F493790

General Info

Members Datasets Scaffolds Average Seq Length
1416 487 1415 87

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100000403|Ga0075430_10000040324
Length 89
Sequence MIRPVITELTLFLVPFVLYALFLWGTKRSGVFDRTNWPLPHVLYLMIAAFLLVIGSFIVLAQWGGAPPGSTYTPAHVEDGRFVPGQTKK

Samples

Sample ID Description Type Environment
1 2643221651 Afipia sp. Root123D2 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
150 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
151 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
152 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
153 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
262 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
263 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
271 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
272 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
273 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
274 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
275 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
276 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
277 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
278 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
279 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
280 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
281 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
282 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
283 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
284 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
285 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
287 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
289 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
290 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
291 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
295 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
300 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
301 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
317 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
320 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
321 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
322 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
323 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
324 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
325 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
329 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
356 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
366 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
367 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
397 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
398 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
406 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
427 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
428 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
459 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
460 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
474 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
481 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
484 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0
Rhizoplane 9.46
Rhizosphere 86.51
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c011245 3300000041 Bacteria 764
2 ARcpr5yngRDRAFT_c016622 3300000043 Bacteria 617
3 ARCol0yngRDRAFT_1007988 3300000652 Bacteria 762
4 JGI24032J14994_100616 3300001430 Bacteria 1853
5 JGI24736J21556_1039826 3300001904 Bacteria 723
6 JGI24741J21665_1022668 3300001915 Bacteria 973
7 JGI24752J21851_1032527 3300001976 Bacteria 690
8 JGI24752J21851_1048551 3300001976 Bacteria 575
9 JGI24746J21847_1000660 3300001977 Bacteria 5285
10 JGI24747J21853_1000065 3300001978 Bacteria 4332
11 JGI24739J22299_10005070 3300001989 Bacteria 5015
12 JGI24737J22298_10001725 3300001990 Bacteria 7790
13 JGI24743J22301_10042470 3300001991 Bacteria 915
14 JGI24743J22301_10071357 3300001991 Bacteria 725
15 JGI24735J21928_10122357 3300002067 Bacteria 749
16 JGI24750J21931_1000201 3300002070 Bacteria 10078
17 JGI24745J21846_1000444 3300002073 Bacteria 3664
18 JGI24745J21846_1011211 3300002073 Bacteria 1023
19 JGI24738J21930_10008541 3300002075 Bacteria 2328
20 JGI24738J21930_10014356 3300002075 Bacteria 1699
21 JGI24749J21850_1002447 3300002076 Bacteria 2610
22 JGI24744J21845_10036039 3300002077 Bacteria 935
23 JGI24035J26624_1000749 3300002126 Bacteria 3043
24 JGI24033J26618_1001273 3300002155 Bacteria 2475
25 JGI24034J26672_10001663 3300002239 Bacteria 2983
26 JGI24742J22300_10000548 3300002244 Bacteria 5621
27 JGI24742J22300_10079592 3300002244 Unclassified 618
28 JGI24751J29686_10030467 3300002459 Bacteria 1119
29 JGI26129J50193_1019387 3300003349 Bacteria 506
30 JGI25404J52841_10001785 3300003659 Bacteria 3898
31 JGI25404J52841_10072301 3300003659 Unclassified 721
32 JGI25405J52794_10002720 3300003911 Bacteria 3070
33 JGI25405J52794_10106706 3300003911 Bacteria 627
34 Ga0065712_10020878 3300005290 Bacteria 1730
35 Ga0065715_10096595 3300005293 Bacteria 3846
36 Ga0065715_10280231 3300005293 Bacteria 1064
37 Ga0065707_10114838 3300005295 Bacteria 2285
38 Ga0070658_10130781 3300005327 Bacteria 2092
39 Ga0070658_10450839 3300005327 Bacteria 1108
40 Ga0070658_11010666 3300005327 Bacteria 723
41 Ga0070676_10004291 3300005328 Bacteria 7488
42 Ga0070676_10081138 3300005328 Bacteria 1968
43 Ga0070676_10874899 3300005328 Unclassified 668
44 Ga0070683_100004677 3300005329 Bacteria 11310
45 Ga0070683_100148684 3300005329 Bacteria 2221
46 Ga0070683_100189798 3300005329 Bacteria 1951
47 Ga0070690_100008757 3300005330 Bacteria 5842
48 Ga0070690_100012125 3300005330 Bacteria 5066
49 Ga0070690_100092303 3300005330 Bacteria 1996
50 Ga0070690_100270903 3300005330 Bacteria 1208
51 Ga0070670_100004378 3300005331 Bacteria 11820
52 Ga0070670_100006765 3300005331 Bacteria 9714
53 Ga0070670_100016298 3300005331 Bacteria 6382
54 Ga0070670_100198783 3300005331 Bacteria 1742
55 Ga0070677_10011104 3300005333 Bacteria 3097
56 Ga0070677_10061625 3300005333 Bacteria 1549
57 Ga0068869_100000546 3300005334 Bacteria 21018
58 Ga0068869_100377194 3300005334 Bacteria 1161
59 Ga0070666_10016324 3300005335 Bacteria 4749
60 Ga0070666_10048506 3300005335 Bacteria 2854
61 Ga0070666_10127353 3300005335 Bacteria 1768
62 Ga0070680_100391835 3300005336 Bacteria 1183
63 Ga0070680_100824459 3300005336 Bacteria 799
64 Ga0070682_100003445 3300005337 Bacteria 8766
65 Ga0070682_100085382 3300005337 Bacteria 2053
66 Ga0070682_100316557 3300005337 Bacteria 1151
67 Ga0068868_100012769 3300005338 Bacteria 6144
68 Ga0068868_100196629 3300005338 Bacteria 1679
69 Ga0068868_100554164 3300005338 Bacteria 1013
70 Ga0070660_100006773 3300005339 Bacteria 7953
71 Ga0070660_100217996 3300005339 Bacteria 1550
72 Ga0070660_100254080 3300005339 Bacteria 1434
73 Ga0070689_100002392 3300005340 Bacteria 12238
74 Ga0070689_100023289 3300005340 Bacteria 4634
75 Ga0070689_100220758 3300005340 Bacteria 1555
76 Ga0070689_100323917 3300005340 Unclassified 1287
77 Ga0070691_10003723 3300005341 Bacteria 6886
78 Ga0070691_10088425 3300005341 Bacteria 1525
79 Ga0070687_100001017 3300005343 Bacteria 9561
80 Ga0070687_100038673 3300005343 Bacteria 2393
81 Ga0070687_100515088 3300005343 Bacteria 808
82 Ga0070661_100001763 3300005344 Bacteria 15010
83 Ga0070661_100068356 3300005344 Bacteria 2611
84 Ga0070661_100260178 3300005344 Bacteria 1341
85 Ga0070661_100406702 3300005344 Bacteria 1077
86 Ga0070692_10004423 3300005345 Bacteria 5871
87 Ga0070692_10378364 3300005345 Bacteria 887
88 Ga0070668_100098541 3300005347 Bacteria 2313
89 Ga0070668_100137935 3300005347 Bacteria 1963
90 Ga0070668_100143313 3300005347 Bacteria 1927
91 Ga0070668_100638854 3300005347 Bacteria 934
92 Ga0070669_100009976 3300005353 Bacteria 6754
93 Ga0070669_100018281 3300005353 Bacteria 5009
94 Ga0070669_100568314 3300005353 Bacteria 947
95 Ga0070675_100029783 3300005354 Bacteria 4404
96 Ga0070675_100110539 3300005354 Bacteria 2324
97 Ga0070675_100335676 3300005354 Bacteria 1338
98 Ga0070671_100007031 3300005355 Bacteria 9015
99 Ga0070671_100033007 3300005355 Bacteria 4279
100 Ga0070671_100128745 3300005355 Bacteria 2131
101 Ga0070671_100739128 3300005355 Bacteria 855
102 Ga0070671_101865723 3300005355 Bacteria 534
103 Ga0070674_100018657 3300005356 Bacteria 4392
104 Ga0070674_100068500 3300005356 Bacteria 2500
105 Ga0070674_101146000 3300005356 Bacteria 688
106 Ga0070674_101919762 3300005356 Bacteria 538
107 Ga0070673_100000050 3300005364 Bacteria 49499
108 Ga0070673_100018483 3300005364 Bacteria 4981
109 Ga0070673_100025735 3300005364 Bacteria 4335
110 Ga0070688_100000781 3300005365 Bacteria 15764
111 Ga0070688_100006605 3300005365 Bacteria 6209
112 Ga0070688_100557685 3300005365 Bacteria 872
113 Ga0070659_100014541 3300005366 Bacteria 5882
114 Ga0070659_100177726 3300005366 Bacteria 1746
115 Ga0070659_100199243 3300005366 Bacteria 1648
116 Ga0070659_100263800 3300005366 Bacteria 1429
117 Ga0070667_100007711 3300005367 Bacteria 8923
118 Ga0070667_100040047 3300005367 Bacteria 3929
119 Ga0070667_100069618 3300005367 Bacteria 2995
120 Ga0070667_100099804 3300005367 Bacteria 2506
121 Ga0070703_10050731 3300005406 Bacteria 1326
122 Ga0070709_10002579 3300005434 Bacteria 9800
123 Ga0070709_10021978 3300005434 Bacteria 3725
124 Ga0070709_10080777 3300005434 Bacteria 2120
125 Ga0070709_10386789 3300005434 Bacteria 1041
126 Ga0070714_100004606 3300005435 Bacteria 10396
127 Ga0070714_100006031 3300005435 Bacteria 9304
128 Ga0070714_100413285 3300005435 Bacteria 1277
129 Ga0070714_101056293 3300005435 Bacteria 791
130 Ga0070714_101362992 3300005435 Bacteria 692
131 Ga0070713_100016906 3300005436 Bacteria 5497
132 Ga0070713_100017576 3300005436 Bacteria 5412
133 Ga0070713_100768913 3300005436 Bacteria 922
134 Ga0070713_100999547 3300005436 Bacteria 807
135 Ga0070713_101434521 3300005436 Bacteria 670
136 Ga0070710_10003313 3300005437 Bacteria 7639
137 Ga0070710_10009139 3300005437 Bacteria 4846
138 Ga0070710_10195953 3300005437 Bacteria 1273
139 Ga0070710_11028345 3300005437 Bacteria 601
140 Ga0070701_10002148 3300005438 Bacteria 7507
141 Ga0070701_10350596 3300005438 Bacteria 922
142 Ga0070711_100070490 3300005439 Bacteria 2461
143 Ga0070711_100093042 3300005439 Bacteria 2176
144 Ga0070711_100581667 3300005439 Bacteria 932
145 Ga0070711_100923648 3300005439 Bacteria 746
146 Ga0070711_101856275 3300005439 Unclassified 529
147 Ga0070705_100003118 3300005440 Bacteria 8153
148 Ga0070705_101036197 3300005440 Bacteria 668
149 Ga0070705_101271323 3300005440 Bacteria 609
150 Ga0070705_101542001 3300005440 Bacteria 558
151 Ga0070700_100002692 3300005441 Bacteria 9079
152 Ga0070700_100057652 3300005441 Bacteria 2438
153 Ga0070700_100129666 3300005441 Bacteria 1700
154 Ga0070700_100558403 3300005441 Bacteria 891
155 Ga0070700_101634796 3300005441 Bacteria 551
156 Ga0070694_100005972 3300005444 Bacteria 7383
157 Ga0070694_100071334 3300005444 Bacteria 2394
158 Ga0070694_100562943 3300005444 Bacteria 914
159 Ga0070708_100092810 3300005445 Bacteria 2751
160 Ga0070663_100020225 3300005455 Bacteria 4404
161 Ga0070663_100044767 3300005455 Bacteria 3123
162 Ga0070663_101451948 3300005455 Bacteria 609
163 Ga0070678_100000518 3300005456 Bacteria 18676
164 Ga0070678_100212529 3300005456 Bacteria 1603
165 Ga0070678_101629124 3300005456 Bacteria 606
166 Ga0070662_100021515 3300005457 Bacteria 4404
167 Ga0070662_100086443 3300005457 Bacteria 2345
168 Ga0070662_100708797 3300005457 Bacteria 852
169 Ga0070662_101498811 3300005457 Bacteria 582
170 Ga0070681_10027987 3300005458 Bacteria 5666
171 Ga0070681_11392097 3300005458 Bacteria 625
172 Ga0070681_11601729 3300005458 Bacteria 577
173 Ga0070681_11993746 3300005458 Bacteria 508
174 Ga0068867_100009022 3300005459 Bacteria 7035
175 Ga0068867_100047831 3300005459 Bacteria 3146
176 Ga0068867_102149891 3300005459 Bacteria 529
177 Ga0070685_10003674 3300005466 Bacteria 7777
178 Ga0070685_10007039 3300005466 Bacteria 5742
179 Ga0070685_10045141 3300005466 Bacteria 2526
180 Ga0070685_10484104 3300005466 Bacteria 873
181 Ga0070707_100977112 3300005468 Bacteria 812
182 Ga0070698_100279765 3300005471 Bacteria 1600
183 Ga0070699_100010972 3300005518 Bacteria 7834
184 Ga0070699_101089575 3300005518 Bacteria 733
185 Ga0070699_101607915 3300005518 Bacteria 595
186 Ga0070679_100007667 3300005530 Bacteria 10102
187 Ga0070679_100023364 3300005530 Bacteria 6050
188 Ga0070679_100252356 3300005530 Bacteria 1720
189 Ga0070684_100004205 3300005535 Bacteria 10907
190 Ga0070684_100050710 3300005535 Bacteria 3605
191 Ga0070684_100180708 3300005535 Bacteria 1918
192 Ga0070697_100535918 3300005536 Bacteria 1026
193 Ga0068853_100030067 3300005539 Bacteria 4585
194 Ga0068853_100362410 3300005539 Bacteria 1351
195 Ga0068853_101191682 3300005539 Unclassified 735
196 Ga0070672_100000643 3300005543 Bacteria 20456
197 Ga0070672_100052229 3300005543 Bacteria 3191
198 Ga0070672_100377859 3300005543 Bacteria 1211
199 Ga0070686_100001304 3300005544 Bacteria 14085
200 Ga0070686_100040350 3300005544 Bacteria 2912
201 Ga0070686_100522866 3300005544 Bacteria 924
202 Ga0070695_100187822 3300005545 Bacteria 1468
203 Ga0070696_100241197 3300005546 Bacteria 1363
204 Ga0070696_100254152 3300005546 Bacteria 1330
205 Ga0070696_100436747 3300005546 Bacteria 1030
206 Ga0070696_101855335 3300005546 Bacteria 522
207 Ga0070693_100008992 3300005547 Bacteria 4957
208 Ga0070693_100237109 3300005547 Bacteria 1203
209 Ga0070665_100021396 3300005548 Bacteria 6505
210 Ga0070665_100097872 3300005548 Bacteria 2939
211 Ga0070665_100115368 3300005548 Bacteria 2688
212 Ga0070665_100250570 3300005548 Bacteria 1771
213 Ga0070665_102210335 3300005548 Bacteria 554
214 Ga0070704_100007534 3300005549 Bacteria 6481
215 Ga0070704_101706686 3300005549 Unclassified 582
216 Ga0070704_102009305 3300005549 Unclassified 537
217 Ga0068855_100035984 3300005563 Bacteria 5895
218 Ga0070664_100026948 3300005564 Bacteria 4773
219 Ga0070664_100065477 3300005564 Bacteria 3101
220 Ga0070664_100389898 3300005564 Bacteria 1272
221 Ga0068857_100001038 3300005577 Bacteria 21487
222 Ga0068857_100128885 3300005577 Bacteria 2281
223 Ga0068857_101250275 3300005577 Unclassified 720
224 Ga0068857_101780054 3300005577 Bacteria 603
225 Ga0068854_100014606 3300005578 Bacteria 5181
226 Ga0068854_100055227 3300005578 Bacteria 2858
227 Ga0068856_100009104 3300005614 Bacteria 9654
228 Ga0068856_101206742 3300005614 Bacteria 773
229 Ga0068856_102584251 3300005614 Bacteria 514
230 Ga0070702_100004502 3300005615 Bacteria 6373
231 Ga0070702_100010693 3300005615 Bacteria 4533
232 Ga0068852_100005996 3300005616 Bacteria 8755
233 Ga0068852_100135825 3300005616 Bacteria 2271
234 Ga0068859_100095197 3300005617 Bacteria 3030
235 Ga0068859_100189786 3300005617 Bacteria 2139
236 Ga0068859_100245444 3300005617 Bacteria 1880
237 Ga0068864_100001882 3300005618 Bacteria 17235
238 Ga0068864_100006391 3300005618 Bacteria 9654
239 Ga0068864_100022271 3300005618 Bacteria 5312
240 Ga0068864_100501285 3300005618 Bacteria 1168
241 Ga0068864_101877383 3300005618 Bacteria 605
242 Ga0068866_10000791 3300005718 Bacteria 14174
243 Ga0068861_100002491 3300005719 Bacteria 12008
244 Ga0068861_100292563 3300005719 Bacteria 1407
245 Ga0068861_100467199 3300005719 Unclassified 1134
246 Ga0068861_101176387 3300005719 Bacteria 740
247 Ga0068851_10427726 3300005834 Bacteria 783
248 Ga0068870_10001431 3300005840 Bacteria 9645
249 Ga0068870_10280768 3300005840 Bacteria 1044
250 Ga0068870_11343338 3300005840 Bacteria 522
251 Ga0068863_100025687 3300005841 Bacteria 5618
252 Ga0068863_100051180 3300005841 Bacteria 3915
253 Ga0068863_101062945 3300005841 Bacteria 813
254 Ga0068858_100109053 3300005842 Bacteria 2584
255 Ga0068858_100208230 3300005842 Bacteria 1850
256 Ga0068858_100456267 3300005842 Bacteria 1232
257 Ga0068860_100002530 3300005843 Bacteria 19153
258 Ga0068860_100047790 3300005843 Bacteria 4078
259 Ga0068862_100090157 3300005844 Bacteria 2668
260 Ga0068862_100258676 3300005844 Bacteria 1588
261 Ga0081455_10000081 3300005937 Bacteria 103752
262 Ga0081455_10003729 3300005937 Bacteria 17413
263 Ga0081455_10048513 3300005937 Bacteria 3668
264 Ga0081455_10342622 3300005937 Bacteria 1057
265 Ga0081455_10415523 3300005937 Bacteria 929
266 Ga0081455_10463321 3300005937 Bacteria 862
267 Ga0081538_10001580 3300005981 Bacteria 23375
268 Ga0081538_10053594 3300005981 Bacteria 2396
269 Ga0081540_1000027 3300005983 Bacteria 151880
270 Ga0081540_1003265 3300005983 Bacteria 12889
271 Ga0081540_1010849 3300005983 Bacteria 6124
272 Ga0081540_1175043 3300005983 Bacteria 811
273 Ga0070717_10000485 3300006028 Bacteria 25249
274 Ga0070717_10000980 3300006028 Bacteria 19102
275 Ga0070717_10097524 3300006028 Bacteria 2491
276 Ga0070717_10434999 3300006028 Bacteria 1181
277 Ga0070717_10914905 3300006028 Bacteria 799
278 Ga0075365_10001829 3300006038 Bacteria 9956
279 Ga0075365_10044104 3300006038 Bacteria 2921
280 Ga0075365_10194423 3300006038 Bacteria 1420
281 Ga0075365_10331494 3300006038 Bacteria 1072
282 Ga0075368_10014387 3300006042 Bacteria 2921
283 Ga0075363_100086742 3300006048 Bacteria 1719
284 Ga0075363_100142372 3300006048 Bacteria 1351
285 Ga0075363_100217271 3300006048 Bacteria 1095
286 Ga0075363_100332782 3300006048 Bacteria 885
287 Ga0075363_100850194 3300006048 Bacteria 557
288 Ga0075432_10218624 3300006058 Unclassified 761
289 Ga0070715_10000289 3300006163 Bacteria 12366
290 Ga0070715_10001137 3300006163 Bacteria 7597
291 Ga0070715_10184904 3300006163 Bacteria 1048
292 Ga0070715_10946657 3300006163 Bacteria 533
293 Ga0070716_100004371 3300006173 Bacteria 6749
294 Ga0070716_100010832 3300006173 Bacteria 4585
295 Ga0070716_100379709 3300006173 Bacteria 1010
296 Ga0070716_101020403 3300006173 Bacteria 655
297 Ga0070712_100000381 3300006175 Bacteria 25274
298 Ga0070712_100003511 3300006175 Bacteria 9649
299 Ga0070712_100179123 3300006175 Bacteria 1650
300 Ga0070712_100589747 3300006175 Bacteria 940
301 Ga0070712_100879196 3300006175 Bacteria 772
302 Ga0070712_101221002 3300006175 Bacteria 654
303 Ga0075362_10060551 3300006177 Bacteria 1711
304 Ga0075367_10012404 3300006178 Bacteria 4543
305 Ga0075367_10018813 3300006178 Bacteria 3817
306 Ga0075367_10113914 3300006178 Bacteria 1662
307 Ga0075367_10192846 3300006178 Bacteria 1271
308 Ga0075367_10713727 3300006178 Bacteria 638
309 Ga0075366_10525448 3300006195 Bacteria 732
310 Ga0097621_100001425 3300006237 Bacteria 16408
311 Ga0097621_100010536 3300006237 Bacteria 6771
312 Ga0097621_100109482 3300006237 Bacteria 2334
313 Ga0075370_10102861 3300006353 Bacteria 1655
314 Ga0075370_10356799 3300006353 Bacteria 874
315 Ga0068871_100002394 3300006358 Bacteria 12790
316 Ga0068871_100006790 3300006358 Bacteria 8135
317 Ga0068871_100648687 3300006358 Bacteria 964
318 Ga0075428_100272670 3300006844 Bacteria 1820
319 Ga0075428_100373229 3300006844 Bacteria 1529
320 Ga0075428_100659124 3300006844 Bacteria 1116
321 Ga0075428_100816747 3300006844 Bacteria 991
322 Ga0075430_100000403 3300006846 Bacteria 32016
323 Ga0075430_100006792 3300006846 Bacteria 9643
324 Ga0075430_100659732 3300006846 Bacteria 863
325 Ga0075431_100057713 3300006847 Bacteria 4004
326 Ga0075431_100067535 3300006847 Bacteria 3691
327 Ga0075431_100221962 3300006847 Bacteria 1928
328 Ga0075431_100342061 3300006847 Bacteria 1505
329 Ga0075431_101248697 3300006847 Unclassified 705
330 Ga0075433_10111705 3300006852 Bacteria 2425
331 Ga0075433_10404315 3300006852 Bacteria 1205
332 Ga0075433_10563575 3300006852 Bacteria 1001
333 Ga0075433_11340954 3300006852 Unclassified 619
334 Ga0075433_11415695 3300006852 Bacteria 601
335 Ga0075434_100004560 3300006871 Bacteria 12511
336 Ga0075434_100031153 3300006871 Bacteria 5256
337 Ga0075434_100178126 3300006871 Bacteria 2146
338 Ga0075434_100226134 3300006871 Bacteria 1891
339 Ga0075434_100264005 3300006871 Bacteria 1741
340 Ga0075434_100391020 3300006871 Bacteria 1412
341 Ga0075434_100519711 3300006871 Bacteria 1211
