 | 342 |
| 599 | 3300006871 | Ga0075434_100052054 | Ga0075434_1000520542 | 342 |
| 600 | 3300006871 | Ga0075434_100065245 | Ga0075434_1000652455 | 342 |
| 601 | 3300006871 | Ga0075434_100371631 | Ga0075434_1003716311 | 342 |
| 602 | 3300006880 | Ga0075429_100012855 | Ga0075429_1000128552 | 342 |
| 603 | 3300006881 | Ga0068865_100039365 | Ga0068865_1000393652 | 342 |
| 604 | 3300006881 | Ga0068865_100351172 | Ga0068865_1003511721 | 342 |
| 605 | 3300006931 | Ga0097620_100077578 | Ga0097620_1000775783 | 342 |
| 606 | 3300006941 | Ga0099825_1028576 | Ga0099825_10285762 | 342 |
| 607 | 3300006942 | Ga0099824_1015348 | Ga0099824_10153486 | 342 |
| 608 | 3300006944 | Ga0099823_1022490 | Ga0099823_10224908 | 342 |
| 609 | 3300007788 | Ga0099795_10004625 | Ga0099795_100046251 | 342 |
| 610 | 3300007788 | Ga0099795_10083585 | Ga0099795_100835851 | 342 |
| 611 | 3300009011 | Ga0105251_10028427 | Ga0105251_100284272 | 342 |
| 612 | 3300009092 | Ga0105250_10032821 | Ga0105250_100328212 | 342 |
| 613 | 3300009093 | Ga0105240_10004107 | Ga0105240_1000410715 | 342 |
| 614 | 3300009093 | Ga0105240_10026526 | Ga0105240_100265265 | 342 |
| 615 | 3300009093 | Ga0105240_10045477 | Ga0105240_100454772 | 342 |
| 616 | 3300009093 | Ga0105240_10135542 | Ga0105240_101355422 | 342 |
| 617 | 3300009093 | Ga0105240_10239306 | Ga0105240_102393063 | 342 |
| 618 | 3300009094 | Ga0111539_10013148 | Ga0111539_100131487 | 342 |
| 619 | 3300009094 | Ga0111539_10216621 | Ga0111539_102166212 | 342 |
| 620 | 3300009094 | Ga0111539_10378641 | Ga0111539_103786412 | 342 |
| 621 | 3300009098 | Ga0105245_10017466 | Ga0105245_100174663 | 342 |
| 622 | 3300009098 | Ga0105245_10388370 | Ga0105245_103883701 | 342 |
| 623 | 3300009101 | Ga0105247_10104863 | Ga0105247_101048632 | 342 |
| 624 | 3300009147 | Ga0114129_10000539 | Ga0114129_1000053921 | 342 |
| 625 | 3300009147 | Ga0114129_10004331 | Ga0114129_1000433112 | 342 |
| 626 | 3300009148 | Ga0105243_10018265 | Ga0105243_100182656 | 342 |
| 627 | 3300009148 | Ga0105243_10155513 | Ga0105243_101555131 | 342 |
| 628 | 3300009174 | Ga0105241_10141983 | Ga0105241_101419832 | 342 |
| 629 | 3300009174 | Ga0105241_10324383 | Ga0105241_103243831 | 342 |
| 630 | 3300009176 | Ga0105242_10057384 | Ga0105242_100573843 | 342 |
| 631 | 3300009176 | Ga0105242_10061315 | Ga0105242_100613152 | 342 |
| 632 | 3300009177 | Ga0105248_10034403 | Ga0105248_100344035 | 342 |
| 633 | 3300009177 | Ga0105248_10136802 | Ga0105248_101368023 | 342 |
| 634 | 3300009545 | Ga0105237_10001334 | Ga0105237_1000133420 | 342 |
| 635 | 3300009545 | Ga0105237_10093492 | Ga0105237_100934922 | 342 |
| 636 | 3300009545 | Ga0105237_10101046 | Ga0105237_101010462 | 342 |
| 637 | 3300009545 | Ga0105237_10114249 | Ga0105237_101142492 | 342 |
| 638 | 3300009545 | Ga0105237_10117998 | Ga0105237_101179983 | 342 |
| 639 | 3300009545 | Ga0105237_10119001 | Ga0105237_101190013 | 342 |
| 640 | 3300009545 | Ga0105237_10338413 | Ga0105237_103384132 | 342 |
| 641 | 3300009551 | Ga0105238_10001553 | Ga0105238_1000155314 | 342 |
| 642 | 3300009551 | Ga0105238_10287986 | Ga0105238_102879862 | 342 |
| 643 | 3300009553 | Ga0105249_10018300 | Ga0105249_100183004 | 342 |
| 644 | 3300010159 | Ga0099796_10037762 | Ga0099796_100377622 | 342 |
| 645 | 3300010375 | Ga0105239_10133472 | Ga0105239_101334723 | 342 |
| 646 | 3300011119 | Ga0105246_10003290 | Ga0105246_100032906 | 342 |
| 647 | 3300011119 | Ga0105246_10044929 | Ga0105246_100449293 | 342 |
| 648 | 3300013102 | Ga0157371_10032500 | Ga0157371_100325002 | 342 |
| 649 | 3300013104 | Ga0157370_10002576 | Ga0157370_100025769 | 342 |
| 650 | 3300013104 | Ga0157370_10100170 | Ga0157370_101001702 | 342 |
| 651 | 3300013104 | Ga0157370_10180961 | Ga0157370_101809611 | 342 |
| 652 | 3300013105 | Ga0157369_10012266 | Ga0157369_100122666 | 342 |
| 653 | 3300013105 | Ga0157369_10013341 | Ga0157369_100133413 | 342 |
| 654 | 3300013105 | Ga0157369_10018334 | Ga0157369_100183346 | 342 |
| 655 | 3300013296 | Ga0157374_10045869 | Ga0157374_100458693 | 342 |
| 656 | 3300013296 | Ga0157374_10140533 | Ga0157374_101405332 | 342 |
| 657 | 3300013297 | Ga0157378_10150969 | Ga0157378_101509692 | 342 |
| 658 | 3300013306 | Ga0163162_10022365 | Ga0163162_100223653 | 342 |
| 659 | 3300013306 | Ga0163162_10246500 | Ga0163162_102465002 | 342 |
| 660 | 3300013307 | Ga0157372_10070340 | Ga0157372_100703404 | 342 |
| 661 | 3300013307 | Ga0157372_10219938 | Ga0157372_102199382 | 342 |
| 662 | 3300013307 | Ga0157372_10358922 | Ga0157372_103589222 | 342 |
| 663 | 3300013307 | Ga0157372_10547214 | Ga0157372_105472141 | 342 |
| 664 | 3300013308 | Ga0157375_10031985 | Ga0157375_100319855 | 342 |
| 665 | 3300013308 | Ga0157375_10234318 | Ga0157375_102343182 | 342 |
| 666 | 3300013308 | Ga0157375_10411469 | Ga0157375_104114692 | 342 |
| 667 | 3300014325 | Ga0163163_10060550 | Ga0163163_100605503 | 342 |
| 668 | 3300014325 | Ga0163163_10070084 | Ga0163163_100700842 | 342 |
| 669 | 3300014326 | Ga0157380_10077742 | Ga0157380_100777424 | 342 |
| 670 | 3300014326 | Ga0157380_10155538 | Ga0157380_101555382 | 342 |
| 671 | 3300014968 | Ga0157379_10012701 | Ga0157379_100127015 | 342 |
| 672 | 3300014969 | Ga0157376_10006200 | Ga0157376_100062005 | 342 |
| 673 | 3300014969 | Ga0157376_10122174 | Ga0157376_101221742 | 342 |
| 674 | 3300017792 | Ga0163161_10041355 | Ga0163161_100413553 | 342 |
| 675 | 3300024227 | Ga0228598_1007512 | Ga0228598_10075122 | 342 |
| 676 | 3300025254 | Ga0209148_1000232 | Ga0209148_100023262 | 342 |
| 677 | 3300025272 | Ga0209455_1004488 | Ga0209455_10044884 | 342 |
| 678 | 3300025295 | Ga0209564_1000390 | Ga0209564_100039056 | 342 |
| 679 | 3300025297 | Ga0209758_1012829 | Ga0209758_10128292 | 342 |
| 680 | 3300025297 | Ga0209758_1013321 | Ga0209758_10133214 | 342 |
| 681 | 3300025297 | Ga0209758_1015980 | Ga0209758_10159802 | 342 |
| 682 | 3300025302 | Ga0207426_1002604 | Ga0207426_10026043 | 342 |
| 683 | 3300025302 | Ga0207426_1007922 | Ga0207426_10079223 | 342 |
| 684 | 3300025302 | Ga0207426_1023952 | Ga0207426_10239522 | 342 |
| 685 | 3300025315 | Ga0207697_10045437 | Ga0207697_100454372 | 342 |
| 686 | 3300025321 | Ga0207656_10007664 | Ga0207656_100076641 | 342 |
| 687 | 3300025898 | Ga0207692_10021447 | Ga0207692_100214473 | 342 |
| 688 | 3300025899 | Ga0207642_10008196 | Ga0207642_100081962 | 342 |
| 689 | 3300025900 | Ga0207710_10012120 | Ga0207710_100121202 | 342 |
| 690 | 3300025901 | Ga0207688_10000632 | Ga0207688_1000063216 | 342 |
| 691 | 3300025901 | Ga0207688_10046119 | Ga0207688_100461192 | 342 |
| 692 | 3300025901 | Ga0207688_10048243 | Ga0207688_100482432 | 342 |
| 693 | 3300025904 | Ga0207647_10011355 | Ga0207647_100113552 | 342 |
| 694 | 3300025904 | Ga0207647_10017016 | Ga0207647_100170165 | 342 |
| 695 | 3300025906 | Ga0207699_10002112 | Ga0207699_100021123 | 342 |
| 696 | 3300025907 | Ga0207645_10089451 | Ga0207645_100894512 | 342 |
| 697 | 3300025908 | Ga0207643_10063452 | Ga0207643_100634522 | 342 |
| 698 | 3300025909 | Ga0207705_10086680 | Ga0207705_100866802 | 342 |
| 699 | 3300025909 | Ga0207705_10117994 | Ga0207705_101179942 | 342 |
| 700 | 3300025911 | Ga0207654_10002057 | Ga0207654_100020573 | 342 |
| 701 | 3300025911 | Ga0207654_10016250 | Ga0207654_100162502 | 342 |
| 702 | 3300025912 | Ga0207707_10001060 | Ga0207707_1000106013 | 342 |
| 703 | 3300025912 | Ga0207707_10003094 | Ga0207707_100030944 | 342 |
| 704 | 3300025912 | Ga0207707_10005972 | Ga0207707_1000597213 | 342 |
| 705 | 3300025912 | Ga0207707_10023267 | Ga0207707_100232671 | 342 |
| 706 | 3300025912 | Ga0207707_10125036 | Ga0207707_101250362 | 342 |
| 707 | 3300025913 | Ga0207695_10000123 | Ga0207695_1000012359 | 342 |
| 708 | 3300025913 | Ga0207695_10096843 | Ga0207695_100968432 | 342 |
| 709 | 3300025913 | Ga0207695_10121008 | Ga0207695_101210082 | 342 |
| 710 | 3300025913 | Ga0207695_10164175 | Ga0207695_101641752 | 342 |
| 711 | 3300025914 | Ga0207671_10003762 | Ga0207671_100037628 | 342 |
| 712 | 3300025914 | Ga0207671_10058901 | Ga0207671_100589012 | 342 |
