F493867

General Info

Members Datasets Scaffolds Average Seq Length
1425 621 1263 342

Family's Representative Sequence

Representative Sequence 3300033442|Ga0315911_1000021|Ga0315911_100002115
Length 404
Sequence MSVASSRRIGPGALPAAQGGHSGRVRPDAGIGRGPGAKARRLLPAATYDTIQSPICFRLWKPMPRRKFDWEKLTDEQLLAQPLSRLRVAVEGTWLADCVNTLYEELEERGVRLRPHTWISSEWFSPADVPGIAIPFYLAHPRLMKLEKKMMLDVEGASWSECMAILRHEAGHAVQHGYQLQRRRRWQQLFGPSSQHYPRYYRPNPASRNYVQHLRLWYAQSHPDEDFAETFAVWLRPRSNWRTRYAGWPALKKLEYVDELMGEIAGKRPLLATRERVDPLHTLKQTLAEHYRKKQAFYAFTPPKTYDRDLSKLFSADPRHYRRPPAAAFIRRHRAQIRQLVARWTGENQLTLDAVLDDMISRCRELNLRAVGPEQKLVTNFTILLTAKTMHALFGPSRRKWIAL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
24 2791355199
25 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
26 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
27 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
28 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
29 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
32 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
33 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
34 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
35 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
36 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
37 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
38 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
39 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
40 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
41 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
42 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
43 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
44 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
45 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
46 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
47 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
48 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
49 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
50 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
51 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
52 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
53 2904699407
54 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
55 2906610324
56 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
57 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
58 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
59 2922368715
60 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
61 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
62 2922425934
63 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
64 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
65 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
66 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
67 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
68 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
69 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
70 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
71 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
72 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
73 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
74 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
75 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
76 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
77 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
78 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
79 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
80 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
81 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
82 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
83 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
84 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
85 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
86 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
87 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
88 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
89 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
90 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
91 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
92 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
93 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
94 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
95 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
96 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
97 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
98 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
99 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
100 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
101 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
102 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
103 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
104 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
105 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
106 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
107 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
108 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
109 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
110 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
111 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
112 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
113 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
114 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
115 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
116 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
117 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
118 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
119 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
120 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
121 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
122 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
123 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
124 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
125 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
126 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
127 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
128 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
129 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
130 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
131 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
132 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
133 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
135 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
136 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
137 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
138 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
139 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
140 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
141 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
142 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
143 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
144 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
145 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
146 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
147 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
148 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
149 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
150 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
151 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
152 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
156 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
157 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
158 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
159 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
160 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
161 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
162 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
163 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
164 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
165 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
166 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
167 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
168 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
169 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
174 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
175 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
176 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
177 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
180 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
181 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
182 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
183 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
184 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
185 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
186 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
187 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
188 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
189 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
190 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
191 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
192 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
193 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
194 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
195 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
196 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
197 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
198 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
199 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
200 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
201 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
202 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
203 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
205 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
206 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
207 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
208 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
209 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
210 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
211 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
212 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
213 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
214 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
215 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
216 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
217 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
218 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
219 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
220 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
221 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
222 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
223 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
224 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
225 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
227 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
228 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
229 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
230 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
231 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
234 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
235 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
236 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
239 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
240 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
241 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
242 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
243 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
244 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
245 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
246 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
247 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
248 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
251 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
252 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
253 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
254 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
255 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
256 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
257 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
258 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
259 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
260 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
263 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
267 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
268 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
331 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
333 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
334 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
336 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
337 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
342 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
343 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
344 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
345 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
346 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
349 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
350 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
351 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
352 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
353 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
354 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
355 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
356 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
357 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
358 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
359 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
360 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
361 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
362 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
363 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
364 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
365 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
366 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
367 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
369 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
370 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
371 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
372 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
373 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
374 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
375 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
376 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
377 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
378 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
379 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
382 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
383 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
384 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
385 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
386 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
387 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
388 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
389 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
390 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
391 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
392 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
393 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
396 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
397 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
406 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
407 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
408 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
409 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
410 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
413 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
414 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
415 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
416 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
417 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
418 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
419 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
420 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
421 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
422 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
423 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
424 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
425 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
426 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
427 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
428 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
429 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
430 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
431 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
432 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
435 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
436 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
437 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
438 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
439 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
440 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
441 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
445 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
446 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
447 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
448 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
449 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
450 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
451 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
452 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
453 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
454 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
455 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
456 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
457 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
458 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
459 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
460 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
461 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
462 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
463 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
464 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
465 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
466 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
467 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
468 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
469 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
470 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
471 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
472 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
473 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
474 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
475 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
476 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
477 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
478 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
479 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
480 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
481 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
482 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
483 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
484 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
485 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
486 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
487 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
493 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
494 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
495 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
496 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
497 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
498 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
499 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
500 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
501 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
502 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
503 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
518 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
519 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
520 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
521 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
522 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
523 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
524 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
525 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
526 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
527 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
528 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
529 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
532 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