342 Ga0075429_100195306 3300006880 Bacteria 1773
343 Ga0075429_100437345 3300006880 Bacteria 1146
344 Ga0075429_101038743 3300006880 Bacteria 716
345 Ga0068865_100001097 3300006881 Bacteria 15622
346 Ga0068865_100134918 3300006881 Bacteria 1853
347 Ga0068865_100249461 3300006881 Bacteria 1400
348 Ga0068865_100631968 3300006881 Bacteria 908
349 Ga0075436_100068349 3300006914 Bacteria 2454
350 Ga0097620_100095196 3300006931 Bacteria 3030
351 Ga0097620_100189785 3300006931 Bacteria 2139
352 Ga0097620_100245421 3300006931 Bacteria 1880
353 Ga0075435_100075222 3300007076 Bacteria 2765
354 Ga0075435_100247382 3300007076 Bacteria 1517
355 Ga0075435_100304901 3300007076 Bacteria 1362
356 Ga0075435_100493958 3300007076 Bacteria 1058
357 Ga0075435_100765232 3300007076 Bacteria 840
358 Ga0105251_10036136 3300009011 Bacteria 2433
359 Ga0105251_10091272 3300009011 Unclassified 1399
360 Ga0105244_10023607 3300009036 Bacteria 3369
361 Ga0105244_10435472 3300009036 Unclassified 603
362 Ga0105250_10078729 3300009092 Bacteria 1335
363 Ga0105250_10616440 3300009092 Bacteria 504
364 Ga0105240_10067050 3300009093 Bacteria 4450
365 Ga0105240_11464700 3300009093 Bacteria 716
366 Ga0111539_10026539 3300009094 Bacteria 7080
367 Ga0111539_10034470 3300009094 Bacteria 6137
368 Ga0111539_10189267 3300009094 Bacteria 2402
369 Ga0111539_10263224 3300009094 Bacteria 2007
370 Ga0111539_11078790 3300009094 Bacteria 933
371 Ga0111539_11664275 3300009094 Bacteria 740
372 Ga0111539_12606955 3300009094 Unclassified 586
373 Ga0105245_10025559 3300009098 Bacteria 5194
374 Ga0105245_10133583 3300009098 Bacteria 2330
375 Ga0105245_11173960 3300009098 Bacteria 815
376 Ga0105245_12571918 3300009098 Unclassified 562
377 Ga0105247_10003270 3300009101 Bacteria 10626
378 Ga0105247_10024258 3300009101 Bacteria 3653
379 Ga0105247_10025129 3300009101 Bacteria 3594
380 Ga0105247_10046239 3300009101 Bacteria 2671
381 Ga0105247_10420950 3300009101 Bacteria 956
382 Ga0114129_10024067 3300009147 Bacteria 8629
383 Ga0114129_10027094 3300009147 Bacteria 8115
384 Ga0114129_10035205 3300009147 Bacteria 7074
385 Ga0114129_10349738 3300009147 Bacteria 1958
386 Ga0114129_10511680 3300009147 Bacteria 1566
387 Ga0114129_10837248 3300009147 Bacteria 1171
388 Ga0114129_13056179 3300009147 Bacteria 548
389 Ga0105243_10002400 3300009148 Bacteria 15707
390 Ga0105243_10004402 3300009148 Bacteria 11139
391 Ga0105243_11781848 3300009148 Bacteria 646
392 Ga0105241_10008636 3300009174 Bacteria 7488
393 Ga0105242_10007578 3300009176 Bacteria 8356
394 Ga0105242_10008734 3300009176 Bacteria 7775
395 Ga0105242_10169037 3300009176 Bacteria 1920
396 Ga0105248_10010839 3300009177 Bacteria 10064
397 Ga0105248_10014218 3300009177 Bacteria 8762
398 Ga0105248_10081366 3300009177 Bacteria 3640
399 Ga0105248_10462007 3300009177 Bacteria 1431
400 Ga0105237_10030610 3300009545 Bacteria 5465
401 Ga0105237_10072688 3300009545 Bacteria 3433
402 Ga0105237_10198301 3300009545 Bacteria 2007
403 Ga0105237_10233019 3300009545 Bacteria 1842
404 Ga0105237_10921939 3300009545 Bacteria 881
405 Ga0105237_12173966 3300009545 Bacteria 564
406 Ga0105238_10009678 3300009551 Bacteria 9647
407 Ga0105238_10704814 3300009551 Bacteria 1022
408 Ga0105238_10923956 3300009551 Bacteria 891
409 Ga0105249_10011450 3300009553 Bacteria 7790
410 Ga0105249_10060226 3300009553 Bacteria 3482
411 Ga0105249_10190476 3300009553 Bacteria 2001
412 Ga0105249_10635830 3300009553 Bacteria 1124
413 Ga0105249_10835085 3300009553 Bacteria 986
414 Ga0105249_10889730 3300009553 Bacteria 957
415 Ga0105249_11209839 3300009553 Bacteria 827
416 Ga0105239_10024088 3300010375 Bacteria 6704
417 Ga0105239_10060055 3300010375 Bacteria 4172
418 Ga0105239_10194362 3300010375 Bacteria 2272
419 Ga0105239_11542931 3300010375 Bacteria 768
420 Ga0105239_13644122 3300010375 Unclassified 500
421 Ga0105246_10022159 3300011119 Bacteria 4097
422 Ga0105246_10025827 3300011119 Bacteria 3830
423 Ga0105246_10064420 3300011119 Bacteria 2560
424 Ga0105246_10293961 3300011119 Bacteria 1308
425 Ga0105246_10516105 3300011119 Bacteria 1017
426 Ga0157325_1001090 3300012485 Bacteria 1178
427 Ga0157339_1006614 3300012505 Unclassified 951
428 Ga0157342_1016394 3300012507 Unclassified 819
429 Ga0157316_1000861 3300012510 Unclassified 1733
430 Ga0157338_1041924 3300012515 Unclassified 627
431 Ga0157373_10045749 3300013100 Bacteria 3124
432 Ga0157373_10185997 3300013100 Bacteria 1463
433 Ga0157373_11039297 3300013100 Unclassified 613
434 Ga0157371_10070112 3300013102 Bacteria 2482
435 Ga0157370_10100379 3300013104 Bacteria 2712
436 Ga0157370_10377576 3300013104 Bacteria 1306
437 Ga0157370_10989840 3300013104 Bacteria 761
438 Ga0157369_10618176 3300013105 Bacteria 1118
439 Ga0157374_10001167 3300013296 Bacteria 22404
440 Ga0157374_10338893 3300013296 Bacteria 1492
441 Ga0157374_10418172 3300013296 Bacteria 1339
442 Ga0157374_11019193 3300013296 Bacteria 847
443 Ga0157374_11253782 3300013296 Bacteria 763
444 Ga0157378_10008023 3300013297 Bacteria 9217
445 Ga0157378_10034938 3300013297 Bacteria 4444
446 Ga0157378_10103420 3300013297 Bacteria 2602
447 Ga0157378_10230936 3300013297 Bacteria 1763
448 Ga0163162_10010853 3300013306 Bacteria 8866
449 Ga0163162_10102479 3300013306 Bacteria 2956
450 Ga0163162_10156327 3300013306 Bacteria 2400
451 Ga0157372_10070864 3300013307 Bacteria 3923
452 Ga0157372_10788245 3300013307 Bacteria 1104
453 Ga0157372_13397406 3300013307 Bacteria 506
454 Ga0157375_10031874 3300013308 Bacteria 4992
455 Ga0157375_10058370 3300013308 Bacteria 3817
456 Ga0157375_10307243 3300013308 Bacteria 1750
457 Ga0157375_11513626 3300013308 Bacteria 792
458 Ga0157375_12241485 3300013308 Bacteria 651
459 Ga0163163_10007288 3300014325 Bacteria 9756
460 Ga0163163_10011174 3300014325 Bacteria 8131
461 Ga0163163_10072774 3300014325 Bacteria 3426
462 Ga0163163_10303092 3300014325 Bacteria 1650
463 Ga0163163_10638904 3300014325 Bacteria 1128
464 Ga0163163_11160597 3300014325 Bacteria 835
465 Ga0157380_10001551 3300014326 Bacteria 15111
466 Ga0157380_10141506 3300014326 Bacteria 2068
467 Ga0157380_10484984 3300014326 Bacteria 1196
468 Ga0157380_11535554 3300014326 Bacteria 720
469 Ga0157380_12279306 3300014326 Unclassified 606
470 Ga0182008_10154603 3300014497 Bacteria 1152
471 Ga0182008_10676170 3300014497 Bacteria 587
472 Ga0157377_10009300 3300014745 Bacteria 4814
473 Ga0157377_10053554 3300014745 Bacteria 2282
474 Ga0157377_10134432 3300014745 Bacteria 1514
475 Ga0157379_10008646 3300014968 Bacteria 8866
476 Ga0157379_10081393 3300014968 Bacteria 2901
477 Ga0157379_10112149 3300014968 Bacteria 2450
478 Ga0157379_10291285 3300014968 Bacteria 1487
479 Ga0157379_11158923 3300014968 Unclassified 742
480 Ga0157376_10580618 3300014969 Bacteria 1113
481 Ga0157376_12255506 3300014969 Bacteria 583
482 Ga0157376_12564712 3300014969 Unclassified 549
483 Ga0163161_10011103 3300017792 Bacteria 6240
484 Ga0163161_10078053 3300017792 Bacteria 2433
485 Ga0163161_10214200 3300017792 Bacteria 1489
486 Ga0163161_10480441 3300017792 Bacteria 1009
487 Ga0213872_10280375 3300021361 Unclassified 696
488 Ga0213876_10029343 3300021384 Bacteria 2898
489 Ga0207666_1000153 3300025271 Bacteria 10663
490 Ga0207673_1000206 3300025290 Bacteria 5940
491 Ga0207697_10001059 3300025315 Bacteria 15198
492 Ga0207697_10296209 3300025315 Unclassified 717
493 Ga0207656_10230074 3300025321 Bacteria 903
494 Ga0207713_1051898 3300025735 Bacteria 1627
495 Ga0207713_1084833 3300025735 Bacteria 1129
496 Ga0207653_10020183 3300025885 Bacteria 2108
497 Ga0207682_10002885 3300025893 Bacteria 7586
498 Ga0207692_10000282 3300025898 Bacteria 17493
499 Ga0207692_10020210 3300025898 Bacteria 3024
500 Ga0207692_10436411 3300025898 Bacteria 822
501 Ga0207642_10119120 3300025899 Bacteria 1358
502 Ga0207642_10347258 3300025899 Bacteria 874
503 Ga0207710_10000382 3300025900 Bacteria 30360
504 Ga0207710_10010435 3300025900 Bacteria 3912
505 Ga0207710_10012560 3300025900 Bacteria 3563
506 Ga0207710_10036246 3300025900 Bacteria 2173
507 Ga0207688_10001072 3300025901 Bacteria 13993
508 Ga0207688_10004597 3300025901 Bacteria 7515
509 Ga0207680_10008936 3300025903 Bacteria 4943
510 Ga0207680_10018703 3300025903 Bacteria 3690
511 Ga0207680_10552131 3300025903 Bacteria 822
512 Ga0207647_10033262 3300025904 Bacteria 3302
513 Ga0207647_10071757 3300025904 Bacteria 2089
514 Ga0207685_10000164 3300025905 Bacteria 10037
515 Ga0207685_10189110 3300025905 Bacteria 960
516 Ga0207699_10148435 3300025906 Bacteria 1548
517 Ga0207699_10230402 3300025906 Bacteria 1269
518 Ga0207699_10300091 3300025906 Bacteria 1121
519 Ga0207699_10315460 3300025906 Bacteria 1095
520 Ga0207699_10405395 3300025906 Bacteria 972
521 Ga0207699_10411845 3300025906 Bacteria 964
522 Ga0207699_11077179 3300025906 Bacteria 595
523 Ga0207645_10002745 3300025907 Bacteria 13711
524 Ga0207645_10036554 3300025907 Bacteria 3153
525 Ga0207645_10065071 3300025907 Bacteria 2330
526 Ga0207645_10245704 3300025907 Bacteria 1183
527 Ga0207643_10000004 3300025908 Bacteria 187006
528 Ga0207643_10000532 3300025908 Bacteria 24445
529 Ga0207705_10517875 3300025909 Bacteria 927
530 Ga0207654_10008032 3300025911 Bacteria 5318
531 Ga0207654_10158904 3300025911 Bacteria 1458
532 Ga0207654_11011474 3300025911 Bacteria 605
533 Ga0207707_10140307 3300025912 Bacteria 2113
534 Ga0207707_10273104 3300025912 Bacteria 1465
535 Ga0207707_10425930 3300025912 Bacteria 1137
536 Ga0207707_11133418 3300025912 Bacteria 636
537 Ga0207695_10072726 3300025913 Bacteria 3506
538 Ga0207695_10542897 3300025913 Bacteria 1044
539 Ga0207671_10086564 3300025914 Bacteria 2355
540 Ga0207671_10137614 3300025914 Bacteria 1879
541 Ga0207671_11387138 3300025914 Bacteria 545
542 Ga0207693_10001038 3300025915 Bacteria 24865
543 Ga0207693_10005381 3300025915 Bacteria 10696
544 Ga0207663_10001206 3300025916 Bacteria 11940
545 Ga0207663_10020826 3300025916 Bacteria 3722
546 Ga0207663_10062599 3300025916 Bacteria 2365
547 Ga0207660_10009992 3300025917 Bacteria 6148
548 Ga0207660_10073080 3300025917 Bacteria 2499
549 Ga0207660_10592331 3300025917 Bacteria 903
550 Ga0207662_10000392 3300025918 Bacteria 19588
551 Ga0207662_10001199 3300025918 Bacteria 12365
552 Ga0207662_10124829 3300025918 Bacteria 1618
553 Ga0207657_10002007 3300025919 Bacteria 22003
554 Ga0207657_10019229 3300025919 Bacteria 6492
555 Ga0207657_10039060 3300025919 Bacteria 4220
556 Ga0207649_10005404 3300025920 Bacteria 6918
557 Ga0207649_10228759 3300025920 Bacteria 1329
558 Ga0207649_10360867 3300025920 Bacteria 1078
559 Ga0207649_10365921 3300025920 Bacteria 1071
560 Ga0207652_10058342 3300025921 Bacteria 3326
561 Ga0207652_10128917 3300025921 Bacteria 2255
562 Ga0207652_10169574 3300025921 Bacteria 1958
563 Ga0207646_10869308 3300025922 Bacteria 801
564 Ga0207681_10024530 3300025923 Bacteria 3871
565 Ga0207681_10077414 3300025923 Bacteria 2338
566 Ga0207694_10363721 3300025924 Bacteria 1199
567 Ga0207650_10004542 3300025925 Bacteria 9492
568 Ga0207650_10017240 3300025925 Bacteria 5055
569 Ga0207650_10412758 3300025925 Bacteria 1119
570 Ga0207659_10000374 3300025926 Bacteria 26976
571 Ga0207659_10025170 3300025926 Bacteria 3996
572 Ga0207659_10383099 3300025926 Bacteria 1173
573 Ga0207659_11675219 3300025926 Unclassified 542
574 Ga0207687_10036426 3300025927 Bacteria 3352
575 Ga0207687_10041087 3300025927 Bacteria 3174
576 Ga0207700_10003347 3300025928 Bacteria 9298
577 Ga0207700_10031654 3300025928 Bacteria 3761
578 Ga0207700_10067428 3300025928 Bacteria 2739
579 Ga0207700_10287224 3300025928 Bacteria 1417
580 Ga0207700_10999172 3300025928 Bacteria 749
581 Ga0207700_11152062 3300025928 Bacteria 693
582 Ga0207664_10012974 3300025929 Bacteria 5970
583 Ga0207664_10339181 3300025929 Bacteria 1329
584 Ga0207664_11341152 3300025929 Unclassified 635
585 Ga0207664_11733889 3300025929 Bacteria 547
586 Ga0207644_10004888 3300025931 Bacteria 8732
587 Ga0207644_10073489 3300025931 Bacteria 2507
588 Ga0207644_10328146 3300025931 Bacteria 1238
589 Ga0207690_10088497 3300025932 Bacteria 2181
590 Ga0207690_10410738 3300025932 Bacteria 1081
591 Ga0207690_10536168 3300025932 Bacteria 950
592 Ga0207690_10806594 3300025932 Bacteria 776
593 Ga0207706_10010623 3300025933 Bacteria 8409
594 Ga0207706_10095775 3300025933 Bacteria 2610
595 Ga0207686_10007542 3300025934 Bacteria 5858
596 Ga0207686_10025932 3300025934 Bacteria 3416
597 Ga0207686_10102145 3300025934 Bacteria 1916
598 Ga0207709_10003882 3300025935 Bacteria 8742
599 Ga0207709_10027047 3300025935 Bacteria 3300
600 Ga0207709_10069241 3300025935 Bacteria 2233
601 Ga0207670_10004902 3300025936 Bacteria 7280
602 Ga0207670_10043451 3300025936 Bacteria 2968
603 Ga0207670_10177322 3300025936 Bacteria 1603
604 Ga0207670_10217320 3300025936 Bacteria 1461
605 Ga0207669_10000275 3300025937 Bacteria 23591
606 Ga0207669_10083520 3300025937 Bacteria 2054
607 Ga0207704_10002620 3300025938 Bacteria 8124
608 Ga0207704_10105952 3300025938 Bacteria 1887
609 Ga0207665_10000541 3300025939 Bacteria 25458
610 Ga0207665_10013741 3300025939 Bacteria 5325
611 Ga0207665_10205088 3300025939 Bacteria 1438
612 Ga0207665_10288681 3300025939 Bacteria 1223
613 Ga0207691_10004396 3300025940 Bacteria 13666
614 Ga0207691_10030766 3300025940 Bacteria 5014
615 Ga0207711_10002645 3300025941 Bacteria 15844
616 Ga0207711_10005696 3300025941 Bacteria 10522
617 Ga0207711_10021126 3300025941 Bacteria 5438
618 Ga0207711_11283095 3300025941 Bacteria 674
619 Ga0207689_10002724 3300025942 Bacteria 16345
620 Ga0207689_10077139 3300025942 Bacteria 2739
621 Ga0207689_10496678 3300025942 Bacteria 1022
622 Ga0207661_10015256 3300025944 Bacteria 5649
623 Ga0207661_10112752 3300025944 Bacteria 2303
624 Ga0207661_10159486 3300025944 Bacteria 1956
625 Ga0207661_10248476 3300025944 Bacteria 1580
626 Ga0207679_10001617 3300025945 Bacteria 14034
627 Ga0207679_10151996 3300025945 Bacteria 1885
628 Ga0207667_10702478 3300025949 Bacteria 1014
629 Ga0207651_10004195 3300025960 Bacteria 7218
630 Ga0207651_10057280 3300025960 Bacteria 2687
631 Ga0207651_10101715 3300025960 Bacteria 2134
632 Ga0207651_11533688 3300025960 Bacteria 600
633 Ga0207712_10033211 3300025961 Bacteria 3487
634 Ga0207712_10069490 3300025961 Bacteria 2527
635 Ga0207712_10218996 3300025961 Bacteria 1521
636 Ga0207712_10298718 3300025961 Bacteria 1320
637 Ga0207712_10413420 3300025961 Bacteria 1136
638 Ga0207712_11079490 3300025961 Bacteria 714
639 Ga0207668_10005763 3300025972 Bacteria 7301
640 Ga0207668_10288942 3300025972 Bacteria 1348
641 Ga0207668_10298681 3300025972 Bacteria 1328
642 Ga0207640_10015642 3300025981 Bacteria 4396
643 Ga0207640_10105178 3300025981 Bacteria 1988
644 Ga0207658_10084208 3300025986 Bacteria 2446
645 Ga0207658_10251997 3300025986 Bacteria 1500
646 Ga0207658_11480453 3300025986 Bacteria 621
647 Ga0207677_10044077 3300026023 Bacteria 2969
648 Ga0207677_10044426 3300026023 Bacteria 2960
649 Ga0207677_10094078 3300026023 Bacteria 2187
650 Ga0207703_10001822 3300026035 Bacteria 19007
651 Ga0207703_10019332 3300026035 Bacteria 5322
652 Ga0207703_10041983 3300026035 Bacteria 3666
653 Ga0207703_10537759 3300026035 Bacteria 1101
654 Ga0207639_10019446 3300026041 Bacteria 4844
655 Ga0207639_10313517 3300026041 Bacteria 1390
656 Ga0207639_11168052 3300026041 Unclassified 722
657 Ga0207678_10002471 3300026067 Bacteria 16791
658 Ga0207678_10019865 3300026067 Bacteria 5905
659 Ga0207678_10032268 3300026067 Bacteria 4565
660 Ga0207708_10001992 3300026075 Bacteria 15035
661 Ga0207708_10047755 3300026075 Bacteria 3258
662 Ga0207708_10196640 3300026075 Bacteria 1607
663 Ga0207702_10021444 3300026078 Bacteria 5349
664 Ga0207702_10886104 3300026078 Bacteria 884
665 Ga0207702_11214162 3300026078 Bacteria 748
666 Ga0207641_10019509 3300026088 Bacteria 5565
667 Ga0207641_10493316 3300026088 Bacteria 1188
668 Ga0207641_10848924 3300026088 Bacteria 905
669 Ga0207648_10004767 3300026089 Bacteria 13850
670 Ga0207648_10010273 3300026089 Bacteria 8889
671 Ga0207676_10001979 3300026095 Bacteria 14919
672 Ga0207676_10002246 3300026095 Bacteria 13878
673 Ga0207676_10375764 3300026095 Bacteria 1321
674 Ga0207676_10473035 3300026095 Bacteria 1185
675 Ga0207676_11118263 3300026095 Bacteria 779
676 Ga0207674_10007733 3300026116 Bacteria 12510
677 Ga0207674_10340244 3300026116 Unclassified 1451
678 Ga0207674_12165721 3300026116 Unclassified 519
679 Ga0207675_100003883 3300026118 Bacteria 14527
680 Ga0207675_100007986 3300026118 Bacteria 9973
681 Ga0207675_100255645 3300026118 Bacteria 1697
682 Ga0207683_10002044 3300026121 Bacteria 17862
683 Ga0207683_10009279 3300026121 Bacteria 8382
684 Ga0207683_10124841 3300026121 Bacteria 2313
685 Ga0207698_10031944 3300026142 Bacteria 3808
686 Ga0207698_10079168 3300026142 Bacteria 2642
687 Ga0207698_10828466 3300026142 Bacteria 929
688 Ga0210000_1028337 3300027462 Bacteria 872
689 Ga0209970_1001300 3300027614 Bacteria 4390
690 Ga0210002_1002503 3300027617 Bacteria 2653
691 Ga0209971_1051991 3300027682 Bacteria 990
692 Ga0209966_1049627 3300027695 Bacteria 890
693 Ga0209998_10001985 3300027717 Bacteria 4800
694 Ga0209998_10027289 3300027717 Bacteria 1250
695 Ga0209813_10042324 3300027866 Bacteria 1392
696 Ga0209974_10010843 3300027876 Bacteria 3070
697 Ga0209974_10013531 3300027876 Bacteria 2718
698 Ga0207428_10000501 3300027907 Bacteria 46798
699 Ga0207428_10240725 3300027907 Bacteria 1352
700 Ga0268266_10003041 3300028379 Bacteria 17192
701 Ga0268266_10268549 3300028379 Bacteria 1583
702 Ga0268266_10288641 3300028379 Bacteria 1527
703 Ga0268265_10027065 3300028380 Bacteria 4088
704 Ga0268265_10055116 3300028380 Bacteria 3019
705 Ga0268264_10041889 3300028381 Bacteria 3788
706 Ga0268264_10342531 3300028381 Bacteria 1420
707 Ga0268264_10542243 3300028381 Unclassified 1140
708 Ga0268264_11402776 3300028381 Bacteria 709
709 Ga0268264_12184799 3300028381 Bacteria 561
710 Ga0265338_10806974 3300028800 Unclassified 643
711 Ga0265330_10221819 3300031235 Bacteria 798
712 Ga0265332_10011394 3300031238 Bacteria 3953
713 Ga0265332_10045090 3300031238 Bacteria 1901
714 Ga0265320_10502443 3300031240 Bacteria 535
715 Ga0265325_10000073 3300031241 Bacteria 70109
716 Ga0265325_10051523 3300031241 Bacteria 2116
717 Ga0265329_10021345 3300031242 Bacteria 2175
718 Ga0265340_10009552 3300031247 Bacteria 5201
719 Ga0265340_10105527 3300031247 Bacteria 1306
720 Ga0265339_10052691 3300031249 Bacteria 2216
721 Ga0265339_10145540 3300031249 Bacteria 1202
722 Ga0265339_10152032 3300031249 Bacteria 1170
723 Ga0265331_10055553 3300031250 Bacteria 1883
724 Ga0265331_10063698 3300031250 Bacteria 1736
725 Ga0265316_10470323 3300031344 Bacteria 900
726 Ga0265316_10508621 3300031344 Bacteria 860
727 Ga0265316_10744580 3300031344 Bacteria 689
728 Ga0265316_11293843 3300031344 Bacteria 503
729 Ga0307408_101670668 3300031548 Bacteria 606
730 Ga0265313_10022124 3300031595 Bacteria 3457
731 Ga0265313_10027730 3300031595 Bacteria 2960
732 Ga0265313_10320954 3300031595 Bacteria 619
733 Ga0316575_10078991 3300031665 Bacteria 1326
734 Ga0316575_10401431 3300031665 Bacteria 588
735 Ga0316575_10485878 3300031665 Bacteria 535
736 Ga0265314_10040448 3300031711 Bacteria 3346
737 Ga0265314_10459996 3300031711 Bacteria 676
738 Ga0265342_10088384 3300031712 Bacteria 1779
739 Ga0265342_10092487 3300031712 Bacteria 1732
740 Ga0307413_11908229 3300031824 Bacteria 534
741 Ga0307409_101253998 3300031995 Bacteria 766
742 Ga0307416_103338916 3300032002 Bacteria 537
743 Ga0316583_10005022 3300032133 Bacteria 4734
744 Ga0316583_10101660 3300032133 Bacteria 1002
745 Ga0373930_0001440 3300034816 Bacteria 3539
746 Ga0373930_0026002 3300034816 Unclassified 1178
747 Ga0373950_0007742 3300034818 Bacteria 1674
748 Ga0373950_0051411 3300034818 Bacteria 810
749 Ga0373959_0034325 3300034820 Bacteria 1038
750 Ga0373959_0089070 3300034820 Bacteria 721
751 Ga0373938_0006145 3300034957 Bacteria 2065
752 Ga0373938_0016299 3300034957 Bacteria 1450
753 Ga0373926_0012934 3300035083 Bacteria 2826
754 Ga0373926_0026591 3300035083 Bacteria 2025
755 Ga0373926_0086034 3300035083 Bacteria 1166
756 Ga0373928_0000779 3300035084 Bacteria 6200