| 713 | 3300025914 | Ga0207671_10273872 | Ga0207671_102738721 | 342 |
| 714 | 3300025915 | Ga0207693_10007711 | Ga0207693_100077112 | 342 |
| 715 | 3300025915 | Ga0207693_10052913 | Ga0207693_100529132 | 342 |
| 716 | 3300025916 | Ga0207663_10013318 | Ga0207663_100133183 | 342 |
| 717 | 3300025917 | Ga0207660_10001447 | Ga0207660_100014478 | 342 |
| 718 | 3300025917 | Ga0207660_10006547 | Ga0207660_100065472 | 342 |
| 719 | 3300025917 | Ga0207660_10112454 | Ga0207660_101124541 | 342 |
| 720 | 3300025917 | Ga0207660_10248425 | Ga0207660_102484252 | 342 |
| 721 | 3300025917 | Ga0207660_10316609 | Ga0207660_103166091 | 342 |
| 722 | 3300025918 | Ga0207662_10057012 | Ga0207662_100570121 | 342 |
| 723 | 3300025918 | Ga0207662_10135310 | Ga0207662_101353102 | 342 |
| 724 | 3300025919 | Ga0207657_10006931 | Ga0207657_1000693111 | 342 |
| 725 | 3300025919 | Ga0207657_10008229 | Ga0207657_1000822910 | 342 |
| 726 | 3300025919 | Ga0207657_10043840 | Ga0207657_100438401 | 342 |
| 727 | 3300025920 | Ga0207649_10156959 | Ga0207649_101569592 | 342 |
| 728 | 3300025920 | Ga0207649_10187614 | Ga0207649_101876142 | 342 |
| 729 | 3300025920 | Ga0207649_10315980 | Ga0207649_103159801 | 342 |
| 730 | 3300025921 | Ga0207652_10001462 | Ga0207652_100014625 | 342 |
| 731 | 3300025921 | Ga0207652_10009510 | Ga0207652_100095105 | 342 |
| 732 | 3300025921 | Ga0207652_10010442 | Ga0207652_100104426 | 342 |
| 733 | 3300025921 | Ga0207652_10013576 | Ga0207652_100135764 | 342 |
| 734 | 3300025923 | Ga0207681_10062526 | Ga0207681_100625262 | 342 |
| 735 | 3300025924 | Ga0207694_10011080 | Ga0207694_100110807 | 342 |
| 736 | 3300025924 | Ga0207694_10162643 | Ga0207694_101626432 | 342 |
| 737 | 3300025925 | Ga0207650_10014705 | Ga0207650_100147053 | 342 |
| 738 | 3300025925 | Ga0207650_10165628 | Ga0207650_101656282 | 342 |
| 739 | 3300025925 | Ga0207650_10223003 | Ga0207650_102230031 | 342 |
| 740 | 3300025926 | Ga0207659_10049502 | Ga0207659_100495022 | 342 |
| 741 | 3300025926 | Ga0207659_10170259 | Ga0207659_101702592 | 342 |
| 742 | 3300025926 | Ga0207659_10225907 | Ga0207659_102259072 | 342 |
| 743 | 3300025927 | Ga0207687_10010511 | Ga0207687_100105112 | 342 |
| 744 | 3300025927 | Ga0207687_10042501 | Ga0207687_100425013 | 342 |
| 745 | 3300025928 | Ga0207700_10003844 | Ga0207700_100038444 | 342 |
| 746 | 3300025928 | Ga0207700_10027640 | Ga0207700_100276402 | 342 |
| 747 | 3300025928 | Ga0207700_10041641 | Ga0207700_100416412 | 342 |
| 748 | 3300025929 | Ga0207664_10039390 | Ga0207664_100393903 | 342 |
| 749 | 3300025929 | Ga0207664_10090250 | Ga0207664_100902502 | 342 |
| 750 | 3300025929 | Ga0207664_10101335 | Ga0207664_101013352 | 342 |
| 751 | 3300025929 | Ga0207664_10174826 | Ga0207664_101748261 | 342 |
| 752 | 3300025931 | Ga0207644_10063359 | Ga0207644_100633593 | 342 |
| 753 | 3300025931 | Ga0207644_10132443 | Ga0207644_101324432 | 342 |
| 754 | 3300025931 | Ga0207644_10193306 | Ga0207644_101933062 | 342 |
| 755 | 3300025932 | Ga0207690_10015287 | Ga0207690_100152872 | 342 |
| 756 | 3300025933 | Ga0207706_10042126 | Ga0207706_100421262 | 342 |
| 757 | 3300025933 | Ga0207706_10098765 | Ga0207706_100987653 | 342 |
| 758 | 3300025933 | Ga0207706_10252822 | Ga0207706_102528222 | 342 |
| 759 | 3300025935 | Ga0207709_10032248 | Ga0207709_100322482 | 342 |
| 760 | 3300025935 | Ga0207709_10093783 | Ga0207709_100937832 | 342 |
| 761 | 3300025936 | Ga0207670_10000723 | Ga0207670_100007233 | 342 |
| 762 | 3300025936 | Ga0207670_10004146 | Ga0207670_100041463 | 342 |
| 763 | 3300025936 | Ga0207670_10084086 | Ga0207670_100840863 | 342 |
| 764 | 3300025937 | Ga0207669_10009635 | Ga0207669_100096356 | 342 |
| 765 | 3300025937 | Ga0207669_10015713 | Ga0207669_100157135 | 342 |
| 766 | 3300025938 | Ga0207704_10057171 | Ga0207704_100571712 | 342 |
| 767 | 3300025939 | Ga0207665_10069227 | Ga0207665_100692273 | 342 |
| 768 | 3300025939 | Ga0207665_10264370 | Ga0207665_102643702 | 342 |
| 769 | 3300025941 | Ga0207711_10054382 | Ga0207711_100543822 | 342 |
| 770 | 3300025941 | Ga0207711_10279473 | Ga0207711_102794731 | 342 |
| 771 | 3300025942 | Ga0207689_10076507 | Ga0207689_100765073 | 342 |
| 772 | 3300025942 | Ga0207689_10122625 | Ga0207689_101226251 | 342 |
| 773 | 3300025942 | Ga0207689_10171695 | Ga0207689_101716952 | 342 |
| 774 | 3300025942 | Ga0207689_10402181 | Ga0207689_104021811 | 342 |
| 775 | 3300025944 | Ga0207661_10002168 | Ga0207661_100021689 | 342 |
| 776 | 3300025944 | Ga0207661_10008830 | Ga0207661_100088302 | 342 |
| 777 | 3300025944 | Ga0207661_10021211 | Ga0207661_100212111 | 342 |
| 778 | 3300025944 | Ga0207661_10099549 | Ga0207661_100995492 | 342 |
| 779 | 3300025944 | Ga0207661_10320509 | Ga0207661_103205091 | 342 |
| 780 | 3300025949 | Ga0207667_10011535 | Ga0207667_100115356 | 342 |
| 781 | 3300025949 | Ga0207667_10063324 | Ga0207667_100633242 | 342 |
| 782 | 3300025949 | Ga0207667_10119404 | Ga0207667_101194042 | 342 |
| 783 | 3300025960 | Ga0207651_10327268 | Ga0207651_103272681 | 342 |
| 784 | 3300025961 | Ga0207712_10016215 | Ga0207712_100162157 | 342 |
| 785 | 3300025961 | Ga0207712_10027361 | Ga0207712_100273616 | 342 |
| 786 | 3300025961 | Ga0207712_10304696 | Ga0207712_103046961 | 342 |
| 787 | 3300025972 | Ga0207668_10001797 | Ga0207668_100017977 | 342 |
| 788 | 3300025972 | Ga0207668_10010768 | Ga0207668_100107682 | 342 |
| 789 | 3300025972 | Ga0207668_10026341 | Ga0207668_100263412 | 342 |
| 790 | 3300025981 | Ga0207640_10092750 | Ga0207640_100927502 | 342 |
| 791 | 3300025981 | Ga0207640_10357785 | Ga0207640_103577851 | 342 |
| 792 | 3300025986 | Ga0207658_10140276 | Ga0207658_101402762 | 342 |
| 793 | 3300025986 | Ga0207658_10315200 | Ga0207658_103152001 | 342 |
| 794 | 3300025986 | Ga0207658_10341710 | Ga0207658_103417101 | 342 |
| 795 | 3300026023 | Ga0207677_10021883 | Ga0207677_100218831 | 342 |
| 796 | 3300026023 | Ga0207677_10027258 | Ga0207677_100272582 | 342 |
| 797 | 3300026041 | Ga0207639_10028505 | Ga0207639_100285054 | 342 |
| 798 | 3300026041 | Ga0207639_10135161 | Ga0207639_101351611 | 342 |
| 799 | 3300026041 | Ga0207639_10174234 | Ga0207639_101742342 | 342 |
| 800 | 3300026067 | Ga0207678_10018436 | Ga0207678_100184363 | 342 |
| 801 | 3300026067 | Ga0207678_10022139 | Ga0207678_100221392 | 342 |
| 802 | 3300026067 | Ga0207678_10028304 | Ga0207678_100283044 | 342 |
| 803 | 3300026067 | Ga0207678_10049981 | Ga0207678_100499811 | 342 |
| 804 | 3300026067 | Ga0207678_10075813 | Ga0207678_100758133 | 342 |
| 805 | 3300026067 | Ga0207678_10147347 | Ga0207678_101473472 | 342 |
| 806 | 3300026067 | Ga0207678_10149815 | Ga0207678_101498152 | 342 |
| 807 | 3300026067 | Ga0207678_10246738 | Ga0207678_102467382 | 342 |
| 808 | 3300026075 | Ga0207708_10044625 | Ga0207708_100446253 | 342 |
| 809 | 3300026078 | Ga0207702_10387797 | Ga0207702_103877971 | 342 |
| 810 | 3300026089 | Ga0207648_10092640 | Ga0207648_100926403 | 342 |
| 811 | 3300026089 | Ga0207648_10113202 | Ga0207648_101132022 | 342 |
| 812 | 3300026089 | Ga0207648_10114859 | Ga0207648_101148592 | 342 |
| 813 | 3300026095 | Ga0207676_10010931 | Ga0207676_100109317 | 342 |
| 814 | 3300026116 | Ga0207674_10030711 | Ga0207674_100307113 | 342 |
| 815 | 3300026116 | Ga0207674_10131644 | Ga0207674_101316442 | 342 |
| 816 | 3300026116 | Ga0207674_10146903 | Ga0207674_101469033 | 342 |
| 817 | 3300026116 | Ga0207674_10169491 | Ga0207674_101694911 | 342 |
| 818 | 3300026118 | Ga0207675_100004169 | Ga0207675_10000416910 | 342 |
| 819 | 3300026118 | Ga0207675_100016487 | Ga0207675_1000164874 | 342 |
| 820 | 3300026118 | Ga0207675_100039441 | Ga0207675_1000394414 | 342 |
| 821 | 3300026118 | Ga0207675_100087282 | Ga0207675_1000872822 | 342 |
| 822 | 3300026118 | Ga0207675_100333474 | Ga0207675_1003334741 | 342 |
| 823 | 3300026121 | Ga0207683_10009233 | Ga0207683_100092332 | 342 |
| 824 | 3300026121 | Ga0207683_10099148 | Ga0207683_100991482 | 342 |
| 825 | 3300026121 | Ga0207683_10102964 | Ga0207683_101029643 | 342 |
| 826 | 3300026121 | Ga0207683_10117012 | Ga0207683_101170124 | 342 |