533 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
534 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
535 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
536 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
537 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
538 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
539 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
540 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
541 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
542 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
543 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
544 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
545 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
546 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
547 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
548 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
549 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
550 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
551 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
552 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
553 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
554 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
555 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
556 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
557 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
558 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
559 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
560 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
561 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
562 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
563 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
564 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
565 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
566 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
567 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
568 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
569 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
570 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
571 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
572 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
573 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
574 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
575 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
576 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
577 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
578 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
579 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
580 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
581 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
582 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
583 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
584 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
585 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
586 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
587 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
588 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
589 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
590 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
591 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
592 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
593 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
594 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
595 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
596 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
597 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
598 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
599 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
600 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
601 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
602 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
603 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
604 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
605 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
606 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
607 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
608 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
609 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
610 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
611 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
612 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
613 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
614 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
615 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
616 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
617 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
618 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
619 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
620 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
621 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.94
Metatranscriptomes 0
Isolates 11.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 10.04
Rhizoplane 6.74
Rhizosphere 70.18
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10019573 3300001990 Bacteria 2164
2 JGI24743J22301_10011395 3300001991 Bacteria 1601
3 JGI24750J21931_1007354 3300002070 Bacteria 1386
4 JGI24738J21930_10019661 3300002075 Bacteria 1407
5 JGI24744J21845_10006724 3300002077 Bacteria 2379
6 JGI25406J46586_10000068 3300003203 Bacteria 47530
7 JGI25153J46596_10005581 3300003215 Bacteria 6577
8 Ga0055542_1005310 3300003762 Bacteria 2935
9 Ga0065165_1001267 3300005262 Bacteria 28574
10 Ga0065165_1002212 3300005262 Bacteria 17380
11 Ga0065712_10084473 3300005290 Bacteria 2760
12 Ga0070658_10185375 3300005327 Bacteria 1752
13 Ga0070676_10008503 3300005328 Bacteria 5533
14 Ga0070676_10162852 3300005328 Bacteria 1437
15 Ga0070683_100008412 3300005329 Bacteria 8761
16 Ga0070683_100031382 3300005329 Unclassified 4830
17 Ga0070683_100100301 3300005329 Bacteria 2726
18 Ga0070683_100127712 3300005329 Bacteria 2404
19 Ga0070690_100017752 3300005330 Bacteria 4287
20 Ga0070690_100069739 3300005330 Bacteria 2282
21 Ga0070670_100002030 3300005331 Bacteria 16570
22 Ga0070670_100067088 3300005331 Bacteria 3079
23 Ga0070670_100130805 3300005331 Bacteria 2167
24 Ga0068869_100107594 3300005334 Bacteria 2117
25 Ga0070680_100010166 3300005336 Bacteria 7257
26 Ga0070680_100047355 3300005336 Bacteria 3500
27 Ga0070680_100056430 3300005336 Bacteria 3210
28 Ga0070682_100064243 3300005337 Bacteria 2329
29 Ga0070682_100088855 3300005337 Bacteria 2018
30 Ga0070682_100117730 3300005337 Bacteria 1779
31 Ga0070682_100199070 3300005337 Bacteria 1412
32 Ga0068868_100015981 3300005338 Bacteria 5566
33 Ga0068868_100038297 3300005338 Bacteria 3722
34 Ga0068868_100058595 3300005338 Bacteria 3044
35 Ga0068868_100229815 3300005338 Bacteria 1556
36 Ga0070660_100008984 3300005339 Bacteria 7010
37 Ga0070660_100036860 3300005339 Bacteria 3705
38 Ga0070660_100056660 3300005339 Bacteria 3033
39 Ga0070660_100063926 3300005339 Bacteria 2862
40 Ga0070660_100380136 3300005339 Bacteria 1166
41 Ga0070689_100002079 3300005340 Bacteria 13007
42 Ga0070689_100070947 3300005340 Bacteria 2721
43 Ga0070689_100108664 3300005340 Bacteria 2204
44 Ga0070691_10052213 3300005341 Bacteria 1955
45 Ga0070687_100027140 3300005343 Bacteria 2762
46 Ga0070661_100022921 3300005344 Bacteria 4473
47 Ga0070661_100049192 3300005344 Bacteria 3086
48 Ga0070661_100092167 3300005344 Bacteria 2245
49 Ga0070692_10012291 3300005345 Unclassified 3958
50 Ga0070668_100003473 3300005347 Bacteria 11631
51 Ga0070668_100005028 3300005347 Bacteria 9796
52 Ga0070668_100008936 3300005347 Bacteria 7438
53 Ga0070668_100050729 3300005347 Bacteria 3195
54 Ga0070668_100141361 3300005347 Bacteria 1940
55 Ga0070668_100314952 3300005347 Bacteria 1316
56 Ga0070669_100001136 3300005353 Bacteria 19444
57 Ga0070669_100014984 3300005353 Bacteria 5526
58 Ga0070669_100042153 3300005353 Bacteria 3321
59 Ga0070669_100077593 3300005353 Bacteria 2468
60 Ga0070669_100163424 3300005353 Bacteria 1732
61 Ga0070675_100000365 3300005354 Bacteria 30549
62 Ga0070675_100027181 3300005354 Bacteria 4595
63 Ga0070675_100235237 3300005354 Bacteria 1599
64 Ga0070671_100063210 3300005355 Bacteria 3082
65 Ga0070671_100094583 3300005355 Bacteria 2505
66 Ga0070671_100133082 3300005355 Bacteria 2095
67 Ga0070671_100227527 3300005355 Bacteria 1582
68 Ga0070671_100286405 3300005355 Bacteria 1402
69 Ga0070674_100001469 3300005356 Bacteria 12578
70 Ga0070674_100010211 3300005356 Bacteria 5664
71 Ga0070674_100013870 3300005356 Bacteria 4993
72 Ga0070674_100201057 3300005356 Bacteria 1539
73 Ga0070673_100014104 3300005364 Bacteria 5552
74 Ga0070673_100021133 3300005364 Unclassified 4710
75 Ga0070659_100011386 3300005366 Bacteria 6580
76 Ga0070659_100022782 3300005366 Unclassified 4784
77 Ga0070659_100053883 3300005366 Bacteria 3167
78 Ga0070659_100280344 3300005366 Bacteria 1386
79 Ga0070667_100116021 3300005367 Bacteria 2326
80 Ga0070667_100186583 3300005367 Bacteria 1835
81 Ga0070667_100268332 3300005367 Bacteria 1530
82 Ga0070709_10005439 3300005434 Bacteria 6901
83 Ga0070714_100050305 3300005435 Bacteria 3549
84 Ga0070714_100055629 3300005435 Bacteria 3382
85 Ga0070714_100170156 3300005435 Bacteria 1977
86 Ga0070713_100003900 3300005436 Bacteria 9890
87 Ga0070713_100028893 3300005436 Bacteria 4382
88 Ga0070713_100059482 3300005436 Bacteria 3191
89 Ga0070713_100116509 3300005436 Bacteria 2337
90 Ga0070713_100186122 3300005436 Bacteria 1869
91 Ga0070710_10001798 3300005437 Bacteria 10141
92 Ga0070710_10211345 3300005437 Bacteria 1230
93 Ga0070701_10029808 3300005438 Bacteria 2694
94 Ga0070711_100013041 3300005439 Bacteria 5211
95 Ga0070711_100018744 3300005439 Bacteria 4426
96 Ga0070705_100142388 3300005440 Bacteria 1580
97 Ga0070700_100035554 3300005441 Bacteria 3015
98 Ga0070694_100051836 3300005444 Bacteria 2772
99 Ga0070663_100029554 3300005455 Bacteria 3747
100 Ga0070663_100052831 3300005455 Bacteria 2899
101 Ga0070663_100063228 3300005455 Bacteria 2671
102 Ga0070663_100107121 3300005455 Bacteria 2095
103 Ga0070663_100231776 3300005455 Bacteria 1454
104 Ga0070678_100033164 3300005456 Bacteria 3582
105 Ga0070678_100052389 3300005456 Bacteria 2963
106 Ga0070678_100058201 3300005456 Bacteria 2836
107 Ga0070678_100218123 3300005456 Bacteria 1584
108 Ga0070662_100003276 3300005457 Bacteria 10076
109 Ga0070662_100009040 3300005457 Bacteria 6500
110 Ga0070662_100095431 3300005457 Bacteria 2241
111 Ga0070662_100209673 3300005457 Bacteria 1550
112 Ga0070681_10000803 3300005458 Bacteria 26193
113 Ga0070681_10005772 3300005458 Bacteria 11970
114 Ga0070681_10009474 3300005458 Bacteria 9581
115 Ga0070681_10018371 3300005458 Bacteria 6988
116 Ga0070681_10237166 3300005458 Bacteria 1738
117 Ga0068867_100038385 3300005459 Bacteria 3486
118 Ga0068867_100083365 3300005459 Bacteria 2413
119 Ga0070685_10006952 3300005466 Bacteria 5773
120 Ga0070679_100002259 3300005530 Bacteria 17397
121 Ga0070679_100012689 3300005530 Bacteria 8059
122 Ga0070679_100040035 3300005530 Bacteria 4661
123 Ga0070679_100041099 3300005530 Bacteria 4603
124 Ga0070679_100069283 3300005530 Bacteria 3518
125 Ga0070684_100011823 3300005535 Bacteria 6967
126 Ga0070684_100015025 3300005535 Bacteria 6289
127 Ga0070684_100026088 3300005535 Bacteria 4918
128 Ga0070684_100092323 3300005535 Bacteria 2693
129 Ga0068853_100005704 3300005539 Bacteria 9794
130 Ga0068853_100037040 3300005539 Bacteria 4149
131 Ga0068853_100192111 3300005539 Bacteria 1855
132 Ga0070672_100030675 3300005543 Bacteria 4041
133 Ga0070672_100049384 3300005543 Unclassified 3273
134 Ga0070686_100095878 3300005544 Bacteria 1994
135 Ga0070695_100255654 3300005545 Bacteria 1277
136 Ga0070693_100047826 3300005547 Bacteria 2435
137 Ga0070665_100007164 3300005548 Bacteria 11337
138 Ga0070665_100008973 3300005548 Bacteria 10132
139 Ga0070665_100056210 3300005548 Bacteria 3946
140 Ga0070665_100063248 3300005548 Bacteria 3710
141 Ga0070665_100076145 3300005548 Bacteria 3362
142 Ga0070665_100083982 3300005548 Bacteria 3189
143 Ga0070665_100087729 3300005548 Bacteria 3117
144 Ga0070665_100089898 3300005548 Bacteria 3076
145 Ga0070665_100159456 3300005548 Bacteria 2258
146 Ga0070665_100168286 3300005548 Bacteria 2193
147 Ga0070665_100313465 3300005548 Bacteria 1573
148 Ga0070665_100595571 3300005548 Bacteria 1118
149 Ga0070704_100062298 3300005549 Bacteria 2673
150 Ga0068855_100011649 3300005563 Bacteria 10627
151 Ga0068855_100063155 3300005563 Bacteria 4322
152 Ga0068855_100068502 3300005563 Unclassified 4132
153 Ga0068855_100238162 3300005563 Bacteria 2034
154 Ga0070664_100038829 3300005564 Bacteria 4009
155 Ga0068857_100004346 3300005577 Bacteria 11963
156 Ga0068857_100065042 3300005577 Bacteria 3242
157 Ga0068857_100081157 3300005577 Bacteria 2896
158 Ga0068857_100108215 3300005577 Bacteria 2497
159 Ga0068857_100132753 3300005577 Bacteria 2246
160 Ga0068857_100202136 3300005577 Bacteria 1811
161 Ga0068857_100233711 3300005577 Bacteria 1682
162 Ga0068854_100289362 3300005578 Bacteria 1322
163 Ga0068856_100117640 3300005614 Bacteria 2659
164 Ga0068859_100077580 3300005617 Bacteria 3363
165 Ga0068864_100158708 3300005618 Bacteria 2055
166 Ga0068864_100261910 3300005618 Unclassified 1609
167 Ga0068866_10027847 3300005718 Bacteria 2687
168 Ga0068861_100000284 3300005719 Bacteria 28457
169 Ga0068861_100010236 3300005719 Bacteria 6510
170 Ga0068861_100013725 3300005719 Bacteria 5672
171 Ga0068861_100069713 3300005719 Bacteria 2721
172 Ga0068861_100151221 3300005719 Bacteria 1905
173 Ga0068851_10041856 3300005834 Bacteria 2304
174 Ga0068870_10024962 3300005840 Unclassified 2963
175 Ga0068863_100031099 3300005841 Bacteria 5097
176 Ga0068863_100054261 3300005841 Bacteria 3797
177 Ga0068858_100025802 3300005842 Bacteria 5466
178 Ga0068858_100072777 3300005842 Bacteria 3189
179 Ga0068858_100355599 3300005842 Bacteria 1403
180 Ga0068860_100058958 3300005843 Bacteria 3650
181 Ga0068860_100081538 3300005843 Bacteria 3076
182 Ga0068860_100375190 3300005843 Bacteria 1403
183 Ga0068860_100393008 3300005843 Bacteria 1371
184 Ga0068862_100004978 3300005844 Bacteria 11182
185 Ga0068862_100007523 3300005844 Bacteria 9026
186 Ga0068862_100013165 3300005844 Bacteria 6841
187 Ga0068862_100056023 3300005844 Bacteria 3377
188 Ga0068862_100378005 3300005844 Bacteria 1321
189 Ga0081455_10009408 3300005937 Bacteria 10053
190 Ga0081455_10009980 3300005937 Bacteria 9706
191 Ga0081455_10012824 3300005937 Bacteria 8326
192 Ga0081455_10016677 3300005937 Bacteria 7076
193 Ga0081455_10065066 3300005937 Bacteria 3051
194 Ga0081455_10128565 3300005937 Bacteria 1984
195 Ga0081538_10005709 3300005981 Bacteria 11126
196 Ga0081538_10026886 3300005981 Bacteria 4008
197 Ga0081540_1000183 3300005983 Bacteria 65356
198 Ga0081540_1003056 3300005983 Bacteria 13411
199 Ga0081540_1008688 3300005983 Bacteria 7074
200 Ga0081539_10000321 3300005985 Bacteria 106887
201 Ga0081539_10001182 3300005985 Bacteria 47183
202 Ga0081539_10061942 3300005985 Bacteria 2047
203 Ga0070717_10027462 3300006028 Bacteria 4549
204 Ga0070717_10031115 3300006028 Bacteria 4291
205 Ga0070717_10194695 3300006028 Bacteria 1773
206 Ga0075365_10004659 3300006038 Bacteria 7303
207 Ga0075365_10027773 3300006038 Bacteria 3604
208 Ga0075365_10049112 3300006038 Bacteria 2779
209 Ga0075365_10092380 3300006038 Bacteria 2063
210 Ga0075368_10002227 3300006042 Bacteria 6299
211 Ga0075368_10004796 3300006042 Bacteria 4608
212 Ga0075363_100000166 3300006048 Bacteria 16960
213 Ga0075363_100005847 3300006048 Bacteria 5531
214 Ga0075363_100026460 3300006048 Bacteria 2968
215 Ga0075363_100032687 3300006048 Bacteria 2704
216 Ga0075364_10014523 3300006051 Bacteria 4868
217 Ga0075364_10018041 3300006051 Bacteria 4414
218 Ga0075364_10061957 3300006051 Bacteria 2454
219 Ga0075364_10306447 3300006051 Bacteria 1081
220 Ga0070715_10001747 3300006163 Bacteria 6466
221 Ga0070715_10105233 3300006163 Bacteria 1323
222 Ga0070716_100006717 3300006173 Bacteria 5634
223 Ga0070712_100012868 3300006175 Bacteria 5330
224 Ga0070712_100013408 3300006175 Bacteria 5239
225 Ga0070712_100129971 3300006175 Bacteria 1907
226 Ga0070712_100209200 3300006175 Bacteria 1537
227 Ga0070712_100405114 3300006175 Bacteria 1127
228 Ga0075362_10002371 3300006177 Bacteria 6305
229 Ga0075362_10006411 3300006177 Bacteria 4386
230 Ga0075362_10018509 3300006177 Bacteria 2883
231 Ga0075362_10023654 3300006177 Bacteria 2601
232 Ga0075362_10113389 3300006177 Bacteria 1278
233 Ga0075367_10000604 3300006178 Bacteria 13811
234 Ga0075367_10010376 3300006178 Bacteria 4893
235 Ga0075367_10013424 3300006178 Bacteria 4403
236 Ga0075367_10100784 3300006178 Bacteria 1765
237 Ga0075367_10114927 3300006178 Bacteria 1655
238 Ga0075366_10000580 3300006195 Bacteria 17184
239 Ga0075366_10002268 3300006195 Bacteria 9819
240 Ga0075366_10022553 3300006195 Bacteria 3663
241 Ga0075366_10028218 3300006195 Bacteria 3294
242 Ga0075366_10030929 3300006195 Bacteria 3148
243 Ga0075366_10123396 3300006195 Bacteria 1562
244 Ga0097621_100023425 3300006237 Bacteria 4809
245 Ga0097621_100149457 3300006237 Bacteria 2002
246 Ga0075370_10011797 3300006353 Bacteria 4601
247 Ga0075370_10036607 3300006353 Bacteria 2757
248 Ga0075370_10042391 3300006353 Bacteria 2571
249 Ga0075370_10046819 3300006353 Bacteria 2448
250 Ga0068871_100176216 3300006358 Bacteria 1836
251 Ga0075428_100001227 3300006844 Bacteria 27447
252 Ga0075428_100024804 3300006844 Bacteria 6634
253 Ga0075428_100040276 3300006844 Bacteria 5141
254 Ga0075428_100224006 3300006844 Bacteria 2030
255 Ga0075428_100246218 3300006844 Unclassified 1927
256 Ga0075430_100000015 3300006846 Bacteria 89952
257 Ga0075430_100001819 3300006846 Bacteria 17456
258 Ga0075430_100008228 3300006846 Bacteria 8810
259 Ga0075430_100012216 3300006846 Bacteria 7312
260 Ga0075430_100096955 3300006846 Bacteria 2464
261 Ga0075431_100000169 3300006847 Bacteria 46379
262 Ga0075431_100032668 3300006847 Bacteria 5363
263 Ga0075431_100043586 3300006847 Bacteria 4628
264 Ga0075431_100224885 3300006847 Bacteria 1913
265 Ga0075431_100514629 3300006847 Bacteria 1187
266 Ga0075433_10010808 3300006852 Bacteria 7342
267 Ga0075433_10034944 3300006852 Unclassified 4320
268 Ga0075433_10237533 3300006852 Bacteria 1618
269 Ga0075433_10241602 3300006852 Bacteria 1603
270 Ga0075433_10344231 3300006852 Bacteria 1318
271 Ga0075434_100004164 3300006871 Bacteria 12962
272 Ga0075434_100044403 3300006871 Bacteria 4409
273 Ga0075434_100052054 3300006871 Bacteria 4068
274 Ga0075434_100065245 3300006871 Bacteria 3626
275 Ga0075434_100162467 3300006871 Bacteria 2253
276 Ga0075434_100371631 3300006871 Bacteria 1451
277 Ga0075429_100012855 3300006880 Bacteria 7262
278 Ga0075429_100146323 3300006880 Bacteria 2068
279 Ga0068865_100007637 3300006881 Bacteria 6658
280 Ga0068865_100039365 3300006881 Bacteria 3206
281 Ga0068865_100351172 3300006881 Bacteria 1195
282 Ga0097620_100077578 3300006931 Bacteria 3363
283 Ga0099825_1028576 3300006941 Bacteria 2695
284 Ga0099824_1015348 3300006942 Bacteria 7278
285 Ga0099823_1022490 3300006944 Bacteria 5831
286 Ga0099795_10004625 3300007788 Bacteria 3573
287 Ga0099795_10083585 3300007788 Bacteria 1226
288 Ga0105251_10028427 3300009011 Bacteria 2824
289 Ga0105250_10032821 3300009092 Bacteria 2084
290 Ga0105240_10004107 3300009093 Bacteria 22352
291 Ga0105240_10026526 3300009093 Bacteria 7602
292 Ga0105240_10045477 3300009093 Bacteria 5568
293 Ga0105240_10135542 3300009093 Bacteria 2949
294 Ga0105240_10239306 3300009093 Bacteria 2105
295 Ga0111539_10013148 3300009094 Bacteria 10352
296 Ga0111539_10083128 3300009094 Bacteria 3766
297 Ga0111539_10149736 3300009094 Bacteria 2732
298 Ga0111539_10216621 3300009094 Bacteria 2230
299 Ga0111539_10378641 3300009094 Bacteria 1648
300 Ga0111539_10555105 3300009094 Unclassified 1338
301 Ga0105245_10017466 3300009098 Bacteria 6258
302 Ga0105245_10308143 3300009098 Bacteria 1556
303 Ga0105245_10388370 3300009098 Bacteria 1392
304 Ga0105247_10104863 3300009101 Bacteria 1812
305 Ga0114129_10000539 3300009147 Bacteria 46397
306 Ga0114129_10004331 3300009147 Bacteria 20067
307 Ga0114129_10142212 3300009147 Bacteria 3288
308 Ga0114129_10391778 3300009147 Unclassified 1832
309 Ga0105243_10018265 3300009148 Bacteria 5310
310 Ga0105243_10155513 3300009148 Bacteria 1966
311 Ga0105243_10400426 3300009148 Bacteria 1275
312 Ga0105241_10141983 3300009174 Bacteria 1956
313 Ga0105241_10324383 3300009174 Bacteria 1329
314 Ga0105242_10057384 3300009176 Bacteria 3188
315 Ga0105242_10061315 3300009176 Bacteria 3093
316 Ga0105248_10031690 3300009177 Bacteria 5906
317 Ga0105248_10034403 3300009177 Bacteria 5665
318 Ga0105248_10099062 3300009177 Bacteria 3284
319 Ga0105248_10136802 3300009177 Bacteria 2764
320 Ga0105237_10001334 3300009545 Bacteria 32733
321 Ga0105237_10033636 3300009545 Bacteria 5195
322 Ga0105237_10093492 3300009545 Bacteria 2996
323 Ga0105237_10101046 3300009545 Bacteria 2876
324 Ga0105237_10114249 3300009545 Bacteria 2693
325 Ga0105237_10117998 3300009545 Bacteria 2647
326 Ga0105237_10119001 3300009545 Bacteria 2635
327 Ga0105237_10338413 3300009545 Bacteria 1509
328 Ga0105238_10001553 3300009551 Bacteria 23043
329 Ga0105238_10005684 3300009551 Bacteria 12325
330 Ga0105238_10018456 3300009551 Bacteria 7099
331 Ga0105238_10018513 3300009551 Bacteria 7088
332 Ga0105238_10192947 3300009551 Bacteria 2013
333 Ga0105238_10287986 3300009551 Bacteria 1624
334 Ga0105249_10000856 3300009553 Bacteria 27157
335 Ga0105249_10016849 3300009553 Bacteria 6484
336 Ga0105249_10018300 3300009553 Bacteria 6229
337 Ga0099796_10037762 3300010159 Bacteria 1616
338 Ga0105239_10009663 3300010375 Bacteria 10847
339 Ga0105239_10133472 3300010375 Bacteria 2763
340 Ga0105246_10003290 3300011119 Bacteria 9789
341 Ga0105246_10044929 3300011119 Bacteria 3005
342 Ga0157371_10016750 3300013102 Bacteria 5460
343 Ga0157371_10032500 3300013102 Bacteria 3754