757 Ga0373929_0094396 3300035085 Bacteria 746
758 Ga0373929_0177484 3300035085 Unclassified 586
759 Ga0373934_0007860 3300035086 Bacteria 3966
760 Ga0373934_0089028 3300035086 Bacteria 1243
761 Ga0373944_0000648 3300035089 Bacteria 8271
762 Ga0373944_0006736 3300035089 Bacteria 3056
763 Ga0373944_0007628 3300035089 Bacteria 2905
764 Ga0373949_0001783 3300035090 Bacteria 5906
765 Ga0373949_0030756 3300035090 Bacteria 1277
766 Ga0373951_0024865 3300035091 Bacteria 1389
767 Ga0373951_0052435 3300035091 Bacteria 1006
768 Ga0373952_0014213 3300035092 Bacteria 1590
769 Ga0373952_0238562 3300035092 Bacteria 546
770 Ga0373923_0000903 3300035111 Bacteria 7919
771 Ga0373932_0007032 3300035112 Bacteria 2674
772 Ga0373936_0025442 3300035113 Bacteria 2314
773 Ga0373936_0040602 3300035113 Bacteria 1864
774 Ga0373939_0005507 3300035114 Bacteria 3019
775 Ga0373939_0014215 3300035114 Bacteria 2062
776 Ga0373939_0060939 3300035114 Bacteria 1201
777 Ga0373939_0183290 3300035114 Bacteria 782
778 Ga0373941_0007122 3300035115 Bacteria 2724
779 Ga0373941_0080731 3300035115 Bacteria 1098
780 Ga0373945_0000024 3300035116 Bacteria 30607
781 Ga0373945_0005743 3300035116 Bacteria 3983
782 Ga0373945_0009935 3300035116 Bacteria 3126
783 Ga0373945_0020687 3300035116 Bacteria 2255
784 Ga0373953_0065822 3300035117 Bacteria 1488
785 Ga0373953_0066423 3300035117 Bacteria 1482
786 Ga0373953_0183570 3300035117 Bacteria 903
787 Ga0373954_0047403 3300035118 Bacteria 2011
788 Ga0373954_0091021 3300035118 Bacteria 1465
789 Ga0373954_0119964 3300035118 Bacteria 1276
790 Ga0373954_0344467 3300035118 Bacteria 736
791 Ga0373956_0009220 3300035119 Bacteria 4006
792 Ga0373957_0031324 3300035120 Bacteria 1954
793 Ga0373957_0032882 3300035120 Bacteria 1913
794 Ga0373957_0045943 3300035120 Bacteria 1656
795 Ga0373960_0008365 3300035121 Bacteria 2478
796 Ga0373943_0016457 3300035170 Bacteria 3372
797 Ga0373943_0027886 3300035170 Bacteria 2657
798 Ga0373943_0153384 3300035170 Bacteria 1249
799 Ga0373946_0001675 3300035171 Bacteria 7723
800 Ga0373946_0003685 3300035171 Bacteria 5427
801 Ga0373946_0084970 3300035171 Bacteria 1393
802 Ga0373955_0003013 3300035172 Bacteria 7382
803 Ga0373955_0004843 3300035172 Bacteria 6000
804 Ga0373955_0010601 3300035172 Bacteria 4359
805 Ga0373955_0049136 3300035172 Bacteria 2290
806 Ga0373955_0374692 3300035172 Bacteria 863
807 Ga0373942_0002310 3300035207 Bacteria 4661
808 Ga0373942_0112143 3300035207 Bacteria 844
809 Ga0373961_0031030 3300035241 Bacteria 1490
810 Ga0373961_0041626 3300035241 Bacteria 1328
811 Ga0373961_0362807 3300035241 Unclassified 549
812 Ga0373962_0003472 3300035242 Bacteria 3785
813 Ga0373962_0044976 3300035242 Bacteria 1256
814 Ga0373962_0055949 3300035242 Bacteria 1147
815 Ga0373924_0001803 3300035410 Bacteria 7079
816 Ga0373924_0170261 3300035410 Bacteria 957
817 Ga0373924_0237640 3300035410 Bacteria 806
818 Ga0373924_0453123 3300035410 Bacteria 575
819 Ga0373931_0008043 3300035691 Bacteria 4989
820 Ga0373931_0025914 3300035691 Bacteria 2979
821 Ga0373931_0145273 3300035691 Bacteria 1378
822 Ga0373935_0008653 3300035692 Bacteria 6095
823 Ga0373935_0009334 3300035692 Bacteria 5875
824 Ga0373935_0017120 3300035692 Bacteria 4391
825 Ga0373935_0315659 3300035692 Bacteria 1108
826 Ga0373935_0545746 3300035692 Bacteria 845
827 Ga0373927_0003867 3300035695 Bacteria 10616
828 Ga0373927_0025567 3300035695 Bacteria 3860
829 Ga0373927_0047557 3300035695 Bacteria 2775
830 Ga0373927_1053640 3300035695 Bacteria 536
831 Ga0373933_0011420 3300035724 Bacteria 4894
832 Ga0373933_0132734 3300035724 Bacteria 1567
833 Ga0373933_0579332 3300035724 Bacteria 737
834 Ga0373933_0676686 3300035724 Bacteria 678
835 Ga0373947_0009320 3300035725 Bacteria 5640
836 Ga0373947_0012283 3300035725 Bacteria 4906
837 Ga0373947_0020184 3300035725 Bacteria 3845
838 Ga0373947_0171729 3300035725 Bacteria 1407
839 Ga0373947_0611576 3300035725 Bacteria 743
840 Ga0373937_0004490 3300036401 Bacteria 11855
841 Ga0373937_0013915 3300036401 Bacteria 7093
842 Ga0373937_0053957 3300036401 Bacteria 3687
843 Ga0373937_0074055 3300036401 Bacteria 3142
844 Ga0373937_0146662 3300036401 Bacteria 2209
845 Ga0373937_0240075 3300036401 Bacteria 1707
846 Ga0373937_0488169 3300036401 Bacteria 1170
847 Ga0373937_0946801 3300036401 Bacteria 810
848 Ga0373925_0011259 3300037068 Bacteria 6488
849 Ga0373925_0017194 3300037068 Bacteria 5238
850 Ga0373925_0080367 3300037068 Bacteria 2478
851 Ga0373925_0518917 3300037068 Bacteria 979
852 Ga0373925_0550777 3300037068 Bacteria 948
853 Ga0373925_0977997 3300037068 Bacteria 697
854 Ga0373925_1643243 3300037068 Bacteria 525
855 Ga0395898_0318698 3300037466 Bacteria 1483
856 Ga0436364_0054321 3300037853 Bacteria 2875
857 Ga0436364_1490302 3300037853 Bacteria 943
858 Ga0395901_0435780 3300038443 Bacteria 1342
859 Ga0436365_0630650 3300039437 Bacteria 763
860 Ga0436365_0653482 3300039437 Bacteria 556
861 Ga0436365_0842200 3300039437 Bacteria 6262
862 Ga0436365_0884037 3300039437 Bacteria 556
863 Ga0436365_0925593 3300039437 Bacteria 680
864 Ga0436365_1179558 3300039437 Bacteria 877
865 Ga0436365_1841819 3300039437 Bacteria 1571
866 Ga0436361_0973070 3300039447 Bacteria 1227
867 Ga0436363_1533352 3300039450 Bacteria 1506
868 Ga0439453_0125858 3300041408 Bacteria 591
869 Ga0451800_1492021 3300041459 Bacteria 1044
870 Ga0451807_0870982 3300041486 Bacteria 626
871 Ga0439437_034738 3300042000 Bacteria 642
872 Ga0439441_025351 3300042001 Bacteria 1119
873 Ga0439450_052964 3300042008 Bacteria 968
874 Ga0439463_182751 3300042016 Bacteria 544
875 Ga0439446_0157950 3300042156 Bacteria 749
876 Ga0439464_0082917 3300042439 Bacteria 959
877 Ga0439460_0192335 3300042461 Bacteria 693
878 Ga0466963_0193222 3300044694 Bacteria 1422
879 Ga0466967_0033052 3300045976 Bacteria 4376
880 Ga0466967_2158738 3300045976 Bacteria 553
881 Ga0495617_047776 3300046452 Bacteria 1424
882 Ga0495627_071409 3300046453 Bacteria 1014
883 Ga0495592_0016847 3300046454 Bacteria 5549
884 Ga0495592_0028202 3300046454 Bacteria 4253
885 Ga0495603_0024080 3300046455 Bacteria 3682
886 Ga0495603_0042104 3300046455 Bacteria 2730
887 Ga0495603_0059379 3300046455 Bacteria 2261
888 Ga0495591_018137 3300046458 Bacteria 2394
889 Ga0495629_0001465 3300046459 Bacteria 18592
890 Ga0495629_0031322 3300046459 Bacteria 3766
891 Ga0495629_0285196 3300046459 Bacteria 1132
892 Ga0495641_0006019 3300046461 Bacteria 7983
893 Ga0495641_0010900 3300046461 Bacteria 5225
894 Ga0495641_0086781 3300046461 Bacteria 1400
895 Ga0495651_0002165 3300046462 Bacteria 15211
896 Ga0495651_0050457 3300046462 Bacteria 3210
897 Ga0495651_0137084 3300046462 Bacteria 1779
898 Ga0495651_0188281 3300046462 Bacteria 1454
899 Ga0495651_0661335 3300046462 Bacteria 654
900 Ga0495653_0018668 3300046463 Bacteria 5630
901 Ga0495653_0327263 3300046463 Bacteria 992
902 Ga0495653_0383617 3300046463 Bacteria 897
903 Ga0495653_0443862 3300046463 Unclassified 817
904 Ga0495653_0517306 3300046463 Bacteria 742
905 Ga0495580_0005009 3300046472 Bacteria 11048
906 Ga0495580_0125642 3300046472 Bacteria 1780
907 Ga0495580_0473017 3300046472 Bacteria 839
908 Ga0495582_0000570 3300046473 Bacteria 20403
909 Ga0495582_0004754 3300046473 Bacteria 7634
910 Ga0495582_0038169 3300046473 Bacteria 2642
911 Ga0495582_0170849 3300046473 Bacteria 1238
912 Ga0495582_0461088 3300046473 Bacteria 734
913 Ga0495582_0498982 3300046473 Bacteria 704
914 Ga0495605_0048845 3300046474 Bacteria 2070
915 Ga0495639_0022702 3300046475 Bacteria 2753
916 Ga0495662_0002431 3300046476 Bacteria 9362
917 Ga0495662_0042738 3300046476 Bacteria 2188
918 Ga0495662_0520017 3300046476 Bacteria 583
919 Ga0495664_0000563 3300046477 Bacteria 18692
920 Ga0495664_0547996 3300046477 Bacteria 689
921 Ga0495664_0605882 3300046477 Bacteria 651
922 Ga0495584_0045363 3300046491 Bacteria 2217
923 Ga0495584_0164348 3300046491 Bacteria 1128
924 Ga0495585_0002912 3300046492 Bacteria 11854
925 Ga0495585_0015407 3300046492 Bacteria 4443
926 Ga0495594_0003570 3300046499 Bacteria 8001
927 Ga0495594_0074658 3300046499 Bacteria 1889
928 Ga0495594_0311049 3300046499 Bacteria 897
929 Ga0495596_0258994 3300046500 Bacteria 675
930 Ga0495607_0010398 3300046501 Bacteria 6258
931 Ga0495583_0083008 3300046506 Bacteria 1390
932 Ga0495608_0015292 3300046511 Bacteria 5324
933 Ga0495608_0058752 3300046511 Bacteria 2535
934 Ga0495608_0264149 3300046511 Bacteria 1071
935 Ga0495608_0845019 3300046511 Bacteria 538
936 Ga0495616_0069100 3300046513 Bacteria 1714
937 Ga0495616_0141795 3300046513 Bacteria 1093
938 Ga0495618_0088636 3300046514 Bacteria 1978
939 Ga0495618_0288003 3300046514 Bacteria 1023
940 Ga0495618_0344270 3300046514 Bacteria 920
941 Ga0495620_0412356 3300046515 Unclassified 511
942 Ga0495628_0011495 3300046516 Bacteria 7483
943 Ga0495628_0197535 3300046516 Bacteria 1517
944 Ga0495630_0017154 3300046517 Bacteria 5301
945 Ga0495630_0138809 3300046517 Bacteria 1847
946 Ga0495630_0305316 3300046517 Bacteria 1216
947 Ga0495631_0102226 3300046518 Bacteria 1233
948 Ga0495631_0213349 3300046518 Bacteria 825
949 Ga0495637_0046164 3300046520 Bacteria 1844
950 Ga0495643_0156009 3300046522 Bacteria 1127
951 Ga0495644_0003284 3300046523 Bacteria 6395
952 Ga0495644_0006910 3300046523 Bacteria 4393
953 Ga0495644_0077657 3300046523 Bacteria 1251
954 Ga0495663_0005215 3300046525 Bacteria 3619
955 Ga0495663_0056811 3300046525 Bacteria 1223
956 Ga0495666_0010760 3300046526 Bacteria 4564
957 Ga0495666_0016580 3300046526 Bacteria 3669
958 Ga0495642_0176577 3300046528 Bacteria 929
959 Ga0495652_0046062 3300046529 Bacteria 3745
960 Ga0495652_0246050 3300046529 Bacteria 1328
961 Ga0495652_0265955 3300046529 Bacteria 1263
962 Ga0495652_0266252 3300046529 Bacteria 1262
963 Ga0495665_0038357 3300046531 Bacteria 2554
964 Ga0495640_0032280 3300046533 Bacteria 3730
965 Ga0495640_0061356 3300046533 Bacteria 2554
966 Ga0495640_0194843 3300046533 Bacteria 1287
967 Ga0495640_0489042 3300046533 Bacteria 749
968 Ga0495586_0029902 3300046535 Bacteria 2916
969 Ga0495587_0142855 3300046536 Bacteria 1365
970 Ga0495587_0493686 3300046536 Bacteria 677
971 Ga0495598_0014447 3300046537 Bacteria 1975
972 Ga0495598_0015165 3300046537 Bacteria 1940
973 Ga0495598_0064546 3300046537 Bacteria 1138
974 Ga0495609_0041279 3300046538 Bacteria 2074
975 Ga0495609_0239370 3300046538 Bacteria 749
976 Ga0495609_0329814 3300046538 Bacteria 618
977 Ga0495621_0049037 3300046539 Bacteria 1506
978 Ga0495621_0151086 3300046539 Bacteria 914
979 Ga0495645_0081407 3300046543 Bacteria 2323
980 Ga0495645_0268481 3300046543 Bacteria 1127
981 Ga0495645_0962271 3300046543 Bacteria 504
982 Ga0495622_0000406 3300046557 Bacteria 28954
983 Ga0495622_0052146 3300046557 Bacteria 1898
984 Ga0495633_0005373 3300046558 Bacteria 7855
985 Ga0495667_0017377 3300046559 Bacteria 4858
986 Ga0495667_0020065 3300046559 Bacteria 4509
987 Ga0495667_0137156 3300046559 Bacteria 1577
988 Ga0495667_0172601 3300046559 Bacteria 1389
989 Ga0495667_1003053 3300046559 Unclassified 509
990 Ga0495656_0000554 3300046615 Bacteria 12229
991 Ga0495656_0108803 3300046615 Bacteria 1293
992 Ga0495656_0408502 3300046615 Bacteria 711
993 Ga0495668_0201057 3300046616 Bacteria 1091
994 Ga0495634_0154428 3300046642 Bacteria 1449
995 Ga0495634_0410072 3300046642 Bacteria 804
996 Ga0495634_0410270 3300046642 Bacteria 803
997 Ga0495634_0832807 3300046642 Unclassified 525
998 Ga0495611_0197505 3300046648 Bacteria 939
999 Ga0495635_0016723 3300046663 Bacteria 5125
1000 Ga0495635_0024301 3300046663 Bacteria 4224
1001 Ga0495635_0304205 3300046663 Bacteria 1069
1002 Ga0495635_0621395 3300046663 Unclassified 704
1003 Ga0495635_0752914 3300046663 Bacteria 630
1004 Ga0495635_1011378 3300046663 Unclassified 529
1005 Ga0495659_0005523 3300046664 Bacteria 3978
1006 Ga0495659_0093023 3300046664 Bacteria 1160
1007 Ga0495661_0076068 3300046665 Bacteria 1949
1008 Ga0495661_0122326 3300046665 Bacteria 1436
1009 Ga0495661_0170850 3300046665 Bacteria 1160
1010 Ga0495588_0029913 3300046674 Bacteria 2734
1011 Ga0495588_0088794 3300046674 Bacteria 1618
1012 Ga0495657_0008729 3300046675 Bacteria 7737
1013 Ga0495657_0196933 3300046675 Bacteria 1229
1014 Ga0495657_0589601 3300046675 Bacteria 644
1015 Ga0495599_0020724 3300046678 Bacteria 4097
1016 Ga0495623_0688389 3300046679 Bacteria 524
1017 Ga0495646_0042474 3300046680 Bacteria 2789
1018 Ga0495646_0144375 3300046680 Bacteria 1328
1019 Ga0495646_0307843 3300046680 Bacteria 837
1020 Ga0495647_0001486 3300046681 Bacteria 7275
1021 Ga0495647_0031744 3300046681 Bacteria 1965
1022 Ga0495647_0097708 3300046681 Unclassified 1212
1023 Ga0495658_0000543 3300046683 Bacteria 20578
1024 Ga0495658_0002466 3300046683 Bacteria 9317
1025 Ga0495658_0028883 3300046683 Bacteria 2997
1026 Ga0495658_0053388 3300046683 Bacteria 2295
1027 Ga0495658_0239013 3300046683 Bacteria 1140
1028 Ga0495658_1118969 3300046683 Bacteria 502
1029 Ga0495669_0020229 3300046684 Bacteria 2879
1030 Ga0495669_0085587 3300046684 Bacteria 1451
1031 Ga0495613_0034941 3300046689 Bacteria 3732
1032 Ga0495613_0153601 3300046689 Bacteria 1640
1033 Ga0495624_0018605 3300046690 Bacteria 4645
1034 Ga0495624_0027306 3300046690 Bacteria 3737
1035 Ga0495670_0008274 3300046691 Bacteria 5114
1036 Ga0495670_0030996 3300046691 Bacteria 2656
1037 Ga0495670_0793193 3300046691 Bacteria 517
1038 Ga0495671_0123171 3300046692 Bacteria 1264
1039 Ga0495649_0040457 3300046694 Bacteria 2553
1040 Ga0495589_0186331 3300046794 Bacteria 983
1041 Ga0495589_0237976 3300046794 Bacteria 852
1042 Ga0495600_0006388 3300046809 Bacteria 7175
1043 Ga0495600_0156242 3300046809 Bacteria 1475
1044 Ga0495581_0003432 3300047315 Bacteria 9101
1045 Ga0495581_0010955 3300047315 Bacteria 5240
1046 Ga0495581_0019117 3300047315 Bacteria 3977
1047 Ga0495581_0626326 3300047315 Bacteria 622
1048 Ga0495604_0013474 3300047317 Bacteria 6513
1049 Ga0495604_0064795 3300047317 Bacteria 2783
1050 Ga0495604_0261884 3300047317 Bacteria 1175
1051 Ga0495604_0572959 3300047317 Bacteria 726
1052 Ga0495636_0176187 3300047318 Bacteria 969
1053 Ga0495674_0026343 3300047319 Bacteria 5320
1054 Ga0495674_0177497 3300047319 Bacteria 1774
1055 Ga0495674_0326614 3300047319 Bacteria 1249
1056 Ga0495674_0626821 3300047319 Bacteria 850
1057 Ga0495674_1253152 3300047319 Unclassified 558
1058 Ga0495672_0101953 3300047320 Bacteria 1555
1059 Ga0495672_0106572 3300047320 Bacteria 1511
1060 Ga0495672_0179645 3300047320 Bacteria 1073
1061 Ga0495676_0013899 3300047321 Bacteria 7217
1062 Ga0495676_0035160 3300047321 Bacteria 4193
1063 Ga0495676_0125529 3300047321 Bacteria 1860
1064 Ga0495676_0233848 3300047321 Bacteria 1261
1065 Ga0495680_0006933 3300047322 Bacteria 10457
1066 Ga0495680_0012328 3300047322 Bacteria 7529
1067 Ga0495680_0061381 3300047322 Bacteria 2892
1068 Ga0495680_0330036 3300047322 Bacteria 1066
1069 Ga0495683_0249865 3300047323 Bacteria 779
1070 Ga0495683_0286823 3300047323 Bacteria 711
1071 Ga0495675_0020224 3300047444 Bacteria 4232
1072 Ga0495675_0253145 3300047444 Bacteria 1057
1073 Ga0495679_027076 3300047446 Bacteria 1896
1074 Ga0495684_0055089 3300047471 Bacteria 3032
1075 Ga0495684_0058031 3300047471 Bacteria 2949
1076 Ga0495684_0193134 3300047471 Unclassified 1504
1077 Ga0495684_0886100 3300047471 Bacteria 576
1078 Ga0495593_0003620 3300047673 Bacteria 9229
1079 Ga0495593_0333250 3300047673 Bacteria 758
1080 Ga0495602_0070224 3300048088 Bacteria 2999
1081 Ga0495602_0412012 3300048088 Bacteria 961
1082 Ga0495602_0462834 3300048088 Bacteria 893
1083 Ga0495614_0019302 3300048089 Bacteria 2950
1084 Ga0496100_0003363 3300048903 Bacteria 8326
1085 Ga0496100_0015421 3300048903 Bacteria 4462
1086 Ga0496100_0016403 3300048903 Bacteria 4350
1087 Ga0496100_0031260 3300048903 Bacteria 3308
1088 Ga0496100_0116497 3300048903 Bacteria 1864
1089 Ga0496100_0194514 3300048903 Bacteria 1474
1090 Ga0496100_0389634 3300048903 Bacteria 1059
1091 Ga0496101_0001983 3300048904 Bacteria 12419
1092 Ga0496101_0002395 3300048904 Bacteria 11503
1093 Ga0496101_0029082 3300048904 Bacteria 3863
1094 Ga0496101_0127119 3300048904 Bacteria 1932
1095 Ga0496101_0182014 3300048904 Bacteria 1618
1096 Ga0496101_0242662 3300048904 Bacteria 1402
1097 Ga0496101_0388549 3300048904 Bacteria 1098
1098 Ga0496101_0431248 3300048904 Unclassified 1039
1099 Ga0496101_1179423 3300048904 Bacteria 600
1100 Ga0496102_0002614 3300048905 Bacteria 15316
1101 Ga0496102_0002793 3300048905 Bacteria 14888
1102 Ga0496102_0016941 3300048905 Bacteria 6377
1103 Ga0496102_0028300 3300048905 Bacteria 5005
1104 Ga0496102_0031173 3300048905 Bacteria 4780
1105 Ga0496102_0220102 3300048905 Bacteria 1789
1106 Ga0496102_0222643 3300048905 Bacteria 1779
1107 Ga0496102_1061322 3300048905 Bacteria 730
1108 Ga0496103_0002369 3300048906 Bacteria 11883
1109 Ga0496103_0020821 3300048906 Bacteria 3943
1110 Ga0496103_0021619 3300048906 Bacteria 3871
1111 Ga0496103_0058182 3300048906 Bacteria 2401
1112 Ga0496103_0183089 3300048906 Bacteria 1346
1113 Ga0496103_0207186 3300048906 Bacteria 1261
1114 Ga0496103_0716510 3300048906 Bacteria 634
1115 Ga0496104_0003070 3300048907 Bacteria 14395
1116 Ga0496104_0004660 3300048907 Bacteria 11929
1117 Ga0496104_0017458 3300048907 Bacteria 6534
1118 Ga0496104_0042670 3300048907 Bacteria 4257
1119 Ga0496104_0053307 3300048907 Bacteria 3820
1120 Ga0496104_0073885 3300048907 Bacteria 3244
1121 Ga0496104_0137363 3300048907 Bacteria 2348
1122 Ga0496104_0146743 3300048907 Bacteria 2265
1123 Ga0496105_0003019 3300048908 Bacteria 12365
1124 Ga0496105_0007082 3300048908 Bacteria 8644
1125 Ga0496105_0016356 3300048908 Bacteria 5921
1126 Ga0496105_0034082 3300048908 Bacteria 4186
1127 Ga0496105_0173296 3300048908 Bacteria 1768
1128 Ga0496105_0384483 3300048908 Bacteria 1116
1129 Ga0496105_0715503 3300048908 Bacteria 767
1130 Ga0496105_0784515 3300048908 Unclassified 725
1131 Ga0496105_1042679 3300048908 Unclassified 610
1132 Ga0496106_0001912 3300048909 Bacteria 15607
1133 Ga0496106_0007123 3300048909 Bacteria 8258
1134 Ga0496106_0010646 3300048909 Bacteria 6795
1135 Ga0496106_0033866 3300048909 Bacteria 3813
1136 Ga0496106_0049304 3300048909 Bacteria 3172
1137 Ga0496106_0102418 3300048909 Bacteria 2221
1138 Ga0496106_0210567 3300048909 Bacteria 1548
1139 Ga0496106_0359577 3300048909 Bacteria 1169
1140 Ga0496106_1222185 3300048909 Unclassified 585
1141 Ga0496107_0000684 3300048910 Bacteria 19232
1142 Ga0496107_0005855 3300048910 Bacteria 8416
1143 Ga0496107_0006823 3300048910 Bacteria 7864
1144 Ga0496107_0019014 3300048910 Bacteria 4844
1145 Ga0496107_0039820 3300048910 Bacteria 3372
1146 Ga0496107_0051559 3300048910 Bacteria 2968
1147 Ga0496107_0365581 3300048910 Bacteria 1073
1148 Ga0496107_0820707 3300048910 Bacteria 680
1149 Ga0496107_1039177 3300048910 Bacteria 593
1150 Ga0496108_0000951 3300048911 Bacteria 22499
1151 Ga0496108_0016761 3300048911 Bacteria 5985
1152 Ga0496108_0017326 3300048911 Bacteria 5892
1153 Ga0496108_0029894 3300048911 Bacteria 4515
1154 Ga0496108_0052548 3300048911 Bacteria 3415
1155 Ga0496108_0426480 3300048911 Unclassified 1158
1156 Ga0496108_0448572 3300048911 Bacteria 1127
1157 Ga0496108_0481997 3300048911 Bacteria 1083
1158 Ga0496108_0725892 3300048911 Bacteria 860
1159 Ga0496108_0850189 3300048911 Bacteria 785
1160 Ga0496108_1623085 3300048911 Bacteria 534
1161 Ga0496109_0004879 3300048912 Bacteria 11202
1162 Ga0496109_0010573 3300048912 Bacteria 7892
1163 Ga0496109_0017589 3300048912 Bacteria 6269
1164 Ga0496109_0021372 3300048912 Bacteria 5721
1165 Ga0496109_0037905 3300048912 Bacteria 4356
1166 Ga0496109_0277762 3300048912 Bacteria 1578
1167 Ga0496109_0469346 3300048912 Bacteria 1188
1168 Ga0496109_0547916 3300048912 Bacteria 1091
1169 Ga0496109_0572689 3300048912 Bacteria 1064
1170 Ga0496109_1081041 3300048912 Unclassified 739
1171 Ga0496110_0010330 3300048913 Bacteria 7588
1172 Ga0496110_0025021 3300048913 Bacteria 5096
1173 Ga0496110_0033011 3300048913 Bacteria 4475
1174 Ga0496110_0148396 3300048913 Bacteria 2122
1175 Ga0496110_0195249 3300048913 Bacteria 1838
1176 Ga0496110_0235839 3300048913 Bacteria 1664
1177 Ga0496110_0413577 3300048913 Bacteria 1229