| 827 | 3300026121 | Ga0207683_10132981 | Ga0207683_101329811 | 342 |
| 828 | 3300026121 | Ga0207683_10174085 | Ga0207683_101740852 | 342 |
| 829 | 3300026142 | Ga0207698_10051937 | Ga0207698_100519372 | 342 |
| 830 | 3300026142 | Ga0207698_10065027 | Ga0207698_100650272 | 342 |
| 831 | 3300026142 | Ga0207698_10198285 | Ga0207698_101982852 | 342 |
| 832 | 3300026142 | Ga0207698_10213291 | Ga0207698_102132912 | 342 |
| 833 | 3300027296 | Ga0209389_1000201 | Ga0209389_100020114 | 342 |
| 834 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002161 | 342 |
| 835 | 3300027361 | Ga0209489_100002 | Ga0209489_100002161 | 342 |
| 836 | 3300027361 | Ga0209489_100035 | Ga0209489_10003537 | 342 |
| 837 | 3300027363 | Ga0209700_100002 | Ga0209700_100002161 | 342 |
| 838 | 3300027363 | Ga0209700_100005 | Ga0209700_10000539 | 342 |
| 839 | 3300027512 | Ga0209179_1010620 | Ga0209179_10106202 | 342 |
| 840 | 3300027866 | Ga0209813_10006831 | Ga0209813_100068312 | 342 |
| 841 | 3300027866 | Ga0209813_10019139 | Ga0209813_100191391 | 342 |
| 842 | 3300027907 | Ga0207428_10021751 | Ga0207428_100217513 | 342 |
| 843 | 3300028379 | Ga0268266_10014910 | Ga0268266_100149103 | 342 |
| 844 | 3300028379 | Ga0268266_10049432 | Ga0268266_100494321 | 342 |
| 845 | 3300028379 | Ga0268266_10092299 | Ga0268266_100922992 | 342 |
| 846 | 3300028379 | Ga0268266_10096847 | Ga0268266_100968472 | 342 |
| 847 | 3300028379 | Ga0268266_10167157 | Ga0268266_101671572 | 342 |
| 848 | 3300028379 | Ga0268266_10234454 | Ga0268266_102344542 | 342 |
| 849 | 3300028379 | Ga0268266_10254583 | Ga0268266_102545832 | 342 |
| 850 | 3300028380 | Ga0268265_10020676 | Ga0268265_100206764 | 342 |
| 851 | 3300028380 | Ga0268265_10251015 | Ga0268265_102510151 | 342 |
| 852 | 3300028794 | Ga0307515_10036261 | Ga0307515_100362613 | 342 |
| 853 | 3300031249 | Ga0265339_10069363 | Ga0265339_100693632 | 342 |
| 854 | 3300031249 | Ga0265339_10110023 | Ga0265339_101100231 | 342 |
| 855 | 3300031250 | Ga0265331_10052024 | Ga0265331_100520242 | 342 |
| 856 | 3300031344 | Ga0265316_10107628 | Ga0265316_101076282 | 342 |
| 857 | 3300031456 | Ga0307513_10082871 | Ga0307513_100828713 | 342 |
| 858 | 3300031616 | Ga0307508_10183623 | Ga0307508_101836232 | 342 |
| 859 | 3300031711 | Ga0265314_10029453 | Ga0265314_100294534 | 342 |
| 860 | 3300031712 | Ga0265342_10017745 | Ga0265342_100177452 | 342 |
| 861 | 3300032002 | Ga0307416_100314809 | Ga0307416_1003148092 | 342 |
| 862 | 3300032004 | Ga0307414_10433562 | Ga0307414_104335621 | 342 |
| 863 | 3300032126 | Ga0307415_100165832 | Ga0307415_1001658322 | 342 |
| 864 | 3300033180 | Ga0307510_10012742 | Ga0307510_100127424 | 342 |
| 865 | 3300033180 | Ga0307510_10032603 | Ga0307510_100326032 | 342 |
| 866 | 3300033442 | Ga0315911_1000021 | Ga0315911_100002115 | 342 |
| 867 | 3300034816 | Ga0373930_0021115 | Ga0373930_0021115_10_1062 | 342 |
| 868 | 3300035083 | Ga0373926_0040292 | Ga0373926_0040292_266_1294 | 342 |
| 869 | 3300035083 | Ga0373926_0078249 | Ga0373926_0078249_109_1200 | 342 |
| 870 | 3300035089 | Ga0373944_0012879 | Ga0373944_0012879_927_1955 | 342 |
| 871 | 3300035089 | Ga0373944_0019033 | Ga0373944_0019033_846_1874 | 342 |
| 872 | 3300035089 | Ga0373944_0046784 | Ga0373944_0046784_103_1131 | 342 |
| 873 | 3300035111 | Ga0373923_0015134 | Ga0373923_0015134_238_1329 | 342 |
| 874 | 3300035111 | Ga0373923_0016016 | Ga0373923_0016016_415_1443 | 342 |
| 875 | 3300035113 | Ga0373936_0005865 | Ga0373936_0005865_3188_4279 | 342 |
| 876 | 3300035116 | Ga0373945_0014426 | Ga0373945_0014426_1145_2173 | 342 |
| 877 | 3300035116 | Ga0373945_0029335 | Ga0373945_0029335_224_1252 | 342 |
| 878 | 3300035116 | Ga0373945_0068268 | Ga0373945_0068268_168_1259 | 342 |
| 879 | 3300035117 | Ga0373953_0055861 | Ga0373953_0055861_401_1429 | 342 |
| 880 | 3300035119 | Ga0373956_0023627 | Ga0373956_0023627_1468_2559 | 342 |
| 881 | 3300035119 | Ga0373956_0062661 | Ga0373956_0062661_346_1374 | 342 |
| 882 | 3300035170 | Ga0373943_0016082 | Ga0373943_0016082_1808_2836 | 342 |
| 883 | 3300035170 | Ga0373943_0030683 | Ga0373943_0030683_212_1240 | 342 |
| 884 | 3300035170 | Ga0373943_0043377 | Ga0373943_0043377_87_1115 | 342 |
| 885 | 3300035170 | Ga0373943_0060103 | Ga0373943_0060103_510_1538 | 342 |
| 886 | 3300035170 | Ga0373943_0064413 | Ga0373943_0064413_777_1805 | 342 |
| 887 | 3300035170 | Ga0373943_0187169 | Ga0373943_0187169_30_1058 | 342 |
| 888 | 3300035171 | Ga0373946_0003500 | Ga0373946_0003500_320_1348 | 342 |
| 889 | 3300035171 | Ga0373946_0011732 | Ga0373946_0011732_1956_2984 | 342 |
| 890 | 3300035410 | Ga0373924_0020510 | Ga0373924_0020510_1026_2117 | 342 |
| 891 | 3300035691 | Ga0373931_0036553 | Ga0373931_0036553_709_1737 | 342 |
| 892 | 3300035691 | Ga0373931_0128212 | Ga0373931_0128212_278_1357 | 342 |
| 893 | 3300035692 | Ga0373935_0013096 | Ga0373935_0013096_1515_2543 | 342 |
| 894 | 3300035692 | Ga0373935_0019770 | Ga0373935_0019770_172_1200 | 342 |
| 895 | 3300035692 | Ga0373935_0044947 | Ga0373935_0044947_1423_2451 | 342 |
| 896 | 3300035692 | Ga0373935_0055404 | Ga0373935_0055404_712_1740 | 342 |
| 897 | 3300035692 | Ga0373935_0056552 | Ga0373935_0056552_769_1797 | 342 |
| 898 | 3300035692 | Ga0373935_0162554 | Ga0373935_0162554_427_1455 | 342 |
| 899 | 3300035695 | Ga0373927_0007278 | Ga0373927_0007278_5019_6047 | 342 |
| 900 | 3300035695 | Ga0373927_0049323 | Ga0373927_0049323_1444_2472 | 342 |
| 901 | 3300035695 | Ga0373927_0094899 | Ga0373927_0094899_231_1259 | 342 |
| 902 | 3300035695 | Ga0373927_0138302 | Ga0373927_0138302_456_1484 | 342 |
| 903 | 3300035724 | Ga0373933_0024090 | Ga0373933_0024090_1412_2440 | 342 |
| 904 | 3300035724 | Ga0373933_0081210 | Ga0373933_0081210_864_1892 | 342 |
| 905 | 3300035725 | Ga0373947_0004180 | Ga0373947_0004180_6248_7276 | 342 |
| 906 | 3300035725 | Ga0373947_0018731 | Ga0373947_0018731_2679_3707 | 342 |
| 907 | 3300035725 | Ga0373947_0020227 | Ga0373947_0020227_1228_2256 | 342 |
| 908 | 3300035725 | Ga0373947_0049538 | Ga0373947_0049538_571_1599 | 342 |
| 909 | 3300035725 | Ga0373947_0062433 | Ga0373947_0062433_144_1172 | 342 |
| 910 | 3300035725 | Ga0373947_0098134 | Ga0373947_0098134_584_1612 | 342 |
| 911 | 3300036401 | Ga0373937_0005300 | Ga0373937_0005300_7676_8704 | 342 |
| 912 | 3300036401 | Ga0373937_0084401 | Ga0373937_0084401_1722_2750 | 342 |
| 913 | 3300036401 | Ga0373937_0099098 | Ga0373937_0099098_1381_2472 | 342 |
| 914 | 3300037068 | Ga0373925_0008589 | Ga0373925_0008589_1502_2530 | 342 |
| 915 | 3300037068 | Ga0373925_0010602 | Ga0373925_0010602_2717_3745 | 342 |
| 916 | 3300037068 | Ga0373925_0063800 | Ga0373925_0063800_1043_2071 | 342 |
| 917 | 3300037068 | Ga0373925_0118544 | Ga0373925_0118544_334_1362 | 342 |
| 918 | 3300037068 | Ga0373925_0145775 | Ga0373925_0145775_739_1767 | 342 |
| 919 | 3300037068 | Ga0373925_0189922 | Ga0373925_0189922_121_1149 | 342 |
| 920 | 3300037312 | Ga0395899_0019733 | Ga0395899_0019733_2879_3907 | 342 |
| 921 | 3300037312 | Ga0395899_0081185 | Ga0395899_0081185_1234_2262 | 342 |
| 922 | 3300037418 | Ga0395900_0031496 | Ga0395900_0031496_4200_5228 | 342 |
| 923 | 3300037418 | Ga0395900_0132004 | Ga0395900_0132004_1134_2162 | 342 |
| 924 | 3300037418 | Ga0395900_0341087 | Ga0395900_0341087_102_1130 | 342 |
| 925 | 3300037466 | Ga0395898_0002361 | Ga0395898_0002361_20999_22027 | 342 |
| 926 | 3300037466 | Ga0395898_0015190 | Ga0395898_0015190_6567_7595 | 342 |
| 927 | 3300037466 | Ga0395898_0407053 | Ga0395898_0407053_54_1082 | 342 |
| 928 | 3300037853 | Ga0436364_0422894 | Ga0436364_0422894_69_1097 | 342 |
| 929 | 3300037853 | Ga0436364_0839082 | Ga0436364_0839082_220_1248 | 342 |
| 930 | 3300038443 | Ga0395901_0094760 | Ga0395901_0094760_1542_2570 | 342 |
| 931 | 3300038443 | Ga0395901_0396539 | Ga0395901_0396539_377_1405 | 342 |
| 932 | 3300039437 | Ga0436365_0045906 | Ga0436365_0045906_1463_2491 | 342 |
| 933 | 3300039437 | Ga0436365_0908986 | Ga0436365_0908986_1200_2228 | 342 |
| 934 | 3300039437 | Ga0436365_1169629 | Ga0436365_1169629_141_1169 | 342 |