344 Ga0157370_10002576 3300013104 Bacteria 21765
345 Ga0157370_10100170 3300013104 Bacteria 2715
346 Ga0157370_10180961 3300013104 Bacteria 1959
347 Ga0157369_10012266 3300013105 Bacteria 9733
348 Ga0157369_10013341 3300013105 Bacteria 9293
349 Ga0157369_10018334 3300013105 Bacteria 7848
350 Ga0157374_10045869 3300013296 Bacteria 4045
351 Ga0157374_10127784 3300013296 Bacteria 2458
352 Ga0157374_10140533 3300013296 Bacteria 2344
353 Ga0157378_10150969 3300013297 Bacteria 2165
354 Ga0157378_10158715 3300013297 Bacteria 2113
355 Ga0163162_10000455 3300013306 Bacteria 37915
356 Ga0163162_10022365 3300013306 Bacteria 6231
357 Ga0163162_10246500 3300013306 Bacteria 1918
358 Ga0157372_10070340 3300013307 Bacteria 3937
359 Ga0157372_10184582 3300013307 Unclassified 2415
360 Ga0157372_10219938 3300013307 Bacteria 2201
361 Ga0157372_10358922 3300013307 Bacteria 1698
362 Ga0157372_10547214 3300013307 Bacteria 1349
363 Ga0157375_10031985 3300013308 Bacteria 4984
364 Ga0157375_10234318 3300013308 Bacteria 1995
365 Ga0157375_10329444 3300013308 Bacteria 1692
366 Ga0157375_10411469 3300013308 Bacteria 1519
367 Ga0163163_10060550 3300014325 Bacteria 3749
368 Ga0163163_10070084 3300014325 Bacteria 3491
369 Ga0157380_10059354 3300014326 Bacteria 3052
370 Ga0157380_10065377 3300014326 Unclassified 2923
371 Ga0157380_10077742 3300014326 Bacteria 2705
372 Ga0157380_10155538 3300014326 Bacteria 1981
373 Ga0157377_10035023 3300014745 Bacteria 2751
374 Ga0157379_10012701 3300014968 Bacteria 7361
375 Ga0157379_10019593 3300014968 Bacteria 5976
376 Ga0157376_10006200 3300014969 Bacteria 8427
377 Ga0157376_10122174 3300014969 Bacteria 2310
378 Ga0182007_10034088 3300015262 Bacteria 1722
379 Ga0163161_10041355 3300017792 Bacteria 3313
380 Ga0228598_1007512 3300024227 Bacteria 2217
381 Ga0209148_1000232 3300025254 Bacteria 90923
382 Ga0209455_1004488 3300025272 Bacteria 4542
383 Ga0209564_1000390 3300025295 Bacteria 78822
384 Ga0209758_1012829 3300025297 Bacteria 4642
385 Ga0209758_1013321 3300025297 Bacteria 4496
386 Ga0209758_1015980 3300025297 Bacteria 3843
387 Ga0207426_1002604 3300025302 Bacteria 11200
388 Ga0207426_1007922 3300025302 Bacteria 4379
389 Ga0207426_1023952 3300025302 Bacteria 2077
390 Ga0207697_10007171 3300025315 Unclassified 4985
391 Ga0207697_10045225 3300025315 Bacteria 1812
392 Ga0207697_10045437 3300025315 Bacteria 1808
393 Ga0207656_10007664 3300025321 Bacteria 3944
394 Ga0207692_10021447 3300025898 Bacteria 2956
395 Ga0207642_10008196 3300025899 Bacteria 3572
396 Ga0207710_10012120 3300025900 Bacteria 3623
397 Ga0207688_10000632 3300025901 Bacteria 17308
398 Ga0207688_10008820 3300025901 Bacteria 5488
399 Ga0207688_10046119 3300025901 Bacteria 2433
400 Ga0207688_10048243 3300025901 Bacteria 2379
401 Ga0207647_10011355 3300025904 Bacteria 6251
402 Ga0207647_10017016 3300025904 Bacteria 4950
403 Ga0207699_10002112 3300025906 Bacteria 9388
404 Ga0207645_10001838 3300025907 Bacteria 17100
405 Ga0207645_10089451 3300025907 Bacteria 1980
406 Ga0207643_10005957 3300025908 Bacteria 6513
407 Ga0207643_10063452 3300025908 Bacteria 2112
408 Ga0207705_10086680 3300025909 Bacteria 2289
409 Ga0207705_10117994 3300025909 Bacteria 1966
410 Ga0207654_10002057 3300025911 Bacteria 10321
411 Ga0207654_10016250 3300025911 Bacteria 3872
412 Ga0207707_10001060 3300025912 Bacteria 26355
413 Ga0207707_10003094 3300025912 Bacteria 14759
414 Ga0207707_10005972 3300025912 Bacteria 10654
415 Ga0207707_10023267 3300025912 Bacteria 5421
416 Ga0207707_10036741 3300025912 Bacteria 4282
417 Ga0207707_10125036 3300025912 Bacteria 2249
418 Ga0207695_10000123 3300025913 Bacteria 232059
419 Ga0207695_10096843 3300025913 Bacteria 2952
420 Ga0207695_10121008 3300025913 Bacteria 2586
421 Ga0207695_10164175 3300025913 Bacteria 2150
422 Ga0207671_10003762 3300025914 Bacteria 14939
423 Ga0207671_10058901 3300025914 Bacteria 2848
424 Ga0207671_10063316 3300025914 Bacteria 2748
425 Ga0207671_10273872 3300025914 Bacteria 1330
426 Ga0207693_10007711 3300025915 Bacteria 8837
427 Ga0207693_10052913 3300025915 Bacteria 3185
428 Ga0207663_10013318 3300025916 Bacteria 4467
429 Ga0207660_10001447 3300025917 Bacteria 15929
430 Ga0207660_10006547 3300025917 Bacteria 7557
431 Ga0207660_10068374 3300025917 Bacteria 2576
432 Ga0207660_10112454 3300025917 Bacteria 2051
433 Ga0207660_10248425 3300025917 Bacteria 1404
434 Ga0207660_10316609 3300025917 Bacteria 1245
435 Ga0207662_10001083 3300025918 Bacteria 12798
436 Ga0207662_10057012 3300025918 Bacteria 2334
437 Ga0207662_10135310 3300025918 Bacteria 1557
438 Ga0207657_10006931 3300025919 Bacteria 11677
439 Ga0207657_10008229 3300025919 Bacteria 10616
440 Ga0207657_10043840 3300025919 Bacteria 3937
441 Ga0207649_10061824 3300025920 Bacteria 2359
442 Ga0207649_10156959 3300025920 Bacteria 1573
443 Ga0207649_10187614 3300025920 Bacteria 1452
444 Ga0207649_10315980 3300025920 Bacteria 1146
445 Ga0207652_10001462 3300025921 Bacteria 20904
446 Ga0207652_10009510 3300025921 Bacteria 7816
447 Ga0207652_10010442 3300025921 Bacteria 7474
448 Ga0207652_10013576 3300025921 Bacteria 6588
449 Ga0207652_10041084 3300025921 Bacteria 3930
450 Ga0207681_10004103 3300025923 Bacteria 9028
451 Ga0207681_10062526 3300025923 Bacteria 2564
452 Ga0207681_10167319 3300025923 Bacteria 1663
453 Ga0207694_10010911 3300025924 Bacteria 6862
454 Ga0207694_10011080 3300025924 Bacteria 6809
455 Ga0207694_10043684 3300025924 Bacteria 3459
456 Ga0207694_10162643 3300025924 Bacteria 1804
457 Ga0207694_10223928 3300025924 Bacteria 1535
458 Ga0207694_10254184 3300025924 Bacteria 1438
459 Ga0207650_10010290 3300025925 Bacteria 6411
460 Ga0207650_10014705 3300025925 Bacteria 5439
461 Ga0207650_10030878 3300025925 Bacteria 3864
462 Ga0207650_10165628 3300025925 Bacteria 1754
463 Ga0207650_10223003 3300025925 Bacteria 1518
464 Ga0207659_10043983 3300025926 Unclassified 3140
465 Ga0207659_10049502 3300025926 Bacteria 2981
466 Ga0207659_10067884 3300025926 Bacteria 2592
467 Ga0207659_10170259 3300025926 Bacteria 1718
468 Ga0207659_10225907 3300025926 Bacteria 1508
469 Ga0207687_10010511 3300025927 Bacteria 6047
470 Ga0207687_10042501 3300025927 Bacteria 3127
471 Ga0207700_10003844 3300025928 Bacteria 8775
472 Ga0207700_10027640 3300025928 Bacteria 3977
473 Ga0207700_10041641 3300025928 Bacteria 3362
474 Ga0207664_10039390 3300025929 Bacteria 3670
475 Ga0207664_10090250 3300025929 Bacteria 2511
476 Ga0207664_10101335 3300025929 Bacteria 2379
477 Ga0207664_10174826 3300025929 Bacteria 1840
478 Ga0207644_10063359 3300025931 Bacteria 2684
479 Ga0207644_10132443 3300025931 Bacteria 1910
480 Ga0207644_10193306 3300025931 Bacteria 1601
481 Ga0207690_10015263 3300025932 Bacteria 4651
482 Ga0207690_10015287 3300025932 Bacteria 4647
483 Ga0207690_10071490 3300025932 Bacteria 2393
484 Ga0207690_10292684 3300025932 Bacteria 1272
485 Ga0207706_10000990 3300025933 Bacteria 28895
486 Ga0207706_10042126 3300025933 Bacteria 4046
487 Ga0207706_10098765 3300025933 Bacteria 2568
488 Ga0207706_10152466 3300025933 Unclassified 2033
489 Ga0207706_10252822 3300025933 Bacteria 1539
490 Ga0207686_10011739 3300025934 Bacteria 4805
491 Ga0207709_10032248 3300025935 Bacteria 3066
492 Ga0207709_10093783 3300025935 Bacteria 1969
493 Ga0207670_10000723 3300025936 Bacteria 17406
494 Ga0207670_10004146 3300025936 Bacteria 7767
495 Ga0207670_10084086 3300025936 Bacteria 2234
496 Ga0207669_10009635 3300025937 Bacteria 4615
497 Ga0207669_10015713 3300025937 Bacteria 3825
498 Ga0207704_10057171 3300025938 Bacteria 2394
499 Ga0207665_10069227 3300025939 Bacteria 2406
500 Ga0207665_10264370 3300025939 Bacteria 1275
501 Ga0207691_10001949 3300025940 Bacteria 20154
502 Ga0207691_10002037 3300025940 Bacteria 19764
503 Ga0207711_10054382 3300025941 Bacteria 3435
504 Ga0207711_10279473 3300025941 Bacteria 1537
505 Ga0207689_10076507 3300025942 Bacteria 2751
506 Ga0207689_10122625 3300025942 Bacteria 2137
507 Ga0207689_10171695 3300025942 Bacteria 1787
508 Ga0207689_10402181 3300025942 Bacteria 1141
509 Ga0207661_10002168 3300025944 Bacteria 13525
510 Ga0207661_10008830 3300025944 Bacteria 7212
511 Ga0207661_10021211 3300025944 Bacteria 4868
512 Ga0207661_10054376 3300025944 Bacteria 3207
513 Ga0207661_10099549 3300025944 Bacteria 2438
514 Ga0207661_10109696 3300025944 Bacteria 2331
515 Ga0207661_10320509 3300025944 Bacteria 1393
516 Ga0207679_10009971 3300025945 Bacteria 6104
517 Ga0207679_10013569 3300025945 Bacteria 5340
518 Ga0207667_10011535 3300025949 Bacteria 10267
519 Ga0207667_10063324 3300025949 Bacteria 3864
520 Ga0207667_10071811 3300025949 Unclassified 3598
521 Ga0207667_10119404 3300025949 Bacteria 2717
522 Ga0207651_10077182 3300025960 Bacteria 2384
523 Ga0207651_10327268 3300025960 Bacteria 1283
524 Ga0207651_10382867 3300025960 Bacteria 1192
525 Ga0207712_10003551 3300025961 Bacteria 9836
526 Ga0207712_10003886 3300025961 Bacteria 9441
527 Ga0207712_10016215 3300025961 Bacteria 4819
528 Ga0207712_10027361 3300025961 Bacteria 3807
529 Ga0207712_10304696 3300025961 Bacteria 1309
530 Ga0207668_10001797 3300025972 Bacteria 12510
531 Ga0207668_10010768 3300025972 Bacteria 5538
532 Ga0207668_10013252 3300025972 Bacteria 5070
533 Ga0207668_10026341 3300025972 Bacteria 3774
534 Ga0207640_10092750 3300025981 Bacteria 2096
535 Ga0207640_10357785 3300025981 Bacteria 1175
536 Ga0207658_10045620 3300025986 Bacteria 3196
537 Ga0207658_10140276 3300025986 Bacteria 1955
538 Ga0207658_10315200 3300025986 Bacteria 1352
539 Ga0207658_10341710 3300025986 Bacteria 1301
540 Ga0207677_10021883 3300026023 Bacteria 3918
541 Ga0207677_10027258 3300026023 Bacteria 3596
542 Ga0207677_10053403 3300026023 Bacteria 2750
543 Ga0207703_10044165 3300026035 Bacteria 3580
544 Ga0207639_10028505 3300026041 Bacteria 4077
545 Ga0207639_10041751 3300026041 Unclassified 3434
546 Ga0207639_10135161 3300026041 Bacteria 2047
547 Ga0207639_10174234 3300026041 Bacteria 1825
548 Ga0207678_10018436 3300026067 Bacteria 6129
549 Ga0207678_10022139 3300026067 Bacteria 5569
550 Ga0207678_10028304 3300026067 Bacteria 4893
551 Ga0207678_10049981 3300026067 Bacteria 3612
552 Ga0207678_10075813 3300026067 Bacteria 2881
553 Ga0207678_10147347 3300026067 Bacteria 2009
554 Ga0207678_10149815 3300026067 Bacteria 1991
555 Ga0207678_10246738 3300026067 Bacteria 1529
556 Ga0207708_10019062 3300026075 Bacteria 5166
557 Ga0207708_10044625 3300026075 Bacteria 3378
558 Ga0207708_10126100 3300026075 Unclassified 1998
559 Ga0207702_10387797 3300026078 Bacteria 1344
560 Ga0207641_10048523 3300026088 Bacteria 3583
561 Ga0207648_10092640 3300026089 Bacteria 2642
562 Ga0207648_10113202 3300026089 Bacteria 2383
563 Ga0207648_10114859 3300026089 Bacteria 2366
564 Ga0207648_10137448 3300026089 Bacteria 2153
565 Ga0207676_10010931 3300026095 Bacteria 6478
566 Ga0207676_10020701 3300026095 Bacteria 4816
567 Ga0207674_10000142 3300026116 Bacteria 83392
568 Ga0207674_10001633 3300026116 Bacteria 28865
569 Ga0207674_10030711 3300026116 Bacteria 5647
570 Ga0207674_10131644 3300026116 Bacteria 2464
571 Ga0207674_10146903 3300026116 Bacteria 2316
572 Ga0207674_10169491 3300026116 Bacteria 2137
573 Ga0207675_100000141 3300026118 Bacteria 61869
574 Ga0207675_100004169 3300026118 Bacteria 13990
575 Ga0207675_100014983 3300026118 Bacteria 7236
576 Ga0207675_100016487 3300026118 Bacteria 6900
577 Ga0207675_100039441 3300026118 Bacteria 4407
578 Ga0207675_100087282 3300026118 Bacteria 2930
579 Ga0207675_100333474 3300026118 Bacteria 1483
580 Ga0207683_10009233 3300026121 Bacteria 8403
581 Ga0207683_10099148 3300026121 Bacteria 2600
582 Ga0207683_10102964 3300026121 Bacteria 2550
583 Ga0207683_10117012 3300026121 Bacteria 2390
584 Ga0207683_10132981 3300026121 Bacteria 2238
585 Ga0207683_10174085 3300026121 Bacteria 1950
586 Ga0207698_10032961 3300026142 Unclassified 3758
587 Ga0207698_10051937 3300026142 Bacteria 3137
588 Ga0207698_10065027 3300026142 Bacteria 2862
589 Ga0207698_10100753 3300026142 Bacteria 2394
590 Ga0207698_10198285 3300026142 Bacteria 1795
591 Ga0207698_10213291 3300026142 Bacteria 1739
592 Ga0209389_1000201 3300027296 Bacteria 42938
593 Ga0209589_1000002 3300027357 Bacteria 708598
594 Ga0209489_100002 3300027361 Bacteria 708609
595 Ga0209489_100035 3300027361 Bacteria 168255
596 Ga0209700_100002 3300027363 Bacteria 708598
597 Ga0209700_100005 3300027363 Bacteria 573969
598 Ga0209179_1010620 3300027512 Bacteria 1610
599 Ga0209813_10006831 3300027866 Bacteria 2829
600 Ga0209813_10019139 3300027866 Bacteria 1900
601 Ga0207428_10021751 3300027907 Bacteria 5425
602 Ga0207428_10106598 3300027907 Unclassified 2160
603 Ga0268266_10014910 3300028379 Bacteria 6674
604 Ga0268266_10049432 3300028379 Bacteria 3607
605 Ga0268266_10084829 3300028379 Bacteria 2767
606 Ga0268266_10092299 3300028379 Bacteria 2656
607 Ga0268266_10096847 3300028379 Bacteria 2594
608 Ga0268266_10167157 3300028379 Bacteria 1994
609 Ga0268266_10174702 3300028379 Bacteria 1952
610 Ga0268266_10234454 3300028379 Bacteria 1691
611 Ga0268266_10254583 3300028379 Bacteria 1625
612 Ga0268265_10005120 3300028380 Bacteria 8976
613 Ga0268265_10017172 3300028380 Unclassified 4987
614 Ga0268265_10020676 3300028380 Bacteria 4598
615 Ga0268265_10251015 3300028380 Bacteria 1567
616 Ga0268264_10033347 3300028381 Unclassified 4229
617 Ga0307515_10036261 3300028794 Bacteria 7984
618 Ga0265338_10016733 3300028800 Bacteria 7946
619 Ga0265339_10000052 3300031249 Bacteria 101603
620 Ga0265339_10069363 3300031249 Bacteria 1882
621 Ga0265339_10110023 3300031249 Bacteria 1426
622 Ga0265331_10052024 3300031250 Bacteria 1958
623 Ga0265327_10017705 3300031251 Bacteria 4453
624 Ga0265316_10107628 3300031344 Bacteria 2114
625 Ga0307513_10082871 3300031456 Bacteria 3300
626 Ga0307408_100000558 3300031548 Bacteria 32149
627 Ga0265313_10000843 3300031595 Bacteria 30858
628 Ga0307508_10044378 3300031616 Bacteria 3977
629 Ga0307508_10183623 3300031616 Bacteria 1694
630 Ga0265314_10007260 3300031711 Bacteria 9628
631 Ga0265314_10029453 3300031711 Bacteria 4080
632 Ga0265342_10017745 3300031712 Bacteria 4622
633 Ga0265342_10107310 3300031712 Bacteria 1584
634 Ga0307516_10069114 3300031730 Bacteria 3398
635 Ga0307410_10285743 3300031852 Bacteria 1296
636 Ga0307406_10008537 3300031901 Bacteria 5718
637 Ga0307407_10144837 3300031903 Bacteria 1537
638 Ga0307409_100093333 3300031995 Unclassified 2473
639 Ga0307416_100063021 3300032002 Bacteria 3034
640 Ga0307416_100314809 3300032002 Bacteria 1564
641 Ga0307414_10222078 3300032004 Bacteria 1552
642 Ga0307414_10433562 3300032004 Bacteria 1149
643 Ga0307415_100165832 3300032126 Bacteria 1717
644 Ga0307510_10012742 3300033180 Bacteria 9977
645 Ga0307510_10032603 3300033180 Bacteria 5866
646 Ga0315911_1000021 3300033442 Bacteria 124874
647 Ga0373930_0021115 3300034816 Bacteria 1275
648 Ga0373926_0040292 3300035083 Bacteria 1667
649 Ga0373926_0078249 3300035083 Bacteria 1220
650 Ga0373934_0042137 3300035086 Bacteria 1803
651 Ga0373944_0012879 3300035089 Bacteria 2313
652 Ga0373944_0019033 3300035089 Bacteria 1967
653 Ga0373944_0046784 3300035089 Bacteria 1353
654 Ga0373923_0015134 3300035111 Bacteria 2908
655 Ga0373923_0016016 3300035111 Bacteria 2840
656 Ga0373936_0005865 3300035113 Bacteria 4624
657 Ga0373945_0014426 3300035116 Bacteria 2648
658 Ga0373945_0029335 3300035116 Bacteria 1932
659 Ga0373945_0068268 3300035116 Bacteria 1340
660 Ga0373953_0055861 3300035117 Bacteria 1604
661 Ga0373956_0023627 3300035119 Bacteria 2640
662 Ga0373956_0062661 3300035119 Bacteria 1686
663 Ga0373943_0016082 3300035170 Bacteria 3407
664 Ga0373943_0030683 3300035170 Bacteria 2546
665 Ga0373943_0043377 3300035170 Bacteria 2184
666 Ga0373943_0060103 3300035170 Bacteria 1896
667 Ga0373943_0064413 3300035170 Bacteria 1840
668 Ga0373943_0187169 3300035170 Bacteria 1140
669 Ga0373946_0003500 3300035171 Bacteria 5571
670 Ga0373946_0011732 3300035171 Bacteria 3275
671 Ga0373946_0038734 3300035171 Bacteria 1943
672 Ga0373961_0002074 3300035241 Bacteria 5339
673 Ga0373924_0020510 3300035410 Bacteria 2570
674 Ga0373924_0059470 3300035410 Bacteria 1596
675 Ga0373931_0036553 3300035691 Bacteria 2560
676 Ga0373931_0128212 3300035691 Bacteria 1457
677 Ga0373935_0013096 3300035692 Bacteria 4999
678 Ga0373935_0019770 3300035692 Bacteria 4108
679 Ga0373935_0044947 3300035692 Bacteria 2785
680 Ga0373935_0055404 3300035692 Bacteria 2526
681 Ga0373935_0056552 3300035692 Bacteria 2501
682 Ga0373935_0162554 3300035692 Bacteria 1523
683 Ga0373927_0007278 3300035695 Bacteria 7504
684 Ga0373927_0049323 3300035695 Bacteria 2722
685 Ga0373927_0094899 3300035695 Bacteria 1938
686 Ga0373927_0138302 3300035695 Bacteria 1592
687 Ga0373933_0024090 3300035724 Bacteria 3484
688 Ga0373933_0081210 3300035724 Bacteria 1988
689 Ga0373933_0171821 3300035724 Bacteria 1379
690 Ga0373947_0004180 3300035725 Bacteria 8476
691 Ga0373947_0018731 3300035725 Bacteria 3987
692 Ga0373947_0020227 3300035725 Bacteria 3842
693 Ga0373947_0049538 3300035725 Bacteria 2523
694 Ga0373947_0062433 3300035725 Bacteria 2267
695 Ga0373947_0098134 3300035725 Bacteria 1837
696 Ga0373937_0005300 3300036401 Bacteria 11020
697 Ga0373937_0084401 3300036401 Bacteria 2938
698 Ga0373937_0099098 3300036401 Bacteria 2703
699 Ga0373925_0008589 3300037068 Bacteria 7443
700 Ga0373925_0010602 3300037068 Bacteria 6681
701 Ga0373925_0063800 3300037068 Bacteria 2772
702 Ga0373925_0118544 3300037068 Bacteria 2052
703 Ga0373925_0145775 3300037068 Bacteria 1856
704 Ga0373925_0189922 3300037068 Bacteria 1629
705 Ga0395899_0019733 3300037312 Bacteria 5118
706 Ga0395899_0081185 3300037312 Bacteria 2360
707 Ga0395900_0031496 3300037418 Bacteria 5450
708 Ga0395900_0132004 3300037418 Bacteria 2559
709 Ga0395900_0341087 3300037418 Bacteria 1474
710 Ga0395898_0002361 3300037466 Bacteria 22461
711 Ga0395898_0015190 3300037466 Bacteria 7904
712 Ga0395898_0407053 3300037466 Bacteria 1297
713 Ga0436364_0422894 3300037853 Bacteria 1409
714 Ga0436364_0839082 3300037853 Bacteria 2981
715 Ga0395901_0094760 3300038443 Bacteria 3128
716 Ga0395901_0396539 3300038443 Bacteria 1418
717 Ga0436365_0045906 3300039437 Bacteria 10690
718 Ga0436365_0908986 3300039437 Bacteria 2500
719 Ga0436365_1169629 3300039437 Bacteria 6807
720 Ga0436360_0676143 3300039438 Bacteria 1428
721 Ga0436360_0851383 3300039438 Bacteria 4013
722 Ga0436363_0548376 3300039450 Bacteria 2935
723 Ga0436362_0075180 3300039453 Bacteria 1153
724 Ga0451807_1527043 3300041486 Bacteria 1542
725 Ga0451855_1643489 3300041511 Bacteria 1102
726 Ga0439443_018774 3300042003 Bacteria 1073
727 Ga0466961_0087148 3300044693 Bacteria 1973
728 Ga0466960_0139629 3300044901 Bacteria 1286
729 Ga0466959_0136494 3300045049 Bacteria 1736
730 Ga0451576_0114353 3300045051 Unclassified 2809
731 Ga0466967_0015489 3300045976 Bacteria 5977
732 Ga0466967_0122933 3300045976 Bacteria 2401
733 Ga0495617_047333 3300046452 Bacteria 1432
734 Ga0495592_0065726 3300046454 Bacteria 2654
735 Ga0495592_0085888 3300046454 Bacteria 2267
736 Ga0495592_0092782 3300046454 Bacteria 2163
737 Ga0495603_0048534 3300046455 Bacteria 2528
738 Ga0495603_0074501 3300046455 Bacteria 1993
739 Ga0495603_0167925 3300046455 Bacteria 1271
740 Ga0495590_0022334 3300046457 Bacteria 2238
741 Ga0495590_0034643 3300046457 Bacteria 1763
742 Ga0495629_0005715 3300046459 Bacteria 9285
743 Ga0495629_0024359 3300046459 Bacteria 4309
744 Ga0495629_0035104 3300046459 Bacteria 3545
745 Ga0495629_0075207 3300046459 Bacteria 2359
746 Ga0495629_0078476 3300046459 Bacteria 2305
747 Ga0495629_0124314 3300046459 Bacteria 1797
748 Ga0495638_0012685 3300046460 Bacteria 5763
749 Ga0495638_0127909 3300046460 Bacteria 1495
750 Ga0495641_0028609 3300046461 Bacteria 2696
751 Ga0495641_0083509 3300046461 Bacteria 1431
752 Ga0495651_0004217 3300046462 Bacteria 11016
753 Ga0495651_0004672 3300046462 Bacteria 10481
754 Ga0495651_0017519 3300046462 Bacteria 5548
755 Ga0495651_0021317 3300046462 Bacteria 5036
756 Ga0495651_0040455 3300046462 Bacteria 3625
757 Ga0495651_0093894 3300046462 Bacteria 2246
758 Ga0495653_0013840 3300046463 Bacteria 6575
759 Ga0495653_0021718 3300046463 Bacteria 5197
760 Ga0495653_0056672 3300046463 Bacteria 2986
761 Ga0495653_0086909 3300046463 Bacteria 2297
762 Ga0495653_0166653 3300046463 Bacteria 1524
763 Ga0495653_0167182 3300046463 Bacteria 1522
764 Ga0495580_0010281 3300046472 Bacteria 7298
765 Ga0495580_0025873 3300046472 Bacteria 4285
766 Ga0495580_0212084 3300046472 Bacteria 1332
767 Ga0495582_0008667 3300046473 Bacteria 5609
768 Ga0495582_0015336 3300046473 Bacteria 4210
769 Ga0495582_0043084 3300046473 Bacteria 2485
770 Ga0495582_0058221 3300046473 Bacteria 2131
771 Ga0495582_0078189 3300046473 Bacteria 1835
772 Ga0495605_0022270 3300046474 Bacteria 3348
773 Ga0495605_0060024 3300046474 Bacteria 1824
774 Ga0495639_0004024 3300046475 Bacteria 6301
775 Ga0495639_0008168 3300046475 Bacteria 4495
776 Ga0495639_0010407 3300046475 Bacteria 4006
777 Ga0495662_0002323 3300046476 Bacteria 9591
778 Ga0495662_0013322 3300046476 Bacteria 4001
779 Ga0495662_0015793 3300046476 Bacteria 3664
780 Ga0495662_0045334 3300046476 Bacteria 2123
781 Ga0495664_0013085 3300046477 Bacteria 4705
782 Ga0495664_0019574 3300046477 Bacteria 3894
783 Ga0495664_0020012 3300046477 Bacteria 3855
784 Ga0495664_0025412 3300046477 Bacteria 3448
785 Ga0495664_0033577 3300046477 Bacteria 3015
786 Ga0495664_0110158 3300046477 Bacteria 1662
787 Ga0495585_0023352 3300046492 Bacteria 3549
788 Ga0495594_0005204 3300046499 Bacteria 6686
789 Ga0495594_0049664 3300046499 Bacteria 2306
790 Ga0495606_0031644 3300046507 Bacteria 3674
791 Ga0495606_0076705 3300046507 Bacteria 2088
792 Ga0495608_0007486 3300046511 Bacteria 7707
793 Ga0495608_0019475 3300046511 Bacteria 4669
794 Ga0495608_0037956 3300046511 Bacteria 3238
795 Ga0495608_0076804 3300046511 Bacteria 2174
796 Ga0495608_0090413 3300046511 Bacteria 1981
797 Ga0495616_0078986 3300046513 Bacteria 1578
798 Ga0495618_0001061 3300046514 Bacteria 18746
799 Ga0495618_0024189 3300046514 Bacteria 3759
800 Ga0495618_0048874 3300046514 Bacteria 2671
801 Ga0495618_0062860 3300046514 Bacteria 2356
802 Ga0495628_0036089 3300046516 Bacteria 3970
803 Ga0495628_0082142 3300046516 Bacteria 2503
804 Ga0495628_0283928 3300046516 Bacteria 1228
805 Ga0495630_0037669 3300046517 Bacteria 3616
806 Ga0495630_0041344 3300046517 Bacteria 3442
807 Ga0495630_0054144 3300046517 Bacteria 3006
808 Ga0495630_0068819 3300046517 Bacteria 2663
809 Ga0495630_0122377 3300046517 Bacteria 1974
810 Ga0495630_0302948 3300046517 Bacteria 1221
811 Ga0495631_0024987 3300046518 Bacteria 2754
812 Ga0495632_0028540 3300046519 Bacteria 2911
813 Ga0495643_0095374 3300046522 Bacteria 1530
814 Ga0495644_0055084 3300046523 Bacteria 1494
815 Ga0495648_0005065 3300046524 Bacteria 11061
816 Ga0495648_0075049 3300046524 Bacteria 1946
817 Ga0495663_0027311 3300046525 Bacteria 1675
818 Ga0495666_0043817 3300046526 Bacteria 2161
819 Ga0495652_0016634 3300046529 Bacteria 6575
820 Ga0495652_0019059 3300046529 Bacteria 6112
821 Ga0495652_0124601 3300046529 Bacteria 2049
822 Ga0495652_0158489 3300046529 Bacteria 1760
823 Ga0495665_0007053 3300046531 Bacteria 6064
824 Ga0495665_0039138 3300046531 Bacteria 2526
825 Ga0495640_0001271 3300046533 Bacteria 19772
826 Ga0495640_0009760 3300046533 Bacteria 7457
827 Ga0495640_0011556 3300046533 Bacteria 6788
828 Ga0495640_0064782 3300046533 Bacteria 2470
829 Ga0495640_0067077 3300046533 Bacteria 2418
830 Ga0495640_0102593 3300046533 Bacteria 1877
831 Ga0495640_0124834 3300046533 Bacteria 1670
832 Ga0495640_0206445 3300046533 Bacteria 1243
833 Ga0495586_0049611 3300046535 Bacteria 2270
834 Ga0495587_0009785 3300046536 Bacteria 6126
835 Ga0495587_0018769 3300046536 Bacteria 4288
836 Ga0495587_0030630 3300046536 Bacteria 3262
837 Ga0495587_0063326 3300046536 Bacteria 2163
838 Ga0495609_0014673 3300046538 Bacteria 3679
839 Ga0495645_0060500 3300046543 Bacteria 2745
840 Ga0495645_0084178 3300046543 Bacteria 2278
841 Ga0495645_0098074 3300046543 Bacteria 2086
842 Ga0495645_0140216 3300046543 Bacteria 1687
843 Ga0495645_0214824 3300046543 Bacteria 1297
844 Ga0495633_0121826 3300046558 Bacteria 1208
845 Ga0495667_0011680 3300046559 Bacteria 5946
846 Ga0495667_0015529 3300046559 Bacteria 5147
847 Ga0495667_0019653 3300046559 Bacteria 4557
848 Ga0495667_0073707 3300046559 Bacteria 2224
849 Ga0495656_0017401 3300046615 Bacteria 2743
850 Ga0495668_0028576 3300046616 Bacteria 3154
851 Ga0495634_0006123 3300046642 Bacteria 9157
852 Ga0495634_0033886 3300046642 Bacteria 3506
853 Ga0495634_0070251 3300046642 Bacteria 2308
854 Ga0495634_0093235 3300046642 Bacteria 1953
855 Ga0495634_0105891 3300046642 Bacteria 1813
856 Ga0495611_0009542 3300046648 Bacteria 4101
857 Ga0495625_0105095 3300046660 Bacteria 1935
858 Ga0495635_0004098 3300046663 Bacteria 10117
859 Ga0495635_0005471 3300046663 Bacteria 8833
860 Ga0495635_0036633 3300046663 Bacteria 3399
861 Ga0495635_0063127 3300046663 Bacteria 2544
862 Ga0495659_0024284 3300046664 Bacteria 2067
863 Ga0495661_0160389 3300046665 Bacteria 1208
864 Ga0495588_0065826 3300046674 Bacteria 1880
865 Ga0495657_0016820 3300046675 Bacteria 5319
866 Ga0495657_0027872 3300046675 Bacteria 3979
867 Ga0495599_0025899 3300046678 Bacteria 3674
868 Ga0495623_0003775 3300046679 Bacteria 9984
869 Ga0495623_0014622 3300046679 Bacteria 5077
870 Ga0495623_0111037 3300046679 Bacteria 1661
871 Ga0495623_0134714 3300046679 Bacteria 1475
872 Ga0495646_0010211 3300046680 Bacteria 5971
873 Ga0495646_0027423 3300046680 Bacteria 3574
874 Ga0495646_0059371 3300046680 Bacteria 2284
875 Ga0495647_0011641 3300046681 Bacteria 3016
876 Ga0495658_0002959 3300046683 Bacteria 8515
877 Ga0495658_0032161 3300046683 Bacteria 2863
878 Ga0495658_0037171 3300046683 Bacteria 2690
879 Ga0495658_0140120 3300046683 Bacteria 1479
880 Ga0495658_0158322 3300046683 Bacteria 1395
881 Ga0495669_0010542 3300046684 Bacteria 3908
882 Ga0495613_0036612 3300046689 Bacteria 3639
883 Ga0495613_0062337 3300046689 Bacteria 2729
884 Ga0495613_0166637 3300046689 Bacteria 1565
885 Ga0495624_0020635 3300046690 Bacteria 4380
886 Ga0495624_0052247 3300046690 Bacteria 2583
887 Ga0495624_0096780 3300046690 Bacteria 1818
888 Ga0495624_0097587 3300046690 Bacteria 1810
889 Ga0495670_0082424 3300046691 Bacteria 1640
890 Ga0495671_0025057 3300046692 Bacteria 3103
891 Ga0495671_0055716 3300046692 Bacteria 1958
892 Ga0495649_0043663 3300046694 Bacteria 2447
893 Ga0495649_0046346 3300046694 Bacteria 2367
894 Ga0495649_0067902 3300046694 Bacteria 1913
895 Ga0495589_0061566 3300046794 Bacteria 1842
896 Ga0495600_0006031 3300046809 Bacteria 7336
897 Ga0495600_0075411 3300046809 Bacteria 2203
898 Ga0495600_0075721 3300046809 Bacteria 2197
899 Ga0495581_0007693 3300047315 Bacteria 6235
900 Ga0495581_0008174 3300047315 Bacteria 6059
901 Ga0495581_0076220 3300047315 Bacteria 1940
902 Ga0495604_0015248 3300047317 Bacteria 6135
903 Ga0495604_0031158 3300047317 Bacteria 4231
904 Ga0495604_0032435 3300047317 Bacteria 4139
905 Ga0495604_0046885 3300047317 Bacteria 3368
906 Ga0495604_0067018 3300047317 Bacteria 2729
907 Ga0495604_0091819 3300047317 Bacteria 2250
908 Ga0495604_0116525 3300047317 Bacteria 1939
909 Ga0495674_0011123 3300047319 Bacteria 8496
910 Ga0495674_0017380 3300047319 Bacteria 6691
911 Ga0495674_0034129 3300047319 Bacteria 4603
912 Ga0495674_0051661 3300047319 Bacteria 3623
913 Ga0495674_0076789 3300047319 Bacteria 2872
914 Ga0495672_0021333 3300047320 Bacteria 4226
915 Ga0495672_0065044 3300047320 Bacteria 2086
916 Ga0495676_0036914 3300047321 Bacteria 4075
917 Ga0495676_0068194 3300047321 Bacteria 2749
918 Ga0495676_0095388 3300047321 Bacteria 2213
919 Ga0495676_0142867 3300047321 Bacteria 1713
920 Ga0495676_0231826 3300047321 Bacteria 1268
921 Ga0495680_0006738 3300047322 Bacteria 10622
922 Ga0495680_0032645 3300047322 Bacteria 4223
923 Ga0495680_0073685 3300047322 Bacteria 2594
924 Ga0495680_0079188 3300047322 Bacteria 2485
925 Ga0495683_0039314 3300047323 Bacteria 2391
926 Ga0495687_014453 3300047443 Bacteria 4063
927 Ga0495675_0030949 3300047444 Bacteria 3415
928 Ga0495675_0058848 3300047444 Bacteria 2436
929 Ga0495675_0085587 3300047444 Bacteria 1982
930 Ga0495677_0015402 3300047445 Bacteria 2778
931 Ga0495677_0075179 3300047445 Bacteria 1262
932 Ga0495673_0074325 3300047469 Bacteria 1422
933 Ga0495684_0036766 3300047471 Bacteria 3754
934 Ga0495684_0050588 3300047471 Bacteria 3172
935 Ga0495684_0062922 3300047471 Bacteria 2822
936 Ga0495684_0076364 3300047471 Bacteria 2544
937 Ga0495684_0101594 3300047471 Bacteria 2174
938 Ga0495684_0117501 3300047471 Unclassified 2004
939 Ga0495684_0122289 3300047471 Bacteria 1959
940 Ga0495684_0134132 3300047471 Bacteria 1858
941 Ga0495686_0183405 3300047472 Bacteria 1211
942 Ga0495686_0224303 3300047472 Bacteria 1067
943 Ga0495593_0019768 3300047673 Bacteria 3774
944 Ga0495593_0050796 3300047673 Bacteria 2196
945 Ga0495593_0060529 3300047673 Bacteria 1982
946 Ga0495593_0060901 3300047673 Bacteria 1975
947 Ga0495602_0005817 3300048088 Bacteria 12942
948 Ga0495602_0047118 3300048088 Bacteria 3887
949 Ga0495602_0089562 3300048088 Bacteria 2558
950 Ga0495602_0114921 3300048088 Bacteria 2178
951 Ga0495602_0168536 3300048088 Bacteria 1702
952 Ga0495614_0054843 3300048089 Unclassified 1710
953 Ga0495614_0108878 3300048089 Bacteria 1216
954 Ga0496100_0001434 3300048903 Bacteria 11668
955 Ga0496100_0007637 3300048903 Bacteria 5980
956 Ga0496100_0021279 3300048903 Bacteria 3903
957 Ga0496100_0112566 3300048903 Bacteria 1893
958 Ga0496100_0131773 3300048903 Bacteria 1762
959 Ga0496100_0165090 3300048903 Bacteria 1590
960 Ga0496101_0002254 3300048904 Bacteria 11787
961 Ga0496101_0030531 3300048904 Bacteria 3780
962 Ga0496101_0043909 3300048904 Bacteria 3196
963 Ga0496101_0064417 3300048904 Bacteria 2670
964 Ga0496102_0001340 3300048905 Bacteria 22086
965 Ga0496102_0001732 3300048905 Bacteria 19108
966 Ga0496102_0022395 3300048905 Bacteria 5597
967 Ga0496102_0073493 3300048905 Bacteria 3142
968 Ga0496102_0144298 3300048905 Bacteria 2233
969 Ga0496102_0170195 3300048905 Bacteria 2051
970 Ga0496102_0320985 3300048905 Bacteria 1459
971 Ga0496103_0028828 3300048906 Bacteria 3371
972 Ga0496103_0031135 3300048906 Bacteria 3250
973 Ga0496103_0045510 3300048906 Bacteria 2708
974 Ga0496104_0002060 3300048907 Bacteria 17457
975 Ga0496104_0024607 3300048907 Bacteria 5538
976 Ga0496104_0049168 3300048907 Bacteria 3976
977 Ga0496104_0081984 3300048907 Bacteria 3076
978 Ga0496104_0086015 3300048907 Bacteria 3001
979 Ga0496104_0100245 3300048907 Bacteria 2772
980 Ga0496104_0239864 3300048907 Bacteria 1725
981 Ga0496105_0001290 3300048908 Bacteria 17532
982 Ga0496105_0003659 3300048908 Bacteria 11426
983 Ga0496105_0012783 3300048908 Bacteria 6651
984 Ga0496105_0018396 3300048908 Bacteria 5614
985 Ga0496105_0038693 3300048908 Bacteria 3929
986 Ga0496105_0104257 3300048908 Bacteria 2342
987 Ga0496105_0265635 3300048908 Bacteria 1387
988 Ga0496106_0000749 3300048909 Bacteria 23393
989 Ga0496106_0028512 3300048909 Bacteria 4158
990 Ga0496106_0036966 3300048909 Bacteria 3652
991 Ga0496106_0056039 3300048909 Bacteria 2980
992 Ga0496106_0061778 3300048909 Bacteria 2843
993 Ga0496106_0213394 3300048909 Bacteria 1538
994 Ga0496106_0291456 3300048909 Bacteria 1308
995 Ga0496107_0039367 3300048910 Bacteria 3391
996 Ga0496107_0053993 3300048910 Bacteria 2899
997 Ga0496107_0073563 3300048910 Bacteria 2486
998 Ga0496107_0186327 3300048910 Bacteria 1541
999 Ga0496108_0010203 3300048911 Bacteria 7628
1000 Ga0496108_0011810 3300048911 Bacteria 7104
1001 Ga0496108_0039896 3300048911 Bacteria 3913
1002 Ga0496108_0066552 3300048911 Bacteria 3038
1003 Ga0496108_0207359 3300048911 Bacteria 1701
1004 Ga0496108_0226935 3300048911 Bacteria 1623
1005 Ga0496109_0000643 3300048912 Bacteria 28967
1006 Ga0496109_0000878 3300048912 Bacteria 25065
1007 Ga0496109_0001869 3300048912 Bacteria 17451
1008 Ga0496109_0075469 3300048912 Bacteria 3100
1009 Ga0496109_0089707 3300048912 Bacteria 2843
1010 Ga0496109_0145889 3300048912 Bacteria 2214
1011 Ga0496109_0200080 3300048912 Bacteria 1878
1012 Ga0496109_0216609 3300048912 Bacteria 1800
1013 Ga0496109_0267131 3300048912 Bacteria 1612
1014 Ga0496110_0001735 3300048913 Bacteria 16067
1015 Ga0496110_0003655 3300048913 Bacteria 11832
1016 Ga0496110_0015850 3300048913 Bacteria 6284
1017 Ga0496110_0023944 3300048913 Bacteria 5199
1018 Ga0496110_0024335 3300048913 Bacteria 5160
1019 Ga0496110_0044621 3300048913 Bacteria 3871
1020 Ga0496110_0105229 3300048913 Bacteria 2531
1021 Ga0496111_0000913 3300048914 Bacteria 16088
1022 Ga0496111_0019396 3300048914 Bacteria 4722
1023 Ga0496111_0029686 3300048914 Bacteria 3884
1024 Ga0496111_0059309 3300048914 Bacteria 2772
1025 Ga0496111_0072095 3300048914 Bacteria 2514
1026 Ga0496111_0094951 3300048914 Bacteria 2187
1027 Ga0496112_0000037 3300048915 Bacteria 96876
1028 Ga0496112_0001774 3300048915 Bacteria 16942
1029 Ga0496112_0002522 3300048915 Bacteria 14782
1030 Ga0496112_0013688 3300048915 Bacteria 7498
1031 Ga0496112_0050148 3300048915 Bacteria 4092
1032 Ga0496112_0058286 3300048915 Bacteria 3802
1033 Ga0496112_0063987 3300048915 Bacteria 3628
1034 Ga0496112_0208879 3300048915 Bacteria 1910
1035 Ga0496112_0304835 3300048915 Bacteria 1538
1036 Ga0496113_0003788 3300048916 Bacteria 9140
1037 Ga0496113_0048029 3300048916 Bacteria 3174
1038 Ga0496113_0072488 3300048916 Bacteria 2621
1039 Ga0496113_0078147 3300048916 Bacteria 2532
1040 Ga0496113_0172447 3300048916 Bacteria 1713
1041 Ga0496114_0003687 3300048917 Bacteria 11784
1042 Ga0496114_0076711 3300048917 Bacteria 2816
1043 Ga0496114_0152026 3300048917 Bacteria 2008
1044 Ga0496115_0008406 3300048918 Bacteria 7639
1045 Ga0496115_0041731 3300048918 Bacteria 3653
1046 Ga0496115_0128087 3300048918 Bacteria 2091
1047 Ga0496115_0164149 3300048918 Bacteria 1836
1048 Ga0496117_0030307 3300048920 Bacteria 4154
1049 Ga0496117_0031929 3300048920 Bacteria 4012
1050 Ga0496117_0052997 3300048920 Bacteria 2854
1051 Ga0496118_0020940 3300048921 Bacteria 5781
1052 Ga0496118_0099337 3300048921 Bacteria 1973
1053 Ga0496118_0104805 3300048921 Bacteria 1897
1054 Ga0496118_0160591 3300048921 Bacteria 1390
1055 Ga0496119_0000934 3300048922 Bacteria 37665
1056 Ga0496119_0057082 3300048922 Bacteria 2362
1057 Ga0496120_0007334 3300048923 Bacteria 8226
1058 Ga0496121_0001566 3300048924 Bacteria 38176
1059 Ga0496121_0015424 3300048924 Bacteria 8009
1060 Ga0496121_0021364 3300048924 Bacteria 6343
1061 Ga0496121_0033449 3300048924 Bacteria 4651
1062 Ga0496121_0039187 3300048924 Bacteria 4181
1063 Ga0496121_0054203 3300048924 Bacteria 3353
1064 Ga0496121_0077245 3300048924 Bacteria 2652
1065 Ga0496122_0028857 3300048925 Bacteria 4694
1066 Ga0496122_0165108 3300048925 Bacteria 1344
1067 Ga0496123_0011686 3300048926 Bacteria 7574
1068 Ga0496124_0039476 3300048927 Bacteria 4092
1069 Ga0496124_0063566 3300048927 Bacteria 3083
1070 Ga0496124_0088542 3300048927 Bacteria 2530
1071 Ga0496124_0278801 3300048927 Bacteria 1220
1072 Ga0496125_0175403 3300048928 Bacteria 1435
1073 Ga0496125_0228827 3300048928 Bacteria 1191
1074 Ga0496125_0255429 3300048928 Bacteria 1102
1075 Ga0496126_0002888 3300048929 Bacteria 22406
1076 Ga0496126_0006284 3300048929 Bacteria 13262
1077 Ga0496126_0011492 3300048929 Bacteria 9157
1078 Ga0496126_0015066 3300048929 Bacteria 7793
1079 Ga0496126_0019797 3300048929 Bacteria 6621
1080 Ga0501031_0051468 3300049568 Bacteria 2682
1081 Ga0501032_0000055 3300049569 Bacteria 99207
1082 Ga0501032_0223014 3300049569 Bacteria 1226
1083 Ga0501033_0001478 3300049570 Bacteria 20801
1084 Ga0501034_0001317 3300049571 Bacteria 33620
1085 Ga0501034_0521317 3300049571 Bacteria 1100
1086 Ga0501036_0000021 3300049572 Bacteria 114136
1087 Ga0501036_0005983 3300049572 Bacteria 9863
1088 Ga0501036_0134104 3300049572 Bacteria 2090
1089 Ga0501037_0001418 3300049573 Bacteria 17590
1090 Ga0501038_0000070 3300049574 Bacteria 84371
1091 Ga0501038_0088596 3300049574 Bacteria 2597
1092 Ga0501038_0221071 3300049574 Bacteria 1511
1093 Ga0501039_0001437 3300049575 Bacteria 17545
1094 Ga0501039_0225438 3300049575 Bacteria 1473
1095 Ga0501040_0094632 3300049576 Bacteria 2079
1096 Ga0501042_0043428 3300049578 Bacteria 3201
1097 Ga0501042_0209952 3300049578 Bacteria 1404
1098 Ga0501043_0000078 3300049579 Bacteria 85968
1099 Ga0501043_0024823 3300049579 Bacteria 4703
1100 Ga0501046_0000627 3300049580 Bacteria 34652
1101 Ga0501046_0015839 3300049580 Bacteria 6326
1102 Ga0501046_0048649 3300049580 Bacteria 3357
1103 Ga0501046_0154282 3300049580 Bacteria 1731
1104 Ga0501047_0000810 3300049581 Bacteria 32588
1105 Ga0501047_0054389 3300049581 Bacteria 3872
1106 Ga0501047_0054608 3300049581 Bacteria 3864
1107 Ga0501047_0087151 3300049581 Bacteria 3000
1108 Ga0501047_0188580 3300049581 Bacteria 1926
1109 Ga0501048_0001060 3300049582 Bacteria 20590
1110 Ga0501067_0000177 3300049583 Bacteria 35936
1111 Ga0501069_0096433 3300049585 Bacteria 1676
1112 Ga0501069_0124527 3300049585 Bacteria 1473
1113 Ga0501070_0001227 3300049586 Bacteria 22954
1114 Ga0501072_0004769 3300049588 Bacteria 10323
1115 Ga0501072_0109122 3300049588 Bacteria 2202
1116 Ga0501072_0218692 3300049588 Bacteria 1518
1117 Ga0501072_0234141 3300049588 Bacteria 1463
1118 Ga0501073_0000039 3300049589 Bacteria 86080
1119 Ga0501074_0000019 3300049590 Bacteria 72385
1120 Ga0501074_0028878 3300049590 Bacteria 4018
1121 Ga0501075_0124073 3300049591 Bacteria 1966
1122 Ga0501076_0031722 3300049592 Bacteria 4124
1123 Ga0501076_0036948 3300049592 Bacteria 3829
1124 Ga0501076_0092578 3300049592 Bacteria 2432
1125 Ga0501079_0060118 3300049741 Bacteria 2931
1126 Ga0501080_0000827 3300049742 Bacteria 25307
1127 Ga0501080_0006935 3300049742 Bacteria 10221
1128 Ga0501080_0214338 3300049742 Bacteria 1764
1129 Ga0501081_0095296 3300049743 Bacteria 2098
1130 Ga0501083_0000242 3300049744 Bacteria 35191
1131 Ga0501083_0087287 3300049744 Bacteria 2063
1132 Ga0501035_0001565 3300049822 Bacteria 23271
1133 Ga0501035_0024129 3300049822 Bacteria 5579
1134 Ga0501035_0149840 3300049822 Bacteria 2025
1135 Ga0501035_0151616 3300049822 Bacteria 2011
1136 Ga0501035_0374161 3300049822 Bacteria 1189
1137 Ga0501044_0000179 3300049823 Bacteria 78633
1138 Ga0501044_0014456 3300049823 Bacteria 8522
1139 Ga0501044_0029341 3300049823 Bacteria 5800
1140 Ga0501044_0175310 3300049823 Bacteria 2113
1141 Ga0501044_0532181 3300049823 Bacteria 1074
1142 Ga0501045_0003829 3300049824 Bacteria 10352
1143 nmdc:mga03683_18496_c1 3300050489 Bacteria 2650
1144 nmdc:mga03683_25741_c1 3300050489 Bacteria 2314
1145 nmdc:mga03683_37033_c1 3300050489 Bacteria 1987
1146 nmdc:mga03n38_3593_c1 3300050490 Bacteria 5011
1147 nmdc:mga03n38_6145_c1 3300050490 Bacteria 2353
1148 nmdc:mga03n38_6519_c1 3300050490 Bacteria 4062
1149 nmdc:mga00v17_14203_c1 3300050491 Bacteria 4440
1150 nmdc:mga00v17_67617_c1 3300050491 Bacteria 2208
1151 nmdc:mga00v17_74501_c1 3300050491 Bacteria 2110
1152 nmdc:mga00v17_84926_c1 3300050491 Bacteria 1982
1153 nmdc:mga0yw44_103732_c1 3300050492 Bacteria 1814
1154 nmdc:mga0yw44_20795_c1 3300050492 Bacteria 3649
1155 nmdc:mga0yw44_44695_c1 3300050492 Bacteria 2651
1156 nmdc:mga0yw44_46962_c1 3300050492 Bacteria 2597
1157 nmdc:mga0yw44_79520_c1 3300050492 Bacteria 2052
1158 nmdc:mga0yw44_81001_c1 3300050492 Bacteria 2035
1159 nmdc:mga0yw44_82070_c1 3300050492 Bacteria 2022
1160 nmdc:mga0k408_4051_c1 3300050493 Bacteria 7774
1161 nmdc:mga0k408_46879_c1 3300050493 Bacteria 2497
1162 nmdc:mga0k408_70815_c1 3300050493 Bacteria 2035
1163 nmdc:mga06z11_120663_c1 3300050494 Bacteria 1462
1164 nmdc:mga06z11_208593_c1 3300050494 Bacteria 1138
1165 nmdc:mga06z11_65644_c1 3300050494 Bacteria 1905
1166 nmdc:mga06z11_70089_c1 3300050494 Bacteria 1853
1167 nmdc:mga04h51_24192_c1 3300050495 Bacteria 1858
1168 nmdc:mga04h51_7894_c1 3300050495 Bacteria 2829
1169 nmdc:mga07m45_29552_c1 3300050496 Bacteria 3032
1170 nmdc:mga07m45_3594_c1 3300050496 Bacteria 4314
1171 nmdc:mga07m45_4538_c1 3300050496 Bacteria 6801
1172 nmdc:mga05p37_130168_c1 3300050507 Bacteria 3087
1173 nmdc:mga05p37_1334_c1 3300050507 Bacteria 28685
1174 nmdc:mga05p37_142693_c2 3300050507 Unclassified 2514
1175 nmdc:mga05p37_243135_c1 3300050507 Bacteria 2163
1176 nmdc:mga05p37_5239_c2 3300050507 Bacteria 13210
1177 nmdc:mga09592_10920_c1 3300050508 Bacteria 7391
1178 nmdc:mga09592_297237_c1 3300050508 Bacteria 1400
1179 nmdc:mga0qj67_13891_c1 3300050509 Bacteria 6080
1180 nmdc:mga0qj67_20483_c1 3300050509 Bacteria 5064
1181 nmdc:mga0qj67_60_c1 3300050509 Bacteria 80228
1182 nmdc:mga0qj67_7222_c1 3300050509 Bacteria 8204
1183 nmdc:mga06r32_19847_c1 3300050510 Bacteria 6176
1184 nmdc:mga06r32_215358_c1 3300050510 Bacteria 1908
1185 nmdc:mga06r32_872_c1 3300050510 Bacteria 26841
1186 nmdc:mga08y16_193845_c1 3300050511 Bacteria 2107
1187 nmdc:mga08y16_201752_c1 3300050511 Bacteria 2061
1188 nmdc:mga08y16_297343_c1 3300050511 Bacteria 1664
1189 nmdc:mga08y16_9141_c1 3300050511 Bacteria 10401
1190 nmdc:mga08y16_95120_c1 3300050511 Bacteria 3103
1191 nmdc:mga0n895_1132_c1 3300050512 Bacteria 19499
1192 nmdc:mga0n895_159639_c1 3300050512 Bacteria 2286
1193 nmdc:mga0n895_21125_c1 3300050512 Bacteria 6083
1194 nmdc:mga0rr50_67985_c1 3300050513 Bacteria 2708
1195 nmdc:mga0a205_13217_c1 3300050515 Bacteria 7673
1196 nmdc:mga0a205_5869_c2 3300050515 Bacteria 10044
1197 nmdc:mga0a205_78600_c1 3300050515 Unclassified 2312
1198 nmdc:mga0a205_85283_c1 3300050515 Bacteria 3050
1199 nmdc:mga0sz30_13927_c1 3300050516 Bacteria 3157
1200 nmdc:mga0sz30_19236_c1 3300050516 Bacteria 2743
1201 nmdc:mga0sz30_24187_c1 3300050516 Bacteria 2478
1202 nmdc:mga0sz30_56386_c1 3300050516 Bacteria 1673
1203 Ga0495601_0005803 3300053077 Bacteria 7198
1204 Ga0495601_0011057 3300053077 Bacteria 5392
1205 Ga0495601_0049193 3300053077 Bacteria 2658
1206 Ga0495601_0080475 3300053077 Bacteria 2090
1207 Ga0495601_0140465 3300053077 Bacteria 1575
1208 Ga0495601_0169888 3300053077 Bacteria 1425
1209 Ga0495612_0007050 3300053078 Bacteria 4598
1210 Ga0495612_0016525 3300053078 Bacteria 2956
1211 Ga0495612_0053459 3300053078 Bacteria 1663
1212 Ga0495612_0055746 3300053078 Bacteria 1630
1213 Ga0500610_0070254 3300053079 Bacteria 1826
1214 Ga0500635_0002704 3300053080 Bacteria 4399
1215 Ga0495655_0012562 3300053083 Bacteria 1729
1216 Ga0495655_0037016 3300053083 Bacteria 1223
1217 Ga0495595_0001332 3300053084 Bacteria 9605
1218 Ga0495595_0020033 3300053084 Bacteria 2907
1219 Ga0495595_0063076 3300053084 Unclassified 1739
1220 Ga0495619_0001258 3300053085 Bacteria 16610
1221 Ga0495619_0028778 3300053085 Bacteria 3586
1222 Ga0495619_0050904 3300053085 Bacteria 2735
1223 Ga0495619_0058284 3300053085 Bacteria 2563
1224 Ga0495619_0059483 3300053085 Bacteria 2538
1225 Ga0495619_0178144 3300053085 Bacteria 1470
1226 Ga0495619_0295338 3300053085 Bacteria 1122
1227 Ga0500643_000013 3300053087 Bacteria 324296
1228 Ga0500644_0106857 3300053088 Bacteria 1072
1229 Ga0500647_0009841 3300053091 Bacteria 4210
1230 Ga0500566_0021751 3300053094 Bacteria 3769
1231 Ga0500641_0006994 3300053096 Bacteria 4017
1232 Ga0500641_0116311 3300053096 Bacteria 1152
1233 Ga0500555_005931 3300053103 Bacteria 3467
1234 Ga0500556_0025840 3300053104 Bacteria 1944
1235 Ga0500557_000030 3300053105 Bacteria 76944
1236 Ga0500569_016936 3300053109 Bacteria 1854
1237 Ga0500594_0015471 3300053118 Bacteria 1841
1238 Ga0500595_002714 3300053119 Bacteria 8575
1239 Ga0500626_079396 3300053128 Bacteria 1452
1240 Ga0500642_0000148 3300053130 Bacteria 30505
1241 Ga0500642_0032629 3300053130 Bacteria 2186
1242 Ga0500652_036114 3300053131 Bacteria 1966
1243 Ga0500655_008285 3300053133 Bacteria 1871
1244 Ga0500568_0001375 3300053139 Bacteria 15794
1245 Ga0500577_0029299 3300053142 Bacteria 1905
1246 Ga0500588_0020728 3300053146 Bacteria 1765
1247 Ga0500604_0000076 3300053151 Bacteria 35570
1248 Ga0500616_0125787 3300053153 Bacteria 1218
1249 Ga0500620_004246 3300053155 Bacteria 3178
1250 Ga0500636_0002634 3300053177 Bacteria 9976
1251 Ga0500637_0208125 3300053178 Bacteria 1111
1252 Ga0500611_021128 3300053727 Bacteria 1239
1253 Ga0500645_038077 3300053730 Bacteria 1427
1254 Ga0500552_006385 3300053733 Bacteria 1321
1255 Ga0500601_000287 3300053737 Bacteria 9581
1256 Ga0501084_0045564 3300054114 Bacteria 3672
1257 Ga0501084_0059048 3300054114 Bacteria 3210
1258 Ga0501084_0432468 3300054114 Bacteria 1113
1259 Ga0501082_0371760 3300060353 Bacteria 1247
1260 Ga0501082_0434332 3300060353 Bacteria 1147
1261 Ga0466962_0047456 3300061719 Bacteria 2052
1262 Ga0530510_0150803 3300061734 Bacteria 1717
1263 Ga0530510_0220795 3300061734 Bacteria 1408

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035241 Ga0373961_0002074 Ga0373961_0002074_890_1939 321
2 3300005435 Ga0070714_100170156 Ga0070714_1001701562 326
3 3300006175 Ga0070712_100405114 Ga0070712_1004051141 326
4 3300006195 Ga0075366_10022553 Ga0075366_100225533 326
5 3300031251 Ga0265327_10017705 Ga0265327_100177055 326
6 3300031711 Ga0265314_10007260 Ga0265314_100072608 326
7 3300041511 Ga0451855_1643489 Ga0451855_1643489_48_1067 326
8 3300048915 Ga0496112_0304835 Ga0496112_0304835_361_1341 326
9 3300042003 Ga0439443_018774 Ga0439443_018774_62_1045 327
10 3300009551 Ga0105238_10018456 Ga0105238_1001845610 330
11 3300025924 Ga0207694_10254184 Ga0207694_102541841 330
12 3300048918 Ga0496115_0164149 Ga0496115_0164149_267_1295 330
13 3300039450 Ga0436363_0548376 Ga0436363_0548376_966_2000 331
14 3300005347 Ga0070668_100314952 Ga0070668_1003149521 332
15 3300005356 Ga0070674_100201057 Ga0070674_1002010571 332
16 3300005456 Ga0070678_100218123 Ga0070678_1002181231 332
17 3300005548 Ga0070665_100076145 Ga0070665_1000761452 332
18 3300006038 Ga0075365_10049112 Ga0075365_100491121 332
19 3300006178 Ga0075367_10013424 Ga0075367_100134242 332
20 3300009098 Ga0105245_10308143 Ga0105245_103081432 332
21 3300009545 Ga0105237_10033636 Ga0105237_100336364 332
22 3300009551 Ga0105238_10005684 Ga0105238_1000568411 332
23 3300009551 Ga0105238_10018513 Ga0105238_100185133 332
24 3300009551 Ga0105238_10192947 Ga0105238_101929472 332
25 3300025914 Ga0207671_10063316 Ga0207671_100633162 332
26 3300025924 Ga0207694_10010911 Ga0207694_100109112 332
27 3300025924 Ga0207694_10043684 Ga0207694_100436844 332
28 3300025924 Ga0207694_10223928 Ga0207694_102239281 332
29 3300028379 Ga0268266_10084829 Ga0268266_100848292 332
30 3300031616 Ga0307508_10044378 Ga0307508_100443784 332
31 3300031730 Ga0307516_10069114 Ga0307516_100691142 332
32 3300046616 Ga0495668_0028576 Ga0495668_0028576_397_1425 332
33 3300047317 Ga0495604_0116525 Ga0495604_0116525_926_1924 332
34 3300048903 Ga0496100_0131773 Ga0496100_0131773_561_1589 332
35 3300048924 Ga0496121_0039187 Ga0496121_0039187_1060_2088 332
36 3300048927 Ga0496124_0063566 Ga0496124_0063566_1909_2937 332
37 3300048928 Ga0496125_0175403 Ga0496125_0175403_386_1414 332
38 3300050492 nmdc:mga0yw44_81001_c1 nmdc:mga0yw44_81001_c1_337_1365 332
39 3300050494 nmdc:mga06z11_65644_c1 nmdc:mga06z11_65644_c1_41_1069 332
40 3300025315 Ga0207697_10045225 Ga0207697_100452251 333
41 3300046683 Ga0495658_0037171 Ga0495658_0037171_211_1221 336
42 3300049588 Ga0501072_0218692 Ga0501072_0218692_22_1041 336
43 iso_pu_bacteria 2507262055 2507511923 338
44 iso_pu_bacteria 2508501009 2508545589 338
45 iso_pu_bacteria 2508501042 2508694405 338
46 iso_pu_bacteria 2511231028 2511401229 338
47 iso_pu_bacteria 2513237094 2513643262 338
48 iso_pu_bacteria 2513237095 2513651051 338
49 iso_pu_bacteria 2513237098 2513676776 338
50 iso_pu_bacteria 2513237104 2513717745 338
51 iso_pu_bacteria 2513237141 2513891095 338
52 iso_pu_bacteria 2515154112 2515624667 338
53 iso_pu_bacteria 2524023205 2524436621 338
54 iso_pu_bacteria 2524023210 2524464086 338
55 iso_pu_bacteria 2524023228 2524539893 338
56 iso_pu_bacteria 2617270735 2617349674 338
57 iso_pu_bacteria 2667528175 2671123355 338
58 iso_pu_bacteria 2728368998 2728752241 338
59 iso_pu_bacteria 2744054633 2745079305 338
60 iso_pu_bacteria 2791355197 2793067112 338
61 iso_pu_bacteria 2791355199 2793078362 338
62 iso_pu_bacteria 2816332527 2818242233 338
63 iso_pu_bacteria 2824600985 2824607199 338
64 iso_pu_bacteria 2824609381 2824615101 338
65 iso_pu_bacteria 2824653114 2824660179 338
66 iso_pu_bacteria 2824661429 2824668462 338
67 iso_pu_bacteria 2824679649 2824684330 338
68 iso_pu_bacteria 2844315083 2844321142 338
69 iso_pu_bacteria 2849076700 2849077219 338
70 iso_pu_bacteria 2857509624 2857515206 338
71 iso_pu_bacteria 2874590934 2874592188 338
72 iso_pu_bacteria 2874628541 2874630933 338
73 iso_pu_bacteria 2874645413 2874647022 338
74 iso_pu_bacteria 2876761206 2876767463 338
75 iso_pu_bacteria 2876771140 2876772399 338
76 iso_pu_bacteria 2876818435 2876819668 338
77 iso_pu_bacteria 2879074833 2879076243 338
78 iso_pu_bacteria 2879099564 2879100164 338
79 iso_pu_bacteria 2879127579 2879132576 338
80 iso_pu_bacteria 2879142872 2879144714 338
81 iso_pu_bacteria 2885409591 2885414221 338
82 iso_pu_bacteria 2888378607 2888387430 338
83 iso_pu_bacteria 2888388044 2888391767 338
84 iso_pu_bacteria 2888419890 2888426652 338
85 iso_pu_bacteria 2903727486 2903728566 338
86 iso_pu_bacteria 2903748898 2903756709 338
87 iso_pu_bacteria 2904690495 2904692973 338
88 iso_pu_bacteria 2904699407 2904709784 338
89 iso_pu_bacteria 2906602504 2906607757 338
90 iso_pu_bacteria 2906610324 2906614349 338
91 iso_pu_bacteria 2906635258 2906639154 338
92 iso_pu_bacteria 2906660503 2906666722 338
93 iso_pu_bacteria 2908756301 2908758005 338
94 iso_pu_bacteria 2922368715 2922370509 338
95 iso_pu_bacteria 2922386360 2922392080 338
96 iso_pu_bacteria 2922393267 2922396482 338
97 iso_pu_bacteria 2922425934 2922426178 338
98 iso_pu_bacteria 2929615660 2929620089 338
99 iso_pu_bacteria 2929624759 2929629402 338
100 iso_pu_bacteria 2932784394 2932791445 338
101 iso_pu_bacteria 2932809354 2932816699 338
102 iso_pu_bacteria 2932818245 2932824119 338
103 iso_pu_bacteria 2932828146 2932835347 338
104 iso_pu_bacteria 2933577622 2933582006 338
105 iso_pu_bacteria 2935608549 2935613433 338
106 iso_pu_bacteria 2935616580 2935621090 338
107 iso_pu_bacteria 2935630451 2935632566 338
108 iso_pu_bacteria 2935638405 2935643603 338
109 iso_pu_bacteria 2935648319 2935656500 338
110 iso_pu_bacteria 2935656913 2935665315 338
111 iso_pu_bacteria 2935665750 2935671087 338
112 iso_pu_bacteria 2935675223 2935681307 338
113 iso_pu_bacteria 2935684952 2935689347 338
114 iso_pu_bacteria 2935694250 2935699925 338
115 iso_pu_bacteria 2935703347 2935712144 338
116 iso_pu_bacteria 2935713505 2935720293 338
117 iso_pu_bacteria 2935722832 2935728090 338
118 iso_pu_bacteria 2935732158 2935737313 338
119 iso_pu_bacteria 2935741537 2935746626 338
120 iso_pu_bacteria 2935750917 2935757593 338
121 iso_pu_bacteria 2935760218 2935763969 338
122 iso_pu_bacteria 2935769743 2935776689 338
123 iso_pu_bacteria 2935777560 2935784028 338
124 iso_pu_bacteria 2935785616 2935789900 338
125 iso_pu_bacteria 2935793552 2935798334 338
126 iso_pu_bacteria 2935801545 2935807944 338
127 iso_pu_bacteria 2935810662 2935818720 338
128 iso_pu_bacteria 2935819856 2935824714 338
129 iso_pu_bacteria 2935827899 2935833120 338
130 iso_pu_bacteria 2935837841 2935844224 338
131 iso_pu_bacteria 2935847175 2935851934 338
132 iso_pu_bacteria 2935855204 2935859717 338
133 iso_pu_bacteria 2935864058 2935872115 338
134 iso_pu_bacteria 2935873716 2935878961 338
135 iso_pu_bacteria 2935908558 2935911281 338
136 iso_pu_bacteria 2935916978 2935920813 338
137 iso_pu_bacteria 2935926038 2935928310 338
138 iso_pu_bacteria 2935934488 2935937955 338
139 iso_pu_bacteria 2935942939 2935945237 338
140 iso_pu_bacteria 2935951376 2935954257 338
141 iso_pu_bacteria 2935959822 2935965664 338
142 iso_pu_bacteria 2935967501 2935971475 338
143 iso_pu_bacteria 2935975950 2935982094 338
144 iso_pu_bacteria 2935984226 2935990565 338
145 iso_pu_bacteria 2935992306 2936000308 338
146 iso_pu_bacteria 2936002035 2936008466 338
147 iso_pu_bacteria 2936011229 2936019391 338
148 iso_pu_bacteria 2936019824 2936027973 338
149 iso_pu_bacteria 2936028420 2936036756 338
150 iso_pu_bacteria 2936037263 2936045530 338
151 iso_pu_bacteria 2936046547 2936054817 338
152 iso_pu_bacteria 2936055302 2936063253 338
153 iso_pu_bacteria 2940556831 2940563585 338
154 iso_pu_bacteria 2941507105 2941508770 338
155 iso_pu_bacteria 2941515067 2941516600 338
156 iso_pu_bacteria 2941523033 2941524384 338
157 iso_pu_bacteria 2941531003 2941537315 338
158 iso_pu_bacteria 2941538514 2941542556 338
159 iso_pu_bacteria 3005474847 3005483366 338
160 iso_pu_bacteria 3005506211 3005506864 338
161 iso_pu_bacteria 3005594810 3005601478 338
162 iso_pu_bacteria 3005718088 3005724173 338
163 iso_pu_bacteria 8006926726 8006929307 338
164 iso_pu_bacteria 8006933436 8006936881 338
165 iso_pu_bacteria 8006964411 8006968975 338
166 iso_pu_bacteria 8006973647 8006976851 338
167 iso_pu_bacteria 8016511872 8016519441 338
168 iso_pu_bacteria 8016522445 8016524919 338
169 iso_pu_bacteria 8016530956 8016538493 338
170 iso_pu_bacteria 8016548790 8016550509 338
171 iso_pu_bacteria 8016557553 8016558925 338
172 iso_pu_bacteria 8016566248 8016568162 338
173 iso_pu_bacteria 8016575299 8016580833 338
174 iso_pu_bacteria 8016595262 8016596891 338
175 iso_pu_bacteria 8016603502 8016607794 338
176 iso_pu_bacteria 8016613128 8016619578 338
177 iso_pu_bacteria 8016622563 8016630026 338
178 iso_pu_bacteria 8016630954 8016637139 338
179 iso_pu_bacteria 8017057580 8017066079 338
180 iso_pu_bacteria 8019530166 8019538160 338
181 iso_pu_bacteria 8019538911 8019541826 338
182 iso_pu_bacteria 8019547302 8019548971 338
183 iso_pu_bacteria 8019555841 8019561806 338
184 iso_pu_bacteria 8019576017 8019578555 338
185 iso_pu_bacteria 8019597564 8019605100 338
186 iso_pu_bacteria 8019608314 8019613435 338
187 iso_pu_bacteria 8019619141 8019624106 338
188 iso_pu_bacteria 8019638758 8019641701 338
189 iso_pu_bacteria 8019648815 8019653625 338
190 iso_pu_bacteria 8019659431 8019665853 338
191 iso_pu_bacteria 8019668869 8019675378 338
192 iso_pu_bacteria 8019687851 8019695042 338
193 iso_pu_bacteria 8055742211 8055750158 338
194 iso_pu_bacteria 8056673599 8056675153 338
195 iso_pu_bacteria 8056681323 8056683821 338
196 iso_pu_bacteria 8056689827 8056695508 338
197 iso_pu_bacteria 8056967851 8056975939 338
198 3300006852 Ga0075433_10241602 Ga0075433_102416021 339
199 3300006871 Ga0075434_100162467 Ga0075434_1001624672 339
200 3300009147 Ga0114129_10391778 Ga0114129_103917782 339
201 3300049588 Ga0501072_0234141 Ga0501072_0234141_351_1373 339
202 3300050507 nmdc:mga05p37_130168_c1 nmdc:mga05p37_130168_c1_494_1513 339
203 3300050507 nmdc:mga05p37_243135_c1 nmdc:mga05p37_243135_c1_18_1037 339
204 3300050515 nmdc:mga0a205_78600_c1 nmdc:mga0a205_78600_c1_142_1161 339
205 3300060353 Ga0501082_0371760 Ga0501082_0371760_189_1211 339
206 3300005290 Ga0065712_10084473 Ga0065712_100844732 340
207 3300005328 Ga0070676_10008503 Ga0070676_100085032 340
208 3300005328 Ga0070676_10162852 Ga0070676_101628522 340
209 3300005329 Ga0070683_100031382 Ga0070683_1000313824 340
210 3300005329 Ga0070683_100127712 Ga0070683_1001277122 340
211 3300005336 Ga0070680_100056430 Ga0070680_1000564303 340
212 3300005338 Ga0068868_100015981 Ga0068868_1000159812 340
213 3300005339 Ga0070660_100056660 Ga0070660_1000566603 340
214 3300005339 Ga0070660_100063926 Ga0070660_1000639262 340
215 3300005340 Ga0070689_100070947 Ga0070689_1000709472 340
216 3300005344 Ga0070661_100049192 Ga0070661_1000491922 340
217 3300005344 Ga0070661_100092167 Ga0070661_1000921672 340
218 3300005345 Ga0070692_10012291 Ga0070692_100122912 340
219 3300005347 Ga0070668_100005028 Ga0070668_1000050282 340
220 3300005353 Ga0070669_100001136 Ga0070669_1000011367 340
221 3300005353 Ga0070669_100014984 Ga0070669_1000149841 340
222 3300005354 Ga0070675_100000365 Ga0070675_10000036520 340
223 3300005355 Ga0070671_100094583 Ga0070671_1000945832 340
224 3300005355 Ga0070671_100133082 Ga0070671_1001330822 340
225 3300005364 Ga0070673_100021133 Ga0070673_1000211332 340
226 3300005366 Ga0070659_100022782 Ga0070659_1000227823 340
227 3300005366 Ga0070659_100053883 Ga0070659_1000538832 340
228 3300005367 Ga0070667_100186583 Ga0070667_1001865832 340
229 3300005438 Ga0070701_10029808 Ga0070701_100298082 340
230 3300005441 Ga0070700_100035554 Ga0070700_1000355542 340
231 3300005444 Ga0070694_100051836 Ga0070694_1000518362 340
232 3300005457 Ga0070662_100003276 Ga0070662_1000032762 340
233 3300005458 Ga0070681_10000803 Ga0070681_1000080312 340
234 3300005459 Ga0068867_100038385 Ga0068867_1000383853 340
235 3300005459 Ga0068867_100083365 Ga0068867_1000833652 340
236 3300005466 Ga0070685_10006952 Ga0070685_100069525 340
237 3300005530 Ga0070679_100040035 Ga0070679_1000400354 340
238 3300005535 Ga0070684_100015025 Ga0070684_1000150254 340
239 3300005539 Ga0068853_100037040 Ga0068853_1000370403 340
240 3300005543 Ga0070672_100049384 Ga0070672_1000493843 340
241 3300005548 Ga0070665_100063248 Ga0070665_1000632482 340
242 3300005548 Ga0070665_100168286 Ga0070665_1001682862 340
243 3300005549 Ga0070704_100062298 Ga0070704_1000622982 340
244 3300005563 Ga0068855_100068502 Ga0068855_1000685024 340
245 3300005564 Ga0070664_100038829 Ga0070664_1000388293 340
246 3300005577 Ga0068857_100004346 Ga0068857_1000043466 340
247 3300005577 Ga0068857_100065042 Ga0068857_1000650423 340
248 3300005614 Ga0068856_100117640 Ga0068856_1001176402 340
249 3300005618 Ga0068864_100261910 Ga0068864_1002619101 340
250 3300005719 Ga0068861_100000284 Ga0068861_10000028412 340
251 3300005719 Ga0068861_100010236 Ga0068861_1000102365 340
252 3300005834 Ga0068851_10041856 Ga0068851_100418562 340
253 3300005840 Ga0068870_10024962 Ga0068870_100249622 340
254 3300005841 Ga0068863_100054261 Ga0068863_1000542613 340
255 3300005842 Ga0068858_100025802 Ga0068858_1000258022 340
256 3300005843 Ga0068860_100058958 Ga0068860_1000589582 340
257 3300005844 Ga0068862_100007523 Ga0068862_1000075235 340
258 3300005844 Ga0068862_100013165 Ga0068862_1000131655 340
259 3300006844 Ga0075428_100040276 Ga0075428_1000402763 340
260 3300006844 Ga0075428_100246218 Ga0075428_1002462182 340
261 3300006846 Ga0075430_100096955 Ga0075430_1000969553 340
262 3300006847 Ga0075431_100032668 Ga0075431_1000326684 340
263 3300006847 Ga0075431_100224885 Ga0075431_1002248852 340
264 3300006852 Ga0075433_10010808 Ga0075433_100108085 340
265 3300006852 Ga0075433_10034944 Ga0075433_100349443 340
266 3300006871 Ga0075434_100004164 Ga0075434_1000041645 340
267 3300006871 Ga0075434_100044403 Ga0075434_1000444032 340
268 3300006881 Ga0068865_100007637 Ga0068865_1000076375 340
269 3300009094 Ga0111539_10083128 Ga0111539_100831282 340
270 3300009094 Ga0111539_10149736 Ga0111539_101497362 340
271 3300009094 Ga0111539_10555105 Ga0111539_105551052 340
272 3300009147 Ga0114129_10142212 Ga0114129_101422122 340
273 3300009148 Ga0105243_10400426 Ga0105243_104004261 340
274 3300009177 Ga0105248_10031690 Ga0105248_100316903 340
275 3300009553 Ga0105249_10000856 Ga0105249_1000085611 340
276 3300009553 Ga0105249_10016849 Ga0105249_100168495 340
277 3300010375 Ga0105239_10009663 Ga0105239_100096637 340
278 3300013102 Ga0157371_10016750 Ga0157371_100167505 340
279 3300013296 Ga0157374_10127784 Ga0157374_101277842 340
280 3300013297 Ga0157378_10158715 Ga0157378_101587152 340
281 3300013306 Ga0163162_10000455 Ga0163162_1000045521 340
282 3300013307 Ga0157372_10184582 Ga0157372_101845822 340
283 3300013308 Ga0157375_10329444 Ga0157375_103294442 340
284 3300014326 Ga0157380_10059354 Ga0157380_100593543 340
285 3300014326 Ga0157380_10065377 Ga0157380_100653772 340
286 3300014745 Ga0157377_10035023 Ga0157377_100350232 340
287 3300014968 Ga0157379_10019593 Ga0157379_100195934 340
288 3300025315 Ga0207697_10007171 Ga0207697_100071712 340
289 3300025901 Ga0207688_10008820 Ga0207688_100088202 340
290 3300025907 Ga0207645_10001838 Ga0207645_100018382 340
291 3300025908 Ga0207643_10005957 Ga0207643_100059574 340
292 3300025912 Ga0207707_10036741 Ga0207707_100367412 340
293 3300025917 Ga0207660_10068374 Ga0207660_100683742 340
294 3300025918 Ga0207662_10001083 Ga0207662_100010837 340
295 3300025920 Ga0207649_10061824 Ga0207649_100618242 340
296 3300025921 Ga0207652_10041084 Ga0207652_100410844 340
297 3300025923 Ga0207681_10004103 Ga0207681_100041033 340
298 3300025925 Ga0207650_10010290 Ga0207650_100102903 340
299 3300025926 Ga0207659_10043983 Ga0207659_100439832 340
300 3300025926 Ga0207659_10067884 Ga0207659_100678842 340
301 3300025932 Ga0207690_10015263 Ga0207690_100152634 340
302 3300025932 Ga0207690_10071490 Ga0207690_100714902 340
303 3300025932 Ga0207690_10292684 Ga0207690_102926841 340
304 3300025933 Ga0207706_10000990 Ga0207706_100009902 340
305 3300025933 Ga0207706_10152466 Ga0207706_101524662 340
306 3300025934 Ga0207686_10011739 Ga0207686_100117394 340
307 3300025940 Ga0207691_10001949 Ga0207691_100019492 340
308 3300025944 Ga0207661_10054376 Ga0207661_100543763 340
309 3300025944 Ga0207661_10109696 Ga0207661_101096961 340
310 3300025945 Ga0207679_10009971 Ga0207679_100099713 340
311 3300025945 Ga0207679_10013569 Ga0207679_100135694 340
312 3300025949 Ga0207667_10071811 Ga0207667_100718113 340
313 3300025960 Ga0207651_10077182 Ga0207651_100771822 340
314 3300025960 Ga0207651_10382867 Ga0207651_103828671 340
315 3300025961 Ga0207712_10003551 Ga0207712_100035512 340
316 3300025961 Ga0207712_10003886 Ga0207712_100038861 340
317 3300025972 Ga0207668_10013252 Ga0207668_100132524 340
318 3300025986 Ga0207658_10045620 Ga0207658_100456202 340
319 3300026023 Ga0207677_10053403 Ga0207677_100534032 340
320 3300026035 Ga0207703_10044165 Ga0207703_100441653 340
321 3300026041 Ga0207639_10041751 Ga0207639_100417513 340
322 3300026075 Ga0207708_10019062 Ga0207708_100190624 340
323 3300026075 Ga0207708_10126100 Ga0207708_101261001 340
324 3300026088 Ga0207641_10048523 Ga0207641_100485232 340
325 3300026089 Ga0207648_10137448 Ga0207648_101374481 340
326 3300026095 Ga0207676_10020701 Ga0207676_100207013 340
327 3300026116 Ga0207674_10000142 Ga0207674_1000014223 340
328 3300026116 Ga0207674_10001633 Ga0207674_1000163318 340
329 3300026118 Ga0207675_100000141 Ga0207675_10000014122 340
330 3300026118 Ga0207675_100014983 Ga0207675_1000149833 340
331 3300026142 Ga0207698_10032961 Ga0207698_100329614 340
332 3300026142 Ga0207698_10100753 Ga0207698_101007531 340
333 3300027907 Ga0207428_10106598 Ga0207428_101065981 340
334 3300028379 Ga0268266_10174702 Ga0268266_101747022 340
335 3300028380 Ga0268265_10005120 Ga0268265_100051206 340
336 3300028380 Ga0268265_10017172 Ga0268265_100171722 340
337 3300028381 Ga0268264_10033347 Ga0268264_100333474 340
338 3300031548 Ga0307408_100000558 Ga0307408_1000005589 340
339 3300031852 Ga0307410_10285743 Ga0307410_102857432 340
340 3300031901 Ga0307406_10008537 Ga0307406_100085372 340
341 3300031903 Ga0307407_10144837 Ga0307407_101448371 340
342 3300031995 Ga0307409_100093333 Ga0307409_1000933332 340
343 3300032004 Ga0307414_10222078 Ga0307414_102220782 340
344 3300045051 Ga0451576_0114353 Ga0451576_0114353_1208_2230 340
345 3300048912 Ga0496109_0089707 Ga0496109_0089707_1153_2175 340
346 3300050507 nmdc:mga05p37_142693_c2 nmdc:mga05p37_142693_c2_519_1541 340
347 3300050510 nmdc:mga06r32_19847_c1 nmdc:mga06r32_19847_c1_4457_5479 340
348 3300050511 nmdc:mga08y16_95120_c1 nmdc:mga08y16_95120_c1_1594_2616 340
349 3300050512 nmdc:mga0n895_1132_c1 nmdc:mga0n895_1132_c1_9771_10793 340
350 3300050513 nmdc:mga0rr50_67985_c1 nmdc:mga0rr50_67985_c1_1226_2248 340
351 3300050515 nmdc:mga0a205_13217_c1 nmdc:mga0a205_13217_c1_1820_2842 340
352 3300050515 nmdc:mga0a205_5869_c2 nmdc:mga0a205_5869_c2_4710_5732 340
353 iso_pu_bacteria 2721755755 2723846965 340
354 3300005331 Ga0070670_100130805 Ga0070670_1001308052 341
355 3300005353 Ga0070669_100077593 Ga0070669_1000775932 341
356 3300005354 Ga0070675_100027181 Ga0070675_1000271814 341
357 3300005436 Ga0070713_100186122 Ga0070713_1001861222 341
358 3300005543 Ga0070672_100030675 Ga0070672_1000306752 341
359 3300006178 Ga0075367_10114927 Ga0075367_101149272 341
360 3300006846 Ga0075430_100001819 Ga0075430_1000018194 341
361 3300006846 Ga0075430_100012216 Ga0075430_1000122166 341
362 3300006847 Ga0075431_100043586 Ga0075431_1000435864 341
363 3300006880 Ga0075429_100146323 Ga0075429_1001463232 341
364 3300009177 Ga0105248_10099062 Ga0105248_100990622 341
365 3300015262 Ga0182007_10034088 Ga0182007_100340881 341
366 3300025923 Ga0207681_10167319 Ga0207681_101673191 341
367 3300025925 Ga0207650_10030878 Ga0207650_100308784 341
368 3300025940 Ga0207691_10002037 Ga0207691_100020377 341
369 3300028800 Ga0265338_10016733 Ga0265338_100167332 341
370 3300031249 Ga0265339_10000052 Ga0265339_1000005210 341
371 3300031595 Ga0265313_10000843 Ga0265313_100008434 341
372 3300031712 Ga0265342_10107310 Ga0265342_101073101 341
373 3300032002 Ga0307416_100063021 Ga0307416_1000630212 341
374 3300035086 Ga0373934_0042137 Ga0373934_0042137_102_1127 341
375 3300035171 Ga0373946_0038734 Ga0373946_0038734_308_1333 341
376 3300035410 Ga0373924_0059470 Ga0373924_0059470_424_1449 341
377 3300035724 Ga0373933_0171821 Ga0373933_0171821_189_1214 341
378 3300046463 Ga0495653_0166653 Ga0495653_0166653_487_1512 341
379 3300046511 Ga0495608_0019475 Ga0495608_0019475_2978_4003 341
380 3300046514 Ga0495618_0048874 Ga0495618_0048874_1538_2563 341
381 3300046533 Ga0495640_0067077 Ga0495640_0067077_679_1704 341
382 3300046543 Ga0495645_0140216 Ga0495645_0140216_529_1554 341
383 3300046663 Ga0495635_0036633 Ga0495635_0036633_1730_2755 341
384 3300047317 Ga0495604_0091819 Ga0495604_0091819_803_1828 341
385 3300047322 Ga0495680_0079188 Ga0495680_0079188_1000_2025 341
386 3300047444 Ga0495675_0058848 Ga0495675_0058848_696_1721 341
387 3300047471 Ga0495684_0122289 Ga0495684_0122289_378_1403 341
388 3300047673 Ga0495593_0050796 Ga0495593_0050796_758_1783 341
389 3300048088 Ga0495602_0114921 Ga0495602_0114921_551_1576 341
390 3300048911 Ga0496108_0226935 Ga0496108_0226935_374_1474 341
391 3300048912 Ga0496109_0200080 Ga0496109_0200080_319_1419 341
392 3300049576 Ga0501040_0094632 Ga0501040_0094632_405_1463 341
393 3300049578 Ga0501042_0043428 Ga0501042_0043428_1621_2646 341
394 3300049588 Ga0501072_0109122 Ga0501072_0109122_74_1099 341
395 3300049591 Ga0501075_0124073 Ga0501075_0124073_240_1265 341
396 3300049592 Ga0501076_0031722 Ga0501076_0031722_1006_2031 341
397 3300049743 Ga0501081_0095296 Ga0501081_0095296_55_1080 341
398 3300050489 nmdc:mga03683_25741_c1 nmdc:mga03683_25741_c1_1146_2225 341
399 3300050508 nmdc:mga09592_297237_c1 nmdc:mga09592_297237_c1_272_1297 341
400 3300050509 nmdc:mga0qj67_13891_c1 nmdc:mga0qj67_13891_c1_4987_6012 341
401 3300050509 nmdc:mga0qj67_20483_c1 nmdc:mga0qj67_20483_c1_3052_4077 341
402 3300050510 nmdc:mga06r32_215358_c1 nmdc:mga06r32_215358_c1_29_1054 341
403 3300050511 nmdc:mga08y16_297343_c1 nmdc:mga08y16_297343_c1_470_1549 341
404 3300053084 Ga0495595_0020033 Ga0495595_0020033_1312_2337 341
405 3300053088 Ga0500644_0106857 Ga0500644_0106857_19_1044 341
406 3300054114 Ga0501084_0059048 Ga0501084_0059048_2076_3101 341
407 3300061734 Ga0530510_0220795 Ga0530510_0220795_245_1270 341
408 3300001990 JGI24737J22298_10019573 JGI24737J22298_100195732 342
409 3300001991 JGI24743J22301_10011395 JGI24743J22301_100113952 342
410 3300002070 JGI24750J21931_1007354 JGI24750J21931_10073542 342
411 3300002075 JGI24738J21930_10019661 JGI24738J21930_100196612 342
412 3300002077 JGI24744J21845_10006724 JGI24744J21845_100067242 342
413 3300003203 JGI25406J46586_10000068 JGI25406J46586_1000006819 342
414 3300003215 JGI25153J46596_10005581 JGI25153J46596_100055815 342
415 3300003762 Ga0055542_1005310 Ga0055542_10053102 342
416 3300005262 Ga0065165_1001267 Ga0065165_10012677 342
417 3300005262 Ga0065165_1002212 Ga0065165_10022127 342
418 3300005327 Ga0070658_10185375 Ga0070658_101853751 342
419 3300005329 Ga0070683_100008412 Ga0070683_1000084124 342
420 3300005329 Ga0070683_100100301 Ga0070683_1001003012 342
421 3300005330 Ga0070690_100017752 Ga0070690_1000177525 342
422 3300005330 Ga0070690_100069739 Ga0070690_1000697392 342
423 3300005331 Ga0070670_100002030 Ga0070670_10000203014 342
424 3300005331 Ga0070670_100067088 Ga0070670_1000670882 342
425 3300005334 Ga0068869_100107594 Ga0068869_1001075941 342
426 3300005336 Ga0070680_100010166 Ga0070680_1000101665 342
427 3300005336 Ga0070680_100047355 Ga0070680_1000473552 342
428 3300005337 Ga0070682_100064243 Ga0070682_1000642432 342
429 3300005337 Ga0070682_100088855 Ga0070682_1000888552 342
430 3300005337 Ga0070682_100117730 Ga0070682_1001177303 342
431 3300005337 Ga0070682_100199070 Ga0070682_1001990701 342
432 3300005338 Ga0068868_100038297 Ga0068868_1000382974 342
433 3300005338 Ga0068868_100058595 Ga0068868_1000585952 342
434 3300005338 Ga0068868_100229815 Ga0068868_1002298151 342
435 3300005339 Ga0070660_100008984 Ga0070660_1000089844 342
436 3300005339 Ga0070660_100036860 Ga0070660_1000368604 342
437 3300005339 Ga0070660_100380136 Ga0070660_1003801361 342
438 3300005340 Ga0070689_100002079 Ga0070689_1000020792 342
439 3300005340 Ga0070689_100108664 Ga0070689_1001086644 342
440 3300005341 Ga0070691_10052213 Ga0070691_100522131 342
441 3300005343 Ga0070687_100027140 Ga0070687_1000271403 342
442 3300005344 Ga0070661_100022921 Ga0070661_1000229213 342
443 3300005347 Ga0070668_100003473 Ga0070668_1000034735 342
444 3300005347 Ga0070668_100008936 Ga0070668_1000089363 342
445 3300005347 Ga0070668_100050729 Ga0070668_1000507293 342
446 3300005347 Ga0070668_100141361 Ga0070668_1001413612 342
447 3300005353 Ga0070669_100042153 Ga0070669_1000421531 342
448 3300005353 Ga0070669_100163424 Ga0070669_1001634241 342
449 3300005354 Ga0070675_100235237 Ga0070675_1002352372 342
450 3300005355 Ga0070671_100063210 Ga0070671_1000632102 342
451 3300005355 Ga0070671_100227527 Ga0070671_1002275272 342
452 3300005355 Ga0070671_100286405 Ga0070671_1002864051 342
453 3300005356 Ga0070674_100001469 Ga0070674_10000146912 342
454 3300005356 Ga0070674_100010211 Ga0070674_1000102118 342
455 3300005356 Ga0070674_100013870 Ga0070674_1000138702 342
456 3300005364 Ga0070673_100014104 Ga0070673_1000141044 342
457 3300005366 Ga0070659_100011386 Ga0070659_1000113864 342
458 3300005366 Ga0070659_100280344 Ga0070659_1002803441 342
459 3300005367 Ga0070667_100116021 Ga0070667_1001160212 342
460 3300005367 Ga0070667_100268332 Ga0070667_1002683321 342
461 3300005434 Ga0070709_10005439 Ga0070709_100054394 342
462 3300005435 Ga0070714_100050305 Ga0070714_1000503053 342
463 3300005435 Ga0070714_100055629 Ga0070714_1000556292 342
464 3300005436 Ga0070713_100003900 Ga0070713_1000039006 342
465 3300005436 Ga0070713_100028893 Ga0070713_1000288933 342
466 3300005436 Ga0070713_100059482 Ga0070713_1000594822 342
467 3300005436 Ga0070713_100116509 Ga0070713_1001165092 342
468 3300005437 Ga0070710_10001798 Ga0070710_100017984 342
469 3300005437 Ga0070710_10211345 Ga0070710_102113451 342
470 3300005439 Ga0070711_100013041 Ga0070711_1000130413 342
471 3300005439 Ga0070711_100018744 Ga0070711_1000187441 342
472 3300005440 Ga0070705_100142388 Ga0070705_1001423882 342
473 3300005455 Ga0070663_100029554 Ga0070663_1000295544 342
474 3300005455 Ga0070663_100052831 Ga0070663_1000528312 342
475 3300005455 Ga0070663_100063228 Ga0070663_1000632282 342
476 3300005455 Ga0070663_100107121 Ga0070663_1001071212 342
477 3300005455 Ga0070663_100231776 Ga0070663_1002317762 342
478 3300005456 Ga0070678_100033164 Ga0070678_1000331643 342
479 3300005456 Ga0070678_100052389 Ga0070678_1000523892 342
480 3300005456 Ga0070678_100058201 Ga0070678_1000582012 342
481 3300005457 Ga0070662_100009040 Ga0070662_1000090405 342
482 3300005457 Ga0070662_100095431 Ga0070662_1000954312 342
483 3300005457 Ga0070662_100209673 Ga0070662_1002096732 342
484 3300005458 Ga0070681_10005772 Ga0070681_1000577216 342
485 3300005458 Ga0070681_10009474 Ga0070681_100094743 342
486 3300005458 Ga0070681_10018371 Ga0070681_100183715 342
487 3300005458 Ga0070681_10237166 Ga0070681_102371662 342
488 3300005530 Ga0070679_100002259 Ga0070679_10000225912 342
489 3300005530 Ga0070679_100012689 Ga0070679_1000126896 342
490 3300005530 Ga0070679_100041099 Ga0070679_1000410992 342
491 3300005530 Ga0070679_100069283 Ga0070679_1000692832 342
492 3300005535 Ga0070684_100011823 Ga0070684_1000118231 342
493 3300005535 Ga0070684_100026088 Ga0070684_1000260882 342
494 3300005535 Ga0070684_100092323 Ga0070684_1000923232 342
495 3300005539 Ga0068853_100005704 Ga0068853_1000057041 342
496 3300005539 Ga0068853_100192111 Ga0068853_1001921112 342
497 3300005544 Ga0070686_100095878 Ga0070686_1000958782 342
498 3300005545 Ga0070695_100255654 Ga0070695_1002556541 342
499 3300005547 Ga0070693_100047826 Ga0070693_1000478262 342
500 3300005548 Ga0070665_100007164 Ga0070665_1000071642 342
501 3300005548 Ga0070665_100008973 Ga0070665_1000089735 342
502 3300005548 Ga0070665_100056210 Ga0070665_1000562103 342
503 3300005548 Ga0070665_100083982 Ga0070665_1000839821 342
504 3300005548 Ga0070665_100087729 Ga0070665_1000877292 342
505 3300005548 Ga0070665_100089898 Ga0070665_1000898982 342
506 3300005548 Ga0070665_100159456 Ga0070665_1001594562 342
507 3300005548 Ga0070665_100313465 Ga0070665_1003134652 342
508 3300005548 Ga0070665_100595571 Ga0070665_1005955711 342
509 3300005563 Ga0068855_100011649 Ga0068855_1000116498 342
510 3300005563 Ga0068855_100063155 Ga0068855_1000631555 342
511 3300005563 Ga0068855_100238162 Ga0068855_1002381622 342
512 3300005577 Ga0068857_100081157 Ga0068857_1000811574 342
513 3300005577 Ga0068857_100108215 Ga0068857_1001082152 342
514 3300005577 Ga0068857_100132753 Ga0068857_1001327532 342
515 3300005577 Ga0068857_100202136 Ga0068857_1002021362 342
516 3300005577 Ga0068857_100233711 Ga0068857_1002337112 342
517 3300005578 Ga0068854_100289362 Ga0068854_1002893621 342
518 3300005617 Ga0068859_100077580 Ga0068859_1000775802 342
519 3300005618 Ga0068864_100158708 Ga0068864_1001587082 342
520 3300005718 Ga0068866_10027847 Ga0068866_100278471 342
521 3300005719 Ga0068861_100013725 Ga0068861_1000137253 342
522 3300005719 Ga0068861_100069713 Ga0068861_1000697132 342
523 3300005719 Ga0068861_100151221 Ga0068861_1001512212 342
524 3300005841 Ga0068863_100031099 Ga0068863_1000310995 342
525 3300005842 Ga0068858_100072777 Ga0068858_1000727771 342
526 3300005842 Ga0068858_100355599 Ga0068858_1003555992 342
527 3300005843 Ga0068860_100081538 Ga0068860_1000815382 342
528 3300005843 Ga0068860_100375190 Ga0068860_1003751901 342
529 3300005843 Ga0068860_100393008 Ga0068860_1003930082 342
530 3300005844 Ga0068862_100004978 Ga0068862_1000049788 342
531 3300005844 Ga0068862_100056023 Ga0068862_1000560235 342
532 3300005844 Ga0068862_100378005 Ga0068862_1003780052 342
533 3300005937 Ga0081455_10009408 Ga0081455_100094086 342
534 3300005937 Ga0081455_10009980 Ga0081455_100099804 342
535 3300005937 Ga0081455_10012824 Ga0081455_100128245 342
536 3300005937 Ga0081455_10016677 Ga0081455_100166773 342
537 3300005937 Ga0081455_10065066 Ga0081455_100650663 342
538 3300005937 Ga0081455_10128565 Ga0081455_101285652 342
539 3300005981 Ga0081538_10005709 Ga0081538_100057093 342
540 3300005981 Ga0081538_10026886 Ga0081538_100268865 342
541 3300005983 Ga0081540_1000183 Ga0081540_100018312 342
542 3300005983 Ga0081540_1003056 Ga0081540_100305616 342
543 3300005983 Ga0081540_1008688 Ga0081540_10086885 342
544 3300005985 Ga0081539_10000321 Ga0081539_1000032171 342
545 3300005985 Ga0081539_10001182 Ga0081539_1000118248 342
546 3300005985 Ga0081539_10061942 Ga0081539_100619422 342
547 3300006028 Ga0070717_10027462 Ga0070717_100274626 342
548 3300006028 Ga0070717_10031115 Ga0070717_100311153 342
549 3300006028 Ga0070717_10194695 Ga0070717_101946952 342
550 3300006038 Ga0075365_10004659 Ga0075365_100046597 342
551 3300006038 Ga0075365_10027773 Ga0075365_100277732 342
552 3300006038 Ga0075365_10092380 Ga0075365_100923802 342
553 3300006042 Ga0075368_10002227 Ga0075368_100022272 342
554 3300006042 Ga0075368_10004796 Ga0075368_100047962 342
555 3300006048 Ga0075363_100000166 Ga0075363_10000016611 342
556 3300006048 Ga0075363_100005847 Ga0075363_1000058476 342
557 3300006048 Ga0075363_100026460 Ga0075363_1000264602 342
558 3300006048 Ga0075363_100032687 Ga0075363_1000326872 342
559 3300006051 Ga0075364_10014523 Ga0075364_100145235 342
560 3300006051 Ga0075364_10018041 Ga0075364_100180413 342
561 3300006051 Ga0075364_10061957 Ga0075364_100619572 342
562 3300006051 Ga0075364_10306447 Ga0075364_103064471 342
563 3300006163 Ga0070715_10001747 Ga0070715_100017473 342
564 3300006163 Ga0070715_10105233 Ga0070715_101052332 342
565 3300006173 Ga0070716_100006717 Ga0070716_1000067174 342
566 3300006175 Ga0070712_100012868 Ga0070712_1000128685 342
567 3300006175 Ga0070712_100013408 Ga0070712_1000134083 342
568 3300006175 Ga0070712_100129971 Ga0070712_1001299714 342
569 3300006175 Ga0070712_100209200 Ga0070712_1002092001 342
570 3300006177 Ga0075362_10002371 Ga0075362_100023714 342
571 3300006177 Ga0075362_10006411 Ga0075362_100064112 342
572 3300006177 Ga0075362_10018509 Ga0075362_100185092 342
573 3300006177 Ga0075362_10023654 Ga0075362_100236542 342
574 3300006177 Ga0075362_10113389 Ga0075362_101133891 342
575 3300006178 Ga0075367_10000604 Ga0075367_100006044 342
576 3300006178 Ga0075367_10010376 Ga0075367_100103766 342
577 3300006178 Ga0075367_10100784 Ga0075367_101007841 342
578 3300006195 Ga0075366_10000580 Ga0075366_1000058010 342
579 3300006195 Ga0075366_10002268 Ga0075366_1000226810 342
580 3300006195 Ga0075366_10028218 Ga0075366_100282182 342
581 3300006195 Ga0075366_10030929 Ga0075366_100309293 342
582 3300006195 Ga0075366_10123396 Ga0075366_101233962 342
583 3300006237 Ga0097621_100023425 Ga0097621_1000234252 342
584 3300006237 Ga0097621_100149457 Ga0097621_1001494572 342
585 3300006353 Ga0075370_10011797 Ga0075370_100117973 342
586 3300006353 Ga0075370_10036607 Ga0075370_100366071 342
587 3300006353 Ga0075370_10042391 Ga0075370_100423913 342
588 3300006353 Ga0075370_10046819 Ga0075370_100468193 342
589 3300006358 Ga0068871_100176216 Ga0068871_1001762163 342
590 3300006844 Ga0075428_100001227 Ga0075428_10000122724 342
591 3300006844 Ga0075428_100024804 Ga0075428_1000248048 342
592 3300006844 Ga0075428_100224006 Ga0075428_1002240062 342
593 3300006846 Ga0075430_100000015 Ga0075430_10000001543 342
594 3300006846 Ga0075430_100008228 Ga0075430_1000082284 342
595 3300006847 Ga0075431_100000169 Ga0075431_10000016934 342
596 3300006847 Ga0075431_100514629 Ga0075431_1005146291 342
597 3300006852 Ga0075433_10237533 Ga0075433_102375332 342
598 3300006852 Ga0075433_10344231 Ga0075433_103442312 342
599 3300006871 Ga0075434_100052054 Ga0075434_1000520542 342
600 3300006871 Ga0075434_100065245 Ga0075434_1000652455 342
601 3300006871 Ga0075434_100371631 Ga0075434_1003716311 342
602 3300006880 Ga0075429_100012855 Ga0075429_1000128552 342
603 3300006881 Ga0068865_100039365 Ga0068865_1000393652 342
604 3300006881 Ga0068865_100351172 Ga0068865_1003511721 342
605 3300006931 Ga0097620_100077578 Ga0097620_1000775783 342
606 3300006941 Ga0099825_1028576 Ga0099825_10285762 342
607 3300006942 Ga0099824_1015348 Ga0099824_10153486 342
608 3300006944 Ga0099823_1022490 Ga0099823_10224908 342
609 3300007788 Ga0099795_10004625 Ga0099795_100046251 342
610 3300007788 Ga0099795_10083585 Ga0099795_100835851 342
611 3300009011 Ga0105251_10028427 Ga0105251_100284272 342
612 3300009092 Ga0105250_10032821 Ga0105250_100328212 342
613 3300009093 Ga0105240_10004107 Ga0105240_1000410715 342
614 3300009093 Ga0105240_10026526 Ga0105240_100265265 342
615 3300009093 Ga0105240_10045477 Ga0105240_100454772 342
616 3300009093 Ga0105240_10135542 Ga0105240_101355422 342
617 3300009093 Ga0105240_10239306 Ga0105240_102393063 342
618 3300009094 Ga0111539_10013148 Ga0111539_100131487 342
619 3300009094 Ga0111539_10216621 Ga0111539_102166212 342
620 3300009094 Ga0111539_10378641 Ga0111539_103786412 342
621 3300009098 Ga0105245_10017466 Ga0105245_100174663 342
622 3300009098 Ga0105245_10388370 Ga0105245_103883701 342
623 3300009101 Ga0105247_10104863 Ga0105247_101048632 342
624 3300009147 Ga0114129_10000539 Ga0114129_1000053921 342
625 3300009147 Ga0114129_10004331 Ga0114129_1000433112 342
626 3300009148 Ga0105243_10018265 Ga0105243_100182656 342
627 3300009148 Ga0105243_10155513 Ga0105243_101555131 342
628 3300009174 Ga0105241_10141983 Ga0105241_101419832 342
629 3300009174 Ga0105241_10324383 Ga0105241_103243831 342
630 3300009176 Ga0105242_10057384 Ga0105242_100573843 342
631 3300009176 Ga0105242_10061315 Ga0105242_100613152 342
632 3300009177 Ga0105248_10034403 Ga0105248_100344035 342
633 3300009177 Ga0105248_10136802 Ga0105248_101368023 342
634 3300009545 Ga0105237_10001334 Ga0105237_1000133420 342
635 3300009545 Ga0105237_10093492 Ga0105237_100934922 342
636 3300009545 Ga0105237_10101046 Ga0105237_101010462 342
637 3300009545 Ga0105237_10114249 Ga0105237_101142492 342
638 3300009545 Ga0105237_10117998 Ga0105237_101179983 342
639 3300009545 Ga0105237_10119001 Ga0105237_101190013 342
640 3300009545 Ga0105237_10338413 Ga0105237_103384132 342
641 3300009551 Ga0105238_10001553 Ga0105238_1000155314 342
642 3300009551 Ga0105238_10287986 Ga0105238_102879862 342
643 3300009553 Ga0105249_10018300 Ga0105249_100183004 342
644 3300010159 Ga0099796_10037762 Ga0099796_100377622 342
645 3300010375 Ga0105239_10133472 Ga0105239_101334723 342
646 3300011119 Ga0105246_10003290 Ga0105246_100032906 342
647 3300011119 Ga0105246_10044929 Ga0105246_100449293 342
648 3300013102 Ga0157371_10032500 Ga0157371_100325002 342
649 3300013104 Ga0157370_10002576 Ga0157370_100025769 342
650 3300013104 Ga0157370_10100170 Ga0157370_101001702 342
651 3300013104 Ga0157370_10180961 Ga0157370_101809611 342
652 3300013105 Ga0157369_10012266 Ga0157369_100122666 342
653 3300013105 Ga0157369_10013341 Ga0157369_100133413 342
654 3300013105 Ga0157369_10018334 Ga0157369_100183346 342
655 3300013296 Ga0157374_10045869 Ga0157374_100458693 342
656 3300013296 Ga0157374_10140533 Ga0157374_101405332 342
657 3300013297 Ga0157378_10150969 Ga0157378_101509692 342
658 3300013306 Ga0163162_10022365 Ga0163162_100223653 342
659 3300013306 Ga0163162_10246500 Ga0163162_102465002 342
660 3300013307 Ga0157372_10070340 Ga0157372_100703404 342
661 3300013307 Ga0157372_10219938 Ga0157372_102199382 342
662 3300013307 Ga0157372_10358922 Ga0157372_103589222 342
663 3300013307 Ga0157372_10547214 Ga0157372_105472141 342
664 3300013308 Ga0157375_10031985 Ga0157375_100319855 342
665 3300013308 Ga0157375_10234318 Ga0157375_102343182 342
666 3300013308 Ga0157375_10411469 Ga0157375_104114692 342
667 3300014325 Ga0163163_10060550 Ga0163163_100605503 342
668 3300014325 Ga0163163_10070084 Ga0163163_100700842 342
669 3300014326 Ga0157380_10077742 Ga0157380_100777424 342
670 3300014326 Ga0157380_10155538 Ga0157380_101555382 342
671 3300014968 Ga0157379_10012701 Ga0157379_100127015 342
672 3300014969 Ga0157376_10006200 Ga0157376_100062005 342
673 3300014969 Ga0157376_10122174 Ga0157376_101221742 342
674 3300017792 Ga0163161_10041355 Ga0163161_100413553 342
675 3300024227 Ga0228598_1007512 Ga0228598_10075122 342
676 3300025254 Ga0209148_1000232 Ga0209148_100023262 342
677 3300025272 Ga0209455_1004488 Ga0209455_10044884 342
678 3300025295 Ga0209564_1000390 Ga0209564_100039056 342
679 3300025297 Ga0209758_1012829 Ga0209758_10128292 342
680 3300025297 Ga0209758_1013321 Ga0209758_10133214 342
681 3300025297 Ga0209758_1015980 Ga0209758_10159802 342
682 3300025302 Ga0207426_1002604 Ga0207426_10026043 342
683 3300025302 Ga0207426_1007922 Ga0207426_10079223 342
684 3300025302 Ga0207426_1023952 Ga0207426_10239522 342
685 3300025315 Ga0207697_10045437 Ga0207697_100454372 342
686 3300025321 Ga0207656_10007664 Ga0207656_100076641 342
687 3300025898 Ga0207692_10021447 Ga0207692_100214473 342
688 3300025899 Ga0207642_10008196 Ga0207642_100081962 342
689 3300025900 Ga0207710_10012120 Ga0207710_100121202 342
690 3300025901 Ga0207688_10000632 Ga0207688_1000063216 342
691 3300025901 Ga0207688_10046119 Ga0207688_100461192 342
692 3300025901 Ga0207688_10048243 Ga0207688_100482432 342
693 3300025904 Ga0207647_10011355 Ga0207647_100113552 342
694 3300025904 Ga0207647_10017016 Ga0207647_100170165 342
695 3300025906 Ga0207699_10002112 Ga0207699_100021123 342
696 3300025907 Ga0207645_10089451 Ga0207645_100894512 342
697 3300025908 Ga0207643_10063452 Ga0207643_100634522 342
698 3300025909 Ga0207705_10086680 Ga0207705_100866802 342
699 3300025909 Ga0207705_10117994 Ga0207705_101179942 342
700 3300025911 Ga0207654_10002057 Ga0207654_100020573 342
701 3300025911 Ga0207654_10016250 Ga0207654_100162502 342
702 3300025912 Ga0207707_10001060 Ga0207707_1000106013 342
703 3300025912 Ga0207707_10003094 Ga0207707_100030944 342
704 3300025912 Ga0207707_10005972 Ga0207707_1000597213 342
705 3300025912 Ga0207707_10023267 Ga0207707_100232671 342
706 3300025912 Ga0207707_10125036 Ga0207707_101250362 342
707 3300025913 Ga0207695_10000123 Ga0207695_1000012359 342
708 3300025913 Ga0207695_10096843 Ga0207695_100968432 342
709 3300025913 Ga0207695_10121008 Ga0207695_101210082 342
710 3300025913 Ga0207695_10164175 Ga0207695_101641752 342
711 3300025914 Ga0207671_10003762 Ga0207671_100037628 342
712 3300025914 Ga0207671_10058901 Ga0207671_100589012 342
713 3300025914 Ga0207671_10273872 Ga0207671_102738721 342
714 3300025915 Ga0207693_10007711 Ga0207693_100077112 342
715 3300025915 Ga0207693_10052913 Ga0207693_100529132 342
716 3300025916 Ga0207663_10013318 Ga0207663_100133183 342
717 3300025917 Ga0207660_10001447 Ga0207660_100014478 342
718 3300025917 Ga0207660_10006547 Ga0207660_100065472 342
719 3300025917 Ga0207660_10112454 Ga0207660_101124541 342
720 3300025917 Ga0207660_10248425 Ga0207660_102484252 342
721 3300025917 Ga0207660_10316609 Ga0207660_103166091 342
722 3300025918 Ga0207662_10057012 Ga0207662_100570121 342
723 3300025918 Ga0207662_10135310 Ga0207662_101353102 342
724 3300025919 Ga0207657_10006931 Ga0207657_1000693111 342
725 3300025919 Ga0207657_10008229 Ga0207657_1000822910 342
726 3300025919 Ga0207657_10043840 Ga0207657_100438401 342
727 3300025920 Ga0207649_10156959 Ga0207649_101569592 342
728 3300025920 Ga0207649_10187614 Ga0207649_101876142 342
729 3300025920 Ga0207649_10315980 Ga0207649_103159801 342
730 3300025921 Ga0207652_10001462 Ga0207652_100014625 342
731 3300025921 Ga0207652_10009510 Ga0207652_100095105 342
732 3300025921 Ga0207652_10010442 Ga0207652_100104426 342
733 3300025921 Ga0207652_10013576 Ga0207652_100135764 342
734 3300025923 Ga0207681_10062526 Ga0207681_100625262 342
735 3300025924 Ga0207694_10011080 Ga0207694_100110807 342
736 3300025924 Ga0207694_10162643 Ga0207694_101626432 342
737 3300025925 Ga0207650_10014705 Ga0207650_100147053 342
738 3300025925 Ga0207650_10165628 Ga0207650_101656282 342
739 3300025925 Ga0207650_10223003 Ga0207650_102230031 342
740 3300025926 Ga0207659_10049502 Ga0207659_100495022 342
741 3300025926 Ga0207659_10170259 Ga0207659_101702592 342
742 3300025926 Ga0207659_10225907 Ga0207659_102259072 342
743 3300025927 Ga0207687_10010511 Ga0207687_100105112 342
744 3300025927 Ga0207687_10042501 Ga0207687_100425013 342
745 3300025928 Ga0207700_10003844 Ga0207700_100038444 342
746 3300025928 Ga0207700_10027640 Ga0207700_100276402 342
747 3300025928 Ga0207700_10041641 Ga0207700_100416412 342
748 3300025929 Ga0207664_10039390 Ga0207664_100393903 342
749 3300025929 Ga0207664_10090250 Ga0207664_100902502 342
750 3300025929 Ga0207664_10101335 Ga0207664_101013352 342
751 3300025929 Ga0207664_10174826 Ga0207664_101748261 342
752 3300025931 Ga0207644_10063359 Ga0207644_100633593 342
753 3300025931 Ga0207644_10132443 Ga0207644_101324432 342
754 3300025931 Ga0207644_10193306 Ga0207644_101933062 342
755 3300025932 Ga0207690_10015287 Ga0207690_100152872 342
756 3300025933 Ga0207706_10042126 Ga0207706_100421262 342
757 3300025933 Ga0207706_10098765 Ga0207706_100987653 342
758 3300025933 Ga0207706_10252822 Ga0207706_102528222 342
759 3300025935 Ga0207709_10032248 Ga0207709_100322482 342
760 3300025935 Ga0207709_10093783 Ga0207709_100937832 342
761 3300025936 Ga0207670_10000723 Ga0207670_100007233 342
762 3300025936 Ga0207670_10004146 Ga0207670_100041463 342
763 3300025936 Ga0207670_10084086 Ga0207670_100840863 342
764 3300025937 Ga0207669_10009635 Ga0207669_100096356 342
765 3300025937 Ga0207669_10015713 Ga0207669_100157135 342
766 3300025938 Ga0207704_10057171 Ga0207704_100571712 342
767 3300025939 Ga0207665_10069227 Ga0207665_100692273 342
768 3300025939 Ga0207665_10264370 Ga0207665_102643702 342
769 3300025941 Ga0207711_10054382 Ga0207711_100543822 342
770 3300025941 Ga0207711_10279473 Ga0207711_102794731 342
771 3300025942 Ga0207689_10076507 Ga0207689_100765073 342
772 3300025942 Ga0207689_10122625 Ga0207689_101226251 342
773 3300025942 Ga0207689_10171695 Ga0207689_101716952 342
774 3300025942 Ga0207689_10402181 Ga0207689_104021811 342
775 3300025944 Ga0207661_10002168 Ga0207661_100021689 342
776 3300025944 Ga0207661_10008830 Ga0207661_100088302 342
777 3300025944 Ga0207661_10021211 Ga0207661_100212111 342
778 3300025944 Ga0207661_10099549 Ga0207661_100995492 342
779 3300025944 Ga0207661_10320509 Ga0207661_103205091 342
780 3300025949 Ga0207667_10011535 Ga0207667_100115356 342
781 3300025949 Ga0207667_10063324 Ga0207667_100633242 342
782 3300025949 Ga0207667_10119404 Ga0207667_101194042 342
783 3300025960 Ga0207651_10327268 Ga0207651_103272681 342
784 3300025961 Ga0207712_10016215 Ga0207712_100162157 342
785 3300025961 Ga0207712_10027361 Ga0207712_100273616 342
786 3300025961 Ga0207712_10304696 Ga0207712_103046961 342
787 3300025972 Ga0207668_10001797 Ga0207668_100017977 342
788 3300025972 Ga0207668_10010768 Ga0207668_100107682 342
789 3300025972 Ga0207668_10026341 Ga0207668_100263412 342
790 3300025981 Ga0207640_10092750 Ga0207640_100927502 342
791 3300025981 Ga0207640_10357785 Ga0207640_103577851 342
792 3300025986 Ga0207658_10140276 Ga0207658_101402762 342
793 3300025986 Ga0207658_10315200 Ga0207658_103152001 342
794 3300025986 Ga0207658_10341710 Ga0207658_103417101 342
795 3300026023 Ga0207677_10021883 Ga0207677_100218831 342
796 3300026023 Ga0207677_10027258 Ga0207677_100272582 342
797 3300026041 Ga0207639_10028505 Ga0207639_100285054 342
798 3300026041 Ga0207639_10135161 Ga0207639_101351611 342
799 3300026041 Ga0207639_10174234 Ga0207639_101742342 342
800 3300026067 Ga0207678_10018436 Ga0207678_100184363 342
801 3300026067 Ga0207678_10022139 Ga0207678_100221392 342
802 3300026067 Ga0207678_10028304 Ga0207678_100283044 342
803 3300026067 Ga0207678_10049981 Ga0207678_100499811 342
804 3300026067 Ga0207678_10075813 Ga0207678_100758133 342
805 3300026067 Ga0207678_10147347 Ga0207678_101473472 342
806 3300026067 Ga0207678_10149815 Ga0207678_101498152 342
807 3300026067 Ga0207678_10246738 Ga0207678_102467382 342
808 3300026075 Ga0207708_10044625 Ga0207708_100446253 342
809 3300026078 Ga0207702_10387797 Ga0207702_103877971 342
810 3300026089 Ga0207648_10092640 Ga0207648_100926403 342
811 3300026089 Ga0207648_10113202 Ga0207648_101132022 342
812 3300026089 Ga0207648_10114859 Ga0207648_101148592 342
813 3300026095 Ga0207676_10010931 Ga0207676_100109317 342
814 3300026116 Ga0207674_10030711 Ga0207674_100307113 342
815 3300026116 Ga0207674_10131644 Ga0207674_101316442 342
816 3300026116 Ga0207674_10146903 Ga0207674_101469033 342
817 3300026116 Ga0207674_10169491 Ga0207674_101694911 342
818 3300026118 Ga0207675_100004169 Ga0207675_10000416910 342
819 3300026118 Ga0207675_100016487 Ga0207675_1000164874 342
820 3300026118 Ga0207675_100039441 Ga0207675_1000394414 342
821 3300026118 Ga0207675_100087282 Ga0207675_1000872822 342
822 3300026118 Ga0207675_100333474 Ga0207675_1003334741 342
823 3300026121 Ga0207683_10009233 Ga0207683_100092332 342
824 3300026121 Ga0207683_10099148 Ga0207683_100991482 342
825 3300026121 Ga0207683_10102964 Ga0207683_101029643 342
826 3300026121 Ga0207683_10117012 Ga0207683_101170124 342
827 3300026121 Ga0207683_10132981 Ga0207683_101329811 342
828 3300026121 Ga0207683_10174085 Ga0207683_101740852 342
829 3300026142 Ga0207698_10051937 Ga0207698_100519372 342
830 3300026142 Ga0207698_10065027 Ga0207698_100650272 342
831 3300026142 Ga0207698_10198285 Ga0207698_101982852 342
832 3300026142 Ga0207698_10213291 Ga0207698_102132912 342
833 3300027296 Ga0209389_1000201 Ga0209389_100020114 342
834 3300027357 Ga0209589_1000002 Ga0209589_1000002161 342
835 3300027361 Ga0209489_100002 Ga0209489_100002161 342
836 3300027361 Ga0209489_100035 Ga0209489_10003537 342
837 3300027363 Ga0209700_100002 Ga0209700_100002161 342
838 3300027363 Ga0209700_100005 Ga0209700_10000539 342
839 3300027512 Ga0209179_1010620 Ga0209179_10106202 342
840 3300027866 Ga0209813_10006831 Ga0209813_100068312 342
841 3300027866 Ga0209813_10019139 Ga0209813_100191391 342
842 3300027907 Ga0207428_10021751 Ga0207428_100217513 342
843 3300028379 Ga0268266_10014910 Ga0268266_100149103 342
844 3300028379 Ga0268266_10049432 Ga0268266_100494321 342
845 3300028379 Ga0268266_10092299 Ga0268266_100922992 342
846 3300028379 Ga0268266_10096847 Ga0268266_100968472 342
847 3300028379 Ga0268266_10167157 Ga0268266_101671572 342
848 3300028379 Ga0268266_10234454 Ga0268266_102344542 342
849 3300028379 Ga0268266_10254583 Ga0268266_102545832 342
850 3300028380 Ga0268265_10020676 Ga0268265_100206764 342
851 3300028380 Ga0268265_10251015 Ga0268265_102510151 342
852 3300028794 Ga0307515_10036261 Ga0307515_100362613 342
853 3300031249 Ga0265339_10069363 Ga0265339_100693632 342
854 3300031249 Ga0265339_10110023 Ga0265339_101100231 342
855 3300031250 Ga0265331_10052024 Ga0265331_100520242 342
856 3300031344 Ga0265316_10107628 Ga0265316_101076282 342
857 3300031456 Ga0307513_10082871 Ga0307513_100828713 342
858 3300031616 Ga0307508_10183623 Ga0307508_101836232 342
859 3300031711 Ga0265314_10029453 Ga0265314_100294534 342
860 3300031712 Ga0265342_10017745 Ga0265342_100177452 342
861 3300032002 Ga0307416_100314809 Ga0307416_1003148092 342
862 3300032004 Ga0307414_10433562 Ga0307414_104335621 342
863 3300032126 Ga0307415_100165832 Ga0307415_1001658322 342
864 3300033180 Ga0307510_10012742 Ga0307510_100127424 342
865 3300033180 Ga0307510_10032603 Ga0307510_100326032 342
866 3300033442 Ga0315911_1000021 Ga0315911_100002115 342
867 3300034816 Ga0373930_0021115 Ga0373930_0021115_10_1062 342
868 3300035083 Ga0373926_0040292 Ga0373926_0040292_266_1294 342
869 3300035083 Ga0373926_0078249 Ga0373926_0078249_109_1200 342
870 3300035089 Ga0373944_0012879 Ga0373944_0012879_927_1955 342
871 3300035089 Ga0373944_0019033 Ga0373944_0019033_846_1874 342
872 3300035089 Ga0373944_0046784 Ga0373944_0046784_103_1131 342
873 3300035111 Ga0373923_0015134 Ga0373923_0015134_238_1329 342
874 3300035111 Ga0373923_0016016 Ga0373923_0016016_415_1443 342
875 3300035113 Ga0373936_0005865 Ga0373936_0005865_3188_4279 342
876 3300035116 Ga0373945_0014426 Ga0373945_0014426_1145_2173 342
877 3300035116 Ga0373945_0029335 Ga0373945_0029335_224_1252 342
878 3300035116 Ga0373945_0068268 Ga0373945_0068268_168_1259 342
879 3300035117 Ga0373953_0055861 Ga0373953_0055861_401_1429 342
880 3300035119 Ga0373956_0023627 Ga0373956_0023627_1468_2559 342
881 3300035119 Ga0373956_0062661 Ga0373956_0062661_346_1374 342
882 3300035170 Ga0373943_0016082 Ga0373943_0016082_1808_2836 342
883 3300035170 Ga0373943_0030683 Ga0373943_0030683_212_1240 342
884 3300035170 Ga0373943_0043377 Ga0373943_0043377_87_1115 342
885 3300035170 Ga0373943_0060103 Ga0373943_0060103_510_1538 342
886 3300035170 Ga0373943_0064413 Ga0373943_0064413_777_1805 342
887 3300035170 Ga0373943_0187169 Ga0373943_0187169_30_1058 342
888 3300035171 Ga0373946_0003500 Ga0373946_0003500_320_1348 342
889 3300035171 Ga0373946_0011732 Ga0373946_0011732_1956_2984 342
890 3300035410 Ga0373924_0020510 Ga0373924_0020510_1026_2117 342
891 3300035691 Ga0373931_0036553 Ga0373931_0036553_709_1737 342
892 3300035691 Ga0373931_0128212 Ga0373931_0128212_278_1357 342
893 3300035692 Ga0373935_0013096 Ga0373935_0013096_1515_2543 342
894 3300035692 Ga0373935_0019770 Ga0373935_0019770_172_1200 342
895 3300035692 Ga0373935_0044947 Ga0373935_0044947_1423_2451 342
896 3300035692 Ga0373935_0055404 Ga0373935_0055404_712_1740 342
897 3300035692 Ga0373935_0056552 Ga0373935_0056552_769_1797 342
898 3300035692 Ga0373935_0162554 Ga0373935_0162554_427_1455 342
899 3300035695 Ga0373927_0007278 Ga0373927_0007278_5019_6047 342
900 3300035695 Ga0373927_0049323 Ga0373927_0049323_1444_2472 342
901 3300035695 Ga0373927_0094899 Ga0373927_0094899_231_1259 342
902 3300035695 Ga0373927_0138302 Ga0373927_0138302_456_1484 342
903 3300035724 Ga0373933_0024090 Ga0373933_0024090_1412_2440 342
904 3300035724 Ga0373933_0081210 Ga0373933_0081210_864_1892 342
905 3300035725 Ga0373947_0004180 Ga0373947_0004180_6248_7276 342
906 3300035725 Ga0373947_0018731 Ga0373947_0018731_2679_3707 342
907 3300035725 Ga0373947_0020227 Ga0373947_0020227_1228_2256 342
908 3300035725 Ga0373947_0049538 Ga0373947_0049538_571_1599 342
909 3300035725 Ga0373947_0062433 Ga0373947_0062433_144_1172 342
910 3300035725 Ga0373947_0098134 Ga0373947_0098134_584_1612 342
911 3300036401 Ga0373937_0005300 Ga0373937_0005300_7676_8704 342
912 3300036401 Ga0373937_0084401 Ga0373937_0084401_1722_2750 342
913 3300036401 Ga0373937_0099098 Ga0373937_0099098_1381_2472 342
914 3300037068 Ga0373925_0008589 Ga0373925_0008589_1502_2530 342
915 3300037068 Ga0373925_0010602 Ga0373925_0010602_2717_3745 342
916 3300037068 Ga0373925_0063800 Ga0373925_0063800_1043_2071 342
917 3300037068 Ga0373925_0118544 Ga0373925_0118544_334_1362 342
918 3300037068 Ga0373925_0145775 Ga0373925_0145775_739_1767 342
919 3300037068 Ga0373925_0189922 Ga0373925_0189922_121_1149 342
920 3300037312 Ga0395899_0019733 Ga0395899_0019733_2879_3907 342
921 3300037312 Ga0395899_0081185 Ga0395899_0081185_1234_2262 342
922 3300037418 Ga0395900_0031496 Ga0395900_0031496_4200_5228 342
923 3300037418 Ga0395900_0132004 Ga0395900_0132004_1134_2162 342
924 3300037418 Ga0395900_0341087 Ga0395900_0341087_102_1130 342
925 3300037466 Ga0395898_0002361 Ga0395898_0002361_20999_22027 342
926 3300037466 Ga0395898_0015190 Ga0395898_0015190_6567_7595 342
927 3300037466 Ga0395898_0407053 Ga0395898_0407053_54_1082 342
928 3300037853 Ga0436364_0422894 Ga0436364_0422894_69_1097 342
929 3300037853 Ga0436364_0839082 Ga0436364_0839082_220_1248 342
930 3300038443 Ga0395901_0094760 Ga0395901_0094760_1542_2570 342
931 3300038443 Ga0395901_0396539 Ga0395901_0396539_377_1405 342
932 3300039437 Ga0436365_0045906 Ga0436365_0045906_1463_2491 342
933 3300039437 Ga0436365_0908986 Ga0436365_0908986_1200_2228 342
934 3300039437 Ga0436365_1169629 Ga0436365_1169629_141_1169 342
935 3300039438 Ga0436360_0676143 Ga0436360_0676143_312_1340 342
936 3300039438 Ga0436360_0851383 Ga0436360_0851383_2046_3074 342
937 3300039453 Ga0436362_0075180 Ga0436362_0075180_72_1100 342
938 3300041486 Ga0451807_1527043 Ga0451807_1527043_385_1413 342
939 3300044693 Ga0466961_0087148 Ga0466961_0087148_43_1071 342
940 3300044901 Ga0466960_0139629 Ga0466960_0139629_143_1171 342
941 3300045049 Ga0466959_0136494 Ga0466959_0136494_45_1073 342
942 3300045976 Ga0466967_0015489 Ga0466967_0015489_355_1383 342
943 3300045976 Ga0466967_0122933 Ga0466967_0122933_927_1955 342
944 3300046452 Ga0495617_047333 Ga0495617_047333_377_1405 342
945 3300046454 Ga0495592_0065726 Ga0495592_0065726_228_1256 342
946 3300046454 Ga0495592_0085888 Ga0495592_0085888_1195_2223 342
947 3300046454 Ga0495592_0092782 Ga0495592_0092782_485_1513 342
948 3300046455 Ga0495603_0048534 Ga0495603_0048534_18_1046 342
949 3300046455 Ga0495603_0074501 Ga0495603_0074501_726_1754 342
950 3300046455 Ga0495603_0167925 Ga0495603_0167925_76_1104 342
951 3300046457 Ga0495590_0022334 Ga0495590_0022334_1046_2074 342
952 3300046457 Ga0495590_0034643 Ga0495590_0034643_167_1195 342
953 3300046459 Ga0495629_0005715 Ga0495629_0005715_6692_7720 342
954 3300046459 Ga0495629_0024359 Ga0495629_0024359_2675_3703 342
955 3300046459 Ga0495629_0035104 Ga0495629_0035104_808_1836 342
956 3300046459 Ga0495629_0075207 Ga0495629_0075207_761_1789 342
957 3300046459 Ga0495629_0078476 Ga0495629_0078476_323_1351 342
958 3300046459 Ga0495629_0124314 Ga0495629_0124314_396_1424 342
959 3300046460 Ga0495638_0012685 Ga0495638_0012685_4199_5227 342
960 3300046460 Ga0495638_0127909 Ga0495638_0127909_309_1337 342
961 3300046461 Ga0495641_0028609 Ga0495641_0028609_536_1564 342
962 3300046461 Ga0495641_0083509 Ga0495641_0083509_102_1130 342
963 3300046462 Ga0495651_0004217 Ga0495651_0004217_6824_7852 342
964 3300046462 Ga0495651_0004672 Ga0495651_0004672_8592_9620 342
965 3300046462 Ga0495651_0017519 Ga0495651_0017519_2426_3454 342
966 3300046462 Ga0495651_0021317 Ga0495651_0021317_3032_4060 342
967 3300046462 Ga0495651_0040455 Ga0495651_0040455_1017_2045 342
968 3300046462 Ga0495651_0093894 Ga0495651_0093894_255_1283 342
969 3300046463 Ga0495653_0013840 Ga0495653_0013840_3676_4704 342
970 3300046463 Ga0495653_0021718 Ga0495653_0021718_2879_3907 342
971 3300046463 Ga0495653_0056672 Ga0495653_0056672_674_1702 342
972 3300046463 Ga0495653_0086909 Ga0495653_0086909_508_1536 342
973 3300046463 Ga0495653_0167182 Ga0495653_0167182_321_1349 342
974 3300046472 Ga0495580_0010281 Ga0495580_0010281_6227_7255 342
975 3300046472 Ga0495580_0025873 Ga0495580_0025873_389_1417 342
976 3300046472 Ga0495580_0212084 Ga0495580_0212084_14_1042 342
977 3300046473 Ga0495582_0008667 Ga0495582_0008667_2052_3080 342
978 3300046473 Ga0495582_0015336 Ga0495582_0015336_1330_2358 342
979 3300046473 Ga0495582_0043084 Ga0495582_0043084_1250_2278 342
980 3300046473 Ga0495582_0058221 Ga0495582_0058221_743_1771 342
981 3300046473 Ga0495582_0078189 Ga0495582_0078189_349_1377 342
982 3300046474 Ga0495605_0022270 Ga0495605_0022270_1434_2462 342
983 3300046474 Ga0495605_0060024 Ga0495605_0060024_616_1644 342
984 3300046475 Ga0495639_0004024 Ga0495639_0004024_2754_3782 342
985 3300046475 Ga0495639_0008168 Ga0495639_0008168_737_1765 342
986 3300046475 Ga0495639_0010407 Ga0495639_0010407_266_1294 342
987 3300046476 Ga0495662_0002323 Ga0495662_0002323_6428_7456 342
988 3300046476 Ga0495662_0013322 Ga0495662_0013322_2113_3141 342
989 3300046476 Ga0495662_0015793 Ga0495662_0015793_1310_2338 342
990 3300046476 Ga0495662_0045334 Ga0495662_0045334_362_1390 342
991 3300046477 Ga0495664_0013085 Ga0495664_0013085_1045_2073 342
992 3300046477 Ga0495664_0019574 Ga0495664_0019574_803_1831 342
993 3300046477 Ga0495664_0020012 Ga0495664_0020012_2793_3821 342
994 3300046477 Ga0495664_0025412 Ga0495664_0025412_1202_2230 342
995 3300046477 Ga0495664_0033577 Ga0495664_0033577_1180_2208 342
996 3300046477 Ga0495664_0110158 Ga0495664_0110158_445_1473 342
997 3300046492 Ga0495585_0023352 Ga0495585_0023352_697_1725 342
998 3300046499 Ga0495594_0005204 Ga0495594_0005204_5071_6099 342
999 3300046499 Ga0495594_0049664 Ga0495594_0049664_364_1392 342
1000 3300046507 Ga0495606_0031644 Ga0495606_0031644_1062_2090 342
1001 3300046507 Ga0495606_0076705 Ga0495606_0076705_273_1301 342
1002 3300046511 Ga0495608_0007486 Ga0495608_0007486_5491_6519 342
1003 3300046511 Ga0495608_0037956 Ga0495608_0037956_862_1890 342
1004 3300046511 Ga0495608_0076804 Ga0495608_0076804_182_1210 342
1005 3300046511 Ga0495608_0090413 Ga0495608_0090413_154_1182 342
1006 3300046513 Ga0495616_0078986 Ga0495616_0078986_298_1326 342
1007 3300046514 Ga0495618_0001061 Ga0495618_0001061_6326_7354 342
1008 3300046514 Ga0495618_0024189 Ga0495618_0024189_2317_3345 342
1009 3300046514 Ga0495618_0062860 Ga0495618_0062860_532_1560 342
1010 3300046516 Ga0495628_0036089 Ga0495628_0036089_437_1465 342
1011 3300046516 Ga0495628_0082142 Ga0495628_0082142_523_1551 342
1012 3300046516 Ga0495628_0283928 Ga0495628_0283928_173_1201 342
1013 3300046517 Ga0495630_0037669 Ga0495630_0037669_2261_3352 342
1014 3300046517 Ga0495630_0041344 Ga0495630_0041344_308_1336 342
1015 3300046517 Ga0495630_0054144 Ga0495630_0054144_1581_2609 342
1016 3300046517 Ga0495630_0068819 Ga0495630_0068819_1215_2243 342
1017 3300046517 Ga0495630_0122377 Ga0495630_0122377_433_1461 342
1018 3300046517 Ga0495630_0302948 Ga0495630_0302948_104_1132 342
1019 3300046518 Ga0495631_0024987 Ga0495631_0024987_422_1450 342
1020 3300046519 Ga0495632_0028540 Ga0495632_0028540_1651_2679 342
1021 3300046522 Ga0495643_0095374 Ga0495643_0095374_219_1247 342
1022 3300046523 Ga0495644_0055084 Ga0495644_0055084_78_1106 342
1023 3300046524 Ga0495648_0005065 Ga0495648_0005065_8820_9848 342
1024 3300046524 Ga0495648_0075049 Ga0495648_0075049_512_1540 342
1025 3300046525 Ga0495663_0027311 Ga0495663_0027311_621_1649 342
1026 3300046526 Ga0495666_0043817 Ga0495666_0043817_660_1688 342
1027 3300046529 Ga0495652_0016634 Ga0495652_0016634_3512_4540 342
1028 3300046529 Ga0495652_0019059 Ga0495652_0019059_496_1524 342
1029 3300046529 Ga0495652_0124601 Ga0495652_0124601_481_1509 342
1030 3300046529 Ga0495652_0158489 Ga0495652_0158489_686_1714 342
1031 3300046531 Ga0495665_0007053 Ga0495665_0007053_2517_3545 342
1032 3300046531 Ga0495665_0039138 Ga0495665_0039138_188_1216 342
1033 3300046533 Ga0495640_0001271 Ga0495640_0001271_15528_16556 342
1034 3300046533 Ga0495640_0009760 Ga0495640_0009760_2163_3191 342
1035 3300046533 Ga0495640_0011556 Ga0495640_0011556_2398_3426 342
1036 3300046533 Ga0495640_0064782 Ga0495640_0064782_1257_2285 342
1037 3300046533 Ga0495640_0102593 Ga0495640_0102593_536_1564 342
1038 3300046533 Ga0495640_0124834 Ga0495640_0124834_504_1532 342
1039 3300046533 Ga0495640_0206445 Ga0495640_0206445_132_1160 342
1040 3300046535 Ga0495586_0049611 Ga0495586_0049611_1222_2250 342
1041 3300046536 Ga0495587_0009785 Ga0495587_0009785_793_1821 342
1042 3300046536 Ga0495587_0018769 Ga0495587_0018769_106_1134 342
1043 3300046536 Ga0495587_0030630 Ga0495587_0030630_1822_2850 342
1044 3300046536 Ga0495587_0063326 Ga0495587_0063326_187_1215 342
1045 3300046538 Ga0495609_0014673 Ga0495609_0014673_2121_3149 342
1046 3300046543 Ga0495645_0060500 Ga0495645_0060500_912_1940 342
1047 3300046543 Ga0495645_0084178 Ga0495645_0084178_791_1819 342
1048 3300046543 Ga0495645_0098074 Ga0495645_0098074_252_1280 342
1049 3300046543 Ga0495645_0214824 Ga0495645_0214824_58_1086 342
1050 3300046558 Ga0495633_0121826 Ga0495633_0121826_19_1047 342
1051 3300046559 Ga0495667_0011680 Ga0495667_0011680_2401_3429 342
1052 3300046559 Ga0495667_0015529 Ga0495667_0015529_2390_3418 342
1053 3300046559 Ga0495667_0019653 Ga0495667_0019653_996_2024 342
1054 3300046559 Ga0495667_0073707 Ga0495667_0073707_582_1610 342
1055 3300046615 Ga0495656_0017401 Ga0495656_0017401_313_1341 342
1056 3300046642 Ga0495634_0006123 Ga0495634_0006123_2215_3243 342
1057 3300046642 Ga0495634_0033886 Ga0495634_0033886_971_1999 342
1058 3300046642 Ga0495634_0070251 Ga0495634_0070251_1015_2043 342
1059 3300046642 Ga0495634_0093235 Ga0495634_0093235_65_1093 342
1060 3300046642 Ga0495634_0105891 Ga0495634_0105891_646_1674 342
1061 3300046648 Ga0495611_0009542 Ga0495611_0009542_1514_2542 342
1062 3300046660 Ga0495625_0105095 Ga0495625_0105095_492_1520 342
1063 3300046663 Ga0495635_0004098 Ga0495635_0004098_205_1233 342
1064 3300046663 Ga0495635_0005471 Ga0495635_0005471_1558_2586 342
1065 3300046663 Ga0495635_0063127 Ga0495635_0063127_697_1725 342
1066 3300046664 Ga0495659_0024284 Ga0495659_0024284_345_1373 342
1067 3300046665 Ga0495661_0160389 Ga0495661_0160389_69_1097 342
1068 3300046674 Ga0495588_0065826 Ga0495588_0065826_198_1226 342
1069 3300046675 Ga0495657_0016820 Ga0495657_0016820_1026_2054 342
1070 3300046675 Ga0495657_0027872 Ga0495657_0027872_857_1885 342
1071 3300046678 Ga0495599_0025899 Ga0495599_0025899_1613_2641 342
1072 3300046679 Ga0495623_0003775 Ga0495623_0003775_5155_6183 342
1073 3300046679 Ga0495623_0014622 Ga0495623_0014622_1980_3008 342
1074 3300046679 Ga0495623_0111037 Ga0495623_0111037_427_1455 342
1075 3300046679 Ga0495623_0134714 Ga0495623_0134714_155_1183 342
1076 3300046680 Ga0495646_0010211 Ga0495646_0010211_2589_3617 342
1077 3300046680 Ga0495646_0027423 Ga0495646_0027423_431_1459 342
1078 3300046680 Ga0495646_0059371 Ga0495646_0059371_346_1374 342
1079 3300046681 Ga0495647_0011641 Ga0495647_0011641_1215_2243 342
1080 3300046683 Ga0495658_0002959 Ga0495658_0002959_2531_3559 342
1081 3300046683 Ga0495658_0032161 Ga0495658_0032161_576_1604 342
1082 3300046683 Ga0495658_0140120 Ga0495658_0140120_37_1065 342
1083 3300046683 Ga0495658_0158322 Ga0495658_0158322_284_1312 342
1084 3300046684 Ga0495669_0010542 Ga0495669_0010542_416_1444 342
1085 3300046689 Ga0495613_0036612 Ga0495613_0036612_762_1790 342
1086 3300046689 Ga0495613_0062337 Ga0495613_0062337_760_1788 342
1087 3300046689 Ga0495613_0166637 Ga0495613_0166637_471_1499 342
1088 3300046690 Ga0495624_0020635 Ga0495624_0020635_1256_2284 342
1089 3300046690 Ga0495624_0052247 Ga0495624_0052247_1460_2488 342
1090 3300046690 Ga0495624_0096780 Ga0495624_0096780_476_1567 342
1091 3300046690 Ga0495624_0097587 Ga0495624_0097587_117_1145 342
1092 3300046691 Ga0495670_0082424 Ga0495670_0082424_54_1082 342
1093 3300046692 Ga0495671_0025057 Ga0495671_0025057_430_1458 342
1094 3300046692 Ga0495671_0055716 Ga0495671_0055716_766_1794 342
1095 3300046694 Ga0495649_0043663 Ga0495649_0043663_922_1950 342
1096 3300046694 Ga0495649_0046346 Ga0495649_0046346_1222_2250 342
1097 3300046694 Ga0495649_0067902 Ga0495649_0067902_49_1077 342
1098 3300046794 Ga0495589_0061566 Ga0495589_0061566_494_1522 342
1099 3300046809 Ga0495600_0006031 Ga0495600_0006031_3172_4200 342
1100 3300046809 Ga0495600_0075411 Ga0495600_0075411_972_2000 342
1101 3300046809 Ga0495600_0075721 Ga0495600_0075721_892_1920 342
1102 3300047315 Ga0495581_0007693 Ga0495581_0007693_3593_4621 342
1103 3300047315 Ga0495581_0008174 Ga0495581_0008174_2520_3548 342
1104 3300047315 Ga0495581_0076220 Ga0495581_0076220_213_1241 342
1105 3300047317 Ga0495604_0015248 Ga0495604_0015248_2519_3547 342
1106 3300047317 Ga0495604_0031158 Ga0495604_0031158_1909_2937 342
1107 3300047317 Ga0495604_0032435 Ga0495604_0032435_1663_2691 342
1108 3300047317 Ga0495604_0046885 Ga0495604_0046885_1229_2257 342
1109 3300047317 Ga0495604_0067018 Ga0495604_0067018_1649_2677 342
1110 3300047319 Ga0495674_0011123 Ga0495674_0011123_5900_6928 342
1111 3300047319 Ga0495674_0017380 Ga0495674_0017380_4735_5826 342
1112 3300047319 Ga0495674_0034129 Ga0495674_0034129_1960_2988 342
1113 3300047319 Ga0495674_0051661 Ga0495674_0051661_1688_2716 342
1114 3300047319 Ga0495674_0076789 Ga0495674_0076789_793_1821 342
1115 3300047320 Ga0495672_0021333 Ga0495672_0021333_740_1768 342
1116 3300047320 Ga0495672_0065044 Ga0495672_0065044_130_1158 342
1117 3300047321 Ga0495676_0036914 Ga0495676_0036914_2875_3903 342
1118 3300047321 Ga0495676_0068194 Ga0495676_0068194_1114_2142 342
1119 3300047321 Ga0495676_0095388 Ga0495676_0095388_974_2002 342
1120 3300047321 Ga0495676_0142867 Ga0495676_0142867_70_1098 342
1121 3300047321 Ga0495676_0231826 Ga0495676_0231826_174_1202 342
1122 3300047322 Ga0495680_0006738 Ga0495680_0006738_3780_4808 342
1123 3300047322 Ga0495680_0032645 Ga0495680_0032645_1004_2032 342
1124 3300047322 Ga0495680_0073685 Ga0495680_0073685_1138_2166 342
1125 3300047323 Ga0495683_0039314 Ga0495683_0039314_312_1340 342
1126 3300047443 Ga0495687_014453 Ga0495687_014453_2903_3931 342
1127 3300047444 Ga0495675_0030949 Ga0495675_0030949_1228_2256 342
1128 3300047444 Ga0495675_0085587 Ga0495675_0085587_443_1471 342
1129 3300047445 Ga0495677_0015402 Ga0495677_0015402_1269_2297 342
1130 3300047445 Ga0495677_0075179 Ga0495677_0075179_152_1180 342
1131 3300047469 Ga0495673_0074325 Ga0495673_0074325_81_1109 342
1132 3300047471 Ga0495684_0036766 Ga0495684_0036766_2033_3061 342
1133 3300047471 Ga0495684_0050588 Ga0495684_0050588_1369_2397 342
1134 3300047471 Ga0495684_0062922 Ga0495684_0062922_1718_2746 342
1135 3300047471 Ga0495684_0076364 Ga0495684_0076364_1015_2043 342
1136 3300047471 Ga0495684_0101594 Ga0495684_0101594_336_1364 342
1137 3300047471 Ga0495684_0117501 Ga0495684_0117501_852_1880 342
1138 3300047471 Ga0495684_0134132 Ga0495684_0134132_800_1828 342
1139 3300047472 Ga0495686_0183405 Ga0495686_0183405_143_1171 342
1140 3300047472 Ga0495686_0224303 Ga0495686_0224303_16_1044 342
1141 3300047673 Ga0495593_0019768 Ga0495593_0019768_807_1898 342
1142 3300047673 Ga0495593_0060529 Ga0495593_0060529_839_1867 342
1143 3300047673 Ga0495593_0060901 Ga0495593_0060901_528_1556 342
1144 3300048088 Ga0495602_0005817 Ga0495602_0005817_2071_3099 342
1145 3300048088 Ga0495602_0047118 Ga0495602_0047118_799_1827 342
1146 3300048088 Ga0495602_0089562 Ga0495602_0089562_934_1962 342
1147 3300048088 Ga0495602_0168536 Ga0495602_0168536_615_1643 342
1148 3300048089 Ga0495614_0054843 Ga0495614_0054843_421_1449 342
1149 3300048089 Ga0495614_0108878 Ga0495614_0108878_178_1206 342
1150 3300048903 Ga0496100_0001434 Ga0496100_0001434_10243_11271 342
1151 3300048903 Ga0496100_0007637 Ga0496100_0007637_4763_5791 342
1152 3300048903 Ga0496100_0021279 Ga0496100_0021279_1159_2187 342
1153 3300048903 Ga0496100_0112566 Ga0496100_0112566_420_1448 342
1154 3300048903 Ga0496100_0165090 Ga0496100_0165090_229_1257 342
1155 3300048904 Ga0496101_0002254 Ga0496101_0002254_2928_3956 342
1156 3300048904 Ga0496101_0030531 Ga0496101_0030531_2562_3590 342
1157 3300048904 Ga0496101_0043909 Ga0496101_0043909_759_1787 342
1158 3300048904 Ga0496101_0064417 Ga0496101_0064417_1057_2085 342
1159 3300048905 Ga0496102_0001340 Ga0496102_0001340_10711_11739 342
1160 3300048905 Ga0496102_0001732 Ga0496102_0001732_3875_4903 342
1161 3300048905 Ga0496102_0022395 Ga0496102_0022395_1739_2767 342
1162 3300048905 Ga0496102_0073493 Ga0496102_0073493_364_1392 342
1163 3300048905 Ga0496102_0144298 Ga0496102_0144298_517_1545 342
1164 3300048905 Ga0496102_0170195 Ga0496102_0170195_166_1194 342
1165 3300048905 Ga0496102_0320985 Ga0496102_0320985_155_1183 342
1166 3300048906 Ga0496103_0028828 Ga0496103_0028828_1560_2588 342
1167 3300048906 Ga0496103_0031135 Ga0496103_0031135_1505_2533 342
1168 3300048906 Ga0496103_0045510 Ga0496103_0045510_1011_2039 342
1169 3300048907 Ga0496104_0002060 Ga0496104_0002060_2703_3731 342
1170 3300048907 Ga0496104_0024607 Ga0496104_0024607_4373_5452 342
1171 3300048907 Ga0496104_0049168 Ga0496104_0049168_2219_3247 342
1172 3300048907 Ga0496104_0081984 Ga0496104_0081984_699_1727 342
1173 3300048907 Ga0496104_0086015 Ga0496104_0086015_1951_2979 342
1174 3300048907 Ga0496104_0100245 Ga0496104_0100245_527_1555 342
1175 3300048907 Ga0496104_0239864 Ga0496104_0239864_328_1359 342
1176 3300048908 Ga0496105_0001290 Ga0496105_0001290_7878_8906 342
1177 3300048908 Ga0496105_0003659 Ga0496105_0003659_3528_4556 342
1178 3300048908 Ga0496105_0012783 Ga0496105_0012783_747_1775 342
1179 3300048908 Ga0496105_0018396 Ga0496105_0018396_2443_3471 342
1180 3300048908 Ga0496105_0038693 Ga0496105_0038693_2115_3143 342
1181 3300048908 Ga0496105_0104257 Ga0496105_0104257_376_1404 342
1182 3300048908 Ga0496105_0265635 Ga0496105_0265635_251_1279 342
1183 3300048909 Ga0496106_0000749 Ga0496106_0000749_4100_5128 342
1184 3300048909 Ga0496106_0028512 Ga0496106_0028512_2799_3827 342
1185 3300048909 Ga0496106_0036966 Ga0496106_0036966_1223_2251 342
1186 3300048909 Ga0496106_0056039 Ga0496106_0056039_325_1353 342
1187 3300048909 Ga0496106_0061778 Ga0496106_0061778_1256_2284 342
1188 3300048909 Ga0496106_0213394 Ga0496106_0213394_241_1272 342
1189 3300048909 Ga0496106_0291456 Ga0496106_0291456_95_1123 342
1190 3300048910 Ga0496107_0039367 Ga0496107_0039367_749_1777 342
1191 3300048910 Ga0496107_0053993 Ga0496107_0053993_1029_2057 342
1192 3300048910 Ga0496107_0073563 Ga0496107_0073563_304_1332 342
1193 3300048910 Ga0496107_0186327 Ga0496107_0186327_20_1048 342
1194 3300048911 Ga0496108_0010203 Ga0496108_0010203_2893_3921 342
1195 3300048911 Ga0496108_0011810 Ga0496108_0011810_1274_2302 342
1196 3300048911 Ga0496108_0039896 Ga0496108_0039896_29_1057 342
1197 3300048911 Ga0496108_0066552 Ga0496108_0066552_666_1694 342
1198 3300048911 Ga0496108_0207359 Ga0496108_0207359_621_1649 342
1199 3300048912 Ga0496109_0000643 Ga0496109_0000643_4823_5851 342
1200 3300048912 Ga0496109_0000878 Ga0496109_0000878_18541_19569 342
1201 3300048912 Ga0496109_0001869 Ga0496109_0001869_3815_4843 342
1202 3300048912 Ga0496109_0075469 Ga0496109_0075469_1643_2671 342
1203 3300048912 Ga0496109_0145889 Ga0496109_0145889_863_1942 342
1204 3300048912 Ga0496109_0216609 Ga0496109_0216609_555_1583 342
1205 3300048912 Ga0496109_0267131 Ga0496109_0267131_402_1430 342
1206 3300048913 Ga0496110_0001735 Ga0496110_0001735_14888_15916 342
1207 3300048913 Ga0496110_0003655 Ga0496110_0003655_133_1161 342
1208 3300048913 Ga0496110_0015850 Ga0496110_0015850_4965_5993 342
1209 3300048913 Ga0496110_0023944 Ga0496110_0023944_57_1136 342
1210 3300048913 Ga0496110_0024335 Ga0496110_0024335_1394_2422 342
1211 3300048913 Ga0496110_0044621 Ga0496110_0044621_2701_3729 342
1212 3300048913 Ga0496110_0105229 Ga0496110_0105229_527_1555 342
1213 3300048914 Ga0496111_0000913 Ga0496111_0000913_3850_4878 342
1214 3300048914 Ga0496111_0019396 Ga0496111_0019396_3445_4473 342
1215 3300048914 Ga0496111_0029686 Ga0496111_0029686_2750_3778 342
1216 3300048914 Ga0496111_0059309 Ga0496111_0059309_1624_2652 342
1217 3300048914 Ga0496111_0072095 Ga0496111_0072095_1094_2122 342
1218 3300048914 Ga0496111_0094951 Ga0496111_0094951_414_1442 342
1219 3300048915 Ga0496112_0000037 Ga0496112_0000037_9988_11016 342
1220 3300048915 Ga0496112_0001774 Ga0496112_0001774_13139_14167 342
1221 3300048915 Ga0496112_0002522 Ga0496112_0002522_4819_5847 342
1222 3300048915 Ga0496112_0013688 Ga0496112_0013688_5955_6983 342
1223 3300048915 Ga0496112_0050148 Ga0496112_0050148_34_1062 342
1224 3300048915 Ga0496112_0058286 Ga0496112_0058286_787_1815 342
1225 3300048915 Ga0496112_0063987 Ga0496112_0063987_2207_3235 342
1226 3300048915 Ga0496112_0208879 Ga0496112_0208879_656_1687 342
1227 3300048916 Ga0496113_0003788 Ga0496113_0003788_6151_7179 342
1228 3300048916 Ga0496113_0048029 Ga0496113_0048029_978_2006 342
1229 3300048916 Ga0496113_0072488 Ga0496113_0072488_1039_2067 342
1230 3300048916 Ga0496113_0078147 Ga0496113_0078147_1042_2070 342
1231 3300048916 Ga0496113_0172447 Ga0496113_0172447_306_1334 342
1232 3300048917 Ga0496114_0003687 Ga0496114_0003687_10657_11685 342
1233 3300048917 Ga0496114_0076711 Ga0496114_0076711_317_1396 342
1234 3300048917 Ga0496114_0152026 Ga0496114_0152026_731_1759 342
1235 3300048918 Ga0496115_0008406 Ga0496115_0008406_5331_6359 342
1236 3300048918 Ga0496115_0041731 Ga0496115_0041731_620_1648 342
1237 3300048918 Ga0496115_0128087 Ga0496115_0128087_59_1087 342
1238 3300048920 Ga0496117_0030307 Ga0496117_0030307_1507_2535 342
1239 3300048920 Ga0496117_0031929 Ga0496117_0031929_2577_3605 342
1240 3300048920 Ga0496117_0052997 Ga0496117_0052997_1399_2433 342
1241 3300048921 Ga0496118_0020940 Ga0496118_0020940_4457_5485 342
1242 3300048921 Ga0496118_0099337 Ga0496118_0099337_735_1769 342
1243 3300048921 Ga0496118_0104805 Ga0496118_0104805_854_1882 342
1244 3300048921 Ga0496118_0160591 Ga0496118_0160591_40_1068 342
1245 3300048922 Ga0496119_0000934 Ga0496119_0000934_30129_31157 342
1246 3300048922 Ga0496119_0057082 Ga0496119_0057082_1322_2350 342
1247 3300048923 Ga0496120_0007334 Ga0496120_0007334_4122_5150 342
1248 3300048924 Ga0496121_0001566 Ga0496121_0001566_12207_13241 342
1249 3300048924 Ga0496121_0015424 Ga0496121_0015424_1245_2273 342
1250 3300048924 Ga0496121_0021364 Ga0496121_0021364_2962_3990 342
1251 3300048924 Ga0496121_0033449 Ga0496121_0033449_3379_4407 342
1252 3300048924 Ga0496121_0054203 Ga0496121_0054203_1973_3001 342
1253 3300048924 Ga0496121_0077245 Ga0496121_0077245_888_1916 342
1254 3300048925 Ga0496122_0028857 Ga0496122_0028857_1348_2376 342
1255 3300048925 Ga0496122_0165108 Ga0496122_0165108_17_1045 342
1256 3300048926 Ga0496123_0011686 Ga0496123_0011686_4555_5583 342
1257 3300048927 Ga0496124_0039476 Ga0496124_0039476_1560_2594 342
1258 3300048927 Ga0496124_0088542 Ga0496124_0088542_902_1930 342
1259 3300048927 Ga0496124_0278801 Ga0496124_0278801_68_1096 342
1260 3300048928 Ga0496125_0228827 Ga0496125_0228827_57_1085 342
1261 3300048928 Ga0496125_0255429 Ga0496125_0255429_59_1087 342
1262 3300048929 Ga0496126_0002888 Ga0496126_0002888_12360_13388 342
1263 3300048929 Ga0496126_0006284 Ga0496126_0006284_4313_5341 342
1264 3300048929 Ga0496126_0011492 Ga0496126_0011492_6629_7663 342
1265 3300048929 Ga0496126_0015066 Ga0496126_0015066_3599_4627 342
1266 3300048929 Ga0496126_0019797 Ga0496126_0019797_5316_6344 342
1267 3300049568 Ga0501031_0051468 Ga0501031_0051468_1482_2510 342
1268 3300049569 Ga0501032_0000055 Ga0501032_0000055_41195_42223 342
1269 3300049569 Ga0501032_0223014 Ga0501032_0223014_29_1057 342
1270 3300049570 Ga0501033_0001478 Ga0501033_0001478_16944_17972 342
1271 3300049571 Ga0501034_0001317 Ga0501034_0001317_1665_2693 342
1272 3300049571 Ga0501034_0521317 Ga0501034_0521317_31_1059 342
1273 3300049572 Ga0501036_0000021 Ga0501036_0000021_71875_72903 342
1274 3300049572 Ga0501036_0005983 Ga0501036_0005983_8403_9431 342
1275 3300049572 Ga0501036_0134104 Ga0501036_0134104_389_1417 342
1276 3300049573 Ga0501037_0001418 Ga0501037_0001418_3085_4113 342
1277 3300049574 Ga0501038_0000070 Ga0501038_0000070_40774_41802 342
1278 3300049574 Ga0501038_0088596 Ga0501038_0088596_1405_2433 342
1279 3300049574 Ga0501038_0221071 Ga0501038_0221071_408_1436 342
1280 3300049575 Ga0501039_0001437 Ga0501039_0001437_16308_17336 342
1281 3300049575 Ga0501039_0225438 Ga0501039_0225438_37_1065 342
1282 3300049578 Ga0501042_0209952 Ga0501042_0209952_125_1153 342
1283 3300049579 Ga0501043_0000078 Ga0501043_0000078_68651_69679 342
1284 3300049579 Ga0501043_0024823 Ga0501043_0024823_2741_3769 342
1285 3300049580 Ga0501046_0000627 Ga0501046_0000627_3697_4725 342
1286 3300049580 Ga0501046_0015839 Ga0501046_0015839_1126_2154 342
1287 3300049580 Ga0501046_0048649 Ga0501046_0048649_1685_2713 342
1288 3300049580 Ga0501046_0154282 Ga0501046_0154282_184_1212 342
1289 3300049581 Ga0501047_0000810 Ga0501047_0000810_5478_6506 342
1290 3300049581 Ga0501047_0054389 Ga0501047_0054389_52_1080 342
1291 3300049581 Ga0501047_0054608 Ga0501047_0054608_1901_2929 342
1292 3300049581 Ga0501047_0087151 Ga0501047_0087151_549_1577 342
1293 3300049581 Ga0501047_0188580 Ga0501047_0188580_418_1446 342
1294 3300049582 Ga0501048_0001060 Ga0501048_0001060_946_1974 342
1295 3300049583 Ga0501067_0000177 Ga0501067_0000177_30400_31428 342
1296 3300049585 Ga0501069_0096433 Ga0501069_0096433_103_1131 342
1297 3300049585 Ga0501069_0124527 Ga0501069_0124527_48_1076 342
1298 3300049586 Ga0501070_0001227 Ga0501070_0001227_10701_11729 342
1299 3300049588 Ga0501072_0004769 Ga0501072_0004769_881_1909 342
1300 3300049589 Ga0501073_0000039 Ga0501073_0000039_71694_72722 342
1301 3300049590 Ga0501074_0000019 Ga0501074_0000019_44366_45394 342
1302 3300049590 Ga0501074_0028878 Ga0501074_0028878_2705_3733 342
1303 3300049592 Ga0501076_0036948 Ga0501076_0036948_2121_3149 342
1304 3300049592 Ga0501076_0092578 Ga0501076_0092578_695_1723 342
1305 3300049741 Ga0501079_0060118 Ga0501079_0060118_902_1930 342
1306 3300049742 Ga0501080_0000827 Ga0501080_0000827_22050_23078 342
1307 3300049742 Ga0501080_0006935 Ga0501080_0006935_78_1106 342
1308 3300049742 Ga0501080_0214338 Ga0501080_0214338_506_1534 342
1309 3300049744 Ga0501083_0000242 Ga0501083_0000242_1101_2129 342
1310 3300049744 Ga0501083_0087287 Ga0501083_0087287_995_2023 342
1311 3300049822 Ga0501035_0001565 Ga0501035_0001565_10677_11705 342
1312 3300049822 Ga0501035_0024129 Ga0501035_0024129_3382_4410 342
1313 3300049822 Ga0501035_0149840 Ga0501035_0149840_333_1361 342
1314 3300049822 Ga0501035_0151616 Ga0501035_0151616_907_1935 342
1315 3300049822 Ga0501035_0374161 Ga0501035_0374161_103_1131 342
1316 3300049823 Ga0501044_0000179 Ga0501044_0000179_18103_19131 342
1317 3300049823 Ga0501044_0014456 Ga0501044_0014456_7246_8274 342
1318 3300049823 Ga0501044_0029341 Ga0501044_0029341_1275_2303 342
1319 3300049823 Ga0501044_0175310 Ga0501044_0175310_259_1287 342
1320 3300049823 Ga0501044_0532181 Ga0501044_0532181_20_1048 342
1321 3300049824 Ga0501045_0003829 Ga0501045_0003829_1000_2028 342
1322 3300050489 nmdc:mga03683_18496_c1 nmdc:mga03683_18496_c1_622_1650 342
1323 3300050489 nmdc:mga03683_37033_c1 nmdc:mga03683_37033_c1_889_1917 342
1324 3300050490 nmdc:mga03n38_3593_c1 nmdc:mga03n38_3593_c1_1980_3011 342
1325 3300050490 nmdc:mga03n38_6145_c1 nmdc:mga03n38_6145_c1_671_1699 342
1326 3300050490 nmdc:mga03n38_6519_c1 nmdc:mga03n38_6519_c1_2681_3709 342
1327 3300050491 nmdc:mga00v17_14203_c1 nmdc:mga00v17_14203_c1_1222_2253 342
1328 3300050491 nmdc:mga00v17_67617_c1 nmdc:mga00v17_67617_c1_53_1081 342
1329 3300050491 nmdc:mga00v17_74501_c1 nmdc:mga00v17_74501_c1_691_1719 342
1330 3300050491 nmdc:mga00v17_84926_c1 nmdc:mga00v17_84926_c1_700_1728 342
1331 3300050492 nmdc:mga0yw44_103732_c1 nmdc:mga0yw44_103732_c1_301_1329 342
1332 3300050492 nmdc:mga0yw44_20795_c1 nmdc:mga0yw44_20795_c1_1044_2072 342
1333 3300050492 nmdc:mga0yw44_44695_c1 nmdc:mga0yw44_44695_c1_947_1975 342
1334 3300050492 nmdc:mga0yw44_46962_c1 nmdc:mga0yw44_46962_c1_792_1820 342
1335 3300050492 nmdc:mga0yw44_79520_c1 nmdc:mga0yw44_79520_c1_670_1698 342
1336 3300050492 nmdc:mga0yw44_82070_c1 nmdc:mga0yw44_82070_c1_564_1595 342
1337 3300050493 nmdc:mga0k408_4051_c1 nmdc:mga0k408_4051_c1_3743_4774 342
1338 3300050493 nmdc:mga0k408_46879_c1 nmdc:mga0k408_46879_c1_358_1386 342
1339 3300050493 nmdc:mga0k408_70815_c1 nmdc:mga0k408_70815_c1_514_1542 342
1340 3300050494 nmdc:mga06z11_120663_c1 nmdc:mga06z11_120663_c1_58_1089 342
1341 3300050494 nmdc:mga06z11_208593_c1 nmdc:mga06z11_208593_c1_51_1079 342
1342 3300050494 nmdc:mga06z11_70089_c1 nmdc:mga06z11_70089_c1_60_1088 342
1343 3300050495 nmdc:mga04h51_24192_c1 nmdc:mga04h51_24192_c1_211_1239 342
1344 3300050495 nmdc:mga04h51_7894_c1 nmdc:mga04h51_7894_c1_1319_2350 342
1345 3300050496 nmdc:mga07m45_29552_c1 nmdc:mga07m45_29552_c1_1947_2975 342
1346 3300050496 nmdc:mga07m45_3594_c1 nmdc:mga07m45_3594_c1_1979_3007 342
1347 3300050496 nmdc:mga07m45_4538_c1 nmdc:mga07m45_4538_c1_3553_4584 342
1348 3300050507 nmdc:mga05p37_1334_c1 nmdc:mga05p37_1334_c1_9711_10739 342
1349 3300050507 nmdc:mga05p37_5239_c2 nmdc:mga05p37_5239_c2_218_1246 342
1350 3300050508 nmdc:mga09592_10920_c1 nmdc:mga09592_10920_c1_513_1541 342
1351 3300050509 nmdc:mga0qj67_60_c1 nmdc:mga0qj67_60_c1_1277_2308 342
1352 3300050509 nmdc:mga0qj67_7222_c1 nmdc:mga0qj67_7222_c1_1988_3016 342
1353 3300050510 nmdc:mga06r32_872_c1 nmdc:mga06r32_872_c1_20364_21392 342
1354 3300050511 nmdc:mga08y16_193845_c1 nmdc:mga08y16_193845_c1_16_1044 342
1355 3300050511 nmdc:mga08y16_201752_c1 nmdc:mga08y16_201752_c1_608_1636 342
1356 3300050511 nmdc:mga08y16_9141_c1 nmdc:mga08y16_9141_c1_7506_8534 342
1357 3300050512 nmdc:mga0n895_159639_c1 nmdc:mga0n895_159639_c1_38_1066 342
1358 3300050512 nmdc:mga0n895_21125_c1 nmdc:mga0n895_21125_c1_3948_4976 342
1359 3300050515 nmdc:mga0a205_85283_c1 nmdc:mga0a205_85283_c1_943_1971 342
1360 3300050516 nmdc:mga0sz30_13927_c1 nmdc:mga0sz30_13927_c1_573_1601 342
1361 3300050516 nmdc:mga0sz30_19236_c1 nmdc:mga0sz30_19236_c1_986_2014 342
1362 3300050516 nmdc:mga0sz30_24187_c1 nmdc:mga0sz30_24187_c1_500_1528 342
1363 3300050516 nmdc:mga0sz30_56386_c1 nmdc:mga0sz30_56386_c1_608_1636 342
1364 3300053077 Ga0495601_0005803 Ga0495601_0005803_440_1468 342
1365 3300053077 Ga0495601_0011057 Ga0495601_0011057_217_1245 342
1366 3300053077 Ga0495601_0049193 Ga0495601_0049193_846_1874 342
1367 3300053077 Ga0495601_0080475 Ga0495601_0080475_321_1349 342
1368 3300053077 Ga0495601_0140465 Ga0495601_0140465_354_1433 342
1369 3300053077 Ga0495601_0169888 Ga0495601_0169888_315_1343 342
1370 3300053078 Ga0495612_0007050 Ga0495612_0007050_2453_3481 342
1371 3300053078 Ga0495612_0016525 Ga0495612_0016525_779_1807 342
1372 3300053078 Ga0495612_0053459 Ga0495612_0053459_281_1360 342
1373 3300053078 Ga0495612_0055746 Ga0495612_0055746_509_1537 342
1374 3300053079 Ga0500610_0070254 Ga0500610_0070254_186_1214 342
1375 3300053080 Ga0500635_0002704 Ga0500635_0002704_348_1376 342
1376 3300053083 Ga0495655_0012562 Ga0495655_0012562_34_1062 342
1377 3300053083 Ga0495655_0037016 Ga0495655_0037016_80_1108 342
1378 3300053084 Ga0495595_0001332 Ga0495595_0001332_7630_8658 342
1379 3300053084 Ga0495595_0063076 Ga0495595_0063076_442_1470 342
1380 3300053085 Ga0495619_0001258 Ga0495619_0001258_2165_3193 342
1381 3300053085 Ga0495619_0028778 Ga0495619_0028778_1516_2544 342
1382 3300053085 Ga0495619_0050904 Ga0495619_0050904_523_1551 342
1383 3300053085 Ga0495619_0058284 Ga0495619_0058284_990_2018 342
1384 3300053085 Ga0495619_0059483 Ga0495619_0059483_1145_2173 342
1385 3300053085 Ga0495619_0178144 Ga0495619_0178144_395_1423 342
1386 3300053085 Ga0495619_0295338 Ga0495619_0295338_32_1060 342
1387 3300053087 Ga0500643_000013 Ga0500643_000013_238651_239679 342
1388 3300053091 Ga0500647_0009841 Ga0500647_0009841_924_1952 342
1389 3300053094 Ga0500566_0021751 Ga0500566_0021751_2518_3546 342
1390 3300053096 Ga0500641_0006994 Ga0500641_0006994_916_1944 342
1391 3300053096 Ga0500641_0116311 Ga0500641_0116311_47_1075 342
1392 3300053103 Ga0500555_005931 Ga0500555_005931_188_1216 342
1393 3300053104 Ga0500556_0025840 Ga0500556_0025840_847_1875 342
1394 3300053105 Ga0500557_000030 Ga0500557_000030_75199_76227 342
1395 3300053109 Ga0500569_016936 Ga0500569_016936_464_1492 342
1396 3300053118 Ga0500594_0015471 Ga0500594_0015471_204_1232 342
1397 3300053119 Ga0500595_002714 Ga0500595_002714_2536_3564 342
1398 3300053128 Ga0500626_079396 Ga0500626_079396_145_1173 342
1399 3300053130 Ga0500642_0000148 Ga0500642_0000148_10033_11061 342
1400 3300053130 Ga0500642_0032629 Ga0500642_0032629_147_1175 342
1401 3300053131 Ga0500652_036114 Ga0500652_036114_12_1040 342
1402 3300053133 Ga0500655_008285 Ga0500655_008285_457_1485 342
1403 3300053139 Ga0500568_0001375 Ga0500568_0001375_1391_2419 342
1404 3300053142 Ga0500577_0029299 Ga0500577_0029299_633_1661 342
1405 3300053146 Ga0500588_0020728 Ga0500588_0020728_15_1043 342
1406 3300053151 Ga0500604_0000076 Ga0500604_0000076_2117_3145 342
1407 3300053153 Ga0500616_0125787 Ga0500616_0125787_121_1149 342
1408 3300053155 Ga0500620_004246 Ga0500620_004246_579_1607 342
1409 3300053177 Ga0500636_0002634 Ga0500636_0002634_515_1543 342
1410 3300053178 Ga0500637_0208125 Ga0500637_0208125_13_1041 342
1411 3300053727 Ga0500611_021128 Ga0500611_021128_147_1175 342
1412 3300053730 Ga0500645_038077 Ga0500645_038077_339_1367 342
1413 3300053733 Ga0500552_006385 Ga0500552_006385_219_1247 342
1414 3300053737 Ga0500601_000287 Ga0500601_000287_8423_9451 342
1415 3300054114 Ga0501084_0045564 Ga0501084_0045564_1673_2701 342
1416 3300054114 Ga0501084_0432468 Ga0501084_0432468_23_1051 342
1417 3300060353 Ga0501082_0434332 Ga0501082_0434332_107_1135 342
1418 3300061719 Ga0466962_0047456 Ga0466962_0047456_892_1920 342
1419 3300061734 Ga0530510_0150803 Ga0530510_0150803_353_1381 342
1420 iso_pu_bacteria 2513237096 2513661048 342
1421 iso_pu_bacteria 2513237137 2513860567 342
1422 iso_pu_bacteria 2513237145 2513918974 342
1423 iso_pu_bacteria 2517572143 2517888296 342
1424 iso_pu_bacteria 2879083081 2879090204 342
1425 iso_pu_bacteria 2903768456 2903771564 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15887

Peptidase_Mx

Putative zinc-binding metallo-peptidase

161

265

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sna-assembly5.cif.gz_J crystal structure of antirestriction ardc protein from r388 plasmid. mn(ii)-bound structure. 0.3949 37 205
6sna-assembly5.cif.gz_J crystal structure of antirestriction ardc protein from r388 plasmid. mn(ii)-bound structure. 0.2411 37 205
1pww-assembly3.cif.gz_A crystal structure of anthrax lethal factor active site mutant protein complexed with an optimised peptide substrate in the presence of zinc. 0.2069 28 323
7yml-assembly1.cif.gz_M structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus 0.1951 102 335
6sgb-assembly1.cif.gz_F6 mt-ssu assemblosome of trypanosoma brucei 0.1897 10 205
ID Description Score Start End Superfamily
af_P9WGG7_72_176_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6023 268 340 1.10.1740.10
af_P9WGG7_72_176_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4553 268 340 1.10.1740.10
af_Q4E5S1_377_622_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.2823 35 236 1.10.390.10
af_O16790_409_708_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.2582 58 246 3.40.390.10
af_Q2KHK3_314_553_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.2327 11 325 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A354BNE7-F1-model_v4 Zinc-dependent peptidase 0.9679 3 117
AF-A0A2V6JK84-F1-model_v4 Uncharacterized protein 0.9521 3 110 GO:0016020
AF-A0A2V8I468-F1-model_v4 GNAT family N-acetyltransferase 0.9436 17 88
AF-A0A7V5UKS1-F1-model_v4 Uncharacterized protein 0.9384 1 100
AF-A0A2V6JK84-F1-model_v4 Uncharacterized protein 0.9353 3 110 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.59 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map