1178 Ga0496110_0766572 3300048913 Bacteria 868
1179 Ga0496111_0002467 3300048914 Bacteria 11163
1180 Ga0496111_0015671 3300048914 Bacteria 5209
1181 Ga0496111_0028559 3300048914 Bacteria 3953
1182 Ga0496111_0033708 3300048914 Bacteria 3653
1183 Ga0496111_0040561 3300048914 Bacteria 3339
1184 Ga0496111_0341480 3300048914 Bacteria 1108
1185 Ga0496112_0007378 3300048915 Bacteria 9759
1186 Ga0496112_0023680 3300048915 Bacteria 5872
1187 Ga0496112_0057371 3300048915 Bacteria 3833
1188 Ga0496112_0060168 3300048915 Bacteria 3742
1189 Ga0496112_0063132 3300048915 Bacteria 3653
1190 Ga0496112_0189422 3300048915 Bacteria 2019
1191 Ga0496112_0612371 3300048915 Bacteria 1020
1192 Ga0496112_0615256 3300048915 Bacteria 1017
1193 Ga0496112_0643787 3300048915 Unclassified 990
1194 Ga0496113_0000043 3300048916 Bacteria 52544
1195 Ga0496113_0004559 3300048916 Bacteria 8532
1196 Ga0496113_0019261 3300048916 Bacteria 4771
1197 Ga0496113_0022484 3300048916 Bacteria 4461
1198 Ga0496113_0023083 3300048916 Bacteria 4408
1199 Ga0496113_0070377 3300048916 Bacteria 2659
1200 Ga0496113_0105396 3300048916 Bacteria 2189
1201 Ga0496114_0007468 3300048917 Bacteria 8642
1202 Ga0496114_0036470 3300048917 Bacteria 4065
1203 Ga0496114_0045150 3300048917 Bacteria 3659
1204 Ga0496114_0080971 3300048917 Bacteria 2742
1205 Ga0496114_0221242 3300048917 Bacteria 1662
1206 Ga0496114_0375589 3300048917 Bacteria 1258
1207 Ga0496115_0002647 3300048918 Bacteria 12855
1208 Ga0496115_0003701 3300048918 Bacteria 11002
1209 Ga0496115_0008385 3300048918 Bacteria 7647
1210 Ga0496115_0030611 3300048918 Bacteria 4235
1211 Ga0496115_0090923 3300048918 Bacteria 2494
1212 Ga0496115_0097906 3300048918 Bacteria 2402
1213 Ga0496115_0132287 3300048918 Bacteria 2056
1214 Ga0496115_0307845 3300048918 Bacteria 1297
1215 Ga0496115_0798912 3300048918 Bacteria 734
1216 Ga0496119_0320507 3300048922 Bacteria 759
1217 Ga0496121_0280117 3300048924 Bacteria 1141
1218 Ga0501031_0104617 3300049568 Bacteria 1847
1219 Ga0501031_0248268 3300049568 Bacteria 1157
1220 Ga0501031_0466125 3300049568 Bacteria 816
1221 Ga0501032_0078980 3300049569 Bacteria 2191
1222 Ga0501032_0285164 3300049569 Bacteria 1069
1223 Ga0501032_0310148 3300049569 Bacteria 1019
1224 Ga0501033_0037850 3300049570 Bacteria 3609
1225 Ga0501033_0061139 3300049570 Bacteria 2777
1226 Ga0501033_0305697 3300049570 Bacteria 1119
1227 Ga0501033_0815407 3300049570 Bacteria 630
1228 Ga0501033_0864931 3300049570 Bacteria 609
1229 Ga0501034_0011170 3300049571 Bacteria 9321
1230 Ga0501034_0114840 3300049571 Bacteria 2681
1231 Ga0501034_0126832 3300049571 Bacteria 2537
1232 Ga0501034_0166390 3300049571 Bacteria 2173
1233 Ga0501034_0265926 3300049571 Bacteria 1657
1234 Ga0501034_0406002 3300049571 Bacteria 1285
1235 Ga0501034_0441180 3300049571 Bacteria 1220
1236 Ga0501034_0488249 3300049571 Bacteria 1146
1237 Ga0501036_0247682 3300049572 Bacteria 1494
1238 Ga0501036_1129081 3300049572 Bacteria 640
1239 Ga0501036_1546404 3300049572 Bacteria 536
1240 Ga0501036_1582149 3300049572 Bacteria 529
1241 Ga0501036_1737362 3300049572 Bacteria 502
1242 Ga0501036_1741801 3300049572 Bacteria 502
1243 Ga0501037_0083329 3300049573 Bacteria 2316
1244 Ga0501037_0117592 3300049573 Bacteria 1913
1245 Ga0501037_0701989 3300049573 Bacteria 673
1246 Ga0501038_0037153 3300049574 Bacteria 4272
1247 Ga0501038_0106265 3300049574 Bacteria 2330
1248 Ga0501038_0196973 3300049574 Bacteria 1619
1249 Ga0501038_0671420 3300049574 Bacteria 778
1250 Ga0501038_1077093 3300049574 Bacteria 588
1251 Ga0501039_0119194 3300049575 Bacteria 2067
1252 Ga0501039_0665796 3300049575 Bacteria 815
1253 Ga0501041_0970653 3300049577 Bacteria 546
1254 Ga0501043_0354867 3300049579 Bacteria 1113
1255 Ga0501043_1172341 3300049579 Bacteria 540
1256 Ga0501046_0614014 3300049580 Bacteria 771
1257 Ga0501046_0858666 3300049580 Bacteria 634
1258 Ga0501047_0011566 3300049581 Bacteria 8352
1259 Ga0501047_0096320 3300049581 Bacteria 2838
1260 Ga0501047_0264236 3300049581 Bacteria 1568
1261 Ga0501047_0315037 3300049581 Bacteria 1405
1262 Ga0501047_0326096 3300049581 Bacteria 1374
1263 Ga0501047_0338253 3300049581 Bacteria 1343
1264 Ga0501047_0872598 3300049581 Bacteria 713
1265 Ga0501047_1090625 3300049581 Bacteria 612
1266 Ga0501048_0395343 3300049582 Bacteria 988
1267 Ga0501048_0495679 3300049582 Bacteria 876
1268 Ga0501067_0316199 3300049583 Bacteria 870
1269 Ga0501068_0530139 3300049584 Bacteria 765
1270 Ga0501068_1094629 3300049584 Bacteria 527
1271 Ga0501069_0334441 3300049585 Bacteria 891
1272 Ga0501070_0024998 3300049586 Bacteria 5009
1273 Ga0501070_0199114 3300049586 Bacteria 1645
1274 Ga0501070_0341850 3300049586 Bacteria 1216
1275 Ga0501070_1119183 3300049586 Bacteria 607
1276 Ga0501071_0022307 3300049587 Bacteria 4414
1277 Ga0501071_0397018 3300049587 Bacteria 1053
1278 Ga0501071_0923688 3300049587 Bacteria 673
1279 Ga0501072_0248999 3300049588 Bacteria 1415
1280 Ga0501072_0294764 3300049588 Bacteria 1289
1281 Ga0501072_0525835 3300049588 Bacteria 935
1282 Ga0501072_1106201 3300049588 Bacteria 616
1283 Ga0501073_0161294 3300049589 Bacteria 1553
1284 Ga0501073_0164878 3300049589 Bacteria 1534
1285 Ga0501073_0682250 3300049589 Bacteria 709
1286 Ga0501073_0851019 3300049589 Bacteria 628
1287 Ga0501074_0058920 3300049590 Bacteria 2767
1288 Ga0501074_0174760 3300049590 Bacteria 1533
1289 Ga0501074_0826878 3300049590 Bacteria 652
1290 Ga0501075_0197119 3300049591 Bacteria 1536
1291 Ga0501075_0776258 3300049591 Bacteria 729
1292 Ga0501076_0004238 3300049592 Bacteria 10148
1293 Ga0501076_0613872 3300049592 Bacteria 897
1294 Ga0501076_0622134 3300049592 Bacteria 891
1295 Ga0501077_0090161 3300049593 Bacteria 1943
1296 Ga0501077_0250185 3300049593 Bacteria 1127
1297 Ga0501077_1113334 3300049593 Unclassified 508
1298 Ga0501079_0189607 3300049741 Bacteria 1604
1299 Ga0501080_0155676 3300049742 Bacteria 2111
1300 Ga0501080_0181125 3300049742 Bacteria 1939
1301 Ga0501080_0218938 3300049742 Bacteria 1743
1302 Ga0501080_0298760 3300049742 Bacteria 1461
1303 Ga0501081_0116221 3300049743 Bacteria 1902
1304 Ga0501081_0462783 3300049743 Bacteria 943
1305 Ga0501083_0014091 3300049744 Bacteria 5590
1306 Ga0501083_0102673 3300049744 Bacteria 1885
1307 Ga0501083_0396630 3300049744 Bacteria 898
1308 Ga0501083_0571174 3300049744 Bacteria 736
1309 Ga0501035_0025517 3300049822 Bacteria 5417
1310 Ga0501035_0250857 3300049822 Bacteria 1503
1311 Ga0501035_0459518 3300049822 Bacteria 1052
1312 Ga0501044_0036606 3300049823 Bacteria 5134
1313 Ga0501044_0119053 3300049823 Bacteria 2643
1314 Ga0501044_0215110 3300049823 Bacteria 1875
1315 Ga0501044_0248327 3300049823 Bacteria 1721
1316 Ga0501044_0762780 3300049823 Bacteria 849
1317 Ga0501044_1364163 3300049823 Bacteria 575
1318 Ga0501044_1532839 3300049823 Bacteria 531
1319 Ga0501045_0445821 3300049824 Bacteria 962
1320 Ga0501045_0720253 3300049824 Bacteria 736
1321 nmdc:mga03683_259195_c1 3300050489 Bacteria 809
1322 nmdc:mga03683_357801_c1 3300050489 Bacteria 692
1323 nmdc:mga03n38_188377_c1 3300050490 Bacteria 1061
1324 nmdc:mga03n38_518282_c1 3300050490 Bacteria 671
1325 nmdc:mga0yw44_10242_c2 3300050492 Bacteria 4376
1326 nmdc:mga0yw44_1082862_c1 3300050492 Unclassified 542
1327 nmdc:mga0yw44_303410_c1 3300050492 Bacteria 1070
1328 nmdc:mga0yw44_56590_c1 3300050492 Bacteria 2390
1329 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
1330 nmdc:mga0k408_184574_c1 3300050493 Bacteria 1244
1331 nmdc:mga06z11_1002996_c1 3300050494 Bacteria 509
1332 nmdc:mga06z11_181820_c1 3300050494 Bacteria 1213
1333 nmdc:mga06z11_51514_c1 3300050494 Bacteria 2108
1334 nmdc:mga06z11_923611_c1 3300050494 Bacteria 532
1335 nmdc:mga04h51_27546_c1 3300050495 Bacteria 1766
1336 nmdc:mga04h51_481589_c1 3300050495 Unclassified 528
1337 nmdc:mga07m45_139450_c1 3300050496 Bacteria 1404
1338 nmdc:mga07m45_61289_c1 3300050496 Bacteria 1134
1339 nmdc:mga05p37_23570_c1 3300050507 Bacteria 7469
1340 nmdc:mga05p37_300683_c1 3300050507 Bacteria 1907
1341 nmdc:mga05p37_604329_c1 3300050507 Bacteria 1237
1342 nmdc:mga09592_1341318_c1 3300050508 Bacteria 587
1343 nmdc:mga09592_224426_c1 3300050508 Bacteria 1628
1344 nmdc:mga09592_425938_c1 3300050508 Bacteria 1146
1345 nmdc:mga09592_70139_c1 3300050508 Bacteria 2973
1346 nmdc:mga0qj67_229704_c1 3300050509 Bacteria 1506
1347 nmdc:mga0qj67_50_c1 3300050509 Bacteria 50243
1348 nmdc:mga0qj67_595131_c1 3300050509 Bacteria 885
1349 nmdc:mga0qj67_667110_c1 3300050509 Bacteria 829
1350 nmdc:mga06r32_118088_c1 3300050510 Bacteria 2614
1351 nmdc:mga06r32_135238_c1 3300050510 Bacteria 2440
1352 nmdc:mga06r32_391370_c1 3300050510 Bacteria 1372
1353 nmdc:mga06r32_79786_c1 3300050510 Bacteria 3184
1354 nmdc:mga08y16_100861_c1 3300050511 Bacteria 3005
1355 nmdc:mga08y16_274487_c1 3300050511 Bacteria 1740
1356 nmdc:mga08y16_310668_c1 3300050511 Bacteria 1624
1357 nmdc:mga08y16_356875_c1 3300050511 Bacteria 1501
1358 nmdc:mga08y16_71155_c1 3300050511 Bacteria 3625
1359 nmdc:mga0n895_117132_c1 3300050512 Bacteria 2683
1360 nmdc:mga0n895_1184061_c1 3300050512 Bacteria 739
1361 nmdc:mga0n895_246323_c1 3300050512 Bacteria 1814
1362 nmdc:mga0n895_50546_c1 3300050512 Bacteria 4076
1363 nmdc:mga0n895_692285_c1 3300050512 Bacteria 1016
1364 nmdc:mga0n895_70607_c1 3300050512 Bacteria 3461
1365 nmdc:mga0n895_840329_c1 3300050512 Bacteria 907
1366 nmdc:mga0rr50_158771_c1 3300050513 Bacteria 1834
1367 nmdc:mga0rr50_247128_c1 3300050513 Bacteria 1480
1368 nmdc:mga0rr50_53320_c1 3300050513 Bacteria 3008
1369 nmdc:mga08x19_1193104_c1 3300050514 Bacteria 540
1370 nmdc:mga08x19_500277_c1 3300050514 Bacteria 858
1371 nmdc:mga08x19_56031_c1 3300050514 Bacteria 2543
1372 nmdc:mga0a205_11361_c1 3300050515 Bacteria 8196
1373 nmdc:mga0a205_1151012_c1 3300050515 Unclassified 623
1374 nmdc:mga0a205_1240444_c1 3300050515 Bacteria 593
1375 nmdc:mga0a205_348188_c1 3300050515 Bacteria 1349
1376 Ga0495601_0001376 3300053077 Bacteria 13385
1377 Ga0495601_0001735 3300053077 Bacteria 12053
1378 Ga0495601_0062873 3300053077 Bacteria 2358
1379 Ga0495601_0082471 3300053077 Bacteria 2064
1380 Ga0495601_0439416 3300053077 Bacteria 844
1381 Ga0495612_0000562 3300053078 Bacteria 14913
1382 Ga0495612_0057057 3300053078 Bacteria 1612
1383 Ga0495612_0089880 3300053078 Bacteria 1299
1384 Ga0495612_0453878 3300053078 Bacteria 586
1385 Ga0495655_0007915 3300053083 Bacteria 1998
1386 Ga0495655_0022803 3300053083 Bacteria 1435
1387 Ga0495595_0003174 3300053084 Bacteria 6518
1388 Ga0495595_0007422 3300053084 Bacteria 4489
1389 Ga0495595_0018837 3300053084 Bacteria 2987
1390 Ga0495595_0281332 3300053084 Bacteria 835
1391 Ga0495595_0447850 3300053084 Bacteria 656
1392 Ga0495619_0000045 3300053085 Bacteria 108543
1393 Ga0495619_0000484 3300053085 Bacteria 26647
1394 Ga0495619_0016005 3300053085 Bacteria 4746
1395 Ga0495619_0016140 3300053085 Bacteria 4727
1396 Ga0495619_0112163 3300053085 Bacteria 1864
1397 Ga0495619_0286387 3300053085 Bacteria 1141
1398 Ga0500566_0142694 3300053094 Bacteria 1269
1399 Ga0500641_0002785 3300053096 Bacteria 6188
1400 Ga0500593_018605 3300053117 Bacteria 3032
1401 Ga0500657_225075 3300053728 Bacteria 590
1402 Ga0500645_063080 3300053730 Bacteria 1070
1403 Ga0501084_0422455 3300054114 Bacteria 1127
1404 Ga0501084_0448276 3300054114 Bacteria 1091
1405 Ga0501084_0624656 3300054114 Bacteria 910
1406 Ga0501084_0707419 3300054114 Bacteria 850
1407 Ga0501084_1301103 3300054114 Bacteria 609
1408 Ga0501082_0018385 3300060353 Bacteria 6020
1409 Ga0501082_0159213 3300060353 Bacteria 1962
1410 Ga0501082_0784497 3300060353 Bacteria 834
1411 Ga0501082_1666857 3300060353 Unclassified 556
1412 Ga0530510_0294726 3300061734 Bacteria 1213
1413 Ga0530510_0552549 3300061734 Bacteria 874
1414 Ga0530510_0870287 3300061734 Unclassified 688
1415 Ga0530510_0891222 3300061734 Bacteria 680

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_11011474 Ga0207654_110114741 71
2 3300049571 Ga0501034_0406002 Ga0501034_0406002_255_518 72
3 3300049823 Ga0501044_0215110 Ga0501044_0215110_1417_1680 72
4 3300005327 Ga0070658_10130781 Ga0070658_101307812 78
5 3300005336 Ga0070680_100824459 Ga0070680_1008244592 78
6 3300005458 Ga0070681_11993746 Ga0070681_119937461 78
7 3300005530 Ga0070679_100023364 Ga0070679_1000233647 78
8 3300025909 Ga0207705_10517875 Ga0207705_105178752 78
9 3300025912 Ga0207707_10425930 Ga0207707_104259302 78
10 3300025917 Ga0207660_10073080 Ga0207660_100730803 78
11 3300025921 Ga0207652_10169574 Ga0207652_101695742 78
12 3300005937 Ga0081455_10415523 Ga0081455_104155232 83
13 3300005983 Ga0081540_1010849 Ga0081540_10108496 83
14 iso_pu_bacteria 2643221651 2644289457 83
15 3300000041 ARcpr5oldR_c011245 ARcpr5oldR_0112451 87
16 3300000043 ARcpr5yngRDRAFT_c016622 ARcpr5yngRDRAFT_0166221 87
17 3300000652 ARCol0yngRDRAFT_1007988 ARCol0yngRDRAFT_10079882 87
18 3300001430 JGI24032J14994_100616 JGI24032J14994_1006164 87
19 3300001904 JGI24736J21556_1039826 JGI24736J21556_10398262 87
20 3300001915 JGI24741J21665_1022668 JGI24741J21665_10226681 87
21 3300001976 JGI24752J21851_1032527 JGI24752J21851_10325272 87
22 3300001976 JGI24752J21851_1048551 JGI24752J21851_10485512 87
23 3300001977 JGI24746J21847_1000660 JGI24746J21847_10006604 87
24 3300001978 JGI24747J21853_1000065 JGI24747J21853_10000655 87
25 3300001989 JGI24739J22299_10005070 JGI24739J22299_100050703 87
26 3300001990 JGI24737J22298_10001725 JGI24737J22298_100017255 87
27 3300001991 JGI24743J22301_10042470 JGI24743J22301_100424701 87
28 3300001991 JGI24743J22301_10071357 JGI24743J22301_100713573 87
29 3300002067 JGI24735J21928_10122357 JGI24735J21928_101223572 87
30 3300002070 JGI24750J21931_1000201 JGI24750J21931_10002017 87
31 3300002073 JGI24745J21846_1000444 JGI24745J21846_10004445 87
32 3300002073 JGI24745J21846_1011211 JGI24745J21846_10112112 87
33 3300002075 JGI24738J21930_10008541 JGI24738J21930_100085413 87
34 3300002075 JGI24738J21930_10014356 JGI24738J21930_100143561 87
35 3300002076 JGI24749J21850_1002447 JGI24749J21850_10024474 87
36 3300002077 JGI24744J21845_10036039 JGI24744J21845_100360391 87
37 3300002126 JGI24035J26624_1000749 JGI24035J26624_10007494 87
38 3300002155 JGI24033J26618_1001273 JGI24033J26618_10012731 87
39 3300002239 JGI24034J26672_10001663 JGI24034J26672_100016635 87
40 3300002244 JGI24742J22300_10000548 JGI24742J22300_100005483 87
41 3300002244 JGI24742J22300_10079592 JGI24742J22300_100795922 87
42 3300002459 JGI24751J29686_10030467 JGI24751J29686_100304672 87
43 3300003349 JGI26129J50193_1019387 JGI26129J50193_10193871 87
44 3300003659 JGI25404J52841_10001785 JGI25404J52841_100017854 87
45 3300003659 JGI25404J52841_10072301 JGI25404J52841_100723012 87
46 3300003911 JGI25405J52794_10002720 JGI25405J52794_100027202 87
47 3300003911 JGI25405J52794_10106706 JGI25405J52794_101067062 87
48 3300005290 Ga0065712_10020878 Ga0065712_100208783 87
49 3300005293 Ga0065715_10096595 Ga0065715_100965952 87
50 3300005293 Ga0065715_10280231 Ga0065715_102802311 87
51 3300005295 Ga0065707_10114838 Ga0065707_101148382 87
52 3300005327 Ga0070658_10450839 Ga0070658_104508392 87
53 3300005327 Ga0070658_11010666 Ga0070658_110106662 87
54 3300005328 Ga0070676_10004291 Ga0070676_100042915 87
55 3300005328 Ga0070676_10081138 Ga0070676_100811383 87
56 3300005328 Ga0070676_10874899 Ga0070676_108748991 87
57 3300005329 Ga0070683_100004677 Ga0070683_1000046777 87
58 3300005329 Ga0070683_100148684 Ga0070683_1001486843 87
59 3300005329 Ga0070683_100189798 Ga0070683_1001897983 87
60 3300005330 Ga0070690_100008757 Ga0070690_1000087575 87
61 3300005330 Ga0070690_100012125 Ga0070690_1000121252 87
62 3300005330 Ga0070690_100092303 Ga0070690_1000923033 87
63 3300005330 Ga0070690_100270903 Ga0070690_1002709032 87
64 3300005331 Ga0070670_100004378 Ga0070670_1000043785 87
65 3300005331 Ga0070670_100006765 Ga0070670_1000067657 87
66 3300005331 Ga0070670_100016298 Ga0070670_1000162985 87
67 3300005331 Ga0070670_100198783 Ga0070670_1001987832 87
68 3300005333 Ga0070677_10011104 Ga0070677_100111043 87
69 3300005333 Ga0070677_10061625 Ga0070677_100616252 87
70 3300005334 Ga0068869_100000546 Ga0068869_10000054612 87
71 3300005334 Ga0068869_100377194 Ga0068869_1003771942 87
72 3300005335 Ga0070666_10016324 Ga0070666_100163243 87
73 3300005335 Ga0070666_10048506 Ga0070666_100485062 87
74 3300005335 Ga0070666_10127353 Ga0070666_101273532 87
75 3300005336 Ga0070680_100391835 Ga0070680_1003918352 87
76 3300005337 Ga0070682_100003445 Ga0070682_1000034456 87
77 3300005337 Ga0070682_100085382 Ga0070682_1000853822 87
78 3300005337 Ga0070682_100316557 Ga0070682_1003165572 87
79 3300005338 Ga0068868_100012769 Ga0068868_1000127696 87
80 3300005338 Ga0068868_100196629 Ga0068868_1001966292 87
81 3300005338 Ga0068868_100554164 Ga0068868_1005541641 87
82 3300005339 Ga0070660_100006773 Ga0070660_1000067738 87
83 3300005339 Ga0070660_100217996 Ga0070660_1002179962 87
84 3300005339 Ga0070660_100254080 Ga0070660_1002540802 87
85 3300005340 Ga0070689_100002392 Ga0070689_1000023927 87
86 3300005340 Ga0070689_100023289 Ga0070689_1000232891 87
87 3300005340 Ga0070689_100220758 Ga0070689_1002207583 87
88 3300005340 Ga0070689_100323917 Ga0070689_1003239172 87
89 3300005341 Ga0070691_10003723 Ga0070691_100037237 87
90 3300005341 Ga0070691_10088425 Ga0070691_100884251 87
91 3300005343 Ga0070687_100001017 Ga0070687_1000010176 87
92 3300005343 Ga0070687_100038673 Ga0070687_1000386732 87
93 3300005343 Ga0070687_100515088 Ga0070687_1005150882 87
94 3300005344 Ga0070661_100001763 Ga0070661_10000176315 87
95 3300005344 Ga0070661_100068356 Ga0070661_1000683564 87
96 3300005344 Ga0070661_100260178 Ga0070661_1002601782 87
97 3300005344 Ga0070661_100406702 Ga0070661_1004067022 87
98 3300005345 Ga0070692_10004423 Ga0070692_100044236 87
99 3300005345 Ga0070692_10378364 Ga0070692_103783642 87
100 3300005347 Ga0070668_100098541 Ga0070668_1000985414 87
101 3300005347 Ga0070668_100137935 Ga0070668_1001379352 87
102 3300005347 Ga0070668_100143313 Ga0070668_1001433133 87
103 3300005347 Ga0070668_100638854 Ga0070668_1006388542 87
104 3300005353 Ga0070669_100009976 Ga0070669_1000099765 87
105 3300005353 Ga0070669_100018281 Ga0070669_1000182813 87
106 3300005353 Ga0070669_100568314 Ga0070669_1005683142 87
107 3300005354 Ga0070675_100029783 Ga0070675_1000297832 87
108 3300005354 Ga0070675_100110539 Ga0070675_1001105391 87
109 3300005354 Ga0070675_100335676 Ga0070675_1003356762 87
110 3300005355 Ga0070671_100007031 Ga0070671_1000070317 87
111 3300005355 Ga0070671_100033007 Ga0070671_1000330072 87
112 3300005355 Ga0070671_100128745 Ga0070671_1001287452 87
113 3300005355 Ga0070671_100739128 Ga0070671_1007391282 87
114 3300005355 Ga0070671_101865723 Ga0070671_1018657232 87
115 3300005356 Ga0070674_100018657 Ga0070674_1000186576 87
116 3300005356 Ga0070674_100068500 Ga0070674_1000685003 87
117 3300005356 Ga0070674_101146000 Ga0070674_1011460002 87
118 3300005356 Ga0070674_101919762 Ga0070674_1019197622 87
119 3300005364 Ga0070673_100000050 Ga0070673_1000000509 87
120 3300005364 Ga0070673_100018483 Ga0070673_1000184836 87
121 3300005364 Ga0070673_100025735 Ga0070673_1000257352 87
122 3300005365 Ga0070688_100000781 Ga0070688_10000078116 87
123 3300005365 Ga0070688_100006605 Ga0070688_1000066056 87
124 3300005365 Ga0070688_100557685 Ga0070688_1005576852 87
125 3300005366 Ga0070659_100014541 Ga0070659_1000145416 87
126 3300005366 Ga0070659_100177726 Ga0070659_1001777262 87
127 3300005366 Ga0070659_100199243 Ga0070659_1001992433 87
128 3300005366 Ga0070659_100263800 Ga0070659_1002638002 87
129 3300005367 Ga0070667_100007711 Ga0070667_1000077112 87
130 3300005367 Ga0070667_100040047 Ga0070667_1000400472 87
131 3300005367 Ga0070667_100069618 Ga0070667_1000696184 87
132 3300005367 Ga0070667_100099804 Ga0070667_1000998042 87
133 3300005406 Ga0070703_10050731 Ga0070703_100507313 87
134 3300005434 Ga0070709_10002579 Ga0070709_100025794 87
135 3300005434 Ga0070709_10021978 Ga0070709_100219784 87
136 3300005434 Ga0070709_10080777 Ga0070709_100807772 87
137 3300005434 Ga0070709_10386789 Ga0070709_103867892 87
138 3300005435 Ga0070714_100004606 Ga0070714_1000046067 87
139 3300005435 Ga0070714_100006031 Ga0070714_1000060317 87
140 3300005435 Ga0070714_100413285 Ga0070714_1004132851 87
141 3300005435 Ga0070714_101056293 Ga0070714_1010562931 87
142 3300005435 Ga0070714_101362992 Ga0070714_1013629922 87
143 3300005436 Ga0070713_100016906 Ga0070713_1000169066 87
144 3300005436 Ga0070713_100017576 Ga0070713_1000175764 87
145 3300005436 Ga0070713_100768913 Ga0070713_1007689132 87
146 3300005436 Ga0070713_100999547 Ga0070713_1009995472 87
147 3300005436 Ga0070713_101434521 Ga0070713_1014345212 87
148 3300005437 Ga0070710_10003313 Ga0070710_100033136 87
149 3300005437 Ga0070710_10009139 Ga0070710_100091394 87
150 3300005437 Ga0070710_10195953 Ga0070710_101959532 87
151 3300005437 Ga0070710_11028345 Ga0070710_110283452 87
152 3300005438 Ga0070701_10002148 Ga0070701_100021483 87
153 3300005438 Ga0070701_10350596 Ga0070701_103505962 87
154 3300005439 Ga0070711_100070490 Ga0070711_1000704903 87
155 3300005439 Ga0070711_100093042 Ga0070711_1000930422 87
156 3300005439 Ga0070711_100581667 Ga0070711_1005816672 87
157 3300005439 Ga0070711_100923648 Ga0070711_1009236481 87
158 3300005439 Ga0070711_101856275 Ga0070711_1018562752 87
159 3300005440 Ga0070705_100003118 Ga0070705_1000031187 87
160 3300005440 Ga0070705_101036197 Ga0070705_1010361972 87
161 3300005440 Ga0070705_101271323 Ga0070705_1012713231 87
162 3300005440 Ga0070705_101542001 Ga0070705_1015420012 87
163 3300005441 Ga0070700_100002692 Ga0070700_1000026927 87
164 3300005441 Ga0070700_100057652 Ga0070700_1000576523 87
165 3300005441 Ga0070700_100129666 Ga0070700_1001296662 87
166 3300005441 Ga0070700_100558403 Ga0070700_1005584032 87
167 3300005441 Ga0070700_101634796 Ga0070700_1016347961 87
168 3300005444 Ga0070694_100005972 Ga0070694_1000059727 87
169 3300005444 Ga0070694_100071334 Ga0070694_1000713342 87
170 3300005444 Ga0070694_100562943 Ga0070694_1005629432 87
171 3300005445 Ga0070708_100092810 Ga0070708_1000928105 87
172 3300005455 Ga0070663_100020225 Ga0070663_1000202256 87
173 3300005455 Ga0070663_100044767 Ga0070663_1000447674 87
174 3300005455 Ga0070663_101451948 Ga0070663_1014519482 87
175 3300005456 Ga0070678_100000518 Ga0070678_10000051810 87
176 3300005456 Ga0070678_100212529 Ga0070678_1002125292 87
177 3300005456 Ga0070678_101629124 Ga0070678_1016291242 87
178 3300005457 Ga0070662_100021515 Ga0070662_1000215152 87
179 3300005457 Ga0070662_100086443 Ga0070662_1000864434 87
180 3300005457 Ga0070662_100708797 Ga0070662_1007087972 87
181 3300005457 Ga0070662_101498811 Ga0070662_1014988111 87
182 3300005458 Ga0070681_10027987 Ga0070681_100279876 87
183 3300005458 Ga0070681_11392097 Ga0070681_113920972 87
184 3300005458 Ga0070681_11601729 Ga0070681_116017291 87
185 3300005459 Ga0068867_100009022 Ga0068867_1000090226 87
186 3300005459 Ga0068867_100047831 Ga0068867_1000478312 87
187 3300005459 Ga0068867_102149891 Ga0068867_1021498912 87
188 3300005466 Ga0070685_10003674 Ga0070685_100036744 87
189 3300005466 Ga0070685_10007039 Ga0070685_100070396 87
190 3300005466 Ga0070685_10045141 Ga0070685_100451412 87
191 3300005466 Ga0070685_10484104 Ga0070685_104841042 87
192 3300005468 Ga0070707_100977112 Ga0070707_1009771122 87
193 3300005471 Ga0070698_100279765 Ga0070698_1002797652 87
194 3300005518 Ga0070699_100010972 Ga0070699_1000109722 87
195 3300005518 Ga0070699_101089575 Ga0070699_1010895751 87
196 3300005518 Ga0070699_101607915 Ga0070699_1016079152 87
197 3300005530 Ga0070679_100007667 Ga0070679_1000076676 87
198 3300005530 Ga0070679_100252356 Ga0070679_1002523562 87
199 3300005535 Ga0070684_100004205 Ga0070684_1000042058 87
200 3300005535 Ga0070684_100050710 Ga0070684_1000507102 87
201 3300005535 Ga0070684_100180708 Ga0070684_1001807082 87
202 3300005536 Ga0070697_100535918 Ga0070697_1005359182 87
203 3300005539 Ga0068853_100030067 Ga0068853_1000300676 87
204 3300005539 Ga0068853_100362410 Ga0068853_1003624102 87
205 3300005539 Ga0068853_101191682 Ga0068853_1011916822 87
206 3300005543 Ga0070672_100000643 Ga0070672_1000006439 87
207 3300005543 Ga0070672_100052229 Ga0070672_1000522292 87
208 3300005543 Ga0070672_100377859 Ga0070672_1003778592 87
209 3300005544 Ga0070686_100001304 Ga0070686_1000013042 87
210 3300005544 Ga0070686_100040350 Ga0070686_1000403502 87
211 3300005544 Ga0070686_100522866 Ga0070686_1005228661 87
212 3300005545 Ga0070695_100187822 Ga0070695_1001878221 87
213 3300005546 Ga0070696_100241197 Ga0070696_1002411972 87
214 3300005546 Ga0070696_100254152 Ga0070696_1002541522 87
215 3300005546 Ga0070696_100436747 Ga0070696_1004367472 87
216 3300005546 Ga0070696_101855335 Ga0070696_1018553351 87
217 3300005547 Ga0070693_100008992 Ga0070693_1000089922 87
218 3300005547 Ga0070693_100237109 Ga0070693_1002371092 87
219 3300005548 Ga0070665_100021396 Ga0070665_1000213966 87
220 3300005548 Ga0070665_100097872 Ga0070665_1000978722 87
221 3300005548 Ga0070665_100115368 Ga0070665_1001153682 87
222 3300005548 Ga0070665_100250570 Ga0070665_1002505704 87
223 3300005548 Ga0070665_102210335 Ga0070665_1022103351 87
224 3300005549 Ga0070704_100007534 Ga0070704_1000075346 87
225 3300005549 Ga0070704_101706686 Ga0070704_1017066861 87
226 3300005549 Ga0070704_102009305 Ga0070704_1020093052 87
227 3300005563 Ga0068855_100035984 Ga0068855_1000359842 87
228 3300005564 Ga0070664_100026948 Ga0070664_1000269486 87
229 3300005564 Ga0070664_100065477 Ga0070664_1000654775 87
230 3300005564 Ga0070664_100389898 Ga0070664_1003898982 87
231 3300005577 Ga0068857_100001038 Ga0068857_1000010386 87
232 3300005577 Ga0068857_100128885 Ga0068857_1001288854 87
233 3300005577 Ga0068857_101250275 Ga0068857_1012502752 87
234 3300005577 Ga0068857_101780054 Ga0068857_1017800542 87
235 3300005578 Ga0068854_100014606 Ga0068854_1000146062 87
236 3300005578 Ga0068854_100055227 Ga0068854_1000552274 87
237 3300005614 Ga0068856_100009104 Ga0068856_1000091045 87
238 3300005614 Ga0068856_101206742 Ga0068856_1012067422 87
239 3300005614 Ga0068856_102584251 Ga0068856_1025842512 87
240 3300005615 Ga0070702_100004502 Ga0070702_1000045022 87
241 3300005615 Ga0070702_100010693 Ga0070702_1000106934 87
242 3300005616 Ga0068852_100005996 Ga0068852_1000059962 87
243 3300005616 Ga0068852_100135825 Ga0068852_1001358253 87
244 3300005617 Ga0068859_100095197 Ga0068859_1000951972 87
245 3300005617 Ga0068859_100189786 Ga0068859_1001897864 87
246 3300005617 Ga0068859_100245444 Ga0068859_1002454443 87
247 3300005618 Ga0068864_100001882 Ga0068864_10000188219 87
248 3300005618 Ga0068864_100006391 Ga0068864_1000063918 87
249 3300005618 Ga0068864_100022271 Ga0068864_1000222711 87
250 3300005618 Ga0068864_100501285 Ga0068864_1005012851 87
251 3300005618 Ga0068864_101877383 Ga0068864_1018773832 87
252 3300005718 Ga0068866_10000791 Ga0068866_100007915 87
253 3300005719 Ga0068861_100002491 Ga0068861_1000024916 87
254 3300005719 Ga0068861_100292563 Ga0068861_1002925632 87
255 3300005719 Ga0068861_100467199 Ga0068861_1004671992 87
256 3300005719 Ga0068861_101176387 Ga0068861_1011763872 87
257 3300005834 Ga0068851_10427726 Ga0068851_104277261 87
258 3300005840 Ga0068870_10001431 Ga0068870_100014314 87
259 3300005840 Ga0068870_10280768 Ga0068870_102807682 87
260 3300005840 Ga0068870_11343338 Ga0068870_113433381 87
261 3300005841 Ga0068863_100025687 Ga0068863_1000256876 87
262 3300005841 Ga0068863_100051180 Ga0068863_1000511805 87
263 3300005841 Ga0068863_101062945 Ga0068863_1010629452 87
264 3300005842 Ga0068858_100109053 Ga0068858_1001090532 87
265 3300005842 Ga0068858_100208230 Ga0068858_1002082302 87
266 3300005842 Ga0068858_100456267 Ga0068858_1004562672 87
267 3300005843 Ga0068860_100002530 Ga0068860_10000253016 87
268 3300005843 Ga0068860_100047790 Ga0068860_1000477905 87
269 3300005844 Ga0068862_100090157 Ga0068862_1000901575 87
270 3300005844 Ga0068862_100258676 Ga0068862_1002586762 87
271 3300005937 Ga0081455_10000081 Ga0081455_1000008157 87
272 3300005937 Ga0081455_10003729 Ga0081455_100037299 87
273 3300005937 Ga0081455_10048513 Ga0081455_100485135 87
274 3300005937 Ga0081455_10342622 Ga0081455_103426222 87
275 3300005937 Ga0081455_10463321 Ga0081455_104633212 87
276 3300005981 Ga0081538_10001580 Ga0081538_1000158016 87
277 3300005981 Ga0081538_10053594 Ga0081538_100535943 87
278 3300005983 Ga0081540_1000027 Ga0081540_100002739 87
279 3300005983 Ga0081540_1003265 Ga0081540_10032657 87
280 3300005983 Ga0081540_1175043 Ga0081540_11750432 87
281 3300006028 Ga0070717_10000485 Ga0070717_1000048518 87
282 3300006028 Ga0070717_10000980 Ga0070717_1000098015 87
283 3300006028 Ga0070717_10097524 Ga0070717_100975243 87
284 3300006028 Ga0070717_10434999 Ga0070717_104349993 87
285 3300006028 Ga0070717_10914905 Ga0070717_109149052 87
286 3300006038 Ga0075365_10001829 Ga0075365_100018298 87
287 3300006038 Ga0075365_10044104 Ga0075365_100441044 87
288 3300006038 Ga0075365_10194423 Ga0075365_101944232 87
289 3300006038 Ga0075365_10331494 Ga0075365_103314942 87
290 3300006042 Ga0075368_10014387 Ga0075368_100143872 87
291 3300006048 Ga0075363_100086742 Ga0075363_1000867423 87
292 3300006048 Ga0075363_100142372 Ga0075363_1001423722 87
293 3300006048 Ga0075363_100217271 Ga0075363_1002172712 87
294 3300006048 Ga0075363_100332782 Ga0075363_1003327822 87
295 3300006048 Ga0075363_100850194 Ga0075363_1008501942 87
296 3300006058 Ga0075432_10218624 Ga0075432_102186242 87
297 3300006163 Ga0070715_10000289 Ga0070715_100002897 87
298 3300006163 Ga0070715_10001137 Ga0070715_100011372 87
299 3300006163 Ga0070715_10184904 Ga0070715_101849042 87
300 3300006163 Ga0070715_10946657 Ga0070715_109466572 87
301 3300006173 Ga0070716_100004371 Ga0070716_1000043712 87
302 3300006173 Ga0070716_100010832 Ga0070716_1000108322 87
303 3300006173 Ga0070716_100379709 Ga0070716_1003797092 87
304 3300006173 Ga0070716_101020403 Ga0070716_1010204031 87
305 3300006175 Ga0070712_100000381 Ga0070712_10000038116 87
306 3300006175 Ga0070712_100003511 Ga0070712_1000035112 87
307 3300006175 Ga0070712_100179123 Ga0070712_1001791233 87
308 3300006175 Ga0070712_100589747 Ga0070712_1005897471 87
309 3300006175 Ga0070712_100879196 Ga0070712_1008791962 87
310 3300006175 Ga0070712_101221002 Ga0070712_1012210022 87
311 3300006177 Ga0075362_10060551 Ga0075362_100605512 87
312 3300006178 Ga0075367_10012404 Ga0075367_100124042 87
313 3300006178 Ga0075367_10018813 Ga0075367_100188135 87
314 3300006178 Ga0075367_10113914 Ga0075367_101139143 87
315 3300006178 Ga0075367_10192846 Ga0075367_101928462 87
316 3300006178 Ga0075367_10713727 Ga0075367_107137272 87
317 3300006195 Ga0075366_10525448 Ga0075366_105254482 87
318 3300006237 Ga0097621_100001425 Ga0097621_10000142510 87
319 3300006237 Ga0097621_100010536 Ga0097621_1000105362 87
320 3300006237 Ga0097621_100109482 Ga0097621_1001094821 87
321 3300006353 Ga0075370_10102861 Ga0075370_101028612 87
322 3300006353 Ga0075370_10356799 Ga0075370_103567992 87
323 3300006358 Ga0068871_100002394 Ga0068871_10000239412 87
324 3300006358 Ga0068871_100006790 Ga0068871_1000067902 87
325 3300006358 Ga0068871_100648687 Ga0068871_1006486872 87
326 3300006844 Ga0075428_100272670 Ga0075428_1002726701 87
327 3300006844 Ga0075428_100373229 Ga0075428_1003732293 87
328 3300006844 Ga0075428_100659124 Ga0075428_1006591242 87
329 3300006844 Ga0075428_100816747 Ga0075428_1008167472 87
330 3300006846 Ga0075430_100000403 Ga0075430_10000040324 87
331 3300006846 Ga0075430_100006792 Ga0075430_1000067922 87
332 3300006846 Ga0075430_100659732 Ga0075430_1006597321 87
333 3300006847 Ga0075431_100057713 Ga0075431_1000577135 87
334 3300006847 Ga0075431_100067535 Ga0075431_1000675351 87
335 3300006847 Ga0075431_100221962 Ga0075431_1002219623 87
336 3300006847 Ga0075431_100342061 Ga0075431_1003420613 87
337 3300006847 Ga0075431_101248697 Ga0075431_1012486972 87
338 3300006852 Ga0075433_10111705 Ga0075433_101117054 87
339 3300006852 Ga0075433_10404315 Ga0075433_104043152 87
340 3300006852 Ga0075433_10563575 Ga0075433_105635752 87
341 3300006852 Ga0075433_11340954 Ga0075433_113409542 87
342 3300006852 Ga0075433_11415695 Ga0075433_114156951 87
343 3300006871 Ga0075434_100004560 Ga0075434_1000045609 87
344 3300006871 Ga0075434_100031153 Ga0075434_1000311535 87
345 3300006871 Ga0075434_100178126 Ga0075434_1001781263 87
346 3300006871 Ga0075434_100226134 Ga0075434_1002261343 87
347 3300006871 Ga0075434_100264005 Ga0075434_1002640052 87
348 3300006871 Ga0075434_100391020 Ga0075434_1003910202 87
349 3300006871 Ga0075434_100519711 Ga0075434_1005197112 87
350 3300006880 Ga0075429_100195306 Ga0075429_1001953061 87
351 3300006880 Ga0075429_100437345 Ga0075429_1004373452 87
352 3300006880 Ga0075429_101038743 Ga0075429_1010387432 87
353 3300006881 Ga0068865_100001097 Ga0068865_1000010976 87
354 3300006881 Ga0068865_100134918 Ga0068865_1001349183 87
355 3300006881 Ga0068865_100249461 Ga0068865_1002494613 87
356 3300006881 Ga0068865_100631968 Ga0068865_1006319681 87
357 3300006914 Ga0075436_100068349 Ga0075436_1000683492 87
358 3300006931 Ga0097620_100095196 Ga0097620_1000951964 87
359 3300006931 Ga0097620_100189785 Ga0097620_1001897854 87
360 3300006931 Ga0097620_100245421 Ga0097620_1002454213 87
361 3300007076 Ga0075435_100075222 Ga0075435_1000752222 87
362 3300007076 Ga0075435_100247382 Ga0075435_1002473822 87
363 3300007076 Ga0075435_100304901 Ga0075435_1003049012 87
364 3300007076 Ga0075435_100493958 Ga0075435_1004939582 87
365 3300007076 Ga0075435_100765232 Ga0075435_1007652321 87
366 3300009011 Ga0105251_10036136 Ga0105251_100361364 87
367 3300009011 Ga0105251_10091272 Ga0105251_100912722 87
368 3300009036 Ga0105244_10023607 Ga0105244_100236072 87
369 3300009036 Ga0105244_10435472 Ga0105244_104354722 87
370 3300009092 Ga0105250_10078729 Ga0105250_100787292 87
371 3300009092 Ga0105250_10616440 Ga0105250_106164401 87
372 3300009093 Ga0105240_10067050 Ga0105240_100670504 87
373 3300009093 Ga0105240_11464700 Ga0105240_114647002 87
374 3300009094 Ga0111539_10026539 Ga0111539_100265395 87
375 3300009094 Ga0111539_10034470 Ga0111539_100344706 87
376 3300009094 Ga0111539_10189267 Ga0111539_101892673 87
377 3300009094 Ga0111539_10263224 Ga0111539_102632242 87
378 3300009094 Ga0111539_11078790 Ga0111539_110787902 87
379 3300009094 Ga0111539_11664275 Ga0111539_116642752 87
380 3300009094 Ga0111539_12606955 Ga0111539_126069552 87
381 3300009098 Ga0105245_10025559 Ga0105245_100255593 87
382 3300009098 Ga0105245_10133583 Ga0105245_101335834 87
383 3300009098 Ga0105245_11173960 Ga0105245_111739602 87
384 3300009098 Ga0105245_12571918 Ga0105245_125719181 87
385 3300009101 Ga0105247_10003270 Ga0105247_1000327012 87
386 3300009101 Ga0105247_10024258 Ga0105247_100242582 87
387 3300009101 Ga0105247_10025129 Ga0105247_100251292 87
388 3300009101 Ga0105247_10046239 Ga0105247_100462392 87
389 3300009101 Ga0105247_10420950 Ga0105247_104209502 87
390 3300009147 Ga0114129_10024067 Ga0114129_100240674 87
391 3300009147 Ga0114129_10027094 Ga0114129_100270945 87
392 3300009147 Ga0114129_10035205 Ga0114129_100352052 87
393 3300009147 Ga0114129_10349738 Ga0114129_103497382 87
394 3300009147 Ga0114129_10511680 Ga0114129_105116802 87
395 3300009147 Ga0114129_10837248 Ga0114129_108372482 87
396 3300009147 Ga0114129_13056179 Ga0114129_130561791 87
397 3300009148 Ga0105243_10002400 Ga0105243_1000240013 87
398 3300009148 Ga0105243_10004402 Ga0105243_100044027 87
399 3300009148 Ga0105243_11781848 Ga0105243_117818482 87
400 3300009174 Ga0105241_10008636 Ga0105241_100086366 87
401 3300009176 Ga0105242_10007578 Ga0105242_100075786 87
402 3300009176 Ga0105242_10008734 Ga0105242_100087347 87
403 3300009176 Ga0105242_10169037 Ga0105242_101690373 87
404 3300009177 Ga0105248_10010839 Ga0105248_100108395 87
405 3300009177 Ga0105248_10014218 Ga0105248_100142186 87
406 3300009177 Ga0105248_10081366 Ga0105248_100813662 87
407 3300009177 Ga0105248_10462007 Ga0105248_104620072 87
408 3300009545 Ga0105237_10030610 Ga0105237_100306102 87
409 3300009545 Ga0105237_10072688 Ga0105237_100726884 87
410 3300009545 Ga0105237_10198301 Ga0105237_101983012 87
411 3300009545 Ga0105237_10233019 Ga0105237_102330194 87
412 3300009545 Ga0105237_10921939 Ga0105237_109219392 87
413 3300009545 Ga0105237_12173966 Ga0105237_121739662 87
414 3300009551 Ga0105238_10009678 Ga0105238_100096782 87
415 3300009551 Ga0105238_10704814 Ga0105238_107048142 87
416 3300009551 Ga0105238_10923956 Ga0105238_109239562 87
417 3300009553 Ga0105249_10011450 Ga0105249_100114503 87
418 3300009553 Ga0105249_10060226 Ga0105249_100602263 87
419 3300009553 Ga0105249_10190476 Ga0105249_101904763 87
420 3300009553 Ga0105249_10635830 Ga0105249_106358302 87
421 3300009553 Ga0105249_10835085 Ga0105249_108350852 87
422 3300009553 Ga0105249_10889730 Ga0105249_108897302 87
423 3300009553 Ga0105249_11209839 Ga0105249_112098391 87
424 3300010375 Ga0105239_10024088 Ga0105239_100240886 87
425 3300010375 Ga0105239_10060055 Ga0105239_100600555 87
426 3300010375 Ga0105239_10194362 Ga0105239_101943623 87
427 3300010375 Ga0105239_11542931 Ga0105239_115429311 87
428 3300010375 Ga0105239_13644122 Ga0105239_136441222 87
429 3300011119 Ga0105246_10022159 Ga0105246_100221593 87
430 3300011119 Ga0105246_10025827 Ga0105246_100258273 87
431 3300011119 Ga0105246_10064420 Ga0105246_100644202 87
432 3300011119 Ga0105246_10293961 Ga0105246_102939612 87
433 3300011119 Ga0105246_10516105 Ga0105246_105161052 87
434 3300012485 Ga0157325_1001090 Ga0157325_10010902 87
435 3300012505 Ga0157339_1006614 Ga0157339_10066142 87
436 3300012507 Ga0157342_1016394 Ga0157342_10163942 87
437 3300012510 Ga0157316_1000861 Ga0157316_10008612 87
438 3300012515 Ga0157338_1041924 Ga0157338_10419242 87
439 3300013100 Ga0157373_10045749 Ga0157373_100457494 87
440 3300013100 Ga0157373_10185997 Ga0157373_101859972 87
441 3300013100 Ga0157373_11039297 Ga0157373_110392972 87
442 3300013102 Ga0157371_10070112 Ga0157371_100701123 87
443 3300013104 Ga0157370_10100379 Ga0157370_101003792 87
444 3300013104 Ga0157370_10377576 Ga0157370_103775762 87
445 3300013104 Ga0157370_10989840 Ga0157370_109898402 87
446 3300013105 Ga0157369_10618176 Ga0157369_106181762 87
447 3300013296 Ga0157374_10001167 Ga0157374_100011674 87
448 3300013296 Ga0157374_10338893 Ga0157374_103388933 87
449 3300013296 Ga0157374_10418172 Ga0157374_104181722 87
450 3300013296 Ga0157374_11019193 Ga0157374_110191931 87
451 3300013296 Ga0157374_11253782 Ga0157374_112537822 87
452 3300013297 Ga0157378_10008023 Ga0157378_100080234 87
453 3300013297 Ga0157378_10034938 Ga0157378_100349382 87
454 3300013297 Ga0157378_10103420 Ga0157378_101034204 87
455 3300013297 Ga0157378_10230936 Ga0157378_102309362 87
456 3300013306 Ga0163162_10010853 Ga0163162_100108534 87
457 3300013306 Ga0163162_10102479 Ga0163162_101024792 87
458 3300013306 Ga0163162_10156327 Ga0163162_101563272 87
459 3300013307 Ga0157372_10070864 Ga0157372_100708643 87
460 3300013307 Ga0157372_10788245 Ga0157372_107882452 87
461 3300013307 Ga0157372_13397406 Ga0157372_133974061 87
462 3300013308 Ga0157375_10031874 Ga0157375_100318747 87
463 3300013308 Ga0157375_10058370 Ga0157375_100583704 87
464 3300013308 Ga0157375_10307243 Ga0157375_103072432 87
465 3300013308 Ga0157375_11513626 Ga0157375_115136262 87
466 3300013308 Ga0157375_12241485 Ga0157375_122414852 87
467 3300014325 Ga0163163_10007288 Ga0163163_100072887 87
468 3300014325 Ga0163163_10011174 Ga0163163_100111749 87
469 3300014325 Ga0163163_10072774 Ga0163163_100727745 87
470 3300014325 Ga0163163_10303092 Ga0163163_103030922 87
471 3300014325 Ga0163163_10638904 Ga0163163_106389042 87
472 3300014325 Ga0163163_11160597 Ga0163163_111605972 87
473 3300014326 Ga0157380_10001551 Ga0157380_100015518 87
474 3300014326 Ga0157380_10141506 Ga0157380_101415062 87
475 3300014326 Ga0157380_10484984 Ga0157380_104849842 87
476 3300014326 Ga0157380_11535554 Ga0157380_115355541 87
477 3300014326 Ga0157380_12279306 Ga0157380_122793062 87
478 3300014497 Ga0182008_10154603 Ga0182008_101546032 87
479 3300014497 Ga0182008_10676170 Ga0182008_106761702 87
480 3300014745 Ga0157377_10009300 Ga0157377_100093005 87
481 3300014745 Ga0157377_10053554 Ga0157377_100535544 87
482 3300014745 Ga0157377_10134432 Ga0157377_101344322 87
483 3300014968 Ga0157379_10008646 Ga0157379_100086463 87
484 3300014968 Ga0157379_10081393 Ga0157379_100813934 87
485 3300014968 Ga0157379_10112149 Ga0157379_101121492 87
486 3300014968 Ga0157379_10291285 Ga0157379_102912852 87
487 3300014968 Ga0157379_11158923 Ga0157379_111589232 87
488 3300014969 Ga0157376_10580618 Ga0157376_105806182 87
489 3300014969 Ga0157376_12255506 Ga0157376_122555061 87
490 3300014969 Ga0157376_12564712 Ga0157376_125647122 87
491 3300017792 Ga0163161_10011103 Ga0163161_100111036 87
492 3300017792 Ga0163161_10078053 Ga0163161_100780532 87
493 3300017792 Ga0163161_10214200 Ga0163161_102142003 87
494 3300017792 Ga0163161_10480441 Ga0163161_104804412 87
495 3300021361 Ga0213872_10280375 Ga0213872_102803752 87
496 3300021384 Ga0213876_10029343 Ga0213876_100293433 87
497 3300025271 Ga0207666_1000153 Ga0207666_10001536 87
498 3300025290 Ga0207673_1000206 Ga0207673_10002066 87
499 3300025315 Ga0207697_10001059 Ga0207697_100010598 87
500 3300025315 Ga0207697_10296209 Ga0207697_102962092 87
501 3300025321 Ga0207656_10230074 Ga0207656_102300742 87
502 3300025735 Ga0207713_1051898 Ga0207713_10518983 87
503 3300025735 Ga0207713_1084833 Ga0207713_10848332 87
504 3300025885 Ga0207653_10020183 Ga0207653_100201833 87
505 3300025893 Ga0207682_10002885 Ga0207682_100028853 87
506 3300025898 Ga0207692_10000282 Ga0207692_1000028212 87
507 3300025898 Ga0207692_10020210 Ga0207692_100202102 87
508 3300025898 Ga0207692_10436411 Ga0207692_104364112 87
509 3300025899 Ga0207642_10119120 Ga0207642_101191202 87
510 3300025899 Ga0207642_10347258 Ga0207642_103472582 87
511 3300025900 Ga0207710_10000382 Ga0207710_1000038215 87
512 3300025900 Ga0207710_10010435 Ga0207710_100104353 87
513 3300025900 Ga0207710_10012560 Ga0207710_100125604 87
514 3300025900 Ga0207710_10036246 Ga0207710_100362462 87
515 3300025901 Ga0207688_10001072 Ga0207688_100010725 87
516 3300025901 Ga0207688_10004597 Ga0207688_100045974 87
517 3300025903 Ga0207680_10008936 Ga0207680_100089365 87
518 3300025903 Ga0207680_10018703 Ga0207680_100187032 87
519 3300025903 Ga0207680_10552131 Ga0207680_105521311 87
520 3300025904 Ga0207647_10033262 Ga0207647_100332623 87
521 3300025904 Ga0207647_10071757 Ga0207647_100717573 87
522 3300025905 Ga0207685_10000164 Ga0207685_100001642 87
523 3300025905 Ga0207685_10189110 Ga0207685_101891101 87
524 3300025906 Ga0207699_10148435 Ga0207699_101484352 87
525 3300025906 Ga0207699_10230402 Ga0207699_102304021 87
526 3300025906 Ga0207699_10300091 Ga0207699_103000912 87
527 3300025906 Ga0207699_10315460 Ga0207699_103154601 87
528 3300025906 Ga0207699_10405395 Ga0207699_104053952 87
529 3300025906 Ga0207699_10411845 Ga0207699_104118452 87
530 3300025906 Ga0207699_11077179 Ga0207699_110771792 87
531 3300025907 Ga0207645_10002745 Ga0207645_100027456 87
532 3300025907 Ga0207645_10036554 Ga0207645_100365546 87
533 3300025907 Ga0207645_10065071 Ga0207645_100650712 87
534 3300025907 Ga0207645_10245704 Ga0207645_102457043 87
535 3300025908 Ga0207643_10000004 Ga0207643_1000000479 87
536 3300025908 Ga0207643_10000532 Ga0207643_100005324 87
537 3300025911 Ga0207654_10008032 Ga0207654_100080325 87
538 3300025911 Ga0207654_10158904 Ga0207654_101589041 87
539 3300025912 Ga0207707_10140307 Ga0207707_101403072 87
540 3300025912 Ga0207707_10273104 Ga0207707_102731043 87
541 3300025912 Ga0207707_11133418 Ga0207707_111334182 87
542 3300025913 Ga0207695_10072726 Ga0207695_100727264 87
543 3300025913 Ga0207695_10542897 Ga0207695_105428972 87
544 3300025914 Ga0207671_10086564 Ga0207671_100865643 87
545 3300025914 Ga0207671_10137614 Ga0207671_101376142 87
546 3300025914 Ga0207671_11387138 Ga0207671_113871382 87
547 3300025915 Ga0207693_10001038 Ga0207693_1000103810 87
548 3300025915 Ga0207693_10005381 Ga0207693_100053814 87
549 3300025916 Ga0207663_10001206 Ga0207663_1000120611 87
550 3300025916 Ga0207663_10020826 Ga0207663_100208265 87
551 3300025916 Ga0207663_10062599 Ga0207663_100625992 87
552 3300025917 Ga0207660_10009992 Ga0207660_100099923 87
553 3300025917 Ga0207660_10592331 Ga0207660_105923312 87
554 3300025918 Ga0207662_10000392 Ga0207662_100003927 87
555 3300025918 Ga0207662_10001199 Ga0207662_1000119910 87
556 3300025918 Ga0207662_10124829 Ga0207662_101248292 87
557 3300025919 Ga0207657_10002007 Ga0207657_1000200715 87
558 3300025919 Ga0207657_10019229 Ga0207657_100192295 87
559 3300025919 Ga0207657_10039060 Ga0207657_100390605 87
560 3300025920 Ga0207649_10005404 Ga0207649_100054043 87
561 3300025920 Ga0207649_10228759 Ga0207649_102287592 87
562 3300025920 Ga0207649_10360867 Ga0207649_103608672 87
563 3300025920 Ga0207649_10365921 Ga0207649_103659212 87
564 3300025921 Ga0207652_10058342 Ga0207652_100583422 87
565 3300025921 Ga0207652_10128917 Ga0207652_101289172 87
566 3300025922 Ga0207646_10869308 Ga0207646_108693082 87
567 3300025923 Ga0207681_10024530 Ga0207681_100245302 87
568 3300025923 Ga0207681_10077414 Ga0207681_100774142 87
569 3300025924 Ga0207694_10363721 Ga0207694_103637212 87
570 3300025925 Ga0207650_10004542 Ga0207650_100045424 87
571 3300025925 Ga0207650_10017240 Ga0207650_100172404 87
572 3300025925 Ga0207650_10412758 Ga0207650_104127582 87
573 3300025926 Ga0207659_10000374 Ga0207659_1000037418 87
574 3300025926 Ga0207659_10025170 Ga0207659_100251704 87
575 3300025926 Ga0207659_10383099 Ga0207659_103830992 87
576 3300025926 Ga0207659_11675219 Ga0207659_116752191 87
577 3300025927 Ga0207687_10036426 Ga0207687_100364264 87
578 3300025927 Ga0207687_10041087 Ga0207687_100410872 87
579 3300025928 Ga0207700_10003347 Ga0207700_100033477 87
580 3300025928 Ga0207700_10031654 Ga0207700_100316543 87
581 3300025928 Ga0207700_10067428 Ga0207700_100674282 87
582 3300025928 Ga0207700_10287224 Ga0207700_102872242 87
583 3300025928 Ga0207700_10999172 Ga0207700_109991722 87
584 3300025928 Ga0207700_11152062 Ga0207700_111520621 87
585 3300025929 Ga0207664_10012974 Ga0207664_100129743 87
586 3300025929 Ga0207664_10339181 Ga0207664_103391813 87
587 3300025929 Ga0207664_11341152 Ga0207664_113411522 87
588 3300025929 Ga0207664_11733889 Ga0207664_117338892 87
589 3300025931 Ga0207644_10004888 Ga0207644_100048884 87
590 3300025931 Ga0207644_10073489 Ga0207644_100734892 87
591 3300025931 Ga0207644_10328146 Ga0207644_103281463 87
592 3300025932 Ga0207690_10088497 Ga0207690_100884972 87
593 3300025932 Ga0207690_10410738 Ga0207690_104107382 87
594 3300025932 Ga0207690_10536168 Ga0207690_105361682 87
595 3300025932 Ga0207690_10806594 Ga0207690_108065942 87
596 3300025933 Ga0207706_10010623 Ga0207706_100106232 87
597 3300025933 Ga0207706_10095775 Ga0207706_100957753 87
598 3300025934 Ga0207686_10007542 Ga0207686_100075426 87
599 3300025934 Ga0207686_10025932 Ga0207686_100259325 87
600 3300025934 Ga0207686_10102145 Ga0207686_101021452 87
601 3300025935 Ga0207709_10003882 Ga0207709_100038822 87
602 3300025935 Ga0207709_10027047 Ga0207709_100270473 87
603 3300025935 Ga0207709_10069241 Ga0207709_100692412 87
604 3300025936 Ga0207670_10004902 Ga0207670_100049026 87
605 3300025936 Ga0207670_10043451 Ga0207670_100434514 87
606 3300025936 Ga0207670_10177322 Ga0207670_101773222 87
607 3300025936 Ga0207670_10217320 Ga0207670_102173202 87
608 3300025937 Ga0207669_10000275 Ga0207669_1000027523 87
609 3300025937 Ga0207669_10083520 Ga0207669_100835203 87
610 3300025938 Ga0207704_10002620 Ga0207704_100026207 87
611 3300025938 Ga0207704_10105952 Ga0207704_101059523 87
612 3300025939 Ga0207665_10000541 Ga0207665_100005417 87
613 3300025939 Ga0207665_10013741 Ga0207665_100137416 87
614 3300025939 Ga0207665_10205088 Ga0207665_102050882 87
615 3300025939 Ga0207665_10288681 Ga0207665_102886812 87
616 3300025940 Ga0207691_10004396 Ga0207691_100043967 87
617 3300025940 Ga0207691_10030766 Ga0207691_100307662 87
618 3300025941 Ga0207711_10002645 Ga0207711_100026452 87
619 3300025941 Ga0207711_10005696 Ga0207711_100056962 87
620 3300025941 Ga0207711_10021126 Ga0207711_100211262 87
621 3300025941 Ga0207711_11283095 Ga0207711_112830952 87
622 3300025942 Ga0207689_10002724 Ga0207689_100027249 87
623 3300025942 Ga0207689_10077139 Ga0207689_100771394 87
624 3300025942 Ga0207689_10496678 Ga0207689_104966782 87
625 3300025944 Ga0207661_10015256 Ga0207661_100152562 87
626 3300025944 Ga0207661_10112752 Ga0207661_101127523 87
627 3300025944 Ga0207661_10159486 Ga0207661_101594861 87
628 3300025944 Ga0207661_10248476 Ga0207661_102484763 87
629 3300025945 Ga0207679_10001617 Ga0207679_100016177 87
630 3300025945 Ga0207679_10151996 Ga0207679_101519962 87
631 3300025949 Ga0207667_10702478 Ga0207667_107024782 87
632 3300025960 Ga0207651_10004195 Ga0207651_100041956 87
633 3300025960 Ga0207651_10057280 Ga0207651_100572805 87
634 3300025960 Ga0207651_10101715 Ga0207651_101017152 87
635 3300025960 Ga0207651_11533688 Ga0207651_115336882 87
636 3300025961 Ga0207712_10033211 Ga0207712_100332114 87
637 3300025961 Ga0207712_10069490 Ga0207712_100694902 87
638 3300025961 Ga0207712_10218996 Ga0207712_102189963 87
639 3300025961 Ga0207712_10298718 Ga0207712_102987182 87
640 3300025961 Ga0207712_10413420 Ga0207712_104134202 87
641 3300025961 Ga0207712_11079490 Ga0207712_110794902 87
642 3300025972 Ga0207668_10005763 Ga0207668_100057632 87
643 3300025972 Ga0207668_10288942 Ga0207668_102889422 87
644 3300025972 Ga0207668_10298681 Ga0207668_102986812 87
645 3300025981 Ga0207640_10015642 Ga0207640_100156425 87
646 3300025981 Ga0207640_10105178 Ga0207640_101051783 87
647 3300025986 Ga0207658_10084208 Ga0207658_100842084 87
648 3300025986 Ga0207658_10251997 Ga0207658_102519973 87
649 3300025986 Ga0207658_11480453 Ga0207658_114804531 87
650 3300026023 Ga0207677_10044077 Ga0207677_100440773 87
651 3300026023 Ga0207677_10044426 Ga0207677_100444262 87
652 3300026023 Ga0207677_10094078 Ga0207677_100940783 87
653 3300026035 Ga0207703_10001822 Ga0207703_1000182213 87
654 3300026035 Ga0207703_10019332 Ga0207703_100193327 87
655 3300026035 Ga0207703_10041983 Ga0207703_100419832 87
656 3300026035 Ga0207703_10537759 Ga0207703_105377592 87
657 3300026041 Ga0207639_10019446 Ga0207639_100194466 87
658 3300026041 Ga0207639_10313517 Ga0207639_103135172 87
659 3300026041 Ga0207639_11168052 Ga0207639_111680522 87
660 3300026067 Ga0207678_10002471 Ga0207678_1000247111 87
661 3300026067 Ga0207678_10019865 Ga0207678_100198652 87
662 3300026067 Ga0207678_10032268 Ga0207678_100322684 87
663 3300026075 Ga0207708_10001992 Ga0207708_100019927 87
664 3300026075 Ga0207708_10047755 Ga0207708_100477553 87
665 3300026075 Ga0207708_10196640 Ga0207708_101966402 87
666 3300026078 Ga0207702_10021444 Ga0207702_100214442 87
667 3300026078 Ga0207702_10886104 Ga0207702_108861042 87
668 3300026078 Ga0207702_11214162 Ga0207702_112141621 87
669 3300026088 Ga0207641_10019509 Ga0207641_100195092 87
670 3300026088 Ga0207641_10493316 Ga0207641_104933162 87
671 3300026088 Ga0207641_10848924 Ga0207641_108489242 87
672 3300026089 Ga0207648_10004767 Ga0207648_100047677 87
673 3300026089 Ga0207648_10010273 Ga0207648_100102733 87
674 3300026095 Ga0207676_10001979 Ga0207676_1000197914 87
675 3300026095 Ga0207676_10002246 Ga0207676_100022467 87
676 3300026095 Ga0207676_10375764 Ga0207676_103757642 87
677 3300026095 Ga0207676_10473035 Ga0207676_104730352 87
678 3300026095 Ga0207676_11118263 Ga0207676_111182632 87
679 3300026116 Ga0207674_10007733 Ga0207674_100077337 87
680 3300026116 Ga0207674_10340244 Ga0207674_103402442 87
681 3300026116 Ga0207674_12165721 Ga0207674_121657212 87
682 3300026118 Ga0207675_100003883 Ga0207675_1000038836 87
683 3300026118 Ga0207675_100007986 Ga0207675_1000079866 87
684 3300026118 Ga0207675_100255645 Ga0207675_1002556452 87
685 3300026121 Ga0207683_10002044 Ga0207683_100020449 87
686 3300026121 Ga0207683_10009279 Ga0207683_100092793 87
687 3300026121 Ga0207683_10124841 Ga0207683_101248415 87
688 3300026142 Ga0207698_10031944 Ga0207698_100319445 87
689 3300026142 Ga0207698_10079168 Ga0207698_100791683 87
690 3300026142 Ga0207698_10828466 Ga0207698_108284661 87
691 3300027462 Ga0210000_1028337 Ga0210000_10283372 87
692 3300027614 Ga0209970_1001300 Ga0209970_10013003 87
693 3300027617 Ga0210002_1002503 Ga0210002_10025034 87
694 3300027682 Ga0209971_1051991 Ga0209971_10519912 87
695 3300027695 Ga0209966_1049627 Ga0209966_10496272 87
696 3300027717 Ga0209998_10001985 Ga0209998_100019853 87
697 3300027717 Ga0209998_10027289 Ga0209998_100272892 87
698 3300027866 Ga0209813_10042324 Ga0209813_100423241 87
699 3300027876 Ga0209974_10010843 Ga0209974_100108434 87
700 3300027876 Ga0209974_10013531 Ga0209974_100135313 87
701 3300027907 Ga0207428_10000501 Ga0207428_1000050146 87
702 3300027907 Ga0207428_10240725 Ga0207428_102407252 87
703 3300028379 Ga0268266_10003041 Ga0268266_1000304118 87
704 3300028379 Ga0268266_10268549 Ga0268266_102685492 87
705 3300028379 Ga0268266_10288641 Ga0268266_102886412 87
706 3300028380 Ga0268265_10027065 Ga0268265_100270653 87
707 3300028380 Ga0268265_10055116 Ga0268265_100551165 87
708 3300028381 Ga0268264_10041889 Ga0268264_100418895 87
709 3300028381 Ga0268264_10342531 Ga0268264_103425312 87
710 3300028381 Ga0268264_10542243 Ga0268264_105422432 87
711 3300028381 Ga0268264_11402776 Ga0268264_114027762 87
712 3300028381 Ga0268264_12184799 Ga0268264_121847992 87
713 3300028800 Ga0265338_10806974 Ga0265338_108069742 87
714 3300031235 Ga0265330_10221819 Ga0265330_102218192 87
715 3300031238 Ga0265332_10011394 Ga0265332_100113945 87
716 3300031238 Ga0265332_10045090 Ga0265332_100450903 87
717 3300031240 Ga0265320_10502443 Ga0265320_105024431 87
718 3300031241 Ga0265325_10000073 Ga0265325_1000007332 87
719 3300031241 Ga0265325_10051523 Ga0265325_100515231 87
720 3300031242 Ga0265329_10021345 Ga0265329_100213452 87
721 3300031247 Ga0265340_10009552 Ga0265340_100095525 87
722 3300031247 Ga0265340_10105527 Ga0265340_101055272 87
723 3300031249 Ga0265339_10052691 Ga0265339_100526914 87
724 3300031249 Ga0265339_10145540 Ga0265339_101455402 87
725 3300031249 Ga0265339_10152032 Ga0265339_101520323 87
726 3300031250 Ga0265331_10055553 Ga0265331_100555533 87
727 3300031250 Ga0265331_10063698 Ga0265331_100636981 87
728 3300031344 Ga0265316_10470323 Ga0265316_104703232 87
729 3300031344 Ga0265316_10508621 Ga0265316_105086211 87
730 3300031344 Ga0265316_10744580 Ga0265316_107445802 87
731 3300031344 Ga0265316_11293843 Ga0265316_112938431 87
732 3300031548 Ga0307408_101670668 Ga0307408_1016706682 87
733 3300031595 Ga0265313_10022124 Ga0265313_100221244 87
734 3300031595 Ga0265313_10027730 Ga0265313_100277302 87
735 3300031595 Ga0265313_10320954 Ga0265313_103209542 87
736 3300031665 Ga0316575_10078991 Ga0316575_100789911 87
737 3300031665 Ga0316575_10401431 Ga0316575_104014312 87
738 3300031665 Ga0316575_10485878 Ga0316575_104858782 87
739 3300031711 Ga0265314_10040448 Ga0265314_100404483 87
740 3300031711 Ga0265314_10459996 Ga0265314_104599961 87
741 3300031712 Ga0265342_10088384 Ga0265342_100883843 87
742 3300031712 Ga0265342_10092487 Ga0265342_100924873 87
743 3300031824 Ga0307413_11908229 Ga0307413_119082292 87
744 3300031995 Ga0307409_101253998 Ga0307409_1012539982 87
745 3300032002 Ga0307416_103338916 Ga0307416_1033389162 87
746 3300032133 Ga0316583_10005022 Ga0316583_100050223 87
747 3300032133 Ga0316583_10101660 Ga0316583_101016602 87
748 3300034816 Ga0373930_0001440 Ga0373930_0001440_2205_2468 87
749 3300034816 Ga0373930_0026002 Ga0373930_0026002_883_1146 87
750 3300034818 Ga0373950_0007742 Ga0373950_0007742_69_332 87
751 3300034818 Ga0373950_0051411 Ga0373950_0051411_296_559 87
752 3300034820 Ga0373959_0034325 Ga0373959_0034325_120_383 87
753 3300034820 Ga0373959_0089070 Ga0373959_0089070_323_586 87
754 3300034957 Ga0373938_0006145 Ga0373938_0006145_1118_1381 87
755 3300034957 Ga0373938_0016299 Ga0373938_0016299_16_279 87
756 3300035083 Ga0373926_0012934 Ga0373926_0012934_1509_1772 87
757 3300035083 Ga0373926_0026591 Ga0373926_0026591_46_309 87
758 3300035083 Ga0373926_0086034 Ga0373926_0086034_779_1042 87
759 3300035084 Ga0373928_0000779 Ga0373928_0000779_4616_4879 87
760 3300035085 Ga0373929_0094396 Ga0373929_0094396_184_447 87
761 3300035085 Ga0373929_0177484 Ga0373929_0177484_306_569 87
762 3300035086 Ga0373934_0007860 Ga0373934_0007860_2845_3108 87
763 3300035086 Ga0373934_0089028 Ga0373934_0089028_688_951 87
764 3300035089 Ga0373944_0000648 Ga0373944_0000648_2478_2741 87
765 3300035089 Ga0373944_0006736 Ga0373944_0006736_1638_1901 87
766 3300035089 Ga0373944_0007628 Ga0373944_0007628_808_1071 87
767 3300035090 Ga0373949_0001783 Ga0373949_0001783_2515_2778 87
768 3300035090 Ga0373949_0030756 Ga0373949_0030756_513_776 87
769 3300035091 Ga0373951_0024865 Ga0373951_0024865_1061_1324 87
770 3300035091 Ga0373951_0052435 Ga0373951_0052435_615_878 87
771 3300035092 Ga0373952_0014213 Ga0373952_0014213_969_1232 87
772 3300035092 Ga0373952_0238562 Ga0373952_0238562_24_287 87
773 3300035111 Ga0373923_0000903 Ga0373923_0000903_2402_2665 87
774 3300035112 Ga0373932_0007032 Ga0373932_0007032_1755_2018 87
775 3300035113 Ga0373936_0025442 Ga0373936_0025442_863_1126 87
776 3300035113 Ga0373936_0040602 Ga0373936_0040602_1469_1732 87
777 3300035114 Ga0373939_0005507 Ga0373939_0005507_1164_1427 87
778 3300035114 Ga0373939_0014215 Ga0373939_0014215_529_792 87
779 3300035114 Ga0373939_0060939 Ga0373939_0060939_366_662 87
780 3300035114 Ga0373939_0183290 Ga0373939_0183290_14_277 87
781 3300035115 Ga0373941_0007122 Ga0373941_0007122_332_595 87
782 3300035115 Ga0373941_0080731 Ga0373941_0080731_70_336 87
783 3300035116 Ga0373945_0000024 Ga0373945_0000024_17137_17400 87
784 3300035116 Ga0373945_0005743 Ga0373945_0005743_1252_1515 87
785 3300035116 Ga0373945_0009935 Ga0373945_0009935_402_665 87
786 3300035116 Ga0373945_0020687 Ga0373945_0020687_1376_1639 87
787 3300035117 Ga0373953_0065822 Ga0373953_0065822_916_1179 87
788 3300035117 Ga0373953_0066423 Ga0373953_0066423_98_361 87
789 3300035117 Ga0373953_0183570 Ga0373953_0183570_459_722 87
790 3300035118 Ga0373954_0047403 Ga0373954_0047403_145_408 87
791 3300035118 Ga0373954_0091021 Ga0373954_0091021_1035_1298 87
792 3300035118 Ga0373954_0119964 Ga0373954_0119964_380_643 87
793 3300035118 Ga0373954_0344467 Ga0373954_0344467_408_671 87
794 3300035119 Ga0373956_0009220 Ga0373956_0009220_1485_1748 87
795 3300035120 Ga0373957_0031324 Ga0373957_0031324_1314_1577 87
796 3300035120 Ga0373957_0032882 Ga0373957_0032882_859_1122 87
797 3300035120 Ga0373957_0045943 Ga0373957_0045943_232_495 87
798 3300035121 Ga0373960_0008365 Ga0373960_0008365_1025_1288 87
799 3300035170 Ga0373943_0016457 Ga0373943_0016457_1038_1301 87
800 3300035170 Ga0373943_0027886 Ga0373943_0027886_1417_1680 87
801 3300035170 Ga0373943_0153384 Ga0373943_0153384_962_1225 87
802 3300035171 Ga0373946_0001675 Ga0373946_0001675_1166_1429 87
803 3300035171 Ga0373946_0003685 Ga0373946_0003685_1144_1407 87
804 3300035171 Ga0373946_0084970 Ga0373946_0084970_240_503 87
805 3300035172 Ga0373955_0003013 Ga0373955_0003013_2949_3212 87
806 3300035172 Ga0373955_0004843 Ga0373955_0004843_3508_3771 87
807 3300035172 Ga0373955_0010601 Ga0373955_0010601_3972_4235 87
808 3300035172 Ga0373955_0049136 Ga0373955_0049136_1808_2071 87
809 3300035172 Ga0373955_0374692 Ga0373955_0374692_35_298 87
810 3300035207 Ga0373942_0002310 Ga0373942_0002310_200_463 87
811 3300035207 Ga0373942_0112143 Ga0373942_0112143_529_792 87
812 3300035241 Ga0373961_0031030 Ga0373961_0031030_358_621 87
813 3300035241 Ga0373961_0041626 Ga0373961_0041626_117_380 87
814 3300035241 Ga0373961_0362807 Ga0373961_0362807_203_499 87
815 3300035242 Ga0373962_0003472 Ga0373962_0003472_2929_3192 87
816 3300035242 Ga0373962_0044976 Ga0373962_0044976_979_1242 87
817 3300035242 Ga0373962_0055949 Ga0373962_0055949_874_1137 87
818 3300035410 Ga0373924_0001803 Ga0373924_0001803_498_761 87
819 3300035410 Ga0373924_0170261 Ga0373924_0170261_546_809 87
820 3300035410 Ga0373924_0237640 Ga0373924_0237640_29_292 87
821 3300035410 Ga0373924_0453123 Ga0373924_0453123_263_526 87
822 3300035691 Ga0373931_0008043 Ga0373931_0008043_3034_3297 87
823 3300035691 Ga0373931_0025914 Ga0373931_0025914_1897_2160 87
824 3300035691 Ga0373931_0145273 Ga0373931_0145273_583_846 87
825 3300035692 Ga0373935_0008653 Ga0373935_0008653_4778_5041 87
826 3300035692 Ga0373935_0009334 Ga0373935_0009334_1038_1301 87
827 3300035692 Ga0373935_0017120 Ga0373935_0017120_1696_1959 87
828 3300035692 Ga0373935_0315659 Ga0373935_0315659_600_863 87
829 3300035692 Ga0373935_0545746 Ga0373935_0545746_139_402 87
830 3300035695 Ga0373927_0003867 Ga0373927_0003867_2445_2708 87
831 3300035695 Ga0373927_0025567 Ga0373927_0025567_1672_1935 87
832 3300035695 Ga0373927_0047557 Ga0373927_0047557_1835_2098 87
833 3300035695 Ga0373927_1053640 Ga0373927_1053640_96_359 87
834 3300035724 Ga0373933_0011420 Ga0373933_0011420_885_1148 87
835 3300035724 Ga0373933_0132734 Ga0373933_0132734_891_1154 87
836 3300035724 Ga0373933_0579332 Ga0373933_0579332_399_662 87
837 3300035724 Ga0373933_0676686 Ga0373933_0676686_274_537 87
838 3300035725 Ga0373947_0009320 Ga0373947_0009320_5197_5460 87
839 3300035725 Ga0373947_0012283 Ga0373947_0012283_4525_4788 87
840 3300035725 Ga0373947_0020184 Ga0373947_0020184_2559_2822 87
841 3300035725 Ga0373947_0171729 Ga0373947_0171729_1065_1328 87
842 3300035725 Ga0373947_0611576 Ga0373947_0611576_341_604 87
843 3300036401 Ga0373937_0004490 Ga0373937_0004490_10319_10582 87
844 3300036401 Ga0373937_0013915 Ga0373937_0013915_3196_3459 87
845 3300036401 Ga0373937_0053957 Ga0373937_0053957_2705_2968 87
846 3300036401 Ga0373937_0074055 Ga0373937_0074055_70_333 87
847 3300036401 Ga0373937_0146662 Ga0373937_0146662_1351_1614 87
848 3300036401 Ga0373937_0240075 Ga0373937_0240075_663_926 87
849 3300036401 Ga0373937_0488169 Ga0373937_0488169_390_653 87
850 3300036401 Ga0373937_0946801 Ga0373937_0946801_348_611 87
851 3300037068 Ga0373925_0011259 Ga0373925_0011259_2479_2742 87
852 3300037068 Ga0373925_0017194 Ga0373925_0017194_954_1217 87
853 3300037068 Ga0373925_0080367 Ga0373925_0080367_363_626 87
854 3300037068 Ga0373925_0518917 Ga0373925_0518917_535_798 87
855 3300037068 Ga0373925_0550777 Ga0373925_0550777_392_655 87
856 3300037068 Ga0373925_0977997 Ga0373925_0977997_420_683 87
857 3300037068 Ga0373925_1643243 Ga0373925_1643243_201_464 87
858 3300037466 Ga0395898_0318698 Ga0395898_0318698_872_1135 87
859 3300037853 Ga0436364_0054321 Ga0436364_0054321_374_637 87
860 3300037853 Ga0436364_1490302 Ga0436364_1490302_463_726 87
861 3300038443 Ga0395901_0435780 Ga0395901_0435780_461_724 87
862 3300039437 Ga0436365_0630650 Ga0436365_0630650_248_511 87
863 3300039437 Ga0436365_0653482 Ga0436365_0653482_117_380 87
864 3300039437 Ga0436365_0842200 Ga0436365_0842200_2019_2282 87
865 3300039437 Ga0436365_0884037 Ga0436365_0884037_144_407 87
866 3300039437 Ga0436365_0925593 Ga0436365_0925593_202_465 87
867 3300039437 Ga0436365_1179558 Ga0436365_1179558_357_620 87
868 3300039437 Ga0436365_1841819 Ga0436365_1841819_1243_1506 87
869 3300039447 Ga0436361_0973070 Ga0436361_0973070_312_575 87
870 3300039450 Ga0436363_1533352 Ga0436363_1533352_1073_1336 87
871 3300041408 Ga0439453_0125858 Ga0439453_0125858_202_465 87
872 3300041459 Ga0451800_1492021 Ga0451800_1492021_630_893 87
873 3300041486 Ga0451807_0870982 Ga0451807_0870982_287_550 87
874 3300042000 Ga0439437_034738 Ga0439437_034738_104_367 87
875 3300042001 Ga0439441_025351 Ga0439441_025351_828_1091 87
876 3300042008 Ga0439450_052964 Ga0439450_052964_112_375 87
877 3300042016 Ga0439463_182751 Ga0439463_182751_232_495 87
878 3300042156 Ga0439446_0157950 Ga0439446_0157950_42_305 87
879 3300042439 Ga0439464_0082917 Ga0439464_0082917_567_830 87
880 3300042461 Ga0439460_0192335 Ga0439460_0192335_416_679 87
881 3300044694 Ga0466963_0193222 Ga0466963_0193222_124_387 87
882 3300045976 Ga0466967_0033052 Ga0466967_0033052_2126_2389 87
883 3300045976 Ga0466967_2158738 Ga0466967_2158738_126_389 87
884 3300046452 Ga0495617_047776 Ga0495617_047776_80_343 87
885 3300046453 Ga0495627_071409 Ga0495627_071409_41_304 87
886 3300046454 Ga0495592_0016847 Ga0495592_0016847_5153_5416 87
887 3300046454 Ga0495592_0028202 Ga0495592_0028202_3860_4123 87
888 3300046455 Ga0495603_0024080 Ga0495603_0024080_1814_2077 87
889 3300046455 Ga0495603_0042104 Ga0495603_0042104_1001_1264 87
890 3300046455 Ga0495603_0059379 Ga0495603_0059379_975_1238 87
891 3300046458 Ga0495591_018137 Ga0495591_018137_1454_1717 87
892 3300046459 Ga0495629_0001465 Ga0495629_0001465_14085_14348 87
893 3300046459 Ga0495629_0031322 Ga0495629_0031322_1141_1404 87
894 3300046459 Ga0495629_0285196 Ga0495629_0285196_473_736 87
895 3300046461 Ga0495641_0006019 Ga0495641_0006019_957_1220 87
896 3300046461 Ga0495641_0010900 Ga0495641_0010900_1680_1943 87
897 3300046461 Ga0495641_0086781 Ga0495641_0086781_166_429 87
898 3300046462 Ga0495651_0002165 Ga0495651_0002165_12714_12977 87
899 3300046462 Ga0495651_0050457 Ga0495651_0050457_928_1191 87
900 3300046462 Ga0495651_0137084 Ga0495651_0137084_837_1100 87
901 3300046462 Ga0495651_0188281 Ga0495651_0188281_605_868 87
902 3300046462 Ga0495651_0661335 Ga0495651_0661335_357_620 87
903 3300046463 Ga0495653_0018668 Ga0495653_0018668_5229_5492 87
904 3300046463 Ga0495653_0327263 Ga0495653_0327263_551_814 87
905 3300046463 Ga0495653_0383617 Ga0495653_0383617_581_844 87
906 3300046463 Ga0495653_0443862 Ga0495653_0443862_36_299 87
907 3300046463 Ga0495653_0517306 Ga0495653_0517306_248_511 87
908 3300046472 Ga0495580_0005009 Ga0495580_0005009_4014_4277 87
909 3300046472 Ga0495580_0125642 Ga0495580_0125642_1318_1581 87
910 3300046472 Ga0495580_0473017 Ga0495580_0473017_92_355 87
911 3300046473 Ga0495582_0000570 Ga0495582_0000570_9580_9843 87
912 3300046473 Ga0495582_0004754 Ga0495582_0004754_602_865 87
913 3300046473 Ga0495582_0038169 Ga0495582_0038169_560_823 87
914 3300046473 Ga0495582_0170849 Ga0495582_0170849_509_772 87
915 3300046473 Ga0495582_0461088 Ga0495582_0461088_129_392 87
916 3300046473 Ga0495582_0498982 Ga0495582_0498982_203_466 87
917 3300046474 Ga0495605_0048845 Ga0495605_0048845_987_1250 87
918 3300046475 Ga0495639_0022702 Ga0495639_0022702_1222_1485 87
919 3300046476 Ga0495662_0002431 Ga0495662_0002431_4525_4788 87
920 3300046476 Ga0495662_0042738 Ga0495662_0042738_1905_2168 87
921 3300046476 Ga0495662_0520017 Ga0495662_0520017_129_392 87
922 3300046477 Ga0495664_0000563 Ga0495664_0000563_12704_12967 87
923 3300046477 Ga0495664_0547996 Ga0495664_0547996_210_473 87
924 3300046477 Ga0495664_0605882 Ga0495664_0605882_77_340 87
925 3300046491 Ga0495584_0045363 Ga0495584_0045363_1756_2019 87
926 3300046491 Ga0495584_0164348 Ga0495584_0164348_92_355 87
927 3300046492 Ga0495585_0002912 Ga0495585_0002912_9071_9334 87
928 3300046492 Ga0495585_0015407 Ga0495585_0015407_2190_2453 87
929 3300046499 Ga0495594_0003570 Ga0495594_0003570_6296_6559 87
930 3300046499 Ga0495594_0074658 Ga0495594_0074658_1445_1708 87
931 3300046499 Ga0495594_0311049 Ga0495594_0311049_14_277 87
932 3300046500 Ga0495596_0258994 Ga0495596_0258994_110_373 87
933 3300046501 Ga0495607_0010398 Ga0495607_0010398_4773_5036 87
934 3300046506 Ga0495583_0083008 Ga0495583_0083008_272_535 87
935 3300046511 Ga0495608_0015292 Ga0495608_0015292_1645_1908 87
936 3300046511 Ga0495608_0058752 Ga0495608_0058752_1868_2131 87
937 3300046511 Ga0495608_0264149 Ga0495608_0264149_353_616 87
938 3300046511 Ga0495608_0845019 Ga0495608_0845019_67_330 87
939 3300046513 Ga0495616_0069100 Ga0495616_0069100_992_1255 87
940 3300046513 Ga0495616_0141795 Ga0495616_0141795_263_526 87
941 3300046514 Ga0495618_0088636 Ga0495618_0088636_551_814 87
942 3300046514 Ga0495618_0288003 Ga0495618_0288003_749_1012 87
943 3300046514 Ga0495618_0344270 Ga0495618_0344270_403_666 87
944 3300046515 Ga0495620_0412356 Ga0495620_0412356_72_335 87
945 3300046516 Ga0495628_0011495 Ga0495628_0011495_741_1004 87
946 3300046516 Ga0495628_0197535 Ga0495628_0197535_158_421 87
947 3300046517 Ga0495630_0017154 Ga0495630_0017154_3200_3463 87
948 3300046517 Ga0495630_0138809 Ga0495630_0138809_1248_1511 87
949 3300046517 Ga0495630_0305316 Ga0495630_0305316_816_1079 87
950 3300046518 Ga0495631_0102226 Ga0495631_0102226_652_915 87
951 3300046518 Ga0495631_0213349 Ga0495631_0213349_12_275 87
952 3300046520 Ga0495637_0046164 Ga0495637_0046164_1235_1498 87
953 3300046522 Ga0495643_0156009 Ga0495643_0156009_157_420 87
954 3300046523 Ga0495644_0003284 Ga0495644_0003284_3104_3367 87
955 3300046523 Ga0495644_0006910 Ga0495644_0006910_1105_1368 87
956 3300046523 Ga0495644_0077657 Ga0495644_0077657_731_994 87
957 3300046525 Ga0495663_0005215 Ga0495663_0005215_480_743 87
958 3300046525 Ga0495663_0056811 Ga0495663_0056811_943_1206 87
959 3300046526 Ga0495666_0010760 Ga0495666_0010760_2569_2832 87
960 3300046526 Ga0495666_0016580 Ga0495666_0016580_981_1244 87
961 3300046528 Ga0495642_0176577 Ga0495642_0176577_622_885 87
962 3300046529 Ga0495652_0046062 Ga0495652_0046062_1248_1511 87
963 3300046529 Ga0495652_0246050 Ga0495652_0246050_337_600 87
964 3300046529 Ga0495652_0265955 Ga0495652_0265955_706_969 87
965 3300046529 Ga0495652_0266252 Ga0495652_0266252_953_1216 87
966 3300046531 Ga0495665_0038357 Ga0495665_0038357_345_608 87
967 3300046533 Ga0495640_0032280 Ga0495640_0032280_356_619 87
968 3300046533 Ga0495640_0061356 Ga0495640_0061356_1627_1890 87
969 3300046533 Ga0495640_0194843 Ga0495640_0194843_261_524 87
970 3300046533 Ga0495640_0489042 Ga0495640_0489042_78_341 87
971 3300046535 Ga0495586_0029902 Ga0495586_0029902_1946_2209 87
972 3300046536 Ga0495587_0142855 Ga0495587_0142855_337_600 87
973 3300046536 Ga0495587_0493686 Ga0495587_0493686_92_355 87
974 3300046537 Ga0495598_0014447 Ga0495598_0014447_1191_1454 87
975 3300046537 Ga0495598_0015165 Ga0495598_0015165_239_502 87
976 3300046537 Ga0495598_0064546 Ga0495598_0064546_686_949 87
977 3300046538 Ga0495609_0041279 Ga0495609_0041279_821_1084 87
978 3300046538 Ga0495609_0239370 Ga0495609_0239370_225_488 87
979 3300046538 Ga0495609_0329814 Ga0495609_0329814_94_357 87
980 3300046539 Ga0495621_0049037 Ga0495621_0049037_158_421 87
981 3300046539 Ga0495621_0151086 Ga0495621_0151086_166_429 87
982 3300046543 Ga0495645_0081407 Ga0495645_0081407_1901_2164 87
983 3300046543 Ga0495645_0268481 Ga0495645_0268481_809_1072 87
984 3300046543 Ga0495645_0962271 Ga0495645_0962271_79_345 87
985 3300046557 Ga0495622_0000406 Ga0495622_0000406_23493_23756 87
986 3300046557 Ga0495622_0052146 Ga0495622_0052146_1356_1619 87
987 3300046558 Ga0495633_0005373 Ga0495633_0005373_2182_2445 87
988 3300046559 Ga0495667_0017377 Ga0495667_0017377_2361_2624 87
989 3300046559 Ga0495667_0020065 Ga0495667_0020065_3344_3607 87
990 3300046559 Ga0495667_0137156 Ga0495667_0137156_261_524 87
991 3300046559 Ga0495667_0172601 Ga0495667_0172601_912_1175 87
992 3300046559 Ga0495667_1003053 Ga0495667_1003053_89_352 87
993 3300046615 Ga0495656_0000554 Ga0495656_0000554_2269_2532 87
994 3300046615 Ga0495656_0108803 Ga0495656_0108803_991_1254 87
995 3300046615 Ga0495656_0408502 Ga0495656_0408502_302_565 87
996 3300046616 Ga0495668_0201057 Ga0495668_0201057_435_698 87
997 3300046642 Ga0495634_0154428 Ga0495634_0154428_120_383 87
998 3300046642 Ga0495634_0410072 Ga0495634_0410072_434_697 87
999 3300046642 Ga0495634_0410270 Ga0495634_0410270_159_422 87
1000 3300046642 Ga0495634_0832807 Ga0495634_0832807_184_447 87
1001 3300046648 Ga0495611_0197505 Ga0495611_0197505_249_512 87
1002 3300046663 Ga0495635_0016723 Ga0495635_0016723_4239_4502 87
1003 3300046663 Ga0495635_0024301 Ga0495635_0024301_3411_3674 87
1004 3300046663 Ga0495635_0304205 Ga0495635_0304205_297_560 87
1005 3300046663 Ga0495635_0621395 Ga0495635_0621395_335_598 87
1006 3300046663 Ga0495635_0752914 Ga0495635_0752914_74_337 87
1007 3300046663 Ga0495635_1011378 Ga0495635_1011378_75_338 87
1008 3300046664 Ga0495659_0005523 Ga0495659_0005523_925_1188 87
1009 3300046664 Ga0495659_0093023 Ga0495659_0093023_131_394 87
1010 3300046665 Ga0495661_0076068 Ga0495661_0076068_1357_1620 87
1011 3300046665 Ga0495661_0122326 Ga0495661_0122326_881_1144 87
1012 3300046665 Ga0495661_0170850 Ga0495661_0170850_46_309 87
1013 3300046674 Ga0495588_0029913 Ga0495588_0029913_851_1114 87
1014 3300046674 Ga0495588_0088794 Ga0495588_0088794_145_408 87
1015 3300046675 Ga0495657_0008729 Ga0495657_0008729_6045_6308 87
1016 3300046675 Ga0495657_0196933 Ga0495657_0196933_107_370 87
1017 3300046675 Ga0495657_0589601 Ga0495657_0589601_135_398 87
1018 3300046678 Ga0495599_0020724 Ga0495599_0020724_3229_3492 87
1019 3300046679 Ga0495623_0688389 Ga0495623_0688389_94_357 87
1020 3300046680 Ga0495646_0042474 Ga0495646_0042474_1946_2209 87
1021 3300046680 Ga0495646_0144375 Ga0495646_0144375_728_991 87
1022 3300046680 Ga0495646_0307843 Ga0495646_0307843_331_594 87
1023 3300046681 Ga0495647_0001486 Ga0495647_0001486_5546_5809 87
1024 3300046681 Ga0495647_0031744 Ga0495647_0031744_1603_1866 87
1025 3300046681 Ga0495647_0097708 Ga0495647_0097708_719_982 87
1026 3300046683 Ga0495658_0000543 Ga0495658_0000543_20100_20363 87
1027 3300046683 Ga0495658_0002466 Ga0495658_0002466_1661_1924 87
1028 3300046683 Ga0495658_0028883 Ga0495658_0028883_1086_1349 87
1029 3300046683 Ga0495658_0053388 Ga0495658_0053388_1634_1897 87
1030 3300046683 Ga0495658_0239013 Ga0495658_0239013_369_632 87
1031 3300046683 Ga0495658_1118969 Ga0495658_1118969_143_406 87
1032 3300046684 Ga0495669_0020229 Ga0495669_0020229_1825_2088 87
1033 3300046684 Ga0495669_0085587 Ga0495669_0085587_497_760 87
1034 3300046689 Ga0495613_0034941 Ga0495613_0034941_2012_2275 87
1035 3300046689 Ga0495613_0153601 Ga0495613_0153601_773_1036 87
1036 3300046690 Ga0495624_0018605 Ga0495624_0018605_1027_1290 87
1037 3300046690 Ga0495624_0027306 Ga0495624_0027306_2873_3136 87
1038 3300046691 Ga0495670_0008274 Ga0495670_0008274_3727_3990 87
1039 3300046691 Ga0495670_0030996 Ga0495670_0030996_2228_2491 87
1040 3300046691 Ga0495670_0793193 Ga0495670_0793193_36_299 87
1041 3300046692 Ga0495671_0123171 Ga0495671_0123171_168_431 87
1042 3300046694 Ga0495649_0040457 Ga0495649_0040457_2243_2506 87
1043 3300046794 Ga0495589_0186331 Ga0495589_0186331_646_909 87
1044 3300046794 Ga0495589_0237976 Ga0495589_0237976_58_321 87
1045 3300046809 Ga0495600_0006388 Ga0495600_0006388_3746_4009 87
1046 3300046809 Ga0495600_0156242 Ga0495600_0156242_44_307 87
1047 3300047315 Ga0495581_0003432 Ga0495581_0003432_930_1193 87
1048 3300047315 Ga0495581_0010955 Ga0495581_0010955_2296_2559 87
1049 3300047315 Ga0495581_0019117 Ga0495581_0019117_960_1223 87
1050 3300047315 Ga0495581_0626326 Ga0495581_0626326_278_541 87
1051 3300047317 Ga0495604_0013474 Ga0495604_0013474_1128_1391 87
1052 3300047317 Ga0495604_0064795 Ga0495604_0064795_77_340 87
1053 3300047317 Ga0495604_0261884 Ga0495604_0261884_672_935 87
1054 3300047317 Ga0495604_0572959 Ga0495604_0572959_238_501 87
1055 3300047318 Ga0495636_0176187 Ga0495636_0176187_273_536 87
1056 3300047319 Ga0495674_0026343 Ga0495674_0026343_4910_5173 87
1057 3300047319 Ga0495674_0177497 Ga0495674_0177497_783_1046 87
1058 3300047319 Ga0495674_0326614 Ga0495674_0326614_792_1055 87
1059 3300047319 Ga0495674_0626821 Ga0495674_0626821_475_738 87
1060 3300047319 Ga0495674_1253152 Ga0495674_1253152_220_483 87
1061 3300047320 Ga0495672_0101953 Ga0495672_0101953_1014_1283 87
1062 3300047320 Ga0495672_0106572 Ga0495672_0106572_854_1117 87
1063 3300047320 Ga0495672_0179645 Ga0495672_0179645_18_284 87
1064 3300047321 Ga0495676_0013899 Ga0495676_0013899_5008_5271 87
1065 3300047321 Ga0495676_0035160 Ga0495676_0035160_1829_2092 87
1066 3300047321 Ga0495676_0125529 Ga0495676_0125529_1338_1601 87
1067 3300047321 Ga0495676_0233848 Ga0495676_0233848_441_704 87
1068 3300047322 Ga0495680_0006933 Ga0495680_0006933_1036_1299 87
1069 3300047322 Ga0495680_0012328 Ga0495680_0012328_3655_3918 87
1070 3300047322 Ga0495680_0061381 Ga0495680_0061381_392_655 87
1071 3300047322 Ga0495680_0330036 Ga0495680_0330036_89_352 87
1072 3300047323 Ga0495683_0249865 Ga0495683_0249865_14_277 87
1073 3300047323 Ga0495683_0286823 Ga0495683_0286823_81_344 87
1074 3300047444 Ga0495675_0020224 Ga0495675_0020224_144_407 87
1075 3300047444 Ga0495675_0253145 Ga0495675_0253145_599_862 87
1076 3300047446 Ga0495679_027076 Ga0495679_027076_843_1106 87
1077 3300047471 Ga0495684_0055089 Ga0495684_0055089_1521_1784 87
1078 3300047471 Ga0495684_0058031 Ga0495684_0058031_2062_2325 87
1079 3300047471 Ga0495684_0193134 Ga0495684_0193134_53_316 87
1080 3300047471 Ga0495684_0886100 Ga0495684_0886100_136_399 87
1081 3300047673 Ga0495593_0003620 Ga0495593_0003620_1514_1777 87
1082 3300047673 Ga0495593_0333250 Ga0495593_0333250_124_387 87
1083 3300048088 Ga0495602_0070224 Ga0495602_0070224_1794_2057 87
1084 3300048088 Ga0495602_0412012 Ga0495602_0412012_154_417 87
1085 3300048088 Ga0495602_0462834 Ga0495602_0462834_411_674 87
1086 3300048089 Ga0495614_0019302 Ga0495614_0019302_273_536 87
1087 3300048903 Ga0496100_0003363 Ga0496100_0003363_3904_4167 87
1088 3300048903 Ga0496100_0015421 Ga0496100_0015421_4182_4445 87
1089 3300048903 Ga0496100_0016403 Ga0496100_0016403_901_1197 87
1090 3300048903 Ga0496100_0031260 Ga0496100_0031260_580_843 87
1091 3300048903 Ga0496100_0116497 Ga0496100_0116497_793_1056 87
1092 3300048903 Ga0496100_0194514 Ga0496100_0194514_403_666 87
1093 3300048903 Ga0496100_0389634 Ga0496100_0389634_79_342 87
1094 3300048904 Ga0496101_0001983 Ga0496101_0001983_4422_4685 87
1095 3300048904 Ga0496101_0002395 Ga0496101_0002395_2494_2757 87
1096 3300048904 Ga0496101_0029082 Ga0496101_0029082_3151_3414 87
1097 3300048904 Ga0496101_0127119 Ga0496101_0127119_245_508 87
1098 3300048904 Ga0496101_0182014 Ga0496101_0182014_1114_1377 87
1099 3300048904 Ga0496101_0242662 Ga0496101_0242662_427_690 87
1100 3300048904 Ga0496101_0388549 Ga0496101_0388549_751_1014 87
1101 3300048904 Ga0496101_0431248 Ga0496101_0431248_242_505 87
1102 3300048904 Ga0496101_1179423 Ga0496101_1179423_326_589 87
1103 3300048905 Ga0496102_0002614 Ga0496102_0002614_2658_2921 87
1104 3300048905 Ga0496102_0002793 Ga0496102_0002793_5482_5745 87
1105 3300048905 Ga0496102_0016941 Ga0496102_0016941_2875_3171 87
1106 3300048905 Ga0496102_0028300 Ga0496102_0028300_1412_1675 87
1107 3300048905 Ga0496102_0031173 Ga0496102_0031173_683_946 87
1108 3300048905 Ga0496102_0220102 Ga0496102_0220102_620_883 87
1109 3300048905 Ga0496102_0222643 Ga0496102_0222643_1306_1569 87
1110 3300048905 Ga0496102_1061322 Ga0496102_1061322_46_309 87
1111 3300048906 Ga0496103_0002369 Ga0496103_0002369_4410_4673 87
1112 3300048906 Ga0496103_0020821 Ga0496103_0020821_1904_2200 87
1113 3300048906 Ga0496103_0021619 Ga0496103_0021619_3407_3670 87
1114 3300048906 Ga0496103_0058182 Ga0496103_0058182_1940_2203 87
1115 3300048906 Ga0496103_0183089 Ga0496103_0183089_212_475 87
1116 3300048906 Ga0496103_0207186 Ga0496103_0207186_495_758 87
1117 3300048906 Ga0496103_0716510 Ga0496103_0716510_19_282 87
1118 3300048907 Ga0496104_0003070 Ga0496104_0003070_12835_13098 87
1119 3300048907 Ga0496104_0004660 Ga0496104_0004660_9582_9845 87
1120 3300048907 Ga0496104_0017458 Ga0496104_0017458_4793_5056 87
1121 3300048907 Ga0496104_0042670 Ga0496104_0042670_1303_1599 87
1122 3300048907 Ga0496104_0053307 Ga0496104_0053307_2159_2422 87
1123 3300048907 Ga0496104_0073885 Ga0496104_0073885_425_688 87
1124 3300048907 Ga0496104_0137363 Ga0496104_0137363_1432_1695 87
1125 3300048907 Ga0496104_0146743 Ga0496104_0146743_1298_1561 87
1126 3300048908 Ga0496105_0003019 Ga0496105_0003019_5766_6029 87
1127 3300048908 Ga0496105_0007082 Ga0496105_0007082_585_881 87
1128 3300048908 Ga0496105_0016356 Ga0496105_0016356_2865_3128 87
1129 3300048908 Ga0496105_0034082 Ga0496105_0034082_2040_2303 87
1130 3300048908 Ga0496105_0173296 Ga0496105_0173296_203_466 87
1131 3300048908 Ga0496105_0384483 Ga0496105_0384483_761_1024 87
1132 3300048908 Ga0496105_0715503 Ga0496105_0715503_55_318 87
1133 3300048908 Ga0496105_0784515 Ga0496105_0784515_452_715 87
1134 3300048908 Ga0496105_1042679 Ga0496105_1042679_99_362 87
1135 3300048909 Ga0496106_0001912 Ga0496106_0001912_11843_12106 87
1136 3300048909 Ga0496106_0007123 Ga0496106_0007123_4339_4602 87
1137 3300048909 Ga0496106_0010646 Ga0496106_0010646_2594_2857 87
1138 3300048909 Ga0496106_0033866 Ga0496106_0033866_1418_1714 87
1139 3300048909 Ga0496106_0049304 Ga0496106_0049304_1057_1320 87
1140 3300048909 Ga0496106_0102418 Ga0496106_0102418_1932_2195 87
1141 3300048909 Ga0496106_0210567 Ga0496106_0210567_427_690 87
1142 3300048909 Ga0496106_0359577 Ga0496106_0359577_427_690 87
1143 3300048909 Ga0496106_1222185 Ga0496106_1222185_83_346 87
1144 3300048910 Ga0496107_0000684 Ga0496107_0000684_8590_8853 87
1145 3300048910 Ga0496107_0005855 Ga0496107_0005855_6006_6269 87
1146 3300048910 Ga0496107_0006823 Ga0496107_0006823_7152_7415 87
1147 3300048910 Ga0496107_0019014 Ga0496107_0019014_80_343 87
1148 3300048910 Ga0496107_0039820 Ga0496107_0039820_1071_1334 87
1149 3300048910 Ga0496107_0051559 Ga0496107_0051559_940_1236 87
1150 3300048910 Ga0496107_0365581 Ga0496107_0365581_311_574 87
1151 3300048910 Ga0496107_0820707 Ga0496107_0820707_351_614 87
1152 3300048910 Ga0496107_1039177 Ga0496107_1039177_191_454 87
1153 3300048911 Ga0496108_0000951 Ga0496108_0000951_282_578 87
1154 3300048911 Ga0496108_0016761 Ga0496108_0016761_825_1088 87
1155 3300048911 Ga0496108_0017326 Ga0496108_0017326_1235_1498 87
1156 3300048911 Ga0496108_0029894 Ga0496108_0029894_1545_1808 87
1157 3300048911 Ga0496108_0052548 Ga0496108_0052548_1123_1386 87
1158 3300048911 Ga0496108_0426480 Ga0496108_0426480_546_809 87
1159 3300048911 Ga0496108_0448572 Ga0496108_0448572_133_396 87
1160 3300048911 Ga0496108_0481997 Ga0496108_0481997_271_534 87
1161 3300048911 Ga0496108_0725892 Ga0496108_0725892_580_843 87
1162 3300048911 Ga0496108_0850189 Ga0496108_0850189_147_410 87
1163 3300048911 Ga0496108_1623085 Ga0496108_1623085_63_326 87
1164 3300048912 Ga0496109_0004879 Ga0496109_0004879_5155_5418 87
1165 3300048912 Ga0496109_0010573 Ga0496109_0010573_3193_3456 87
1166 3300048912 Ga0496109_0017589 Ga0496109_0017589_348_611 87
1167 3300048912 Ga0496109_0021372 Ga0496109_0021372_1980_2276 87
1168 3300048912 Ga0496109_0037905 Ga0496109_0037905_2792_3055 87
1169 3300048912 Ga0496109_0277762 Ga0496109_0277762_271_534 87
1170 3300048912 Ga0496109_0469346 Ga0496109_0469346_500_763 87
1171 3300048912 Ga0496109_0547916 Ga0496109_0547916_425_688 87
1172 3300048912 Ga0496109_0572689 Ga0496109_0572689_571_834 87
1173 3300048912 Ga0496109_1081041 Ga0496109_1081041_41_304 87
1174 3300048913 Ga0496110_0010330 Ga0496110_0010330_3480_3743 87
1175 3300048913 Ga0496110_0025021 Ga0496110_0025021_68_364 87
1176 3300048913 Ga0496110_0033011 Ga0496110_0033011_1691_1954 87
1177 3300048913 Ga0496110_0148396 Ga0496110_0148396_705_968 87
1178 3300048913 Ga0496110_0195249 Ga0496110_0195249_481_744 87
1179 3300048913 Ga0496110_0235839 Ga0496110_0235839_1222_1485 87
1180 3300048913 Ga0496110_0413577 Ga0496110_0413577_347_610 87
1181 3300048913 Ga0496110_0766572 Ga0496110_0766572_179_442 87
1182 3300048914 Ga0496111_0002467 Ga0496111_0002467_6814_7110 87
1183 3300048914 Ga0496111_0015671 Ga0496111_0015671_1814_2077 87
1184 3300048914 Ga0496111_0028559 Ga0496111_0028559_2466_2729 87
1185 3300048914 Ga0496111_0033708 Ga0496111_0033708_3087_3350 87
1186 3300048914 Ga0496111_0040561 Ga0496111_0040561_1626_1889 87
1187 3300048914 Ga0496111_0341480 Ga0496111_0341480_373_636 87
1188 3300048915 Ga0496112_0007378 Ga0496112_0007378_6047_6310 87
1189 3300048915 Ga0496112_0023680 Ga0496112_0023680_4733_5029 87
1190 3300048915 Ga0496112_0057371 Ga0496112_0057371_2068_2331 87
1191 3300048915 Ga0496112_0060168 Ga0496112_0060168_390_653 87
1192 3300048915 Ga0496112_0063132 Ga0496112_0063132_2811_3074 87
1193 3300048915 Ga0496112_0189422 Ga0496112_0189422_1285_1548 87
1194 3300048915 Ga0496112_0612371 Ga0496112_0612371_398_661 87
1195 3300048915 Ga0496112_0615256 Ga0496112_0615256_210_473 87
1196 3300048915 Ga0496112_0643787 Ga0496112_0643787_43_306 87
1197 3300048916 Ga0496113_0000043 Ga0496113_0000043_941_1237 87
1198 3300048916 Ga0496113_0004559 Ga0496113_0004559_4728_4991 87
1199 3300048916 Ga0496113_0019261 Ga0496113_0019261_3082_3345 87
1200 3300048916 Ga0496113_0022484 Ga0496113_0022484_2962_3225 87
1201 3300048916 Ga0496113_0023083 Ga0496113_0023083_1558_1821 87
1202 3300048916 Ga0496113_0070377 Ga0496113_0070377_1878_2141 87
1203 3300048916 Ga0496113_0105396 Ga0496113_0105396_459_722 87
1204 3300048917 Ga0496114_0007468 Ga0496114_0007468_7554_7817 87
1205 3300048917 Ga0496114_0036470 Ga0496114_0036470_3423_3686 87
1206 3300048917 Ga0496114_0045150 Ga0496114_0045150_3169_3432 87
1207 3300048917 Ga0496114_0080971 Ga0496114_0080971_452_715 87
1208 3300048917 Ga0496114_0221242 Ga0496114_0221242_1127_1390 87
1209 3300048917 Ga0496114_0375589 Ga0496114_0375589_782_1045 87
1210 3300048918 Ga0496115_0002647 Ga0496115_0002647_4853_5116 87
1211 3300048918 Ga0496115_0003701 Ga0496115_0003701_3588_3851 87
1212 3300048918 Ga0496115_0008385 Ga0496115_0008385_2766_3029 87
1213 3300048918 Ga0496115_0030611 Ga0496115_0030611_1808_2104 87
1214 3300048918 Ga0496115_0090923 Ga0496115_0090923_284_547 87
1215 3300048918 Ga0496115_0097906 Ga0496115_0097906_1164_1427 87
1216 3300048918 Ga0496115_0132287 Ga0496115_0132287_980_1243 87
1217 3300048918 Ga0496115_0307845 Ga0496115_0307845_960_1223 87
1218 3300048918 Ga0496115_0798912 Ga0496115_0798912_143_406 87
1219 3300048922 Ga0496119_0320507 Ga0496119_0320507_37_300 87
1220 3300048924 Ga0496121_0280117 Ga0496121_0280117_114_377 87
1221 3300049568 Ga0501031_0104617 Ga0501031_0104617_551_814 87
1222 3300049568 Ga0501031_0248268 Ga0501031_0248268_182_445 87
1223 3300049568 Ga0501031_0466125 Ga0501031_0466125_416_679 87
1224 3300049569 Ga0501032_0078980 Ga0501032_0078980_1509_1772 87
1225 3300049569 Ga0501032_0285164 Ga0501032_0285164_35_298 87
1226 3300049569 Ga0501032_0310148 Ga0501032_0310148_694_957 87
1227 3300049570 Ga0501033_0037850 Ga0501033_0037850_352_615 87
1228 3300049570 Ga0501033_0061139 Ga0501033_0061139_1382_1645 87
1229 3300049570 Ga0501033_0305697 Ga0501033_0305697_236_499 87
1230 3300049570 Ga0501033_0815407 Ga0501033_0815407_105_368 87
1231 3300049570 Ga0501033_0864931 Ga0501033_0864931_215_478 87
1232 3300049571 Ga0501034_0011170 Ga0501034_0011170_717_980 87
1233 3300049571 Ga0501034_0114840 Ga0501034_0114840_2039_2302 87
1234 3300049571 Ga0501034_0126832 Ga0501034_0126832_1148_1411 87
1235 3300049571 Ga0501034_0166390 Ga0501034_0166390_1790_2053 87
1236 3300049571 Ga0501034_0265926 Ga0501034_0265926_765_1028 87
1237 3300049571 Ga0501034_0441180 Ga0501034_0441180_700_963 87
1238 3300049571 Ga0501034_0488249 Ga0501034_0488249_438_701 87
1239 3300049572 Ga0501036_0247682 Ga0501036_0247682_965_1228 87
1240 3300049572 Ga0501036_1129081 Ga0501036_1129081_112_375 87
1241 3300049572 Ga0501036_1546404 Ga0501036_1546404_199_462 87
1242 3300049572 Ga0501036_1582149 Ga0501036_1582149_184_447 87
1243 3300049572 Ga0501036_1737362 Ga0501036_1737362_121_384 87
1244 3300049572 Ga0501036_1741801 Ga0501036_1741801_221_484 87
1245 3300049573 Ga0501037_0083329 Ga0501037_0083329_1919_2182 87
1246 3300049573 Ga0501037_0117592 Ga0501037_0117592_172_435 87
1247 3300049573 Ga0501037_0701989 Ga0501037_0701989_332_595 87
1248 3300049574 Ga0501038_0037153 Ga0501038_0037153_1569_1832 87
1249 3300049574 Ga0501038_0106265 Ga0501038_0106265_1124_1387 87
1250 3300049574 Ga0501038_0196973 Ga0501038_0196973_720_983 87
1251 3300049574 Ga0501038_0671420 Ga0501038_0671420_307_570 87
1252 3300049574 Ga0501038_1077093 Ga0501038_1077093_275_538 87
1253 3300049575 Ga0501039_0119194 Ga0501039_0119194_177_440 87
1254 3300049575 Ga0501039_0665796 Ga0501039_0665796_204_467 87
1255 3300049577 Ga0501041_0970653 Ga0501041_0970653_160_423 87
1256 3300049579 Ga0501043_0354867 Ga0501043_0354867_739_1002 87
1257 3300049579 Ga0501043_1172341 Ga0501043_1172341_149_412 87
1258 3300049580 Ga0501046_0614014 Ga0501046_0614014_79_342 87
1259 3300049580 Ga0501046_0858666 Ga0501046_0858666_237_500 87
1260 3300049581 Ga0501047_0011566 Ga0501047_0011566_60_323 87
1261 3300049581 Ga0501047_0096320 Ga0501047_0096320_1545_1808 87
1262 3300049581 Ga0501047_0264236 Ga0501047_0264236_1228_1491 87
1263 3300049581 Ga0501047_0315037 Ga0501047_0315037_690_953 87
1264 3300049581 Ga0501047_0326096 Ga0501047_0326096_1089_1352 87
1265 3300049581 Ga0501047_0338253 Ga0501047_0338253_697_960 87
1266 3300049581 Ga0501047_0872598 Ga0501047_0872598_313_576 87
1267 3300049581 Ga0501047_1090625 Ga0501047_1090625_192_458 87
1268 3300049582 Ga0501048_0395343 Ga0501048_0395343_694_957 87
1269 3300049582 Ga0501048_0495679 Ga0501048_0495679_378_641 87
1270 3300049583 Ga0501067_0316199 Ga0501067_0316199_273_536 87
1271 3300049584 Ga0501068_0530139 Ga0501068_0530139_265_528 87
1272 3300049584 Ga0501068_1094629 Ga0501068_1094629_224_487 87
1273 3300049585 Ga0501069_0334441 Ga0501069_0334441_599_862 87
1274 3300049586 Ga0501070_0024998 Ga0501070_0024998_785_1048 87
1275 3300049586 Ga0501070_0199114 Ga0501070_0199114_806_1069 87
1276 3300049586 Ga0501070_0341850 Ga0501070_0341850_746_1009 87
1277 3300049586 Ga0501070_1119183 Ga0501070_1119183_58_321 87
1278 3300049587 Ga0501071_0022307 Ga0501071_0022307_906_1169 87
1279 3300049587 Ga0501071_0397018 Ga0501071_0397018_237_500 87
1280 3300049587 Ga0501071_0923688 Ga0501071_0923688_333_596 87
1281 3300049588 Ga0501072_0248999 Ga0501072_0248999_75_338 87
1282 3300049588 Ga0501072_0294764 Ga0501072_0294764_1006_1269 87
1283 3300049588 Ga0501072_0525835 Ga0501072_0525835_262_525 87
1284 3300049588 Ga0501072_1106201 Ga0501072_1106201_179_442 87
1285 3300049589 Ga0501073_0161294 Ga0501073_0161294_1170_1433 87
1286 3300049589 Ga0501073_0164878 Ga0501073_0164878_775_1038 87
1287 3300049589 Ga0501073_0682250 Ga0501073_0682250_334_597 87
1288 3300049589 Ga0501073_0851019 Ga0501073_0851019_174_437 87
1289 3300049590 Ga0501074_0058920 Ga0501074_0058920_1939_2202 87
1290 3300049590 Ga0501074_0174760 Ga0501074_0174760_1149_1412 87
1291 3300049590 Ga0501074_0826878 Ga0501074_0826878_174_437 87
1292 3300049591 Ga0501075_0197119 Ga0501075_0197119_944_1207 87
1293 3300049591 Ga0501075_0776258 Ga0501075_0776258_17_280 87
1294 3300049592 Ga0501076_0004238 Ga0501076_0004238_5551_5814 87
1295 3300049592 Ga0501076_0613872 Ga0501076_0613872_442_705 87
1296 3300049592 Ga0501076_0622134 Ga0501076_0622134_540_803 87
1297 3300049593 Ga0501077_0090161 Ga0501077_0090161_1196_1459 87
1298 3300049593 Ga0501077_0250185 Ga0501077_0250185_605_868 87
1299 3300049593 Ga0501077_1113334 Ga0501077_1113334_86_349 87
1300 3300049741 Ga0501079_0189607 Ga0501079_0189607_853_1116 87
1301 3300049742 Ga0501080_0155676 Ga0501080_0155676_1035_1298 87
1302 3300049742 Ga0501080_0181125 Ga0501080_0181125_1166_1429 87
1303 3300049742 Ga0501080_0218938 Ga0501080_0218938_247_510 87
1304 3300049742 Ga0501080_0298760 Ga0501080_0298760_1165_1428 87
1305 3300049743 Ga0501081_0116221 Ga0501081_0116221_1611_1874 87
1306 3300049743 Ga0501081_0462783 Ga0501081_0462783_502_765 87
1307 3300049744 Ga0501083_0014091 Ga0501083_0014091_1735_1998 87
1308 3300049744 Ga0501083_0102673 Ga0501083_0102673_1426_1689 87
1309 3300049744 Ga0501083_0396630 Ga0501083_0396630_521_784 87
1310 3300049744 Ga0501083_0571174 Ga0501083_0571174_72_335 87
1311 3300049822 Ga0501035_0025517 Ga0501035_0025517_1704_1967 87
1312 3300049822 Ga0501035_0250857 Ga0501035_0250857_322_585 87
1313 3300049822 Ga0501035_0459518 Ga0501035_0459518_90_353 87
1314 3300049823 Ga0501044_0036606 Ga0501044_0036606_1509_1772 87
1315 3300049823 Ga0501044_0119053 Ga0501044_0119053_1940_2203 87
1316 3300049823 Ga0501044_0248327 Ga0501044_0248327_700_963 87
1317 3300049823 Ga0501044_0762780 Ga0501044_0762780_294_557 87
1318 3300049823 Ga0501044_1364163 Ga0501044_1364163_28_291 87
1319 3300049823 Ga0501044_1532839 Ga0501044_1532839_133_396 87
1320 3300049824 Ga0501045_0445821 Ga0501045_0445821_398_661 87
1321 3300049824 Ga0501045_0720253 Ga0501045_0720253_278_541 87
1322 3300050489 nmdc:mga03683_259195_c1 nmdc:mga03683_259195_c1_145_408 87
1323 3300050489 nmdc:mga03683_357801_c1 nmdc:mga03683_357801_c1_366_629 87
1324 3300050490 nmdc:mga03n38_188377_c1 nmdc:mga03n38_188377_c1_304_567 87
1325 3300050490 nmdc:mga03n38_518282_c1 nmdc:mga03n38_518282_c1_375_638 87
1326 3300050492 nmdc:mga0yw44_10242_c2 nmdc:mga0yw44_10242_c2_3944_4207 87
1327 3300050492 nmdc:mga0yw44_1082862_c1 nmdc:mga0yw44_1082862_c1_219_482 87
1328 3300050492 nmdc:mga0yw44_303410_c1 nmdc:mga0yw44_303410_c1_675_938 87
1329 3300050492 nmdc:mga0yw44_56590_c1 nmdc:mga0yw44_56590_c1_41_304 87
1330 3300050492 nmdc:mga0yw44_813_c1 nmdc:mga0yw44_813_c1_6804_7067 87
1331 3300050493 nmdc:mga0k408_184574_c1 nmdc:mga0k408_184574_c1_532_795 87
1332 3300050494 nmdc:mga06z11_1002996_c1 nmdc:mga06z11_1002996_c1_100_363 87
1333 3300050494 nmdc:mga06z11_181820_c1 nmdc:mga06z11_181820_c1_558_821 87
1334 3300050494 nmdc:mga06z11_51514_c1 nmdc:mga06z11_51514_c1_847_1110 87
1335 3300050494 nmdc:mga06z11_923611_c1 nmdc:mga06z11_923611_c1_120_383 87
1336 3300050495 nmdc:mga04h51_27546_c1 nmdc:mga04h51_27546_c1_1425_1688 87
1337 3300050495 nmdc:mga04h51_481589_c1 nmdc:mga04h51_481589_c1_252_515 87
1338 3300050496 nmdc:mga07m45_139450_c1 nmdc:mga07m45_139450_c1_272_535 87
1339 3300050496 nmdc:mga07m45_61289_c1 nmdc:mga07m45_61289_c1_480_743 87
1340 3300050507 nmdc:mga05p37_23570_c1 nmdc:mga05p37_23570_c1_3912_4208 87
1341 3300050507 nmdc:mga05p37_300683_c1 nmdc:mga05p37_300683_c1_1532_1795 87
1342 3300050507 nmdc:mga05p37_604329_c1 nmdc:mga05p37_604329_c1_430_693 87
1343 3300050508 nmdc:mga09592_1341318_c1 nmdc:mga09592_1341318_c1_41_304 87
1344 3300050508 nmdc:mga09592_224426_c1 nmdc:mga09592_224426_c1_1264_1527 87
1345 3300050508 nmdc:mga09592_425938_c1 nmdc:mga09592_425938_c1_429_725 87
1346 3300050508 nmdc:mga09592_70139_c1 nmdc:mga09592_70139_c1_2646_2909 87
1347 3300050509 nmdc:mga0qj67_229704_c1 nmdc:mga0qj67_229704_c1_907_1170 87
1348 3300050509 nmdc:mga0qj67_50_c1 nmdc:mga0qj67_50_c1_24368_24637 87
1349 3300050509 nmdc:mga0qj67_595131_c1 nmdc:mga0qj67_595131_c1_387_650 87
1350 3300050509 nmdc:mga0qj67_667110_c1 nmdc:mga0qj67_667110_c1_52_315 87
1351 3300050510 nmdc:mga06r32_118088_c1 nmdc:mga06r32_118088_c1_875_1138 87
1352 3300050510 nmdc:mga06r32_135238_c1 nmdc:mga06r32_135238_c1_552_815 87
1353 3300050510 nmdc:mga06r32_391370_c1 nmdc:mga06r32_391370_c1_654_917 87
1354 3300050510 nmdc:mga06r32_79786_c1 nmdc:mga06r32_79786_c1_2157_2420 87
1355 3300050511 nmdc:mga08y16_100861_c1 nmdc:mga08y16_100861_c1_2501_2764 87
1356 3300050511 nmdc:mga08y16_274487_c1 nmdc:mga08y16_274487_c1_746_1009 87
1357 3300050511 nmdc:mga08y16_310668_c1 nmdc:mga08y16_310668_c1_886_1149 87
1358 3300050511 nmdc:mga08y16_356875_c1 nmdc:mga08y16_356875_c1_543_806 87
1359 3300050511 nmdc:mga08y16_71155_c1 nmdc:mga08y16_71155_c1_825_1121 87
1360 3300050512 nmdc:mga0n895_117132_c1 nmdc:mga0n895_117132_c1_527_790 87
1361 3300050512 nmdc:mga0n895_1184061_c1 nmdc:mga0n895_1184061_c1_53_316 87
1362 3300050512 nmdc:mga0n895_246323_c1 nmdc:mga0n895_246323_c1_872_1168 87
1363 3300050512 nmdc:mga0n895_50546_c1 nmdc:mga0n895_50546_c1_2348_2611 87
1364 3300050512 nmdc:mga0n895_692285_c1 nmdc:mga0n895_692285_c1_398_661 87
1365 3300050512 nmdc:mga0n895_70607_c1 nmdc:mga0n895_70607_c1_2581_2844 87
1366 3300050512 nmdc:mga0n895_840329_c1 nmdc:mga0n895_840329_c1_103_366 87
1367 3300050513 nmdc:mga0rr50_158771_c1 nmdc:mga0rr50_158771_c1_444_707 87
1368 3300050513 nmdc:mga0rr50_247128_c1 nmdc:mga0rr50_247128_c1_791_1087 87
1369 3300050513 nmdc:mga0rr50_53320_c1 nmdc:mga0rr50_53320_c1_1325_1588 87
1370 3300050514 nmdc:mga08x19_1193104_c1 nmdc:mga08x19_1193104_c1_34_297 87
1371 3300050514 nmdc:mga08x19_500277_c1 nmdc:mga08x19_500277_c1_174_437 87
1372 3300050514 nmdc:mga08x19_56031_c1 nmdc:mga08x19_56031_c1_747_1010 87
1373 3300050515 nmdc:mga0a205_11361_c1 nmdc:mga0a205_11361_c1_7818_8081 87
1374 3300050515 nmdc:mga0a205_1151012_c1 nmdc:mga0a205_1151012_c1_247_510 87
1375 3300050515 nmdc:mga0a205_1240444_c1 nmdc:mga0a205_1240444_c1_58_321 87
1376 3300050515 nmdc:mga0a205_348188_c1 nmdc:mga0a205_348188_c1_597_860 87
1377 3300053077 Ga0495601_0001376 Ga0495601_0001376_4227_4490 87
1378 3300053077 Ga0495601_0001735 Ga0495601_0001735_1291_1554 87
1379 3300053077 Ga0495601_0062873 Ga0495601_0062873_1166_1429 87
1380 3300053077 Ga0495601_0082471 Ga0495601_0082471_701_964 87
1381 3300053077 Ga0495601_0439416 Ga0495601_0439416_364_627 87
1382 3300053078 Ga0495612_0000562 Ga0495612_0000562_12480_12743 87
1383 3300053078 Ga0495612_0057057 Ga0495612_0057057_1206_1469 87
1384 3300053078 Ga0495612_0089880 Ga0495612_0089880_559_822 87
1385 3300053078 Ga0495612_0453878 Ga0495612_0453878_150_413 87
1386 3300053083 Ga0495655_0007915 Ga0495655_0007915_166_429 87
1387 3300053083 Ga0495655_0022803 Ga0495655_0022803_325_588 87
1388 3300053084 Ga0495595_0003174 Ga0495595_0003174_409_672 87
1389 3300053084 Ga0495595_0007422 Ga0495595_0007422_3061_3324 87
1390 3300053084 Ga0495595_0018837 Ga0495595_0018837_2165_2428 87
1391 3300053084 Ga0495595_0281332 Ga0495595_0281332_29_292 87
1392 3300053084 Ga0495595_0447850 Ga0495595_0447850_177_440 87
1393 3300053085 Ga0495619_0000045 Ga0495619_0000045_32251_32514 87
1394 3300053085 Ga0495619_0000484 Ga0495619_0000484_380_643 87
1395 3300053085 Ga0495619_0016005 Ga0495619_0016005_2241_2504 87
1396 3300053085 Ga0495619_0016140 Ga0495619_0016140_852_1115 87
1397 3300053085 Ga0495619_0112163 Ga0495619_0112163_70_333 87
1398 3300053085 Ga0495619_0286387 Ga0495619_0286387_338_601 87
1399 3300053094 Ga0500566_0142694 Ga0500566_0142694_130_393 87
1400 3300053096 Ga0500641_0002785 Ga0500641_0002785_4657_4920 87
1401 3300053117 Ga0500593_018605 Ga0500593_018605_620_916 87
1402 3300053728 Ga0500657_225075 Ga0500657_225075_33_296 87
1403 3300053730 Ga0500645_063080 Ga0500645_063080_139_408 87
1404 3300054114 Ga0501084_0422455 Ga0501084_0422455_694_957 87
1405 3300054114 Ga0501084_0448276 Ga0501084_0448276_726_989 87
1406 3300054114 Ga0501084_0624656 Ga0501084_0624656_490_753 87
1407 3300054114 Ga0501084_0707419 Ga0501084_0707419_218_481 87
1408 3300054114 Ga0501084_1301103 Ga0501084_1301103_266_529 87
1409 3300060353 Ga0501082_0018385 Ga0501082_0018385_746_1009 87
1410 3300060353 Ga0501082_0159213 Ga0501082_0159213_1277_1540 87
1411 3300060353 Ga0501082_0784497 Ga0501082_0784497_414_677 87
1412 3300060353 Ga0501082_1666857 Ga0501082_1666857_229_492 87
1413 3300061734 Ga0530510_0294726 Ga0530510_0294726_580_843 87
1414 3300061734 Ga0530510_0552549 Ga0530510_0552549_561_824 87
1415 3300061734 Ga0530510_0870287 Ga0530510_0870287_52_315 87
1416 3300061734 Ga0530510_0891222 Ga0530510_0891222_92_382 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19606

DUF6111

Family of unknown function (DUF6111)

1

88

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fcm-assembly2.cif.gz_B crystal structure of a nudix hydrolase from clostridium perfringens 0.8923 69 86
6ous-assembly1.cif.gz_D structure of fusion glycoprotein from human respiratory syncytial virus 0.5168 38 82
2phk-assembly1.cif.gz_A-2 the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition 0.4618 36 81
4du0-assembly5.cif.gz_D-2 crystal structure of human alpha-defensin 1, hnp1 (g17a mutant) 0.3885 62 84
1zmk-assembly1.cif.gz_B crystal structure of human alpha-defensin-2 (variant gly16-> d-ala), p 42 21 2 space group 0.3361 62 81
ID Description Score Start End Superfamily
af_X1WEQ3_485_592_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5116 47 81 3.30.200.20
af_O06796_1_121_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.4959 49 87 3.30.920.10
af_A4IAU7_107_274_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4912 42 87 1.10.510.10
af_A4HW76_216_470_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4847 43 87 1.10.510.10
af_C0H4G2_2_88_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4728 50 78 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A537VQR1-F1-model_v4 Uncharacterized protein 0.8411 24 87 GO:0016020
AF-K7RSY2-F1-model_v4 HipA N-terminal domain-containing protein 0.7807 63 87 GO:0004674
GO:0005829
AF-D7A4B6-F1-model_v4 Uncharacterized protein 0.6765 1 87 GO:0016020
AF-D7A4B6-F1-model_v4 Uncharacterized protein 0.6704 1 87 GO:0016020
AF-A0A537VQR1-F1-model_v4 Uncharacterized protein 0.6362 24 87 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.92 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map