| 935 | 3300039438 | Ga0436360_0676143 | Ga0436360_0676143_312_1340 | 342 |
| 936 | 3300039438 | Ga0436360_0851383 | Ga0436360_0851383_2046_3074 | 342 |
| 937 | 3300039453 | Ga0436362_0075180 | Ga0436362_0075180_72_1100 | 342 |
| 938 | 3300041486 | Ga0451807_1527043 | Ga0451807_1527043_385_1413 | 342 |
| 939 | 3300044693 | Ga0466961_0087148 | Ga0466961_0087148_43_1071 | 342 |
| 940 | 3300044901 | Ga0466960_0139629 | Ga0466960_0139629_143_1171 | 342 |
| 941 | 3300045049 | Ga0466959_0136494 | Ga0466959_0136494_45_1073 | 342 |
| 942 | 3300045976 | Ga0466967_0015489 | Ga0466967_0015489_355_1383 | 342 |
| 943 | 3300045976 | Ga0466967_0122933 | Ga0466967_0122933_927_1955 | 342 |
| 944 | 3300046452 | Ga0495617_047333 | Ga0495617_047333_377_1405 | 342 |
| 945 | 3300046454 | Ga0495592_0065726 | Ga0495592_0065726_228_1256 | 342 |
| 946 | 3300046454 | Ga0495592_0085888 | Ga0495592_0085888_1195_2223 | 342 |
| 947 | 3300046454 | Ga0495592_0092782 | Ga0495592_0092782_485_1513 | 342 |
| 948 | 3300046455 | Ga0495603_0048534 | Ga0495603_0048534_18_1046 | 342 |
| 949 | 3300046455 | Ga0495603_0074501 | Ga0495603_0074501_726_1754 | 342 |
| 950 | 3300046455 | Ga0495603_0167925 | Ga0495603_0167925_76_1104 | 342 |
| 951 | 3300046457 | Ga0495590_0022334 | Ga0495590_0022334_1046_2074 | 342 |
| 952 | 3300046457 | Ga0495590_0034643 | Ga0495590_0034643_167_1195 | 342 |
| 953 | 3300046459 | Ga0495629_0005715 | Ga0495629_0005715_6692_7720 | 342 |
| 954 | 3300046459 | Ga0495629_0024359 | Ga0495629_0024359_2675_3703 | 342 |
| 955 | 3300046459 | Ga0495629_0035104 | Ga0495629_0035104_808_1836 | 342 |
| 956 | 3300046459 | Ga0495629_0075207 | Ga0495629_0075207_761_1789 | 342 |
| 957 | 3300046459 | Ga0495629_0078476 | Ga0495629_0078476_323_1351 | 342 |
| 958 | 3300046459 | Ga0495629_0124314 | Ga0495629_0124314_396_1424 | 342 |
| 959 | 3300046460 | Ga0495638_0012685 | Ga0495638_0012685_4199_5227 | 342 |
| 960 | 3300046460 | Ga0495638_0127909 | Ga0495638_0127909_309_1337 | 342 |
| 961 | 3300046461 | Ga0495641_0028609 | Ga0495641_0028609_536_1564 | 342 |
| 962 | 3300046461 | Ga0495641_0083509 | Ga0495641_0083509_102_1130 | 342 |
| 963 | 3300046462 | Ga0495651_0004217 | Ga0495651_0004217_6824_7852 | 342 |
| 964 | 3300046462 | Ga0495651_0004672 | Ga0495651_0004672_8592_9620 | 342 |
| 965 | 3300046462 | Ga0495651_0017519 | Ga0495651_0017519_2426_3454 | 342 |
| 966 | 3300046462 | Ga0495651_0021317 | Ga0495651_0021317_3032_4060 | 342 |
| 967 | 3300046462 | Ga0495651_0040455 | Ga0495651_0040455_1017_2045 | 342 |
| 968 | 3300046462 | Ga0495651_0093894 | Ga0495651_0093894_255_1283 | 342 |
| 969 | 3300046463 | Ga0495653_0013840 | Ga0495653_0013840_3676_4704 | 342 |
| 970 | 3300046463 | Ga0495653_0021718 | Ga0495653_0021718_2879_3907 | 342 |
| 971 | 3300046463 | Ga0495653_0056672 | Ga0495653_0056672_674_1702 | 342 |
| 972 | 3300046463 | Ga0495653_0086909 | Ga0495653_0086909_508_1536 | 342 |
| 973 | 3300046463 | Ga0495653_0167182 | Ga0495653_0167182_321_1349 | 342 |
| 974 | 3300046472 | Ga0495580_0010281 | Ga0495580_0010281_6227_7255 | 342 |
| 975 | 3300046472 | Ga0495580_0025873 | Ga0495580_0025873_389_1417 | 342 |
| 976 | 3300046472 | Ga0495580_0212084 | Ga0495580_0212084_14_1042 | 342 |
| 977 | 3300046473 | Ga0495582_0008667 | Ga0495582_0008667_2052_3080 | 342 |
| 978 | 3300046473 | Ga0495582_0015336 | Ga0495582_0015336_1330_2358 | 342 |
| 979 | 3300046473 | Ga0495582_0043084 | Ga0495582_0043084_1250_2278 | 342 |
| 980 | 3300046473 | Ga0495582_0058221 | Ga0495582_0058221_743_1771 | 342 |
| 981 | 3300046473 | Ga0495582_0078189 | Ga0495582_0078189_349_1377 | 342 |
| 982 | 3300046474 | Ga0495605_0022270 | Ga0495605_0022270_1434_2462 | 342 |
| 983 | 3300046474 | Ga0495605_0060024 | Ga0495605_0060024_616_1644 | 342 |
| 984 | 3300046475 | Ga0495639_0004024 | Ga0495639_0004024_2754_3782 | 342 |
| 985 | 3300046475 | Ga0495639_0008168 | Ga0495639_0008168_737_1765 | 342 |
| 986 | 3300046475 | Ga0495639_0010407 | Ga0495639_0010407_266_1294 | 342 |
| 987 | 3300046476 | Ga0495662_0002323 | Ga0495662_0002323_6428_7456 | 342 |
| 988 | 3300046476 | Ga0495662_0013322 | Ga0495662_0013322_2113_3141 | 342 |
| 989 | 3300046476 | Ga0495662_0015793 | Ga0495662_0015793_1310_2338 | 342 |
| 990 | 3300046476 | Ga0495662_0045334 | Ga0495662_0045334_362_1390 | 342 |
| 991 | 3300046477 | Ga0495664_0013085 | Ga0495664_0013085_1045_2073 | 342 |
| 992 | 3300046477 | Ga0495664_0019574 | Ga0495664_0019574_803_1831 | 342 |
| 993 | 3300046477 | Ga0495664_0020012 | Ga0495664_0020012_2793_3821 | 342 |
| 994 | 3300046477 | Ga0495664_0025412 | Ga0495664_0025412_1202_2230 | 342 |
| 995 | 3300046477 | Ga0495664_0033577 | Ga0495664_0033577_1180_2208 | 342 |
| 996 | 3300046477 | Ga0495664_0110158 | Ga0495664_0110158_445_1473 | 342 |
| 997 | 3300046492 | Ga0495585_0023352 | Ga0495585_0023352_697_1725 | 342 |
| 998 | 3300046499 | Ga0495594_0005204 | Ga0495594_0005204_5071_6099 | 342 |
| 999 | 3300046499 | Ga0495594_0049664 | Ga0495594_0049664_364_1392 | 342 |
| 1000 | 3300046507 | Ga0495606_0031644 | Ga0495606_0031644_1062_2090 | 342 |
| 1001 | 3300046507 | Ga0495606_0076705 | Ga0495606_0076705_273_1301 | 342 |
| 1002 | 3300046511 | Ga0495608_0007486 | Ga0495608_0007486_5491_6519 | 342 |
| 1003 | 3300046511 | Ga0495608_0037956 | Ga0495608_0037956_862_1890 | 342 |
| 1004 | 3300046511 | Ga0495608_0076804 | Ga0495608_0076804_182_1210 | 342 |
| 1005 | 3300046511 | Ga0495608_0090413 | Ga0495608_0090413_154_1182 | 342 |
| 1006 | 3300046513 | Ga0495616_0078986 | Ga0495616_0078986_298_1326 | 342 |
| 1007 | 3300046514 | Ga0495618_0001061 | Ga0495618_0001061_6326_7354 | 342 |
| 1008 | 3300046514 | Ga0495618_0024189 | Ga0495618_0024189_2317_3345 | 342 |
| 1009 | 3300046514 | Ga0495618_0062860 | Ga0495618_0062860_532_1560 | 342 |
| 1010 | 3300046516 | Ga0495628_0036089 | Ga0495628_0036089_437_1465 | 342 |
| 1011 | 3300046516 | Ga0495628_0082142 | Ga0495628_0082142_523_1551 | 342 |
| 1012 | 3300046516 | Ga0495628_0283928 | Ga0495628_0283928_173_1201 | 342 |
| 1013 | 3300046517 | Ga0495630_0037669 | Ga0495630_0037669_2261_3352 | 342 |
| 1014 | 3300046517 | Ga0495630_0041344 | Ga0495630_0041344_308_1336 | 342 |
| 1015 | 3300046517 | Ga0495630_0054144 | Ga0495630_0054144_1581_2609 | 342 |
| 1016 | 3300046517 | Ga0495630_0068819 | Ga0495630_0068819_1215_2243 | 342 |
| 1017 | 3300046517 | Ga0495630_0122377 | Ga0495630_0122377_433_1461 | 342 |
| 1018 | 3300046517 | Ga0495630_0302948 | Ga0495630_0302948_104_1132 | 342 |
| 1019 | 3300046518 | Ga0495631_0024987 | Ga0495631_0024987_422_1450 | 342 |
| 1020 | 3300046519 | Ga0495632_0028540 | Ga0495632_0028540_1651_2679 | 342 |
| 1021 | 3300046522 | Ga0495643_0095374 | Ga0495643_0095374_219_1247 | 342 |
| 1022 | 3300046523 | Ga0495644_0055084 | Ga0495644_0055084_78_1106 | 342 |
| 1023 | 3300046524 | Ga0495648_0005065 | Ga0495648_0005065_8820_9848 | 342 |
| 1024 | 3300046524 | Ga0495648_0075049 | Ga0495648_0075049_512_1540 | 342 |
| 1025 | 3300046525 | Ga0495663_0027311 | Ga0495663_0027311_621_1649 | 342 |
| 1026 | 3300046526 | Ga0495666_0043817 | Ga0495666_0043817_660_1688 | 342 |
| 1027 | 3300046529 | Ga0495652_0016634 | Ga0495652_0016634_3512_4540 | 342 |
| 1028 | 3300046529 | Ga0495652_0019059 | Ga0495652_0019059_496_1524 | 342 |
| 1029 | 3300046529 | Ga0495652_0124601 | Ga0495652_0124601_481_1509 | 342 |
| 1030 | 3300046529 | Ga0495652_0158489 | Ga0495652_0158489_686_1714 | 342 |
| 1031 | 3300046531 | Ga0495665_0007053 | Ga0495665_0007053_2517_3545 | 342 |
| 1032 | 3300046531 | Ga0495665_0039138 | Ga0495665_0039138_188_1216 | 342 |
| 1033 | 3300046533 | Ga0495640_0001271 | Ga0495640_0001271_15528_16556 | 342 |
| 1034 | 3300046533 | Ga0495640_0009760 | Ga0495640_0009760_2163_3191 | 342 |
| 1035 | 3300046533 | Ga0495640_0011556 | Ga0495640_0011556_2398_3426 | 342 |
| 1036 | 3300046533 | Ga0495640_0064782 | Ga0495640_0064782_1257_2285 | 342 |
| 1037 | 3300046533 | Ga0495640_0102593 | Ga0495640_0102593_536_1564 | 342 |
| 1038 | 3300046533 | Ga0495640_0124834 | Ga0495640_0124834_504_1532 | 342 |
| 1039 | 3300046533 | Ga0495640_0206445 | Ga0495640_0206445_132_1160 | 342 |
| 1040 | 3300046535 | Ga0495586_0049611 | Ga0495586_0049611_1222_2250 | 342 |
| 1041 | 3300046536 | Ga0495587_0009785 | Ga0495587_0009785_793_1821 | 342 |
| 1042 | 3300046536 | Ga0495587_0018769 | Ga0495587_0018769_106_1134 | 342 |
| 1043 | 3300046536 | Ga0495587_0030630 | Ga0495587_0030630_1822_2850 | 342 |
| 1044 | 3300046536 | Ga0495587_0063326 | Ga0495587_0063326_187_1215 | 342 |
| 1045 | 3300046538 | Ga0495609_0014673 | Ga0495609_0014673_2121_3149 | 342 |
| 1046 | 3300046543 | Ga0495645_0060500 | Ga0495645_0060500_912_1940 | 342 |
| 1047 | 3300046543 | Ga0495645_0084178 | Ga0495645_0084178_791_1819 | 342 |
| 1048 | 3300046543 | Ga0495645_0098074 | Ga0495645_0098074_252_1280 | 342 |
| 1049 | 3300046543 | Ga0495645_0214824 | Ga0495645_0214824_58_1086 | 342 |
| 1050 | 3300046558 | Ga0495633_0121826 | Ga0495633_0121826_19_1047 | 342 |
| 1051 | 3300046559 | Ga0495667_0011680 | Ga0495667_0011680_2401_3429 | 342 |
| 1052 | 3300046559 | Ga0495667_0015529 | Ga0495667_0015529_2390_3418 | 342 |
| 1053 | 3300046559 | Ga0495667_0019653 | Ga0495667_0019653_996_2024 | 342 |
| 1054 | 3300046559 | Ga0495667_0073707 | Ga0495667_0073707_582_1610 | 342 |
| 1055 | 3300046615 | Ga0495656_0017401 | Ga0495656_0017401_313_1341 | 342 |
| 1056 | 3300046642 | Ga0495634_0006123 | Ga0495634_0006123_2215_3243 | 342 |
| 1057 | 3300046642 | Ga0495634_0033886 | Ga0495634_0033886_971_1999 | 342 |
| 1058 | 3300046642 | Ga0495634_0070251 | Ga0495634_0070251_1015_2043 | 342 |
| 1059 | 3300046642 | Ga0495634_0093235 | Ga0495634_0093235_65_1093 | 342 |
| 1060 | 3300046642 | Ga0495634_0105891 | Ga0495634_0105891_646_1674 | 342 |
| 1061 | 3300046648 | Ga0495611_0009542 | Ga0495611_0009542_1514_2542 | 342 |
| 1062 | 3300046660 | Ga0495625_0105095 | Ga0495625_0105095_492_1520 | 342 |
| 1063 | 3300046663 | Ga0495635_0004098 | Ga0495635_0004098_205_1233 | 342 |
| 1064 | 3300046663 | Ga0495635_0005471 | Ga0495635_0005471_1558_2586 | 342 |
| 1065 | 3300046663 | Ga0495635_0063127 | Ga0495635_0063127_697_1725 | 342 |
| 1066 | 3300046664 | Ga0495659_0024284 | Ga0495659_0024284_345_1373 | 342 |
| 1067 | 3300046665 | Ga0495661_0160389 | Ga0495661_0160389_69_1097 | 342 |
| 1068 | 3300046674 | Ga0495588_0065826 | Ga0495588_0065826_198_1226 | 342 |
| 1069 | 3300046675 | Ga0495657_0016820 | Ga0495657_0016820_1026_2054 | 342 |
| 1070 | 3300046675 | Ga0495657_0027872 | Ga0495657_0027872_857_1885 | 342 |
| 1071 | 3300046678 | Ga0495599_0025899 | Ga0495599_0025899_1613_2641 | 342 |
| 1072 | 3300046679 | Ga0495623_0003775 | Ga0495623_0003775_5155_6183 | 342 |
| 1073 | 3300046679 | Ga0495623_0014622 | Ga0495623_0014622_1980_3008 | 342 |
| 1074 | 3300046679 | Ga0495623_0111037 | Ga0495623_0111037_427_1455 | 342 |
| 1075 | 3300046679 | Ga0495623_0134714 | Ga0495623_0134714_155_1183 | 342 |
| 1076 | 3300046680 | Ga0495646_0010211 | Ga0495646_0010211_2589_3617 | 342 |
| 1077 | 3300046680 | Ga0495646_0027423 | Ga0495646_0027423_431_1459 | 342 |
| 1078 | 3300046680 | Ga0495646_0059371 | Ga0495646_0059371_346_1374 | 342 |
| 1079 | 3300046681 | Ga0495647_0011641 | Ga0495647_0011641_1215_2243 | 342 |
| 1080 | 3300046683 | Ga0495658_0002959 | Ga0495658_0002959_2531_3559 | 342 |
| 1081 | 3300046683 | Ga0495658_0032161 | Ga0495658_0032161_576_1604 | 342 |
| 1082 | 3300046683 | Ga0495658_0140120 | Ga0495658_0140120_37_1065 | 342 |
| 1083 | 3300046683 | Ga0495658_0158322 | Ga0495658_0158322_284_1312 | 342 |
| 1084 | 3300046684 | Ga0495669_0010542 | Ga0495669_0010542_416_1444 | 342 |
| 1085 | 3300046689 | Ga0495613_0036612 | Ga0495613_0036612_762_1790 | 342 |
| 1086 | 3300046689 | Ga0495613_0062337 | Ga0495613_0062337_760_1788 | 342 |
| 1087 | 3300046689 | Ga0495613_0166637 | Ga0495613_0166637_471_1499 | 342 |
| 1088 | 3300046690 | Ga0495624_0020635 | Ga0495624_0020635_1256_2284 | 342 |
| 1089 | 3300046690 | Ga0495624_0052247 | Ga0495624_0052247_1460_2488 | 342 |
| 1090 | 3300046690 | Ga0495624_0096780 | Ga0495624_0096780_476_1567 | 342 |
| 1091 | 3300046690 | Ga0495624_0097587 | Ga0495624_0097587_117_1145 | 342 |
| 1092 | 3300046691 | Ga0495670_0082424 | Ga0495670_0082424_54_1082 | 342 |
| 1093 | 3300046692 | Ga0495671_0025057 | Ga0495671_0025057_430_1458 | 342 |
| 1094 | 3300046692 | Ga0495671_0055716 | Ga0495671_0055716_766_1794 | 342 |
| 1095 | 3300046694 | Ga0495649_0043663 | Ga0495649_0043663_922_1950 | 342 |
| 1096 | 3300046694 | Ga0495649_0046346 | Ga0495649_0046346_1222_2250 | 342 |
| 1097 | 3300046694 | Ga0495649_0067902 | Ga0495649_0067902_49_1077 | 342 |
| 1098 | 3300046794 | Ga0495589_0061566 | Ga0495589_0061566_494_1522 | 342 |
| 1099 | 3300046809 | Ga0495600_0006031 | Ga0495600_0006031_3172_4200 | 342 |
| 1100 | 3300046809 | Ga0495600_0075411 | Ga0495600_0075411_972_2000 | 342 |
| 1101 | 3300046809 | Ga0495600_0075721 | Ga0495600_0075721_892_1920 | 342 |
| 1102 | 3300047315 | Ga0495581_0007693 | Ga0495581_0007693_3593_4621 | 342 |
| 1103 | 3300047315 | Ga0495581_0008174 | Ga0495581_0008174_2520_3548 | 342 |
| 1104 | 3300047315 | Ga0495581_0076220 | Ga0495581_0076220_213_1241 | 342 |
| 1105 | 3300047317 | Ga0495604_0015248 | Ga0495604_0015248_2519_3547 | 342 |
| 1106 | 3300047317 | Ga0495604_0031158 | Ga0495604_0031158_1909_2937 | 342 |
| 1107 | 3300047317 | Ga0495604_0032435 | Ga0495604_0032435_1663_2691 | 342 |
| 1108 | 3300047317 | Ga0495604_0046885 | Ga0495604_0046885_1229_2257 | 342 |
| 1109 | 3300047317 | Ga0495604_0067018 | Ga0495604_0067018_1649_2677 | 342 |
| 1110 | 3300047319 | Ga0495674_0011123 | Ga0495674_0011123_5900_6928 | 342 |
| 1111 | 3300047319 | Ga0495674_0017380 | Ga0495674_0017380_4735_5826 | 342 |
| 1112 | 3300047319 | Ga0495674_0034129 | Ga0495674_0034129_1960_2988 | 342 |
| 1113 | 3300047319 | Ga0495674_0051661 | Ga0495674_0051661_1688_2716 | 342 |
| 1114 | 3300047319 | Ga0495674_0076789 | Ga0495674_0076789_793_1821 | 342 |
| 1115 | 3300047320 | Ga0495672_0021333 | Ga0495672_0021333_740_1768 | 342 |
| 1116 | 3300047320 | Ga0495672_0065044 | Ga0495672_0065044_130_1158 | 342 |
| 1117 | 3300047321 | Ga0495676_0036914 | Ga0495676_0036914_2875_3903 | 342 |
| 1118 | 3300047321 | Ga0495676_0068194 | Ga0495676_0068194_1114_2142 | 342 |
| 1119 | 3300047321 | Ga0495676_0095388 | Ga0495676_0095388_974_2002 | 342 |
| 1120 | 3300047321 | Ga0495676_0142867 | Ga0495676_0142867_70_1098 | 342 |
| 1121 | 3300047321 | Ga0495676_0231826 | Ga0495676_0231826_174_1202 | 342 |
| 1122 | 3300047322 | Ga0495680_0006738 | Ga0495680_0006738_3780_4808 | 342 |
| 1123 | 3300047322 | Ga0495680_0032645 | Ga0495680_0032645_1004_2032 | 342 |
| 1124 | 3300047322 | Ga0495680_0073685 | Ga0495680_0073685_1138_2166 | 342 |
| 1125 | 3300047323 | Ga0495683_0039314 | Ga0495683_0039314_312_1340 | 342 |
| 1126 | 3300047443 | Ga0495687_014453 | Ga0495687_014453_2903_3931 | 342 |
| 1127 | 3300047444 | Ga0495675_0030949 | Ga0495675_0030949_1228_2256 | 342 |
| 1128 | 3300047444 | Ga0495675_0085587 | Ga0495675_0085587_443_1471 | 342 |
| 1129 | 3300047445 | Ga0495677_0015402 | Ga0495677_0015402_1269_2297 | 342 |
| 1130 | 3300047445 | Ga0495677_0075179 | Ga0495677_0075179_152_1180 | 342 |
| 1131 | 3300047469 | Ga0495673_0074325 | Ga0495673_0074325_81_1109 | 342 |
| 1132 | 3300047471 | Ga0495684_0036766 | Ga0495684_0036766_2033_3061 | 342 |
| 1133 | 3300047471 | Ga0495684_0050588 | Ga0495684_0050588_1369_2397 | 342 |
| 1134 | 3300047471 | Ga0495684_0062922 | Ga0495684_0062922_1718_2746 | 342 |
| 1135 | 3300047471 | Ga0495684_0076364 | Ga0495684_0076364_1015_2043 | 342 |
| 1136 | 3300047471 | Ga0495684_0101594 | Ga0495684_0101594_336_1364 | 342 |
| 1137 | 3300047471 | Ga0495684_0117501 | Ga0495684_0117501_852_1880 | 342 |
| 1138 | 3300047471 | Ga0495684_0134132 | Ga0495684_0134132_800_1828 | 342 |
| 1139 | 3300047472 | Ga0495686_0183405 | Ga0495686_0183405_143_1171 | 342 |
| 1140 | 3300047472 | Ga0495686_0224303 | Ga0495686_0224303_16_1044 | 342 |
| 1141 | 3300047673 | Ga0495593_0019768 | Ga0495593_0019768_807_1898 | 342 |
| 1142 | 3300047673 | Ga0495593_0060529 | Ga0495593_0060529_839_1867 | 342 |
| 1143 | 3300047673 | Ga0495593_0060901 | Ga0495593_0060901_528_1556 | 342 |
| 1144 | 3300048088 | Ga0495602_0005817 | Ga0495602_0005817_2071_3099 | 342 |
| 1145 | 3300048088 | Ga0495602_0047118 | Ga0495602_0047118_799_1827 | 342 |
| 1146 | 3300048088 | Ga0495602_0089562 | Ga0495602_0089562_934_1962 | 342 |
| 1147 | 3300048088 | Ga0495602_0168536 | Ga0495602_0168536_615_1643 | 342 |
| 1148 | 3300048089 | Ga0495614_0054843 | Ga0495614_0054843_421_1449 | 342 |
| 1149 | 3300048089 | Ga0495614_0108878 | Ga0495614_0108878_178_1206 | 342 |
| 1150 | 3300048903 | Ga0496100_0001434 | Ga0496100_0001434_10243_11271 | 342 |
| 1151 | 3300048903 | Ga0496100_0007637 | Ga0496100_0007637_4763_5791 | 342 |
| 1152 | 3300048903 | Ga0496100_0021279 | Ga0496100_0021279_1159_2187 | 342 |
| 1153 | 3300048903 | Ga0496100_0112566 | Ga0496100_0112566_420_1448 | 342 |
| 1154 | 3300048903 | Ga0496100_0165090 | Ga0496100_0165090_229_1257 | 342 |
| 1155 | 3300048904 | Ga0496101_0002254 | Ga0496101_0002254_2928_3956 | 342 |
| 1156 | 3300048904 | Ga0496101_0030531 | Ga0496101_0030531_2562_3590 | 342 |
| 1157 | 3300048904 | Ga0496101_0043909 | Ga0496101_0043909_759_1787 | 342 |
| 1158 | 3300048904 | Ga0496101_0064417 | Ga0496101_0064417_1057_2085 | 342 |
| 1159 | 3300048905 | Ga0496102_0001340 | Ga0496102_0001340_10711_11739 | 342 |
| 1160 | 3300048905 | Ga0496102_0001732 | Ga0496102_0001732_3875_4903 | 342 |
| 1161 | 3300048905 | Ga0496102_0022395 | Ga0496102_0022395_1739_2767 | 342 |
| 1162 | 3300048905 | Ga0496102_0073493 | Ga0496102_0073493_364_1392 | 342 |
| 1163 | 3300048905 | Ga0496102_0144298 | Ga0496102_0144298_517_1545 | 342 |
| 1164 | 3300048905 | Ga0496102_0170195 | Ga0496102_0170195_166_1194 | 342 |
| 1165 | 3300048905 | Ga0496102_0320985 | Ga0496102_0320985_155_1183 | 342 |
| 1166 | 3300048906 | Ga0496103_0028828 | Ga0496103_0028828_1560_2588 | 342 |
| 1167 | 3300048906 | Ga0496103_0031135 | Ga0496103_0031135_1505_2533 | 342 |
| 1168 | 3300048906 | Ga0496103_0045510 | Ga0496103_0045510_1011_2039 | 342 |
| 1169 | 3300048907 | Ga0496104_0002060 | Ga0496104_0002060_2703_3731 | 342 |
| 1170 | 3300048907 | Ga0496104_0024607 | Ga0496104_0024607_4373_5452 | 342 |
| 1171 | 3300048907 | Ga0496104_0049168 | Ga0496104_0049168_2219_3247 | 342 |
| 1172 | 3300048907 | Ga0496104_0081984 | Ga0496104_0081984_699_1727 | 342 |
| 1173 | 3300048907 | Ga0496104_0086015 | Ga0496104_0086015_1951_2979 | 342 |
| 1174 | 3300048907 | Ga0496104_0100245 | Ga0496104_0100245_527_1555 | 342 |
| 1175 | 3300048907 | Ga0496104_0239864 | Ga0496104_0239864_328_1359 | 342 |
| 1176 | 3300048908 | Ga0496105_0001290 | Ga0496105_0001290_7878_8906 | 342 |
| 1177 | 3300048908 | Ga0496105_0003659 | Ga0496105_0003659_3528_4556 | 342 |
| 1178 | 3300048908 | Ga0496105_0012783 | Ga0496105_0012783_747_1775 | 342 |
| 1179 | 3300048908 | Ga0496105_0018396 | Ga0496105_0018396_2443_3471 | 342 |
| 1180 | 3300048908 | Ga0496105_0038693 | Ga0496105_0038693_2115_3143 | 342 |
| 1181 | 3300048908 | Ga0496105_0104257 | Ga0496105_0104257_376_1404 | 342 |
| 1182 | 3300048908 | Ga0496105_0265635 | Ga0496105_0265635_251_1279 | 342 |
| 1183 | 3300048909 | Ga0496106_0000749 | Ga0496106_0000749_4100_5128 | 342 |
| 1184 | 3300048909 | Ga0496106_0028512 | Ga0496106_0028512_2799_3827 | 342 |
| 1185 | 3300048909 | Ga0496106_0036966 | Ga0496106_0036966_1223_2251 | 342 |
| 1186 | 3300048909 | Ga0496106_0056039 | Ga0496106_0056039_325_1353 | 342 |
| 1187 | 3300048909 | Ga0496106_0061778 | Ga0496106_0061778_1256_2284 | 342 |
| 1188 | 3300048909 | Ga0496106_0213394 | Ga0496106_0213394_241_1272 | 342 |
| 1189 | 3300048909 | Ga0496106_0291456 | Ga0496106_0291456_95_1123 | 342 |
| 1190 | 3300048910 | Ga0496107_0039367 | Ga0496107_0039367_749_1777 | 342 |
| 1191 | 3300048910 | Ga0496107_0053993 | Ga0496107_0053993_1029_2057 | 342 |
| 1192 | 3300048910 | Ga0496107_0073563 | Ga0496107_0073563_304_1332 | 342 |
| 1193 | 3300048910 | Ga0496107_0186327 | Ga0496107_0186327_20_1048 | 342 |
| 1194 | 3300048911 | Ga0496108_0010203 | Ga0496108_0010203_2893_3921 | 342 |
| 1195 | 3300048911 | Ga0496108_0011810 | Ga0496108_0011810_1274_2302 | 342 |
| 1196 | 3300048911 | Ga0496108_0039896 | Ga0496108_0039896_29_1057 | 342 |
| 1197 | 3300048911 | Ga0496108_0066552 | Ga0496108_0066552_666_1694 | 342 |
| 1198 | 3300048911 | Ga0496108_0207359 | Ga0496108_0207359_621_1649 | 342 |
| 1199 | 3300048912 | Ga0496109_0000643 | Ga0496109_0000643_4823_5851 | 342 |
| 1200 | 3300048912 | Ga0496109_0000878 | Ga0496109_0000878_18541_19569 | 342 |
| 1201 | 3300048912 | Ga0496109_0001869 | Ga0496109_0001869_3815_4843 | 342 |
| 1202 | 3300048912 | Ga0496109_0075469 | Ga0496109_0075469_1643_2671 | 342 |
| 1203 | 3300048912 | Ga0496109_0145889 | Ga0496109_0145889_863_1942 | 342 |
| 1204 | 3300048912 | Ga0496109_0216609 | Ga0496109_0216609_555_1583 | 342 |
| 1205 | 3300048912 | Ga0496109_0267131 | Ga0496109_0267131_402_1430 | 342 |
| 1206 | 3300048913 | Ga0496110_0001735 | Ga0496110_0001735_14888_15916 | 342 |
| 1207 | 3300048913 | Ga0496110_0003655 | Ga0496110_0003655_133_1161 | 342 |
| 1208 | 3300048913 | Ga0496110_0015850 | Ga0496110_0015850_4965_5993 | 342 |
| 1209 | 3300048913 | Ga0496110_0023944 | Ga0496110_0023944_57_1136 | 342 |
| 1210 | 3300048913 | Ga0496110_0024335 | Ga0496110_0024335_1394_2422 | 342 |
| 1211 | 3300048913 | Ga0496110_0044621 | Ga0496110_0044621_2701_3729 | 342 |
| 1212 | 3300048913 | Ga0496110_0105229 | Ga0496110_0105229_527_1555 | 342 |
| 1213 | 3300048914 | Ga0496111_0000913 | Ga0496111_0000913_3850_4878 | 342 |
| 1214 | 3300048914 | Ga0496111_0019396 | Ga0496111_0019396_3445_4473 | 342 |
| 1215 | 3300048914 | Ga0496111_0029686 | Ga0496111_0029686_2750_3778 | 342 |
| 1216 | 3300048914 | Ga0496111_0059309 | Ga0496111_0059309_1624_2652 | 342 |
| 1217 | 3300048914 | Ga0496111_0072095 | Ga0496111_0072095_1094_2122 | 342 |
| 1218 | 3300048914 | Ga0496111_0094951 | Ga0496111_0094951_414_1442 | 342 |
| 1219 | 3300048915 | Ga0496112_0000037 | Ga0496112_0000037_9988_11016 | 342 |
| 1220 | 3300048915 | Ga0496112_0001774 | Ga0496112_0001774_13139_14167 | 342 |
| 1221 | 3300048915 | Ga0496112_0002522 | Ga0496112_0002522_4819_5847 | 342 |
| 1222 | 3300048915 | Ga0496112_0013688 | Ga0496112_0013688_5955_6983 | 342 |
| 1223 | 3300048915 | Ga0496112_0050148 | Ga0496112_0050148_34_1062 | 342 |
| 1224 | 3300048915 | Ga0496112_0058286 | Ga0496112_0058286_787_1815 | 342 |
| 1225 | 3300048915 | Ga0496112_0063987 | Ga0496112_0063987_2207_3235 | 342 |
| 1226 | 3300048915 | Ga0496112_0208879 | Ga0496112_0208879_656_1687 | 342 |
| 1227 | 3300048916 | Ga0496113_0003788 | Ga0496113_0003788_6151_7179 | 342 |
| 1228 | 3300048916 | Ga0496113_0048029 | Ga0496113_0048029_978_2006 | 342 |
| 1229 | 3300048916 | Ga0496113_0072488 | Ga0496113_0072488_1039_2067 | 342 |
| 1230 | 3300048916 | Ga0496113_0078147 | Ga0496113_0078147_1042_2070 | 342 |
| 1231 | 3300048916 | Ga0496113_0172447 | Ga0496113_0172447_306_1334 | 342 |
| 1232 | 3300048917 | Ga0496114_0003687 | Ga0496114_0003687_10657_11685 | 342 |
| 1233 | 3300048917 | Ga0496114_0076711 | Ga0496114_0076711_317_1396 | 342 |
| 1234 | 3300048917 | Ga0496114_0152026 | Ga0496114_0152026_731_1759 | 342 |
| 1235 | 3300048918 | Ga0496115_0008406 | Ga0496115_0008406_5331_6359 | 342 |
| 1236 | 3300048918 | Ga0496115_0041731 | Ga0496115_0041731_620_1648 | 342 |
| 1237 | 3300048918 | Ga0496115_0128087 | Ga0496115_0128087_59_1087 | 342 |
| 1238 | 3300048920 | Ga0496117_0030307 | Ga0496117_0030307_1507_2535 | 342 |
| 1239 | 3300048920 | Ga0496117_0031929 | Ga0496117_0031929_2577_3605 | 342 |
| 1240 | 3300048920 | Ga0496117_0052997 | Ga0496117_0052997_1399_2433 | 342 |
| 1241 | 3300048921 | Ga0496118_0020940 | Ga0496118_0020940_4457_5485 | 342 |
| 1242 | 3300048921 | Ga0496118_0099337 | Ga0496118_0099337_735_1769 | 342 |
| 1243 | 3300048921 | Ga0496118_0104805 | Ga0496118_0104805_854_1882 | 342 |
| 1244 | 3300048921 | Ga0496118_0160591 | Ga0496118_0160591_40_1068 | 342 |
| 1245 | 3300048922 | Ga0496119_0000934 | Ga0496119_0000934_30129_31157 | 342 |
| 1246 | 3300048922 | Ga0496119_0057082 | Ga0496119_0057082_1322_2350 | 342 |
| 1247 | 3300048923 | Ga0496120_0007334 | Ga0496120_0007334_4122_5150 | 342 |
| 1248 | 3300048924 | Ga0496121_0001566 | Ga0496121_0001566_12207_13241 | 342 |
| 1249 | 3300048924 | Ga0496121_0015424 | Ga0496121_0015424_1245_2273 | 342 |
| 1250 | 3300048924 | Ga0496121_0021364 | Ga0496121_0021364_2962_3990 | 342 |
| 1251 | 3300048924 | Ga0496121_0033449 | Ga0496121_0033449_3379_4407 | 342 |
| 1252 | 3300048924 | Ga0496121_0054203 | Ga0496121_0054203_1973_3001 | 342 |
| 1253 | 3300048924 | Ga0496121_0077245 | Ga0496121_0077245_888_1916 | 342 |
| 1254 | 3300048925 | Ga0496122_0028857 | Ga0496122_0028857_1348_2376 | 342 |
| 1255 | 3300048925 | Ga0496122_0165108 | Ga0496122_0165108_17_1045 | 342 |
| 1256 | 3300048926 | Ga0496123_0011686 | Ga0496123_0011686_4555_5583 | 342 |
| 1257 | 3300048927 | Ga0496124_0039476 | Ga0496124_0039476_1560_2594 | 342 |
| 1258 | 3300048927 | Ga0496124_0088542 | Ga0496124_0088542_902_1930 | 342 |
| 1259 | 3300048927 | Ga0496124_0278801 | Ga0496124_0278801_68_1096 | 342 |
| 1260 | 3300048928 | Ga0496125_0228827 | Ga0496125_0228827_57_1085 | 342 |
| 1261 | 3300048928 | Ga0496125_0255429 | Ga0496125_0255429_59_1087 | 342 |
| 1262 | 3300048929 | Ga0496126_0002888 | Ga0496126_0002888_12360_13388 | 342 |
| 1263 | 3300048929 | Ga0496126_0006284 | Ga0496126_0006284_4313_5341 | 342 |
| 1264 | 3300048929 | Ga0496126_0011492 | Ga0496126_0011492_6629_7663 | 342 |
| 1265 | 3300048929 | Ga0496126_0015066 | Ga0496126_0015066_3599_4627 | 342 |
| 1266 | 3300048929 | Ga0496126_0019797 | Ga0496126_0019797_5316_6344 | 342 |
| 1267 | 3300049568 | Ga0501031_0051468 | Ga0501031_0051468_1482_2510 | 342 |
| 1268 | 3300049569 | Ga0501032_0000055 | Ga0501032_0000055_41195_42223 | 342 |
| 1269 | 3300049569 | Ga0501032_0223014 | Ga0501032_0223014_29_1057 | 342 |
| 1270 | 3300049570 | Ga0501033_0001478 | Ga0501033_0001478_16944_17972 | 342 |
| 1271 | 3300049571 | Ga0501034_0001317 | Ga0501034_0001317_1665_2693 | 342 |
| 1272 | 3300049571 | Ga0501034_0521317 | Ga0501034_0521317_31_1059 | 342 |
| 1273 | 3300049572 | Ga0501036_0000021 | Ga0501036_0000021_71875_72903 | 342 |
| 1274 | 3300049572 | Ga0501036_0005983 | Ga0501036_0005983_8403_9431 | 342 |
| 1275 | 3300049572 | Ga0501036_0134104 | Ga0501036_0134104_389_1417 | 342 |
| 1276 | 3300049573 | Ga0501037_0001418 | Ga0501037_0001418_3085_4113 | 342 |
| 1277 | 3300049574 | Ga0501038_0000070 | Ga0501038_0000070_40774_41802 | 342 |
| 1278 | 3300049574 | Ga0501038_0088596 | Ga0501038_0088596_1405_2433 | 342 |
| 1279 | 3300049574 | Ga0501038_0221071 | Ga0501038_0221071_408_1436 | 342 |
| 1280 | 3300049575 | Ga0501039_0001437 | Ga0501039_0001437_16308_17336 | 342 |
| 1281 | 3300049575 | Ga0501039_0225438 | Ga0501039_0225438_37_1065 | 342 |
| 1282 | 3300049578 | Ga0501042_0209952 | Ga0501042_0209952_125_1153 | 342 |
| 1283 | 3300049579 | Ga0501043_0000078 | Ga0501043_0000078_68651_69679 | 342 |
| 1284 | 3300049579 | Ga0501043_0024823 | Ga0501043_0024823_2741_3769 | 342 |
| 1285 | 3300049580 | Ga0501046_0000627 | Ga0501046_0000627_3697_4725 | 342 |
| 1286 | 3300049580 | Ga0501046_0015839 | Ga0501046_0015839_1126_2154 | 342 |
| 1287 | 3300049580 | Ga0501046_0048649 | Ga0501046_0048649_1685_2713 | 342 |
| 1288 | 3300049580 | Ga0501046_0154282 | Ga0501046_0154282_184_1212 | 342 |
| 1289 | 3300049581 | Ga0501047_0000810 | Ga0501047_0000810_5478_6506 | 342 |
| 1290 | 3300049581 | Ga0501047_0054389 | Ga0501047_0054389_52_1080 | 342 |
| 1291 | 3300049581 | Ga0501047_0054608 | Ga0501047_0054608_1901_2929 | 342 |
| 1292 | 3300049581 | Ga0501047_0087151 | Ga0501047_0087151_549_1577 | 342 |
| 1293 | 3300049581 | Ga0501047_0188580 | Ga0501047_0188580_418_1446 | 342 |
| 1294 | 3300049582 | Ga0501048_0001060 | Ga0501048_0001060_946_1974 | 342 |
| 1295 | 3300049583 | Ga0501067_0000177 | Ga0501067_0000177_30400_31428 | 342 |
| 1296 | 3300049585 | Ga0501069_0096433 | Ga0501069_0096433_103_1131 | 342 |
| 1297 | 3300049585 | Ga0501069_0124527 | Ga0501069_0124527_48_1076 | 342 |
| 1298 | 3300049586 | Ga0501070_0001227 | Ga0501070_0001227_10701_11729 | 342 |
| 1299 | 3300049588 | Ga0501072_0004769 | Ga0501072_0004769_881_1909 | 342 |
| 1300 | 3300049589 | Ga0501073_0000039 | Ga0501073_0000039_71694_72722 | 342 |
| 1301 | 3300049590 | Ga0501074_0000019 | Ga0501074_0000019_44366_45394 | 342 |
| 1302 | 3300049590 | Ga0501074_0028878 | Ga0501074_0028878_2705_3733 | 342 |
| 1303 | 3300049592 | Ga0501076_0036948 | Ga0501076_0036948_2121_3149 | 342 |
| 1304 | 3300049592 | Ga0501076_0092578 | Ga0501076_0092578_695_1723 | 342 |
| 1305 | 3300049741 | Ga0501079_0060118 | Ga0501079_0060118_902_1930 | 342 |
| 1306 | 3300049742 | Ga0501080_0000827 | Ga0501080_0000827_22050_23078 | 342 |
| 1307 | 3300049742 | Ga0501080_0006935 | Ga0501080_0006935_78_1106 | 342 |
| 1308 | 3300049742 | Ga0501080_0214338 | Ga0501080_0214338_506_1534 | 342 |
| 1309 | 3300049744 | Ga0501083_0000242 | Ga0501083_0000242_1101_2129 | 342 |
| 1310 | 3300049744 | Ga0501083_0087287 | Ga0501083_0087287_995_2023 | 342 |
| 1311 | 3300049822 | Ga0501035_0001565 | Ga0501035_0001565_10677_11705 | 342 |
| 1312 | 3300049822 | Ga0501035_0024129 | Ga0501035_0024129_3382_4410 | 342 |
| 1313 | 3300049822 | Ga0501035_0149840 | Ga0501035_0149840_333_1361 | 342 |
| 1314 | 3300049822 | Ga0501035_0151616 | Ga0501035_0151616_907_1935 | 342 |
| 1315 | 3300049822 | Ga0501035_0374161 | Ga0501035_0374161_103_1131 | 342 |
| 1316 | 3300049823 | Ga0501044_0000179 | Ga0501044_0000179_18103_19131 | 342 |
| 1317 | 3300049823 | Ga0501044_0014456 | Ga0501044_0014456_7246_8274 | 342 |
| 1318 | 3300049823 | Ga0501044_0029341 | Ga0501044_0029341_1275_2303 | 342 |
| 1319 | 3300049823 | Ga0501044_0175310 | Ga0501044_0175310_259_1287 | 342 |
| 1320 | 3300049823 | Ga0501044_0532181 | Ga0501044_0532181_20_1048 | 342 |
| 1321 | 3300049824 | Ga0501045_0003829 | Ga0501045_0003829_1000_2028 | 342 |
| 1322 | 3300050489 | nmdc:mga03683_18496_c1 | nmdc:mga03683_18496_c1_622_1650 | 342 |
| 1323 | 3300050489 | nmdc:mga03683_37033_c1 | nmdc:mga03683_37033_c1_889_1917 | 342 |
| 1324 | 3300050490 | nmdc:mga03n38_3593_c1 | nmdc:mga03n38_3593_c1_1980_3011 | 342 |
| 1325 | 3300050490 | nmdc:mga03n38_6145_c1 | nmdc:mga03n38_6145_c1_671_1699 | 342 |
| 1326 | 3300050490 | nmdc:mga03n38_6519_c1 | nmdc:mga03n38_6519_c1_2681_3709 | 342 |
| 1327 | 3300050491 | nmdc:mga00v17_14203_c1 | nmdc:mga00v17_14203_c1_1222_2253 | 342 |
| 1328 | 3300050491 | nmdc:mga00v17_67617_c1 | nmdc:mga00v17_67617_c1_53_1081 | 342 |
| 1329 | 3300050491 | nmdc:mga00v17_74501_c1 | nmdc:mga00v17_74501_c1_691_1719 | 342 |
| 1330 | 3300050491 | nmdc:mga00v17_84926_c1 | nmdc:mga00v17_84926_c1_700_1728 | 342 |
| 1331 | 3300050492 | nmdc:mga0yw44_103732_c1 | nmdc:mga0yw44_103732_c1_301_1329 | 342 |
| 1332 | 3300050492 | nmdc:mga0yw44_20795_c1 | nmdc:mga0yw44_20795_c1_1044_2072 | 342 |
| 1333 | 3300050492 | nmdc:mga0yw44_44695_c1 | nmdc:mga0yw44_44695_c1_947_1975 | 342 |
| 1334 | 3300050492 | nmdc:mga0yw44_46962_c1 | nmdc:mga0yw44_46962_c1_792_1820 | 342 |
| 1335 | 3300050492 | nmdc:mga0yw44_79520_c1 | nmdc:mga0yw44_79520_c1_670_1698 | 342 |
| 1336 | 3300050492 | nmdc:mga0yw44_82070_c1 | nmdc:mga0yw44_82070_c1_564_1595 | 342 |
| 1337 | 3300050493 | nmdc:mga0k408_4051_c1 | nmdc:mga0k408_4051_c1_3743_4774 | 342 |
| 1338 | 3300050493 | nmdc:mga0k408_46879_c1 | nmdc:mga0k408_46879_c1_358_1386 | 342 |
| 1339 | 3300050493 | nmdc:mga0k408_70815_c1 | nmdc:mga0k408_70815_c1_514_1542 | 342 |
| 1340 | 3300050494 | nmdc:mga06z11_120663_c1 | nmdc:mga06z11_120663_c1_58_1089 | 342 |
| 1341 | 3300050494 | nmdc:mga06z11_208593_c1 | nmdc:mga06z11_208593_c1_51_1079 | 342 |
| 1342 | 3300050494 | nmdc:mga06z11_70089_c1 | nmdc:mga06z11_70089_c1_60_1088 | 342 |
| 1343 | 3300050495 | nmdc:mga04h51_24192_c1 | nmdc:mga04h51_24192_c1_211_1239 | 342 |
| 1344 | 3300050495 | nmdc:mga04h51_7894_c1 | nmdc:mga04h51_7894_c1_1319_2350 | 342 |
| 1345 | 3300050496 | nmdc:mga07m45_29552_c1 | nmdc:mga07m45_29552_c1_1947_2975 | 342 |
| 1346 | 3300050496 | nmdc:mga07m45_3594_c1 | nmdc:mga07m45_3594_c1_1979_3007 | 342 |
| 1347 | 3300050496 | nmdc:mga07m45_4538_c1 | nmdc:mga07m45_4538_c1_3553_4584 | 342 |
| 1348 | 3300050507 | nmdc:mga05p37_1334_c1 | nmdc:mga05p37_1334_c1_9711_10739 | 342 |
| 1349 | 3300050507 | nmdc:mga05p37_5239_c2 | nmdc:mga05p37_5239_c2_218_1246 | 342 |
| 1350 | 3300050508 | nmdc:mga09592_10920_c1 | nmdc:mga09592_10920_c1_513_1541 | 342 |
| 1351 | 3300050509 | nmdc:mga0qj67_60_c1 | nmdc:mga0qj67_60_c1_1277_2308 | 342 |
| 1352 | 3300050509 | nmdc:mga0qj67_7222_c1 | nmdc:mga0qj67_7222_c1_1988_3016 | 342 |
| 1353 | 3300050510 | nmdc:mga06r32_872_c1 | nmdc:mga06r32_872_c1_20364_21392 | 342 |
| 1354 | 3300050511 | nmdc:mga08y16_193845_c1 | nmdc:mga08y16_193845_c1_16_1044 | 342 |
| 1355 | 3300050511 | nmdc:mga08y16_201752_c1 | nmdc:mga08y16_201752_c1_608_1636 | 342 |
| 1356 | 3300050511 | nmdc:mga08y16_9141_c1 | nmdc:mga08y16_9141_c1_7506_8534 | 342 |
| 1357 | 3300050512 | nmdc:mga0n895_159639_c1 | nmdc:mga0n895_159639_c1_38_1066 | 342 |
| 1358 | 3300050512 | nmdc:mga0n895_21125_c1 | nmdc:mga0n895_21125_c1_3948_4976 | 342 |
| 1359 | 3300050515 | nmdc:mga0a205_85283_c1 | nmdc:mga0a205_85283_c1_943_1971 | 342 |
| 1360 | 3300050516 | nmdc:mga0sz30_13927_c1 | nmdc:mga0sz30_13927_c1_573_1601 | 342 |
| 1361 | 3300050516 | nmdc:mga0sz30_19236_c1 | nmdc:mga0sz30_19236_c1_986_2014 | 342 |
| 1362 | 3300050516 | nmdc:mga0sz30_24187_c1 | nmdc:mga0sz30_24187_c1_500_1528 | 342 |
| 1363 | 3300050516 | nmdc:mga0sz30_56386_c1 | nmdc:mga0sz30_56386_c1_608_1636 | 342 |
| 1364 | 3300053077 | Ga0495601_0005803 | Ga0495601_0005803_440_1468 | 342 |
| 1365 | 3300053077 | Ga0495601_0011057 | Ga0495601_0011057_217_1245 | 342 |
| 1366 | 3300053077 | Ga0495601_0049193 | Ga0495601_0049193_846_1874 | 342 |
| 1367 | 3300053077 | Ga0495601_0080475 | Ga0495601_0080475_321_1349 | 342 |
| 1368 | 3300053077 | Ga0495601_0140465 | Ga0495601_0140465_354_1433 | 342 |
| 1369 | 3300053077 | Ga0495601_0169888 | Ga0495601_0169888_315_1343 | 342 |
| 1370 | 3300053078 | Ga0495612_0007050 | Ga0495612_0007050_2453_3481 | 342 |
| 1371 | 3300053078 | Ga0495612_0016525 | Ga0495612_0016525_779_1807 | 342 |
| 1372 | 3300053078 | Ga0495612_0053459 | Ga0495612_0053459_281_1360 | 342 |
| 1373 | 3300053078 | Ga0495612_0055746 | Ga0495612_0055746_509_1537 | 342 |
| 1374 | 3300053079 | Ga0500610_0070254 | Ga0500610_0070254_186_1214 | 342 |
| 1375 | 3300053080 | Ga0500635_0002704 | Ga0500635_0002704_348_1376 | 342 |
| 1376 | 3300053083 | Ga0495655_0012562 | Ga0495655_0012562_34_1062 | 342 |
| 1377 | 3300053083 | Ga0495655_0037016 | Ga0495655_0037016_80_1108 | 342 |
| 1378 | 3300053084 | Ga0495595_0001332 | Ga0495595_0001332_7630_8658 | 342 |
| 1379 | 3300053084 | Ga0495595_0063076 | Ga0495595_0063076_442_1470 | 342 |
| 1380 | 3300053085 | Ga0495619_0001258 | Ga0495619_0001258_2165_3193 | 342 |
| 1381 | 3300053085 | Ga0495619_0028778 | Ga0495619_0028778_1516_2544 | 342 |
| 1382 | 3300053085 | Ga0495619_0050904 | Ga0495619_0050904_523_1551 | 342 |
| 1383 | 3300053085 | Ga0495619_0058284 | Ga0495619_0058284_990_2018 | 342 |
| 1384 | 3300053085 | Ga0495619_0059483 | Ga0495619_0059483_1145_2173 | 342 |
| 1385 | 3300053085 | Ga0495619_0178144 | Ga0495619_0178144_395_1423 | 342 |
| 1386 | 3300053085 | Ga0495619_0295338 | Ga0495619_0295338_32_1060 | 342 |
| 1387 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_238651_239679 | 342 |
| 1388 | 3300053091 | Ga0500647_0009841 | Ga0500647_0009841_924_1952 | 342 |
| 1389 | 3300053094 | Ga0500566_0021751 | Ga0500566_0021751_2518_3546 | 342 |
| 1390 | 3300053096 | Ga0500641_0006994 | Ga0500641_0006994_916_1944 | 342 |
| 1391 | 3300053096 | Ga0500641_0116311 | Ga0500641_0116311_47_1075 | 342 |
| 1392 | 3300053103 | Ga0500555_005931 | Ga0500555_005931_188_1216 | 342 |
| 1393 | 3300053104 | Ga0500556_0025840 | Ga0500556_0025840_847_1875 | 342 |
| 1394 | 3300053105 | Ga0500557_000030 | Ga0500557_000030_75199_76227 | 342 |
| 1395 | 3300053109 | Ga0500569_016936 | Ga0500569_016936_464_1492 | 342 |
| 1396 | 3300053118 | Ga0500594_0015471 | Ga0500594_0015471_204_1232 | 342 |
| 1397 | 3300053119 | Ga0500595_002714 | Ga0500595_002714_2536_3564 | 342 |
| 1398 | 3300053128 | Ga0500626_079396 | Ga0500626_079396_145_1173 | 342 |
| 1399 | 3300053130 | Ga0500642_0000148 | Ga0500642_0000148_10033_11061 | 342 |
| 1400 | 3300053130 | Ga0500642_0032629 | Ga0500642_0032629_147_1175 | 342 |
| 1401 | 3300053131 | Ga0500652_036114 | Ga0500652_036114_12_1040 | 342 |
| 1402 | 3300053133 | Ga0500655_008285 | Ga0500655_008285_457_1485 | 342 |
| 1403 | 3300053139 | Ga0500568_0001375 | Ga0500568_0001375_1391_2419 | 342 |
| 1404 | 3300053142 | Ga0500577_0029299 | Ga0500577_0029299_633_1661 | 342 |
| 1405 | 3300053146 | Ga0500588_0020728 | Ga0500588_0020728_15_1043 | 342 |
| 1406 | 3300053151 | Ga0500604_0000076 | Ga0500604_0000076_2117_3145 | 342 |
| 1407 | 3300053153 | Ga0500616_0125787 | Ga0500616_0125787_121_1149 | 342 |
| 1408 | 3300053155 | Ga0500620_004246 | Ga0500620_004246_579_1607 | 342 |
| 1409 | 3300053177 | Ga0500636_0002634 | Ga0500636_0002634_515_1543 | 342 |
| 1410 | 3300053178 | Ga0500637_0208125 | Ga0500637_0208125_13_1041 | 342 |
| 1411 | 3300053727 | Ga0500611_021128 | Ga0500611_021128_147_1175 | 342 |
| 1412 | 3300053730 | Ga0500645_038077 | Ga0500645_038077_339_1367 | 342 |
| 1413 | 3300053733 | Ga0500552_006385 | Ga0500552_006385_219_1247 | 342 |
| 1414 | 3300053737 | Ga0500601_000287 | Ga0500601_000287_8423_9451 | 342 |
| 1415 | 3300054114 | Ga0501084_0045564 | Ga0501084_0045564_1673_2701 | 342 |
| 1416 | 3300054114 | Ga0501084_0432468 | Ga0501084_0432468_23_1051 | 342 |
| 1417 | 3300060353 | Ga0501082_0434332 | Ga0501082_0434332_107_1135 | 342 |
| 1418 | 3300061719 | Ga0466962_0047456 | Ga0466962_0047456_892_1920 | 342 |
| 1419 | 3300061734 | Ga0530510_0150803 | Ga0530510_0150803_353_1381 | 342 |
| 1420 | iso_pu_bacteria | 2513237096 | 2513661048 | 342 |
| 1421 | iso_pu_bacteria | 2513237137 | 2513860567 | 342 |
| 1422 | iso_pu_bacteria | 2513237145 | 2513918974 | 342 |
| 1423 | iso_pu_bacteria | 2517572143 | 2517888296 | 342 |
| 1424 | iso_pu_bacteria | 2879083081 | 2879090204 | 342 |
| 1425 | iso_pu_bacteria | 2903768456 | 2903771564 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sna-assembly5.cif.gz_J | crystal structure of antirestriction ardc protein from r388 plasmid. mn(ii)-bound structure. | 0.3949 | 37 | 205 |
| 6sna-assembly5.cif.gz_J | crystal structure of antirestriction ardc protein from r388 plasmid. mn(ii)-bound structure. | 0.2411 | 37 | 205 |
| 1pww-assembly3.cif.gz_A | crystal structure of anthrax lethal factor active site mutant protein complexed with an optimised peptide substrate in the presence of zinc. | 0.2069 | 28 | 323 |
| 7yml-assembly1.cif.gz_M | structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus | 0.1951 | 102 | 335 |
| 6sgb-assembly1.cif.gz_F6 | mt-ssu assemblosome of trypanosoma brucei | 0.1897 | 10 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGG7_72_176_1.10.1740.10 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.6023 | 268 | 340 | 1.10.1740.10 |
| af_P9WGG7_72_176_1.10.1740.10 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.4553 | 268 | 340 | 1.10.1740.10 |
| af_Q4E5S1_377_622_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.2823 | 35 | 236 | 1.10.390.10 |
| af_O16790_409_708_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.2582 | 58 | 246 | 3.40.390.10 |
| af_Q2KHK3_314_553_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.2327 | 11 | 325 | 1.10.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354BNE7-F1-model_v4 | Zinc-dependent peptidase | 0.9679 | 3 | 117 |
|
| AF-A0A2V6JK84-F1-model_v4 | Uncharacterized protein | 0.9521 | 3 | 110 |
GO:0016020
|
| AF-A0A2V8I468-F1-model_v4 | GNAT family N-acetyltransferase | 0.9436 | 17 | 88 |
|
| AF-A0A7V5UKS1-F1-model_v4 | Uncharacterized protein | 0.9384 | 1 | 100 |
|
| AF-A0A2V6JK84-F1-model_v4 | Uncharacterized protein | 0.9353 | 3 | 110 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar