F493790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1416 | 487 | 1415 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100000403|Ga0075430_10000040324 |
| Length | 89 |
| Sequence | MIRPVITELTLFLVPFVLYALFLWGTKRSGVFDRTNWPLPHVLYLMIAAFLLVIGSFIVLAQWGGAPPGSTYTPAHVEDGRFVPGQTKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 26 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 150 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 151 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 153 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 166 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 270 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 271 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 272 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 273 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 278 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 280 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 285 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 289 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 295 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 317 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 319 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 320 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 321 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 322 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 323 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 324 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 325 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 326 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 427 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 428 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 461 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.93 |
| Metatranscriptomes | 0 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.04 |
| Nodule | 0 |
| Rhizoplane | 9.46 |
| Rhizosphere | 86.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c011245 | 3300000041 | Bacteria | 764 |
| 2 | ARcpr5yngRDRAFT_c016622 | 3300000043 | Bacteria | 617 |
| 3 | ARCol0yngRDRAFT_1007988 | 3300000652 | Bacteria | 762 |
| 4 | JGI24032J14994_100616 | 3300001430 | Bacteria | 1853 |
| 5 | JGI24736J21556_1039826 | 3300001904 | Bacteria | 723 |
| 6 | JGI24741J21665_1022668 | 3300001915 | Bacteria | 973 |
| 7 | JGI24752J21851_1032527 | 3300001976 | Bacteria | 690 |
| 8 | JGI24752J21851_1048551 | 3300001976 | Bacteria | 575 |
| 9 | JGI24746J21847_1000660 | 3300001977 | Bacteria | 5285 |
| 10 | JGI24747J21853_1000065 | 3300001978 | Bacteria | 4332 |
| 11 | JGI24739J22299_10005070 | 3300001989 | Bacteria | 5015 |
| 12 | JGI24737J22298_10001725 | 3300001990 | Bacteria | 7790 |
| 13 | JGI24743J22301_10042470 | 3300001991 | Bacteria | 915 |
| 14 | JGI24743J22301_10071357 | 3300001991 | Bacteria | 725 |
| 15 | JGI24735J21928_10122357 | 3300002067 | Bacteria | 749 |
| 16 | JGI24750J21931_1000201 | 3300002070 | Bacteria | 10078 |
| 17 | JGI24745J21846_1000444 | 3300002073 | Bacteria | 3664 |
| 18 | JGI24745J21846_1011211 | 3300002073 | Bacteria | 1023 |
| 19 | JGI24738J21930_10008541 | 3300002075 | Bacteria | 2328 |
| 20 | JGI24738J21930_10014356 | 3300002075 | Bacteria | 1699 |
| 21 | JGI24749J21850_1002447 | 3300002076 | Bacteria | 2610 |
| 22 | JGI24744J21845_10036039 | 3300002077 | Bacteria | 935 |
| 23 | JGI24035J26624_1000749 | 3300002126 | Bacteria | 3043 |
| 24 | JGI24033J26618_1001273 | 3300002155 | Bacteria | 2475 |
| 25 | JGI24034J26672_10001663 | 3300002239 | Bacteria | 2983 |
| 26 | JGI24742J22300_10000548 | 3300002244 | Bacteria | 5621 |
| 27 | JGI24742J22300_10079592 | 3300002244 | Unclassified | 618 |
| 28 | JGI24751J29686_10030467 | 3300002459 | Bacteria | 1119 |
| 29 | JGI26129J50193_1019387 | 3300003349 | Bacteria | 506 |
| 30 | JGI25404J52841_10001785 | 3300003659 | Bacteria | 3898 |
| 31 | JGI25404J52841_10072301 | 3300003659 | Unclassified | 721 |
| 32 | JGI25405J52794_10002720 | 3300003911 | Bacteria | 3070 |
| 33 | JGI25405J52794_10106706 | 3300003911 | Bacteria | 627 |
| 34 | Ga0065712_10020878 | 3300005290 | Bacteria | 1730 |
| 35 | Ga0065715_10096595 | 3300005293 | Bacteria | 3846 |
| 36 | Ga0065715_10280231 | 3300005293 | Bacteria | 1064 |
| 37 | Ga0065707_10114838 | 3300005295 | Bacteria | 2285 |
| 38 | Ga0070658_10130781 | 3300005327 | Bacteria | 2092 |
| 39 | Ga0070658_10450839 | 3300005327 | Bacteria | 1108 |
| 40 | Ga0070658_11010666 | 3300005327 | Bacteria | 723 |
| 41 | Ga0070676_10004291 | 3300005328 | Bacteria | 7488 |
| 42 | Ga0070676_10081138 | 3300005328 | Bacteria | 1968 |
| 43 | Ga0070676_10874899 | 3300005328 | Unclassified | 668 |
| 44 | Ga0070683_100004677 | 3300005329 | Bacteria | 11310 |
| 45 | Ga0070683_100148684 | 3300005329 | Bacteria | 2221 |
| 46 | Ga0070683_100189798 | 3300005329 | Bacteria | 1951 |
| 47 | Ga0070690_100008757 | 3300005330 | Bacteria | 5842 |
| 48 | Ga0070690_100012125 | 3300005330 | Bacteria | 5066 |
| 49 | Ga0070690_100092303 | 3300005330 | Bacteria | 1996 |
| 50 | Ga0070690_100270903 | 3300005330 | Bacteria | 1208 |
| 51 | Ga0070670_100004378 | 3300005331 | Bacteria | 11820 |
| 52 | Ga0070670_100006765 | 3300005331 | Bacteria | 9714 |
| 53 | Ga0070670_100016298 | 3300005331 | Bacteria | 6382 |
| 54 | Ga0070670_100198783 | 3300005331 | Bacteria | 1742 |
| 55 | Ga0070677_10011104 | 3300005333 | Bacteria | 3097 |
| 56 | Ga0070677_10061625 | 3300005333 | Bacteria | 1549 |
| 57 | Ga0068869_100000546 | 3300005334 | Bacteria | 21018 |
| 58 | Ga0068869_100377194 | 3300005334 | Bacteria | 1161 |
| 59 | Ga0070666_10016324 | 3300005335 | Bacteria | 4749 |
| 60 | Ga0070666_10048506 | 3300005335 | Bacteria | 2854 |
| 61 | Ga0070666_10127353 | 3300005335 | Bacteria | 1768 |
| 62 | Ga0070680_100391835 | 3300005336 | Bacteria | 1183 |
| 63 | Ga0070680_100824459 | 3300005336 | Bacteria | 799 |
| 64 | Ga0070682_100003445 | 3300005337 | Bacteria | 8766 |
| 65 | Ga0070682_100085382 | 3300005337 | Bacteria | 2053 |
| 66 | Ga0070682_100316557 | 3300005337 | Bacteria | 1151 |
| 67 | Ga0068868_100012769 | 3300005338 | Bacteria | 6144 |
| 68 | Ga0068868_100196629 | 3300005338 | Bacteria | 1679 |
| 69 | Ga0068868_100554164 | 3300005338 | Bacteria | 1013 |
| 70 | Ga0070660_100006773 | 3300005339 | Bacteria | 7953 |
| 71 | Ga0070660_100217996 | 3300005339 | Bacteria | 1550 |
| 72 | Ga0070660_100254080 | 3300005339 | Bacteria | 1434 |
| 73 | Ga0070689_100002392 | 3300005340 | Bacteria | 12238 |
| 74 | Ga0070689_100023289 | 3300005340 | Bacteria | 4634 |
| 75 | Ga0070689_100220758 | 3300005340 | Bacteria | 1555 |
| 76 | Ga0070689_100323917 | 3300005340 | Unclassified | 1287 |
| 77 | Ga0070691_10003723 | 3300005341 | Bacteria | 6886 |
| 78 | Ga0070691_10088425 | 3300005341 | Bacteria | 1525 |
| 79 | Ga0070687_100001017 | 3300005343 | Bacteria | 9561 |
| 80 | Ga0070687_100038673 | 3300005343 | Bacteria | 2393 |
| 81 | Ga0070687_100515088 | 3300005343 | Bacteria | 808 |
| 82 | Ga0070661_100001763 | 3300005344 | Bacteria | 15010 |
| 83 | Ga0070661_100068356 | 3300005344 | Bacteria | 2611 |
| 84 | Ga0070661_100260178 | 3300005344 | Bacteria | 1341 |
| 85 | Ga0070661_100406702 | 3300005344 | Bacteria | 1077 |
| 86 | Ga0070692_10004423 | 3300005345 | Bacteria | 5871 |
| 87 | Ga0070692_10378364 | 3300005345 | Bacteria | 887 |
| 88 | Ga0070668_100098541 | 3300005347 | Bacteria | 2313 |
| 89 | Ga0070668_100137935 | 3300005347 | Bacteria | 1963 |
| 90 | Ga0070668_100143313 | 3300005347 | Bacteria | 1927 |
| 91 | Ga0070668_100638854 | 3300005347 | Bacteria | 934 |
| 92 | Ga0070669_100009976 | 3300005353 | Bacteria | 6754 |
| 93 | Ga0070669_100018281 | 3300005353 | Bacteria | 5009 |
| 94 | Ga0070669_100568314 | 3300005353 | Bacteria | 947 |
| 95 | Ga0070675_100029783 | 3300005354 | Bacteria | 4404 |
| 96 | Ga0070675_100110539 | 3300005354 | Bacteria | 2324 |
| 97 | Ga0070675_100335676 | 3300005354 | Bacteria | 1338 |
| 98 | Ga0070671_100007031 | 3300005355 | Bacteria | 9015 |
| 99 | Ga0070671_100033007 | 3300005355 | Bacteria | 4279 |
| 100 | Ga0070671_100128745 | 3300005355 | Bacteria | 2131 |
| 101 | Ga0070671_100739128 | 3300005355 | Bacteria | 855 |
| 102 | Ga0070671_101865723 | 3300005355 | Bacteria | 534 |
| 103 | Ga0070674_100018657 | 3300005356 | Bacteria | 4392 |
| 104 | Ga0070674_100068500 | 3300005356 | Bacteria | 2500 |
| 105 | Ga0070674_101146000 | 3300005356 | Bacteria | 688 |
| 106 | Ga0070674_101919762 | 3300005356 | Bacteria | 538 |
| 107 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 108 | Ga0070673_100018483 | 3300005364 | Bacteria | 4981 |
| 109 | Ga0070673_100025735 | 3300005364 | Bacteria | 4335 |
| 110 | Ga0070688_100000781 | 3300005365 | Bacteria | 15764 |
| 111 | Ga0070688_100006605 | 3300005365 | Bacteria | 6209 |
| 112 | Ga0070688_100557685 | 3300005365 | Bacteria | 872 |
| 113 | Ga0070659_100014541 | 3300005366 | Bacteria | 5882 |
| 114 | Ga0070659_100177726 | 3300005366 | Bacteria | 1746 |
| 115 | Ga0070659_100199243 | 3300005366 | Bacteria | 1648 |
| 116 | Ga0070659_100263800 | 3300005366 | Bacteria | 1429 |
| 117 | Ga0070667_100007711 | 3300005367 | Bacteria | 8923 |
| 118 | Ga0070667_100040047 | 3300005367 | Bacteria | 3929 |
| 119 | Ga0070667_100069618 | 3300005367 | Bacteria | 2995 |
| 120 | Ga0070667_100099804 | 3300005367 | Bacteria | 2506 |
| 121 | Ga0070703_10050731 | 3300005406 | Bacteria | 1326 |
| 122 | Ga0070709_10002579 | 3300005434 | Bacteria | 9800 |
| 123 | Ga0070709_10021978 | 3300005434 | Bacteria | 3725 |
| 124 | Ga0070709_10080777 | 3300005434 | Bacteria | 2120 |
| 125 | Ga0070709_10386789 | 3300005434 | Bacteria | 1041 |
| 126 | Ga0070714_100004606 | 3300005435 | Bacteria | 10396 |
| 127 | Ga0070714_100006031 | 3300005435 | Bacteria | 9304 |
| 128 | Ga0070714_100413285 | 3300005435 | Bacteria | 1277 |
| 129 | Ga0070714_101056293 | 3300005435 | Bacteria | 791 |
| 130 | Ga0070714_101362992 | 3300005435 | Bacteria | 692 |
| 131 | Ga0070713_100016906 | 3300005436 | Bacteria | 5497 |
| 132 | Ga0070713_100017576 | 3300005436 | Bacteria | 5412 |
| 133 | Ga0070713_100768913 | 3300005436 | Bacteria | 922 |
| 134 | Ga0070713_100999547 | 3300005436 | Bacteria | 807 |
| 135 | Ga0070713_101434521 | 3300005436 | Bacteria | 670 |
| 136 | Ga0070710_10003313 | 3300005437 | Bacteria | 7639 |
| 137 | Ga0070710_10009139 | 3300005437 | Bacteria | 4846 |
| 138 | Ga0070710_10195953 | 3300005437 | Bacteria | 1273 |
| 139 | Ga0070710_11028345 | 3300005437 | Bacteria | 601 |
| 140 | Ga0070701_10002148 | 3300005438 | Bacteria | 7507 |
| 141 | Ga0070701_10350596 | 3300005438 | Bacteria | 922 |
| 142 | Ga0070711_100070490 | 3300005439 | Bacteria | 2461 |
| 143 | Ga0070711_100093042 | 3300005439 | Bacteria | 2176 |
| 144 | Ga0070711_100581667 | 3300005439 | Bacteria | 932 |
| 145 | Ga0070711_100923648 | 3300005439 | Bacteria | 746 |
| 146 | Ga0070711_101856275 | 3300005439 | Unclassified | 529 |
| 147 | Ga0070705_100003118 | 3300005440 | Bacteria | 8153 |
| 148 | Ga0070705_101036197 | 3300005440 | Bacteria | 668 |
| 149 | Ga0070705_101271323 | 3300005440 | Bacteria | 609 |
| 150 | Ga0070705_101542001 | 3300005440 | Bacteria | 558 |
| 151 | Ga0070700_100002692 | 3300005441 | Bacteria | 9079 |
| 152 | Ga0070700_100057652 | 3300005441 | Bacteria | 2438 |
| 153 | Ga0070700_100129666 | 3300005441 | Bacteria | 1700 |
| 154 | Ga0070700_100558403 | 3300005441 | Bacteria | 891 |
| 155 | Ga0070700_101634796 | 3300005441 | Bacteria | 551 |
| 156 | Ga0070694_100005972 | 3300005444 | Bacteria | 7383 |
| 157 | Ga0070694_100071334 | 3300005444 | Bacteria | 2394 |
| 158 | Ga0070694_100562943 | 3300005444 | Bacteria | 914 |
| 159 | Ga0070708_100092810 | 3300005445 | Bacteria | 2751 |
| 160 | Ga0070663_100020225 | 3300005455 | Bacteria | 4404 |
| 161 | Ga0070663_100044767 | 3300005455 | Bacteria | 3123 |
| 162 | Ga0070663_101451948 | 3300005455 | Bacteria | 609 |
| 163 | Ga0070678_100000518 | 3300005456 | Bacteria | 18676 |
| 164 | Ga0070678_100212529 | 3300005456 | Bacteria | 1603 |
| 165 | Ga0070678_101629124 | 3300005456 | Bacteria | 606 |
| 166 | Ga0070662_100021515 | 3300005457 | Bacteria | 4404 |
| 167 | Ga0070662_100086443 | 3300005457 | Bacteria | 2345 |
| 168 | Ga0070662_100708797 | 3300005457 | Bacteria | 852 |
| 169 | Ga0070662_101498811 | 3300005457 | Bacteria | 582 |
| 170 | Ga0070681_10027987 | 3300005458 | Bacteria | 5666 |
| 171 | Ga0070681_11392097 | 3300005458 | Bacteria | 625 |
| 172 | Ga0070681_11601729 | 3300005458 | Bacteria | 577 |
| 173 | Ga0070681_11993746 | 3300005458 | Bacteria | 508 |
| 174 | Ga0068867_100009022 | 3300005459 | Bacteria | 7035 |
| 175 | Ga0068867_100047831 | 3300005459 | Bacteria | 3146 |
| 176 | Ga0068867_102149891 | 3300005459 | Bacteria | 529 |
| 177 | Ga0070685_10003674 | 3300005466 | Bacteria | 7777 |
| 178 | Ga0070685_10007039 | 3300005466 | Bacteria | 5742 |
| 179 | Ga0070685_10045141 | 3300005466 | Bacteria | 2526 |
| 180 | Ga0070685_10484104 | 3300005466 | Bacteria | 873 |
| 181 | Ga0070707_100977112 | 3300005468 | Bacteria | 812 |
| 182 | Ga0070698_100279765 | 3300005471 | Bacteria | 1600 |
| 183 | Ga0070699_100010972 | 3300005518 | Bacteria | 7834 |
| 184 | Ga0070699_101089575 | 3300005518 | Bacteria | 733 |
| 185 | Ga0070699_101607915 | 3300005518 | Bacteria | 595 |
| 186 | Ga0070679_100007667 | 3300005530 | Bacteria | 10102 |
| 187 | Ga0070679_100023364 | 3300005530 | Bacteria | 6050 |
| 188 | Ga0070679_100252356 | 3300005530 | Bacteria | 1720 |
| 189 | Ga0070684_100004205 | 3300005535 | Bacteria | 10907 |
| 190 | Ga0070684_100050710 | 3300005535 | Bacteria | 3605 |
| 191 | Ga0070684_100180708 | 3300005535 | Bacteria | 1918 |
| 192 | Ga0070697_100535918 | 3300005536 | Bacteria | 1026 |
| 193 | Ga0068853_100030067 | 3300005539 | Bacteria | 4585 |
| 194 | Ga0068853_100362410 | 3300005539 | Bacteria | 1351 |
| 195 | Ga0068853_101191682 | 3300005539 | Unclassified | 735 |
| 196 | Ga0070672_100000643 | 3300005543 | Bacteria | 20456 |
| 197 | Ga0070672_100052229 | 3300005543 | Bacteria | 3191 |
| 198 | Ga0070672_100377859 | 3300005543 | Bacteria | 1211 |
| 199 | Ga0070686_100001304 | 3300005544 | Bacteria | 14085 |
| 200 | Ga0070686_100040350 | 3300005544 | Bacteria | 2912 |
| 201 | Ga0070686_100522866 | 3300005544 | Bacteria | 924 |
| 202 | Ga0070695_100187822 | 3300005545 | Bacteria | 1468 |
| 203 | Ga0070696_100241197 | 3300005546 | Bacteria | 1363 |
| 204 | Ga0070696_100254152 | 3300005546 | Bacteria | 1330 |
| 205 | Ga0070696_100436747 | 3300005546 | Bacteria | 1030 |
| 206 | Ga0070696_101855335 | 3300005546 | Bacteria | 522 |
| 207 | Ga0070693_100008992 | 3300005547 | Bacteria | 4957 |
| 208 | Ga0070693_100237109 | 3300005547 | Bacteria | 1203 |
| 209 | Ga0070665_100021396 | 3300005548 | Bacteria | 6505 |
| 210 | Ga0070665_100097872 | 3300005548 | Bacteria | 2939 |
| 211 | Ga0070665_100115368 | 3300005548 | Bacteria | 2688 |
| 212 | Ga0070665_100250570 | 3300005548 | Bacteria | 1771 |
| 213 | Ga0070665_102210335 | 3300005548 | Bacteria | 554 |
| 214 | Ga0070704_100007534 | 3300005549 | Bacteria | 6481 |
| 215 | Ga0070704_101706686 | 3300005549 | Unclassified | 582 |
| 216 | Ga0070704_102009305 | 3300005549 | Unclassified | 537 |
| 217 | Ga0068855_100035984 | 3300005563 | Bacteria | 5895 |
| 218 | Ga0070664_100026948 | 3300005564 | Bacteria | 4773 |
| 219 | Ga0070664_100065477 | 3300005564 | Bacteria | 3101 |
| 220 | Ga0070664_100389898 | 3300005564 | Bacteria | 1272 |
| 221 | Ga0068857_100001038 | 3300005577 | Bacteria | 21487 |
| 222 | Ga0068857_100128885 | 3300005577 | Bacteria | 2281 |
| 223 | Ga0068857_101250275 | 3300005577 | Unclassified | 720 |
| 224 | Ga0068857_101780054 | 3300005577 | Bacteria | 603 |
| 225 | Ga0068854_100014606 | 3300005578 | Bacteria | 5181 |
| 226 | Ga0068854_100055227 | 3300005578 | Bacteria | 2858 |
| 227 | Ga0068856_100009104 | 3300005614 | Bacteria | 9654 |
| 228 | Ga0068856_101206742 | 3300005614 | Bacteria | 773 |
| 229 | Ga0068856_102584251 | 3300005614 | Bacteria | 514 |
| 230 | Ga0070702_100004502 | 3300005615 | Bacteria | 6373 |
| 231 | Ga0070702_100010693 | 3300005615 | Bacteria | 4533 |
| 232 | Ga0068852_100005996 | 3300005616 | Bacteria | 8755 |
| 233 | Ga0068852_100135825 | 3300005616 | Bacteria | 2271 |
| 234 | Ga0068859_100095197 | 3300005617 | Bacteria | 3030 |
| 235 | Ga0068859_100189786 | 3300005617 | Bacteria | 2139 |
| 236 | Ga0068859_100245444 | 3300005617 | Bacteria | 1880 |
| 237 | Ga0068864_100001882 | 3300005618 | Bacteria | 17235 |
| 238 | Ga0068864_100006391 | 3300005618 | Bacteria | 9654 |
| 239 | Ga0068864_100022271 | 3300005618 | Bacteria | 5312 |
| 240 | Ga0068864_100501285 | 3300005618 | Bacteria | 1168 |
| 241 | Ga0068864_101877383 | 3300005618 | Bacteria | 605 |
| 242 | Ga0068866_10000791 | 3300005718 | Bacteria | 14174 |
| 243 | Ga0068861_100002491 | 3300005719 | Bacteria | 12008 |
| 244 | Ga0068861_100292563 | 3300005719 | Bacteria | 1407 |
| 245 | Ga0068861_100467199 | 3300005719 | Unclassified | 1134 |
| 246 | Ga0068861_101176387 | 3300005719 | Bacteria | 740 |
| 247 | Ga0068851_10427726 | 3300005834 | Bacteria | 783 |
| 248 | Ga0068870_10001431 | 3300005840 | Bacteria | 9645 |
| 249 | Ga0068870_10280768 | 3300005840 | Bacteria | 1044 |
| 250 | Ga0068870_11343338 | 3300005840 | Bacteria | 522 |
| 251 | Ga0068863_100025687 | 3300005841 | Bacteria | 5618 |
| 252 | Ga0068863_100051180 | 3300005841 | Bacteria | 3915 |
| 253 | Ga0068863_101062945 | 3300005841 | Bacteria | 813 |
| 254 | Ga0068858_100109053 | 3300005842 | Bacteria | 2584 |
| 255 | Ga0068858_100208230 | 3300005842 | Bacteria | 1850 |
| 256 | Ga0068858_100456267 | 3300005842 | Bacteria | 1232 |
| 257 | Ga0068860_100002530 | 3300005843 | Bacteria | 19153 |
| 258 | Ga0068860_100047790 | 3300005843 | Bacteria | 4078 |
| 259 | Ga0068862_100090157 | 3300005844 | Bacteria | 2668 |
| 260 | Ga0068862_100258676 | 3300005844 | Bacteria | 1588 |
| 261 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 262 | Ga0081455_10003729 | 3300005937 | Bacteria | 17413 |
| 263 | Ga0081455_10048513 | 3300005937 | Bacteria | 3668 |
| 264 | Ga0081455_10342622 | 3300005937 | Bacteria | 1057 |
| 265 | Ga0081455_10415523 | 3300005937 | Bacteria | 929 |
| 266 | Ga0081455_10463321 | 3300005937 | Bacteria | 862 |
| 267 | Ga0081538_10001580 | 3300005981 | Bacteria | 23375 |
| 268 | Ga0081538_10053594 | 3300005981 | Bacteria | 2396 |
| 269 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 270 | Ga0081540_1003265 | 3300005983 | Bacteria | 12889 |
| 271 | Ga0081540_1010849 | 3300005983 | Bacteria | 6124 |
| 272 | Ga0081540_1175043 | 3300005983 | Bacteria | 811 |
| 273 | Ga0070717_10000485 | 3300006028 | Bacteria | 25249 |
| 274 | Ga0070717_10000980 | 3300006028 | Bacteria | 19102 |
| 275 | Ga0070717_10097524 | 3300006028 | Bacteria | 2491 |
| 276 | Ga0070717_10434999 | 3300006028 | Bacteria | 1181 |
| 277 | Ga0070717_10914905 | 3300006028 | Bacteria | 799 |
| 278 | Ga0075365_10001829 | 3300006038 | Bacteria | 9956 |
| 279 | Ga0075365_10044104 | 3300006038 | Bacteria | 2921 |
| 280 | Ga0075365_10194423 | 3300006038 | Bacteria | 1420 |
| 281 | Ga0075365_10331494 | 3300006038 | Bacteria | 1072 |
| 282 | Ga0075368_10014387 | 3300006042 | Bacteria | 2921 |
| 283 | Ga0075363_100086742 | 3300006048 | Bacteria | 1719 |
| 284 | Ga0075363_100142372 | 3300006048 | Bacteria | 1351 |
| 285 | Ga0075363_100217271 | 3300006048 | Bacteria | 1095 |
| 286 | Ga0075363_100332782 | 3300006048 | Bacteria | 885 |
| 287 | Ga0075363_100850194 | 3300006048 | Bacteria | 557 |
| 288 | Ga0075432_10218624 | 3300006058 | Unclassified | 761 |
| 289 | Ga0070715_10000289 | 3300006163 | Bacteria | 12366 |
| 290 | Ga0070715_10001137 | 3300006163 | Bacteria | 7597 |
| 291 | Ga0070715_10184904 | 3300006163 | Bacteria | 1048 |
| 292 | Ga0070715_10946657 | 3300006163 | Bacteria | 533 |
| 293 | Ga0070716_100004371 | 3300006173 | Bacteria | 6749 |
| 294 | Ga0070716_100010832 | 3300006173 | Bacteria | 4585 |
| 295 | Ga0070716_100379709 | 3300006173 | Bacteria | 1010 |
| 296 | Ga0070716_101020403 | 3300006173 | Bacteria | 655 |
| 297 | Ga0070712_100000381 | 3300006175 | Bacteria | 25274 |
| 298 | Ga0070712_100003511 | 3300006175 | Bacteria | 9649 |
| 299 | Ga0070712_100179123 | 3300006175 | Bacteria | 1650 |
| 300 | Ga0070712_100589747 | 3300006175 | Bacteria | 940 |
| 301 | Ga0070712_100879196 | 3300006175 | Bacteria | 772 |
| 302 | Ga0070712_101221002 | 3300006175 | Bacteria | 654 |
| 303 | Ga0075362_10060551 | 3300006177 | Bacteria | 1711 |
| 304 | Ga0075367_10012404 | 3300006178 | Bacteria | 4543 |
| 305 | Ga0075367_10018813 | 3300006178 | Bacteria | 3817 |
| 306 | Ga0075367_10113914 | 3300006178 | Bacteria | 1662 |
| 307 | Ga0075367_10192846 | 3300006178 | Bacteria | 1271 |
| 308 | Ga0075367_10713727 | 3300006178 | Bacteria | 638 |
| 309 | Ga0075366_10525448 | 3300006195 | Bacteria | 732 |
| 310 | Ga0097621_100001425 | 3300006237 | Bacteria | 16408 |
| 311 | Ga0097621_100010536 | 3300006237 | Bacteria | 6771 |
| 312 | Ga0097621_100109482 | 3300006237 | Bacteria | 2334 |
| 313 | Ga0075370_10102861 | 3300006353 | Bacteria | 1655 |
| 314 | Ga0075370_10356799 | 3300006353 | Bacteria | 874 |
| 315 | Ga0068871_100002394 | 3300006358 | Bacteria | 12790 |
| 316 | Ga0068871_100006790 | 3300006358 | Bacteria | 8135 |
| 317 | Ga0068871_100648687 | 3300006358 | Bacteria | 964 |
| 318 | Ga0075428_100272670 | 3300006844 | Bacteria | 1820 |
| 319 | Ga0075428_100373229 | 3300006844 | Bacteria | 1529 |
| 320 | Ga0075428_100659124 | 3300006844 | Bacteria | 1116 |
| 321 | Ga0075428_100816747 | 3300006844 | Bacteria | 991 |
| 322 | Ga0075430_100000403 | 3300006846 | Bacteria | 32016 |
| 323 | Ga0075430_100006792 | 3300006846 | Bacteria | 9643 |
| 324 | Ga0075430_100659732 | 3300006846 | Bacteria | 863 |
| 325 | Ga0075431_100057713 | 3300006847 | Bacteria | 4004 |
| 326 | Ga0075431_100067535 | 3300006847 | Bacteria | 3691 |
| 327 | Ga0075431_100221962 | 3300006847 | Bacteria | 1928 |
| 328 | Ga0075431_100342061 | 3300006847 | Bacteria | 1505 |
| 329 | Ga0075431_101248697 | 3300006847 | Unclassified | 705 |
| 330 | Ga0075433_10111705 | 3300006852 | Bacteria | 2425 |
| 331 | Ga0075433_10404315 | 3300006852 | Bacteria | 1205 |
| 332 | Ga0075433_10563575 | 3300006852 | Bacteria | 1001 |
| 333 | Ga0075433_11340954 | 3300006852 | Unclassified | 619 |
| 334 | Ga0075433_11415695 | 3300006852 | Bacteria | 601 |
| 335 | Ga0075434_100004560 | 3300006871 | Bacteria | 12511 |
| 336 | Ga0075434_100031153 | 3300006871 | Bacteria | 5256 |
| 337 | Ga0075434_100178126 | 3300006871 | Bacteria | 2146 |
| 338 | Ga0075434_100226134 | 3300006871 | Bacteria | 1891 |
| 339 | Ga0075434_100264005 | 3300006871 | Bacteria | 1741 |
| 340 | Ga0075434_100391020 | 3300006871 | Bacteria | 1412 |
| 341 | Ga0075434_100519711 | 3300006871 | Bacteria | 1211 |
| 342 | Ga0075429_100195306 | 3300006880 | Bacteria | 1773 |
| 343 | Ga0075429_100437345 | 3300006880 | Bacteria | 1146 |
| 344 | Ga0075429_101038743 | 3300006880 | Bacteria | 716 |
| 345 | Ga0068865_100001097 | 3300006881 | Bacteria | 15622 |
| 346 | Ga0068865_100134918 | 3300006881 | Bacteria | 1853 |
| 347 | Ga0068865_100249461 | 3300006881 | Bacteria | 1400 |
| 348 | Ga0068865_100631968 | 3300006881 | Bacteria | 908 |
| 349 | Ga0075436_100068349 | 3300006914 | Bacteria | 2454 |
| 350 | Ga0097620_100095196 | 3300006931 | Bacteria | 3030 |
| 351 | Ga0097620_100189785 | 3300006931 | Bacteria | 2139 |
| 352 | Ga0097620_100245421 | 3300006931 | Bacteria | 1880 |
| 353 | Ga0075435_100075222 | 3300007076 | Bacteria | 2765 |
| 354 | Ga0075435_100247382 | 3300007076 | Bacteria | 1517 |
| 355 | Ga0075435_100304901 | 3300007076 | Bacteria | 1362 |
| 356 | Ga0075435_100493958 | 3300007076 | Bacteria | 1058 |
| 357 | Ga0075435_100765232 | 3300007076 | Bacteria | 840 |
| 358 | Ga0105251_10036136 | 3300009011 | Bacteria | 2433 |
| 359 | Ga0105251_10091272 | 3300009011 | Unclassified | 1399 |
| 360 | Ga0105244_10023607 | 3300009036 | Bacteria | 3369 |
| 361 | Ga0105244_10435472 | 3300009036 | Unclassified | 603 |
| 362 | Ga0105250_10078729 | 3300009092 | Bacteria | 1335 |
| 363 | Ga0105250_10616440 | 3300009092 | Bacteria | 504 |
| 364 | Ga0105240_10067050 | 3300009093 | Bacteria | 4450 |
| 365 | Ga0105240_11464700 | 3300009093 | Bacteria | 716 |
| 366 | Ga0111539_10026539 | 3300009094 | Bacteria | 7080 |
| 367 | Ga0111539_10034470 | 3300009094 | Bacteria | 6137 |
| 368 | Ga0111539_10189267 | 3300009094 | Bacteria | 2402 |
| 369 | Ga0111539_10263224 | 3300009094 | Bacteria | 2007 |
| 370 | Ga0111539_11078790 | 3300009094 | Bacteria | 933 |
| 371 | Ga0111539_11664275 | 3300009094 | Bacteria | 740 |
| 372 | Ga0111539_12606955 | 3300009094 | Unclassified | 586 |
| 373 | Ga0105245_10025559 | 3300009098 | Bacteria | 5194 |
| 374 | Ga0105245_10133583 | 3300009098 | Bacteria | 2330 |
| 375 | Ga0105245_11173960 | 3300009098 | Bacteria | 815 |
| 376 | Ga0105245_12571918 | 3300009098 | Unclassified | 562 |
| 377 | Ga0105247_10003270 | 3300009101 | Bacteria | 10626 |
| 378 | Ga0105247_10024258 | 3300009101 | Bacteria | 3653 |
| 379 | Ga0105247_10025129 | 3300009101 | Bacteria | 3594 |
| 380 | Ga0105247_10046239 | 3300009101 | Bacteria | 2671 |
| 381 | Ga0105247_10420950 | 3300009101 | Bacteria | 956 |
| 382 | Ga0114129_10024067 | 3300009147 | Bacteria | 8629 |
| 383 | Ga0114129_10027094 | 3300009147 | Bacteria | 8115 |
| 384 | Ga0114129_10035205 | 3300009147 | Bacteria | 7074 |
| 385 | Ga0114129_10349738 | 3300009147 | Bacteria | 1958 |
| 386 | Ga0114129_10511680 | 3300009147 | Bacteria | 1566 |
| 387 | Ga0114129_10837248 | 3300009147 | Bacteria | 1171 |
| 388 | Ga0114129_13056179 | 3300009147 | Bacteria | 548 |
| 389 | Ga0105243_10002400 | 3300009148 | Bacteria | 15707 |
| 390 | Ga0105243_10004402 | 3300009148 | Bacteria | 11139 |
| 391 | Ga0105243_11781848 | 3300009148 | Bacteria | 646 |
| 392 | Ga0105241_10008636 | 3300009174 | Bacteria | 7488 |
| 393 | Ga0105242_10007578 | 3300009176 | Bacteria | 8356 |
| 394 | Ga0105242_10008734 | 3300009176 | Bacteria | 7775 |
| 395 | Ga0105242_10169037 | 3300009176 | Bacteria | 1920 |
| 396 | Ga0105248_10010839 | 3300009177 | Bacteria | 10064 |
| 397 | Ga0105248_10014218 | 3300009177 | Bacteria | 8762 |
| 398 | Ga0105248_10081366 | 3300009177 | Bacteria | 3640 |
| 399 | Ga0105248_10462007 | 3300009177 | Bacteria | 1431 |
| 400 | Ga0105237_10030610 | 3300009545 | Bacteria | 5465 |
| 401 | Ga0105237_10072688 | 3300009545 | Bacteria | 3433 |
| 402 | Ga0105237_10198301 | 3300009545 | Bacteria | 2007 |
| 403 | Ga0105237_10233019 | 3300009545 | Bacteria | 1842 |
| 404 | Ga0105237_10921939 | 3300009545 | Bacteria | 881 |
| 405 | Ga0105237_12173966 | 3300009545 | Bacteria | 564 |
| 406 | Ga0105238_10009678 | 3300009551 | Bacteria | 9647 |
| 407 | Ga0105238_10704814 | 3300009551 | Bacteria | 1022 |
| 408 | Ga0105238_10923956 | 3300009551 | Bacteria | 891 |
| 409 | Ga0105249_10011450 | 3300009553 | Bacteria | 7790 |
| 410 | Ga0105249_10060226 | 3300009553 | Bacteria | 3482 |
| 411 | Ga0105249_10190476 | 3300009553 | Bacteria | 2001 |
| 412 | Ga0105249_10635830 | 3300009553 | Bacteria | 1124 |
| 413 | Ga0105249_10835085 | 3300009553 | Bacteria | 986 |
| 414 | Ga0105249_10889730 | 3300009553 | Bacteria | 957 |
| 415 | Ga0105249_11209839 | 3300009553 | Bacteria | 827 |
| 416 | Ga0105239_10024088 | 3300010375 | Bacteria | 6704 |
| 417 | Ga0105239_10060055 | 3300010375 | Bacteria | 4172 |
| 418 | Ga0105239_10194362 | 3300010375 | Bacteria | 2272 |
| 419 | Ga0105239_11542931 | 3300010375 | Bacteria | 768 |
| 420 | Ga0105239_13644122 | 3300010375 | Unclassified | 500 |
| 421 | Ga0105246_10022159 | 3300011119 | Bacteria | 4097 |
| 422 | Ga0105246_10025827 | 3300011119 | Bacteria | 3830 |
| 423 | Ga0105246_10064420 | 3300011119 | Bacteria | 2560 |
| 424 | Ga0105246_10293961 | 3300011119 | Bacteria | 1308 |
| 425 | Ga0105246_10516105 | 3300011119 | Bacteria | 1017 |
| 426 | Ga0157325_1001090 | 3300012485 | Bacteria | 1178 |
| 427 | Ga0157339_1006614 | 3300012505 | Unclassified | 951 |
| 428 | Ga0157342_1016394 | 3300012507 | Unclassified | 819 |
| 429 | Ga0157316_1000861 | 3300012510 | Unclassified | 1733 |
| 430 | Ga0157338_1041924 | 3300012515 | Unclassified | 627 |
| 431 | Ga0157373_10045749 | 3300013100 | Bacteria | 3124 |
| 432 | Ga0157373_10185997 | 3300013100 | Bacteria | 1463 |
| 433 | Ga0157373_11039297 | 3300013100 | Unclassified | 613 |
| 434 | Ga0157371_10070112 | 3300013102 | Bacteria | 2482 |
| 435 | Ga0157370_10100379 | 3300013104 | Bacteria | 2712 |
| 436 | Ga0157370_10377576 | 3300013104 | Bacteria | 1306 |
| 437 | Ga0157370_10989840 | 3300013104 | Bacteria | 761 |
| 438 | Ga0157369_10618176 | 3300013105 | Bacteria | 1118 |
| 439 | Ga0157374_10001167 | 3300013296 | Bacteria | 22404 |
| 440 | Ga0157374_10338893 | 3300013296 | Bacteria | 1492 |
| 441 | Ga0157374_10418172 | 3300013296 | Bacteria | 1339 |
| 442 | Ga0157374_11019193 | 3300013296 | Bacteria | 847 |
| 443 | Ga0157374_11253782 | 3300013296 | Bacteria | 763 |
| 444 | Ga0157378_10008023 | 3300013297 | Bacteria | 9217 |
| 445 | Ga0157378_10034938 | 3300013297 | Bacteria | 4444 |
| 446 | Ga0157378_10103420 | 3300013297 | Bacteria | 2602 |
| 447 | Ga0157378_10230936 | 3300013297 | Bacteria | 1763 |
| 448 | Ga0163162_10010853 | 3300013306 | Bacteria | 8866 |
| 449 | Ga0163162_10102479 | 3300013306 | Bacteria | 2956 |
| 450 | Ga0163162_10156327 | 3300013306 | Bacteria | 2400 |
| 451 | Ga0157372_10070864 | 3300013307 | Bacteria | 3923 |
| 452 | Ga0157372_10788245 | 3300013307 | Bacteria | 1104 |
| 453 | Ga0157372_13397406 | 3300013307 | Bacteria | 506 |
| 454 | Ga0157375_10031874 | 3300013308 | Bacteria | 4992 |
| 455 | Ga0157375_10058370 | 3300013308 | Bacteria | 3817 |
| 456 | Ga0157375_10307243 | 3300013308 | Bacteria | 1750 |
| 457 | Ga0157375_11513626 | 3300013308 | Bacteria | 792 |
| 458 | Ga0157375_12241485 | 3300013308 | Bacteria | 651 |
| 459 | Ga0163163_10007288 | 3300014325 | Bacteria | 9756 |
| 460 | Ga0163163_10011174 | 3300014325 | Bacteria | 8131 |
| 461 | Ga0163163_10072774 | 3300014325 | Bacteria | 3426 |
| 462 | Ga0163163_10303092 | 3300014325 | Bacteria | 1650 |
| 463 | Ga0163163_10638904 | 3300014325 | Bacteria | 1128 |
| 464 | Ga0163163_11160597 | 3300014325 | Bacteria | 835 |
| 465 | Ga0157380_10001551 | 3300014326 | Bacteria | 15111 |
| 466 | Ga0157380_10141506 | 3300014326 | Bacteria | 2068 |
| 467 | Ga0157380_10484984 | 3300014326 | Bacteria | 1196 |
| 468 | Ga0157380_11535554 | 3300014326 | Bacteria | 720 |
| 469 | Ga0157380_12279306 | 3300014326 | Unclassified | 606 |
| 470 | Ga0182008_10154603 | 3300014497 | Bacteria | 1152 |
| 471 | Ga0182008_10676170 | 3300014497 | Bacteria | 587 |
| 472 | Ga0157377_10009300 | 3300014745 | Bacteria | 4814 |
| 473 | Ga0157377_10053554 | 3300014745 | Bacteria | 2282 |
| 474 | Ga0157377_10134432 | 3300014745 | Bacteria | 1514 |
| 475 | Ga0157379_10008646 | 3300014968 | Bacteria | 8866 |
| 476 | Ga0157379_10081393 | 3300014968 | Bacteria | 2901 |
| 477 | Ga0157379_10112149 | 3300014968 | Bacteria | 2450 |
| 478 | Ga0157379_10291285 | 3300014968 | Bacteria | 1487 |
| 479 | Ga0157379_11158923 | 3300014968 | Unclassified | 742 |
| 480 | Ga0157376_10580618 | 3300014969 | Bacteria | 1113 |
| 481 | Ga0157376_12255506 | 3300014969 | Bacteria | 583 |
| 482 | Ga0157376_12564712 | 3300014969 | Unclassified | 549 |
| 483 | Ga0163161_10011103 | 3300017792 | Bacteria | 6240 |
| 484 | Ga0163161_10078053 | 3300017792 | Bacteria | 2433 |
| 485 | Ga0163161_10214200 | 3300017792 | Bacteria | 1489 |
| 486 | Ga0163161_10480441 | 3300017792 | Bacteria | 1009 |
| 487 | Ga0213872_10280375 | 3300021361 | Unclassified | 696 |
| 488 | Ga0213876_10029343 | 3300021384 | Bacteria | 2898 |
| 489 | Ga0207666_1000153 | 3300025271 | Bacteria | 10663 |
| 490 | Ga0207673_1000206 | 3300025290 | Bacteria | 5940 |
| 491 | Ga0207697_10001059 | 3300025315 | Bacteria | 15198 |
| 492 | Ga0207697_10296209 | 3300025315 | Unclassified | 717 |
| 493 | Ga0207656_10230074 | 3300025321 | Bacteria | 903 |
| 494 | Ga0207713_1051898 | 3300025735 | Bacteria | 1627 |
| 495 | Ga0207713_1084833 | 3300025735 | Bacteria | 1129 |
| 496 | Ga0207653_10020183 | 3300025885 | Bacteria | 2108 |
| 497 | Ga0207682_10002885 | 3300025893 | Bacteria | 7586 |
| 498 | Ga0207692_10000282 | 3300025898 | Bacteria | 17493 |
| 499 | Ga0207692_10020210 | 3300025898 | Bacteria | 3024 |
| 500 | Ga0207692_10436411 | 3300025898 | Bacteria | 822 |
| 501 | Ga0207642_10119120 | 3300025899 | Bacteria | 1358 |
| 502 | Ga0207642_10347258 | 3300025899 | Bacteria | 874 |
| 503 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 504 | Ga0207710_10010435 | 3300025900 | Bacteria | 3912 |
| 505 | Ga0207710_10012560 | 3300025900 | Bacteria | 3563 |
| 506 | Ga0207710_10036246 | 3300025900 | Bacteria | 2173 |
| 507 | Ga0207688_10001072 | 3300025901 | Bacteria | 13993 |
| 508 | Ga0207688_10004597 | 3300025901 | Bacteria | 7515 |
| 509 | Ga0207680_10008936 | 3300025903 | Bacteria | 4943 |
| 510 | Ga0207680_10018703 | 3300025903 | Bacteria | 3690 |
| 511 | Ga0207680_10552131 | 3300025903 | Bacteria | 822 |
| 512 | Ga0207647_10033262 | 3300025904 | Bacteria | 3302 |
| 513 | Ga0207647_10071757 | 3300025904 | Bacteria | 2089 |
| 514 | Ga0207685_10000164 | 3300025905 | Bacteria | 10037 |
| 515 | Ga0207685_10189110 | 3300025905 | Bacteria | 960 |
| 516 | Ga0207699_10148435 | 3300025906 | Bacteria | 1548 |
| 517 | Ga0207699_10230402 | 3300025906 | Bacteria | 1269 |
| 518 | Ga0207699_10300091 | 3300025906 | Bacteria | 1121 |
| 519 | Ga0207699_10315460 | 3300025906 | Bacteria | 1095 |
| 520 | Ga0207699_10405395 | 3300025906 | Bacteria | 972 |
| 521 | Ga0207699_10411845 | 3300025906 | Bacteria | 964 |
| 522 | Ga0207699_11077179 | 3300025906 | Bacteria | 595 |
| 523 | Ga0207645_10002745 | 3300025907 | Bacteria | 13711 |
| 524 | Ga0207645_10036554 | 3300025907 | Bacteria | 3153 |
| 525 | Ga0207645_10065071 | 3300025907 | Bacteria | 2330 |
| 526 | Ga0207645_10245704 | 3300025907 | Bacteria | 1183 |
| 527 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 528 | Ga0207643_10000532 | 3300025908 | Bacteria | 24445 |
| 529 | Ga0207705_10517875 | 3300025909 | Bacteria | 927 |
| 530 | Ga0207654_10008032 | 3300025911 | Bacteria | 5318 |
| 531 | Ga0207654_10158904 | 3300025911 | Bacteria | 1458 |
| 532 | Ga0207654_11011474 | 3300025911 | Bacteria | 605 |
| 533 | Ga0207707_10140307 | 3300025912 | Bacteria | 2113 |
| 534 | Ga0207707_10273104 | 3300025912 | Bacteria | 1465 |
| 535 | Ga0207707_10425930 | 3300025912 | Bacteria | 1137 |
| 536 | Ga0207707_11133418 | 3300025912 | Bacteria | 636 |
| 537 | Ga0207695_10072726 | 3300025913 | Bacteria | 3506 |
| 538 | Ga0207695_10542897 | 3300025913 | Bacteria | 1044 |
| 539 | Ga0207671_10086564 | 3300025914 | Bacteria | 2355 |
| 540 | Ga0207671_10137614 | 3300025914 | Bacteria | 1879 |
| 541 | Ga0207671_11387138 | 3300025914 | Bacteria | 545 |
| 542 | Ga0207693_10001038 | 3300025915 | Bacteria | 24865 |
| 543 | Ga0207693_10005381 | 3300025915 | Bacteria | 10696 |
| 544 | Ga0207663_10001206 | 3300025916 | Bacteria | 11940 |
| 545 | Ga0207663_10020826 | 3300025916 | Bacteria | 3722 |
| 546 | Ga0207663_10062599 | 3300025916 | Bacteria | 2365 |
| 547 | Ga0207660_10009992 | 3300025917 | Bacteria | 6148 |
| 548 | Ga0207660_10073080 | 3300025917 | Bacteria | 2499 |
| 549 | Ga0207660_10592331 | 3300025917 | Bacteria | 903 |
| 550 | Ga0207662_10000392 | 3300025918 | Bacteria | 19588 |
| 551 | Ga0207662_10001199 | 3300025918 | Bacteria | 12365 |
| 552 | Ga0207662_10124829 | 3300025918 | Bacteria | 1618 |
| 553 | Ga0207657_10002007 | 3300025919 | Bacteria | 22003 |
| 554 | Ga0207657_10019229 | 3300025919 | Bacteria | 6492 |
| 555 | Ga0207657_10039060 | 3300025919 | Bacteria | 4220 |
| 556 | Ga0207649_10005404 | 3300025920 | Bacteria | 6918 |
| 557 | Ga0207649_10228759 | 3300025920 | Bacteria | 1329 |
| 558 | Ga0207649_10360867 | 3300025920 | Bacteria | 1078 |
| 559 | Ga0207649_10365921 | 3300025920 | Bacteria | 1071 |
| 560 | Ga0207652_10058342 | 3300025921 | Bacteria | 3326 |
| 561 | Ga0207652_10128917 | 3300025921 | Bacteria | 2255 |
| 562 | Ga0207652_10169574 | 3300025921 | Bacteria | 1958 |
| 563 | Ga0207646_10869308 | 3300025922 | Bacteria | 801 |
| 564 | Ga0207681_10024530 | 3300025923 | Bacteria | 3871 |
| 565 | Ga0207681_10077414 | 3300025923 | Bacteria | 2338 |
| 566 | Ga0207694_10363721 | 3300025924 | Bacteria | 1199 |
| 567 | Ga0207650_10004542 | 3300025925 | Bacteria | 9492 |
| 568 | Ga0207650_10017240 | 3300025925 | Bacteria | 5055 |
| 569 | Ga0207650_10412758 | 3300025925 | Bacteria | 1119 |
| 570 | Ga0207659_10000374 | 3300025926 | Bacteria | 26976 |
| 571 | Ga0207659_10025170 | 3300025926 | Bacteria | 3996 |
| 572 | Ga0207659_10383099 | 3300025926 | Bacteria | 1173 |
| 573 | Ga0207659_11675219 | 3300025926 | Unclassified | 542 |
| 574 | Ga0207687_10036426 | 3300025927 | Bacteria | 3352 |
| 575 | Ga0207687_10041087 | 3300025927 | Bacteria | 3174 |
| 576 | Ga0207700_10003347 | 3300025928 | Bacteria | 9298 |
| 577 | Ga0207700_10031654 | 3300025928 | Bacteria | 3761 |
| 578 | Ga0207700_10067428 | 3300025928 | Bacteria | 2739 |
| 579 | Ga0207700_10287224 | 3300025928 | Bacteria | 1417 |
| 580 | Ga0207700_10999172 | 3300025928 | Bacteria | 749 |
| 581 | Ga0207700_11152062 | 3300025928 | Bacteria | 693 |
| 582 | Ga0207664_10012974 | 3300025929 | Bacteria | 5970 |
| 583 | Ga0207664_10339181 | 3300025929 | Bacteria | 1329 |
| 584 | Ga0207664_11341152 | 3300025929 | Unclassified | 635 |
| 585 | Ga0207664_11733889 | 3300025929 | Bacteria | 547 |
| 586 | Ga0207644_10004888 | 3300025931 | Bacteria | 8732 |
| 587 | Ga0207644_10073489 | 3300025931 | Bacteria | 2507 |
| 588 | Ga0207644_10328146 | 3300025931 | Bacteria | 1238 |
| 589 | Ga0207690_10088497 | 3300025932 | Bacteria | 2181 |
| 590 | Ga0207690_10410738 | 3300025932 | Bacteria | 1081 |
| 591 | Ga0207690_10536168 | 3300025932 | Bacteria | 950 |
| 592 | Ga0207690_10806594 | 3300025932 | Bacteria | 776 |
| 593 | Ga0207706_10010623 | 3300025933 | Bacteria | 8409 |
| 594 | Ga0207706_10095775 | 3300025933 | Bacteria | 2610 |
| 595 | Ga0207686_10007542 | 3300025934 | Bacteria | 5858 |
| 596 | Ga0207686_10025932 | 3300025934 | Bacteria | 3416 |
| 597 | Ga0207686_10102145 | 3300025934 | Bacteria | 1916 |
| 598 | Ga0207709_10003882 | 3300025935 | Bacteria | 8742 |
| 599 | Ga0207709_10027047 | 3300025935 | Bacteria | 3300 |
| 600 | Ga0207709_10069241 | 3300025935 | Bacteria | 2233 |
| 601 | Ga0207670_10004902 | 3300025936 | Bacteria | 7280 |
| 602 | Ga0207670_10043451 | 3300025936 | Bacteria | 2968 |
| 603 | Ga0207670_10177322 | 3300025936 | Bacteria | 1603 |
| 604 | Ga0207670_10217320 | 3300025936 | Bacteria | 1461 |
| 605 | Ga0207669_10000275 | 3300025937 | Bacteria | 23591 |
| 606 | Ga0207669_10083520 | 3300025937 | Bacteria | 2054 |
| 607 | Ga0207704_10002620 | 3300025938 | Bacteria | 8124 |
| 608 | Ga0207704_10105952 | 3300025938 | Bacteria | 1887 |
| 609 | Ga0207665_10000541 | 3300025939 | Bacteria | 25458 |
| 610 | Ga0207665_10013741 | 3300025939 | Bacteria | 5325 |
| 611 | Ga0207665_10205088 | 3300025939 | Bacteria | 1438 |
| 612 | Ga0207665_10288681 | 3300025939 | Bacteria | 1223 |
| 613 | Ga0207691_10004396 | 3300025940 | Bacteria | 13666 |
| 614 | Ga0207691_10030766 | 3300025940 | Bacteria | 5014 |
| 615 | Ga0207711_10002645 | 3300025941 | Bacteria | 15844 |
| 616 | Ga0207711_10005696 | 3300025941 | Bacteria | 10522 |
| 617 | Ga0207711_10021126 | 3300025941 | Bacteria | 5438 |
| 618 | Ga0207711_11283095 | 3300025941 | Bacteria | 674 |
| 619 | Ga0207689_10002724 | 3300025942 | Bacteria | 16345 |
| 620 | Ga0207689_10077139 | 3300025942 | Bacteria | 2739 |
| 621 | Ga0207689_10496678 | 3300025942 | Bacteria | 1022 |
| 622 | Ga0207661_10015256 | 3300025944 | Bacteria | 5649 |
| 623 | Ga0207661_10112752 | 3300025944 | Bacteria | 2303 |
| 624 | Ga0207661_10159486 | 3300025944 | Bacteria | 1956 |
| 625 | Ga0207661_10248476 | 3300025944 | Bacteria | 1580 |
| 626 | Ga0207679_10001617 | 3300025945 | Bacteria | 14034 |
| 627 | Ga0207679_10151996 | 3300025945 | Bacteria | 1885 |
| 628 | Ga0207667_10702478 | 3300025949 | Bacteria | 1014 |
| 629 | Ga0207651_10004195 | 3300025960 | Bacteria | 7218 |
| 630 | Ga0207651_10057280 | 3300025960 | Bacteria | 2687 |
| 631 | Ga0207651_10101715 | 3300025960 | Bacteria | 2134 |
| 632 | Ga0207651_11533688 | 3300025960 | Bacteria | 600 |
| 633 | Ga0207712_10033211 | 3300025961 | Bacteria | 3487 |
| 634 | Ga0207712_10069490 | 3300025961 | Bacteria | 2527 |
| 635 | Ga0207712_10218996 | 3300025961 | Bacteria | 1521 |
| 636 | Ga0207712_10298718 | 3300025961 | Bacteria | 1320 |
| 637 | Ga0207712_10413420 | 3300025961 | Bacteria | 1136 |
| 638 | Ga0207712_11079490 | 3300025961 | Bacteria | 714 |
| 639 | Ga0207668_10005763 | 3300025972 | Bacteria | 7301 |
| 640 | Ga0207668_10288942 | 3300025972 | Bacteria | 1348 |
| 641 | Ga0207668_10298681 | 3300025972 | Bacteria | 1328 |
| 642 | Ga0207640_10015642 | 3300025981 | Bacteria | 4396 |
| 643 | Ga0207640_10105178 | 3300025981 | Bacteria | 1988 |
| 644 | Ga0207658_10084208 | 3300025986 | Bacteria | 2446 |
| 645 | Ga0207658_10251997 | 3300025986 | Bacteria | 1500 |
| 646 | Ga0207658_11480453 | 3300025986 | Bacteria | 621 |
| 647 | Ga0207677_10044077 | 3300026023 | Bacteria | 2969 |
| 648 | Ga0207677_10044426 | 3300026023 | Bacteria | 2960 |
| 649 | Ga0207677_10094078 | 3300026023 | Bacteria | 2187 |
| 650 | Ga0207703_10001822 | 3300026035 | Bacteria | 19007 |
| 651 | Ga0207703_10019332 | 3300026035 | Bacteria | 5322 |
| 652 | Ga0207703_10041983 | 3300026035 | Bacteria | 3666 |
| 653 | Ga0207703_10537759 | 3300026035 | Bacteria | 1101 |
| 654 | Ga0207639_10019446 | 3300026041 | Bacteria | 4844 |
| 655 | Ga0207639_10313517 | 3300026041 | Bacteria | 1390 |
| 656 | Ga0207639_11168052 | 3300026041 | Unclassified | 722 |
| 657 | Ga0207678_10002471 | 3300026067 | Bacteria | 16791 |
| 658 | Ga0207678_10019865 | 3300026067 | Bacteria | 5905 |
| 659 | Ga0207678_10032268 | 3300026067 | Bacteria | 4565 |
| 660 | Ga0207708_10001992 | 3300026075 | Bacteria | 15035 |
| 661 | Ga0207708_10047755 | 3300026075 | Bacteria | 3258 |
| 662 | Ga0207708_10196640 | 3300026075 | Bacteria | 1607 |
| 663 | Ga0207702_10021444 | 3300026078 | Bacteria | 5349 |
| 664 | Ga0207702_10886104 | 3300026078 | Bacteria | 884 |
| 665 | Ga0207702_11214162 | 3300026078 | Bacteria | 748 |
| 666 | Ga0207641_10019509 | 3300026088 | Bacteria | 5565 |
| 667 | Ga0207641_10493316 | 3300026088 | Bacteria | 1188 |
| 668 | Ga0207641_10848924 | 3300026088 | Bacteria | 905 |
| 669 | Ga0207648_10004767 | 3300026089 | Bacteria | 13850 |
| 670 | Ga0207648_10010273 | 3300026089 | Bacteria | 8889 |
| 671 | Ga0207676_10001979 | 3300026095 | Bacteria | 14919 |
| 672 | Ga0207676_10002246 | 3300026095 | Bacteria | 13878 |
| 673 | Ga0207676_10375764 | 3300026095 | Bacteria | 1321 |
| 674 | Ga0207676_10473035 | 3300026095 | Bacteria | 1185 |
| 675 | Ga0207676_11118263 | 3300026095 | Bacteria | 779 |
| 676 | Ga0207674_10007733 | 3300026116 | Bacteria | 12510 |
| 677 | Ga0207674_10340244 | 3300026116 | Unclassified | 1451 |
| 678 | Ga0207674_12165721 | 3300026116 | Unclassified | 519 |
| 679 | Ga0207675_100003883 | 3300026118 | Bacteria | 14527 |
| 680 | Ga0207675_100007986 | 3300026118 | Bacteria | 9973 |
| 681 | Ga0207675_100255645 | 3300026118 | Bacteria | 1697 |
| 682 | Ga0207683_10002044 | 3300026121 | Bacteria | 17862 |
| 683 | Ga0207683_10009279 | 3300026121 | Bacteria | 8382 |
| 684 | Ga0207683_10124841 | 3300026121 | Bacteria | 2313 |
| 685 | Ga0207698_10031944 | 3300026142 | Bacteria | 3808 |
| 686 | Ga0207698_10079168 | 3300026142 | Bacteria | 2642 |
| 687 | Ga0207698_10828466 | 3300026142 | Bacteria | 929 |
| 688 | Ga0210000_1028337 | 3300027462 | Bacteria | 872 |
| 689 | Ga0209970_1001300 | 3300027614 | Bacteria | 4390 |
| 690 | Ga0210002_1002503 | 3300027617 | Bacteria | 2653 |
| 691 | Ga0209971_1051991 | 3300027682 | Bacteria | 990 |
| 692 | Ga0209966_1049627 | 3300027695 | Bacteria | 890 |
| 693 | Ga0209998_10001985 | 3300027717 | Bacteria | 4800 |
| 694 | Ga0209998_10027289 | 3300027717 | Bacteria | 1250 |
| 695 | Ga0209813_10042324 | 3300027866 | Bacteria | 1392 |
| 696 | Ga0209974_10010843 | 3300027876 | Bacteria | 3070 |
| 697 | Ga0209974_10013531 | 3300027876 | Bacteria | 2718 |
| 698 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 699 | Ga0207428_10240725 | 3300027907 | Bacteria | 1352 |
| 700 | Ga0268266_10003041 | 3300028379 | Bacteria | 17192 |
| 701 | Ga0268266_10268549 | 3300028379 | Bacteria | 1583 |
| 702 | Ga0268266_10288641 | 3300028379 | Bacteria | 1527 |
| 703 | Ga0268265_10027065 | 3300028380 | Bacteria | 4088 |
| 704 | Ga0268265_10055116 | 3300028380 | Bacteria | 3019 |
| 705 | Ga0268264_10041889 | 3300028381 | Bacteria | 3788 |
| 706 | Ga0268264_10342531 | 3300028381 | Bacteria | 1420 |
| 707 | Ga0268264_10542243 | 3300028381 | Unclassified | 1140 |
| 708 | Ga0268264_11402776 | 3300028381 | Bacteria | 709 |
| 709 | Ga0268264_12184799 | 3300028381 | Bacteria | 561 |
| 710 | Ga0265338_10806974 | 3300028800 | Unclassified | 643 |
| 711 | Ga0265330_10221819 | 3300031235 | Bacteria | 798 |
| 712 | Ga0265332_10011394 | 3300031238 | Bacteria | 3953 |
| 713 | Ga0265332_10045090 | 3300031238 | Bacteria | 1901 |
| 714 | Ga0265320_10502443 | 3300031240 | Bacteria | 535 |
| 715 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 716 | Ga0265325_10051523 | 3300031241 | Bacteria | 2116 |
| 717 | Ga0265329_10021345 | 3300031242 | Bacteria | 2175 |
| 718 | Ga0265340_10009552 | 3300031247 | Bacteria | 5201 |
| 719 | Ga0265340_10105527 | 3300031247 | Bacteria | 1306 |
| 720 | Ga0265339_10052691 | 3300031249 | Bacteria | 2216 |
| 721 | Ga0265339_10145540 | 3300031249 | Bacteria | 1202 |
| 722 | Ga0265339_10152032 | 3300031249 | Bacteria | 1170 |
| 723 | Ga0265331_10055553 | 3300031250 | Bacteria | 1883 |
| 724 | Ga0265331_10063698 | 3300031250 | Bacteria | 1736 |
| 725 | Ga0265316_10470323 | 3300031344 | Bacteria | 900 |
| 726 | Ga0265316_10508621 | 3300031344 | Bacteria | 860 |
| 727 | Ga0265316_10744580 | 3300031344 | Bacteria | 689 |
| 728 | Ga0265316_11293843 | 3300031344 | Bacteria | 503 |
| 729 | Ga0307408_101670668 | 3300031548 | Bacteria | 606 |
| 730 | Ga0265313_10022124 | 3300031595 | Bacteria | 3457 |
| 731 | Ga0265313_10027730 | 3300031595 | Bacteria | 2960 |
| 732 | Ga0265313_10320954 | 3300031595 | Bacteria | 619 |
| 733 | Ga0316575_10078991 | 3300031665 | Bacteria | 1326 |
| 734 | Ga0316575_10401431 | 3300031665 | Bacteria | 588 |
| 735 | Ga0316575_10485878 | 3300031665 | Bacteria | 535 |
| 736 | Ga0265314_10040448 | 3300031711 | Bacteria | 3346 |
| 737 | Ga0265314_10459996 | 3300031711 | Bacteria | 676 |
| 738 | Ga0265342_10088384 | 3300031712 | Bacteria | 1779 |
| 739 | Ga0265342_10092487 | 3300031712 | Bacteria | 1732 |
| 740 | Ga0307413_11908229 | 3300031824 | Bacteria | 534 |
| 741 | Ga0307409_101253998 | 3300031995 | Bacteria | 766 |
| 742 | Ga0307416_103338916 | 3300032002 | Bacteria | 537 |
| 743 | Ga0316583_10005022 | 3300032133 | Bacteria | 4734 |
| 744 | Ga0316583_10101660 | 3300032133 | Bacteria | 1002 |
| 745 | Ga0373930_0001440 | 3300034816 | Bacteria | 3539 |
| 746 | Ga0373930_0026002 | 3300034816 | Unclassified | 1178 |
| 747 | Ga0373950_0007742 | 3300034818 | Bacteria | 1674 |
| 748 | Ga0373950_0051411 | 3300034818 | Bacteria | 810 |
| 749 | Ga0373959_0034325 | 3300034820 | Bacteria | 1038 |
| 750 | Ga0373959_0089070 | 3300034820 | Bacteria | 721 |
| 751 | Ga0373938_0006145 | 3300034957 | Bacteria | 2065 |
| 752 | Ga0373938_0016299 | 3300034957 | Bacteria | 1450 |
| 753 | Ga0373926_0012934 | 3300035083 | Bacteria | 2826 |
| 754 | Ga0373926_0026591 | 3300035083 | Bacteria | 2025 |
| 755 | Ga0373926_0086034 | 3300035083 | Bacteria | 1166 |
| 756 | Ga0373928_0000779 | 3300035084 | Bacteria | 6200 |
| 757 | Ga0373929_0094396 | 3300035085 | Bacteria | 746 |
| 758 | Ga0373929_0177484 | 3300035085 | Unclassified | 586 |
| 759 | Ga0373934_0007860 | 3300035086 | Bacteria | 3966 |
| 760 | Ga0373934_0089028 | 3300035086 | Bacteria | 1243 |
| 761 | Ga0373944_0000648 | 3300035089 | Bacteria | 8271 |
| 762 | Ga0373944_0006736 | 3300035089 | Bacteria | 3056 |
| 763 | Ga0373944_0007628 | 3300035089 | Bacteria | 2905 |
| 764 | Ga0373949_0001783 | 3300035090 | Bacteria | 5906 |
| 765 | Ga0373949_0030756 | 3300035090 | Bacteria | 1277 |
| 766 | Ga0373951_0024865 | 3300035091 | Bacteria | 1389 |
| 767 | Ga0373951_0052435 | 3300035091 | Bacteria | 1006 |
| 768 | Ga0373952_0014213 | 3300035092 | Bacteria | 1590 |
| 769 | Ga0373952_0238562 | 3300035092 | Bacteria | 546 |
| 770 | Ga0373923_0000903 | 3300035111 | Bacteria | 7919 |
| 771 | Ga0373932_0007032 | 3300035112 | Bacteria | 2674 |
| 772 | Ga0373936_0025442 | 3300035113 | Bacteria | 2314 |
| 773 | Ga0373936_0040602 | 3300035113 | Bacteria | 1864 |
| 774 | Ga0373939_0005507 | 3300035114 | Bacteria | 3019 |
| 775 | Ga0373939_0014215 | 3300035114 | Bacteria | 2062 |
| 776 | Ga0373939_0060939 | 3300035114 | Bacteria | 1201 |
| 777 | Ga0373939_0183290 | 3300035114 | Bacteria | 782 |
| 778 | Ga0373941_0007122 | 3300035115 | Bacteria | 2724 |
| 779 | Ga0373941_0080731 | 3300035115 | Bacteria | 1098 |
| 780 | Ga0373945_0000024 | 3300035116 | Bacteria | 30607 |
| 781 | Ga0373945_0005743 | 3300035116 | Bacteria | 3983 |
| 782 | Ga0373945_0009935 | 3300035116 | Bacteria | 3126 |
| 783 | Ga0373945_0020687 | 3300035116 | Bacteria | 2255 |
| 784 | Ga0373953_0065822 | 3300035117 | Bacteria | 1488 |
| 785 | Ga0373953_0066423 | 3300035117 | Bacteria | 1482 |
| 786 | Ga0373953_0183570 | 3300035117 | Bacteria | 903 |
| 787 | Ga0373954_0047403 | 3300035118 | Bacteria | 2011 |
| 788 | Ga0373954_0091021 | 3300035118 | Bacteria | 1465 |
| 789 | Ga0373954_0119964 | 3300035118 | Bacteria | 1276 |
| 790 | Ga0373954_0344467 | 3300035118 | Bacteria | 736 |
| 791 | Ga0373956_0009220 | 3300035119 | Bacteria | 4006 |
| 792 | Ga0373957_0031324 | 3300035120 | Bacteria | 1954 |
| 793 | Ga0373957_0032882 | 3300035120 | Bacteria | 1913 |
| 794 | Ga0373957_0045943 | 3300035120 | Bacteria | 1656 |
| 795 | Ga0373960_0008365 | 3300035121 | Bacteria | 2478 |
| 796 | Ga0373943_0016457 | 3300035170 | Bacteria | 3372 |
| 797 | Ga0373943_0027886 | 3300035170 | Bacteria | 2657 |
| 798 | Ga0373943_0153384 | 3300035170 | Bacteria | 1249 |
| 799 | Ga0373946_0001675 | 3300035171 | Bacteria | 7723 |
| 800 | Ga0373946_0003685 | 3300035171 | Bacteria | 5427 |
| 801 | Ga0373946_0084970 | 3300035171 | Bacteria | 1393 |
| 802 | Ga0373955_0003013 | 3300035172 | Bacteria | 7382 |
| 803 | Ga0373955_0004843 | 3300035172 | Bacteria | 6000 |
| 804 | Ga0373955_0010601 | 3300035172 | Bacteria | 4359 |
| 805 | Ga0373955_0049136 | 3300035172 | Bacteria | 2290 |
| 806 | Ga0373955_0374692 | 3300035172 | Bacteria | 863 |
| 807 | Ga0373942_0002310 | 3300035207 | Bacteria | 4661 |
| 808 | Ga0373942_0112143 | 3300035207 | Bacteria | 844 |
| 809 | Ga0373961_0031030 | 3300035241 | Bacteria | 1490 |
| 810 | Ga0373961_0041626 | 3300035241 | Bacteria | 1328 |
| 811 | Ga0373961_0362807 | 3300035241 | Unclassified | 549 |
| 812 | Ga0373962_0003472 | 3300035242 | Bacteria | 3785 |
| 813 | Ga0373962_0044976 | 3300035242 | Bacteria | 1256 |
| 814 | Ga0373962_0055949 | 3300035242 | Bacteria | 1147 |
| 815 | Ga0373924_0001803 | 3300035410 | Bacteria | 7079 |
| 816 | Ga0373924_0170261 | 3300035410 | Bacteria | 957 |
| 817 | Ga0373924_0237640 | 3300035410 | Bacteria | 806 |
| 818 | Ga0373924_0453123 | 3300035410 | Bacteria | 575 |
| 819 | Ga0373931_0008043 | 3300035691 | Bacteria | 4989 |
| 820 | Ga0373931_0025914 | 3300035691 | Bacteria | 2979 |
| 821 | Ga0373931_0145273 | 3300035691 | Bacteria | 1378 |
| 822 | Ga0373935_0008653 | 3300035692 | Bacteria | 6095 |
| 823 | Ga0373935_0009334 | 3300035692 | Bacteria | 5875 |
| 824 | Ga0373935_0017120 | 3300035692 | Bacteria | 4391 |
| 825 | Ga0373935_0315659 | 3300035692 | Bacteria | 1108 |
| 826 | Ga0373935_0545746 | 3300035692 | Bacteria | 845 |
| 827 | Ga0373927_0003867 | 3300035695 | Bacteria | 10616 |
| 828 | Ga0373927_0025567 | 3300035695 | Bacteria | 3860 |
| 829 | Ga0373927_0047557 | 3300035695 | Bacteria | 2775 |
| 830 | Ga0373927_1053640 | 3300035695 | Bacteria | 536 |
| 831 | Ga0373933_0011420 | 3300035724 | Bacteria | 4894 |
| 832 | Ga0373933_0132734 | 3300035724 | Bacteria | 1567 |
| 833 | Ga0373933_0579332 | 3300035724 | Bacteria | 737 |
| 834 | Ga0373933_0676686 | 3300035724 | Bacteria | 678 |
| 835 | Ga0373947_0009320 | 3300035725 | Bacteria | 5640 |
| 836 | Ga0373947_0012283 | 3300035725 | Bacteria | 4906 |
| 837 | Ga0373947_0020184 | 3300035725 | Bacteria | 3845 |
| 838 | Ga0373947_0171729 | 3300035725 | Bacteria | 1407 |
| 839 | Ga0373947_0611576 | 3300035725 | Bacteria | 743 |
| 840 | Ga0373937_0004490 | 3300036401 | Bacteria | 11855 |
| 841 | Ga0373937_0013915 | 3300036401 | Bacteria | 7093 |
| 842 | Ga0373937_0053957 | 3300036401 | Bacteria | 3687 |
| 843 | Ga0373937_0074055 | 3300036401 | Bacteria | 3142 |
| 844 | Ga0373937_0146662 | 3300036401 | Bacteria | 2209 |
| 845 | Ga0373937_0240075 | 3300036401 | Bacteria | 1707 |
| 846 | Ga0373937_0488169 | 3300036401 | Bacteria | 1170 |
| 847 | Ga0373937_0946801 | 3300036401 | Bacteria | 810 |
| 848 | Ga0373925_0011259 | 3300037068 | Bacteria | 6488 |
| 849 | Ga0373925_0017194 | 3300037068 | Bacteria | 5238 |
| 850 | Ga0373925_0080367 | 3300037068 | Bacteria | 2478 |
| 851 | Ga0373925_0518917 | 3300037068 | Bacteria | 979 |
| 852 | Ga0373925_0550777 | 3300037068 | Bacteria | 948 |
| 853 | Ga0373925_0977997 | 3300037068 | Bacteria | 697 |
| 854 | Ga0373925_1643243 | 3300037068 | Bacteria | 525 |
| 855 | Ga0395898_0318698 | 3300037466 | Bacteria | 1483 |
| 856 | Ga0436364_0054321 | 3300037853 | Bacteria | 2875 |
| 857 | Ga0436364_1490302 | 3300037853 | Bacteria | 943 |
| 858 | Ga0395901_0435780 | 3300038443 | Bacteria | 1342 |
| 859 | Ga0436365_0630650 | 3300039437 | Bacteria | 763 |
| 860 | Ga0436365_0653482 | 3300039437 | Bacteria | 556 |
| 861 | Ga0436365_0842200 | 3300039437 | Bacteria | 6262 |
| 862 | Ga0436365_0884037 | 3300039437 | Bacteria | 556 |
| 863 | Ga0436365_0925593 | 3300039437 | Bacteria | 680 |
| 864 | Ga0436365_1179558 | 3300039437 | Bacteria | 877 |
| 865 | Ga0436365_1841819 | 3300039437 | Bacteria | 1571 |
| 866 | Ga0436361_0973070 | 3300039447 | Bacteria | 1227 |
| 867 | Ga0436363_1533352 | 3300039450 | Bacteria | 1506 |
| 868 | Ga0439453_0125858 | 3300041408 | Bacteria | 591 |
| 869 | Ga0451800_1492021 | 3300041459 | Bacteria | 1044 |
| 870 | Ga0451807_0870982 | 3300041486 | Bacteria | 626 |
| 871 | Ga0439437_034738 | 3300042000 | Bacteria | 642 |
| 872 | Ga0439441_025351 | 3300042001 | Bacteria | 1119 |
| 873 | Ga0439450_052964 | 3300042008 | Bacteria | 968 |
| 874 | Ga0439463_182751 | 3300042016 | Bacteria | 544 |
| 875 | Ga0439446_0157950 | 3300042156 | Bacteria | 749 |
| 876 | Ga0439464_0082917 | 3300042439 | Bacteria | 959 |
| 877 | Ga0439460_0192335 | 3300042461 | Bacteria | 693 |
| 878 | Ga0466963_0193222 | 3300044694 | Bacteria | 1422 |
| 879 | Ga0466967_0033052 | 3300045976 | Bacteria | 4376 |
| 880 | Ga0466967_2158738 | 3300045976 | Bacteria | 553 |
| 881 | Ga0495617_047776 | 3300046452 | Bacteria | 1424 |
| 882 | Ga0495627_071409 | 3300046453 | Bacteria | 1014 |
| 883 | Ga0495592_0016847 | 3300046454 | Bacteria | 5549 |
| 884 | Ga0495592_0028202 | 3300046454 | Bacteria | 4253 |
| 885 | Ga0495603_0024080 | 3300046455 | Bacteria | 3682 |
| 886 | Ga0495603_0042104 | 3300046455 | Bacteria | 2730 |
| 887 | Ga0495603_0059379 | 3300046455 | Bacteria | 2261 |
| 888 | Ga0495591_018137 | 3300046458 | Bacteria | 2394 |
| 889 | Ga0495629_0001465 | 3300046459 | Bacteria | 18592 |
| 890 | Ga0495629_0031322 | 3300046459 | Bacteria | 3766 |
| 891 | Ga0495629_0285196 | 3300046459 | Bacteria | 1132 |
| 892 | Ga0495641_0006019 | 3300046461 | Bacteria | 7983 |
| 893 | Ga0495641_0010900 | 3300046461 | Bacteria | 5225 |
| 894 | Ga0495641_0086781 | 3300046461 | Bacteria | 1400 |
| 895 | Ga0495651_0002165 | 3300046462 | Bacteria | 15211 |
| 896 | Ga0495651_0050457 | 3300046462 | Bacteria | 3210 |
| 897 | Ga0495651_0137084 | 3300046462 | Bacteria | 1779 |
| 898 | Ga0495651_0188281 | 3300046462 | Bacteria | 1454 |
| 899 | Ga0495651_0661335 | 3300046462 | Bacteria | 654 |
| 900 | Ga0495653_0018668 | 3300046463 | Bacteria | 5630 |
| 901 | Ga0495653_0327263 | 3300046463 | Bacteria | 992 |
| 902 | Ga0495653_0383617 | 3300046463 | Bacteria | 897 |
| 903 | Ga0495653_0443862 | 3300046463 | Unclassified | 817 |
| 904 | Ga0495653_0517306 | 3300046463 | Bacteria | 742 |
| 905 | Ga0495580_0005009 | 3300046472 | Bacteria | 11048 |
| 906 | Ga0495580_0125642 | 3300046472 | Bacteria | 1780 |
| 907 | Ga0495580_0473017 | 3300046472 | Bacteria | 839 |
| 908 | Ga0495582_0000570 | 3300046473 | Bacteria | 20403 |
| 909 | Ga0495582_0004754 | 3300046473 | Bacteria | 7634 |
| 910 | Ga0495582_0038169 | 3300046473 | Bacteria | 2642 |
| 911 | Ga0495582_0170849 | 3300046473 | Bacteria | 1238 |
| 912 | Ga0495582_0461088 | 3300046473 | Bacteria | 734 |
| 913 | Ga0495582_0498982 | 3300046473 | Bacteria | 704 |
| 914 | Ga0495605_0048845 | 3300046474 | Bacteria | 2070 |
| 915 | Ga0495639_0022702 | 3300046475 | Bacteria | 2753 |
| 916 | Ga0495662_0002431 | 3300046476 | Bacteria | 9362 |
| 917 | Ga0495662_0042738 | 3300046476 | Bacteria | 2188 |
| 918 | Ga0495662_0520017 | 3300046476 | Bacteria | 583 |
| 919 | Ga0495664_0000563 | 3300046477 | Bacteria | 18692 |
| 920 | Ga0495664_0547996 | 3300046477 | Bacteria | 689 |
| 921 | Ga0495664_0605882 | 3300046477 | Bacteria | 651 |
| 922 | Ga0495584_0045363 | 3300046491 | Bacteria | 2217 |
| 923 | Ga0495584_0164348 | 3300046491 | Bacteria | 1128 |
| 924 | Ga0495585_0002912 | 3300046492 | Bacteria | 11854 |
| 925 | Ga0495585_0015407 | 3300046492 | Bacteria | 4443 |
| 926 | Ga0495594_0003570 | 3300046499 | Bacteria | 8001 |
| 927 | Ga0495594_0074658 | 3300046499 | Bacteria | 1889 |
| 928 | Ga0495594_0311049 | 3300046499 | Bacteria | 897 |
| 929 | Ga0495596_0258994 | 3300046500 | Bacteria | 675 |
| 930 | Ga0495607_0010398 | 3300046501 | Bacteria | 6258 |
| 931 | Ga0495583_0083008 | 3300046506 | Bacteria | 1390 |
| 932 | Ga0495608_0015292 | 3300046511 | Bacteria | 5324 |
| 933 | Ga0495608_0058752 | 3300046511 | Bacteria | 2535 |
| 934 | Ga0495608_0264149 | 3300046511 | Bacteria | 1071 |
| 935 | Ga0495608_0845019 | 3300046511 | Bacteria | 538 |
| 936 | Ga0495616_0069100 | 3300046513 | Bacteria | 1714 |
| 937 | Ga0495616_0141795 | 3300046513 | Bacteria | 1093 |
| 938 | Ga0495618_0088636 | 3300046514 | Bacteria | 1978 |
| 939 | Ga0495618_0288003 | 3300046514 | Bacteria | 1023 |
| 940 | Ga0495618_0344270 | 3300046514 | Bacteria | 920 |
| 941 | Ga0495620_0412356 | 3300046515 | Unclassified | 511 |
| 942 | Ga0495628_0011495 | 3300046516 | Bacteria | 7483 |
| 943 | Ga0495628_0197535 | 3300046516 | Bacteria | 1517 |
| 944 | Ga0495630_0017154 | 3300046517 | Bacteria | 5301 |
| 945 | Ga0495630_0138809 | 3300046517 | Bacteria | 1847 |
| 946 | Ga0495630_0305316 | 3300046517 | Bacteria | 1216 |
| 947 | Ga0495631_0102226 | 3300046518 | Bacteria | 1233 |
| 948 | Ga0495631_0213349 | 3300046518 | Bacteria | 825 |
| 949 | Ga0495637_0046164 | 3300046520 | Bacteria | 1844 |
| 950 | Ga0495643_0156009 | 3300046522 | Bacteria | 1127 |
| 951 | Ga0495644_0003284 | 3300046523 | Bacteria | 6395 |
| 952 | Ga0495644_0006910 | 3300046523 | Bacteria | 4393 |
| 953 | Ga0495644_0077657 | 3300046523 | Bacteria | 1251 |
| 954 | Ga0495663_0005215 | 3300046525 | Bacteria | 3619 |
| 955 | Ga0495663_0056811 | 3300046525 | Bacteria | 1223 |
| 956 | Ga0495666_0010760 | 3300046526 | Bacteria | 4564 |
| 957 | Ga0495666_0016580 | 3300046526 | Bacteria | 3669 |
| 958 | Ga0495642_0176577 | 3300046528 | Bacteria | 929 |
| 959 | Ga0495652_0046062 | 3300046529 | Bacteria | 3745 |
| 960 | Ga0495652_0246050 | 3300046529 | Bacteria | 1328 |
| 961 | Ga0495652_0265955 | 3300046529 | Bacteria | 1263 |
| 962 | Ga0495652_0266252 | 3300046529 | Bacteria | 1262 |
| 963 | Ga0495665_0038357 | 3300046531 | Bacteria | 2554 |
| 964 | Ga0495640_0032280 | 3300046533 | Bacteria | 3730 |
| 965 | Ga0495640_0061356 | 3300046533 | Bacteria | 2554 |
| 966 | Ga0495640_0194843 | 3300046533 | Bacteria | 1287 |
| 967 | Ga0495640_0489042 | 3300046533 | Bacteria | 749 |
| 968 | Ga0495586_0029902 | 3300046535 | Bacteria | 2916 |
| 969 | Ga0495587_0142855 | 3300046536 | Bacteria | 1365 |
| 970 | Ga0495587_0493686 | 3300046536 | Bacteria | 677 |
| 971 | Ga0495598_0014447 | 3300046537 | Bacteria | 1975 |
| 972 | Ga0495598_0015165 | 3300046537 | Bacteria | 1940 |
| 973 | Ga0495598_0064546 | 3300046537 | Bacteria | 1138 |
| 974 | Ga0495609_0041279 | 3300046538 | Bacteria | 2074 |
| 975 | Ga0495609_0239370 | 3300046538 | Bacteria | 749 |
| 976 | Ga0495609_0329814 | 3300046538 | Bacteria | 618 |
| 977 | Ga0495621_0049037 | 3300046539 | Bacteria | 1506 |
| 978 | Ga0495621_0151086 | 3300046539 | Bacteria | 914 |
| 979 | Ga0495645_0081407 | 3300046543 | Bacteria | 2323 |
| 980 | Ga0495645_0268481 | 3300046543 | Bacteria | 1127 |
| 981 | Ga0495645_0962271 | 3300046543 | Bacteria | 504 |
| 982 | Ga0495622_0000406 | 3300046557 | Bacteria | 28954 |
| 983 | Ga0495622_0052146 | 3300046557 | Bacteria | 1898 |
| 984 | Ga0495633_0005373 | 3300046558 | Bacteria | 7855 |
| 985 | Ga0495667_0017377 | 3300046559 | Bacteria | 4858 |
| 986 | Ga0495667_0020065 | 3300046559 | Bacteria | 4509 |
| 987 | Ga0495667_0137156 | 3300046559 | Bacteria | 1577 |
| 988 | Ga0495667_0172601 | 3300046559 | Bacteria | 1389 |
| 989 | Ga0495667_1003053 | 3300046559 | Unclassified | 509 |
| 990 | Ga0495656_0000554 | 3300046615 | Bacteria | 12229 |
| 991 | Ga0495656_0108803 | 3300046615 | Bacteria | 1293 |
| 992 | Ga0495656_0408502 | 3300046615 | Bacteria | 711 |
| 993 | Ga0495668_0201057 | 3300046616 | Bacteria | 1091 |
| 994 | Ga0495634_0154428 | 3300046642 | Bacteria | 1449 |
| 995 | Ga0495634_0410072 | 3300046642 | Bacteria | 804 |
| 996 | Ga0495634_0410270 | 3300046642 | Bacteria | 803 |
| 997 | Ga0495634_0832807 | 3300046642 | Unclassified | 525 |
| 998 | Ga0495611_0197505 | 3300046648 | Bacteria | 939 |
| 999 | Ga0495635_0016723 | 3300046663 | Bacteria | 5125 |
| 1000 | Ga0495635_0024301 | 3300046663 | Bacteria | 4224 |
| 1001 | Ga0495635_0304205 | 3300046663 | Bacteria | 1069 |
| 1002 | Ga0495635_0621395 | 3300046663 | Unclassified | 704 |
| 1003 | Ga0495635_0752914 | 3300046663 | Bacteria | 630 |
| 1004 | Ga0495635_1011378 | 3300046663 | Unclassified | 529 |
| 1005 | Ga0495659_0005523 | 3300046664 | Bacteria | 3978 |
| 1006 | Ga0495659_0093023 | 3300046664 | Bacteria | 1160 |
| 1007 | Ga0495661_0076068 | 3300046665 | Bacteria | 1949 |
| 1008 | Ga0495661_0122326 | 3300046665 | Bacteria | 1436 |
| 1009 | Ga0495661_0170850 | 3300046665 | Bacteria | 1160 |
| 1010 | Ga0495588_0029913 | 3300046674 | Bacteria | 2734 |
| 1011 | Ga0495588_0088794 | 3300046674 | Bacteria | 1618 |
| 1012 | Ga0495657_0008729 | 3300046675 | Bacteria | 7737 |
| 1013 | Ga0495657_0196933 | 3300046675 | Bacteria | 1229 |
| 1014 | Ga0495657_0589601 | 3300046675 | Bacteria | 644 |
| 1015 | Ga0495599_0020724 | 3300046678 | Bacteria | 4097 |
| 1016 | Ga0495623_0688389 | 3300046679 | Bacteria | 524 |
| 1017 | Ga0495646_0042474 | 3300046680 | Bacteria | 2789 |
| 1018 | Ga0495646_0144375 | 3300046680 | Bacteria | 1328 |
| 1019 | Ga0495646_0307843 | 3300046680 | Bacteria | 837 |
| 1020 | Ga0495647_0001486 | 3300046681 | Bacteria | 7275 |
| 1021 | Ga0495647_0031744 | 3300046681 | Bacteria | 1965 |
| 1022 | Ga0495647_0097708 | 3300046681 | Unclassified | 1212 |
| 1023 | Ga0495658_0000543 | 3300046683 | Bacteria | 20578 |
| 1024 | Ga0495658_0002466 | 3300046683 | Bacteria | 9317 |
| 1025 | Ga0495658_0028883 | 3300046683 | Bacteria | 2997 |
| 1026 | Ga0495658_0053388 | 3300046683 | Bacteria | 2295 |
| 1027 | Ga0495658_0239013 | 3300046683 | Bacteria | 1140 |
| 1028 | Ga0495658_1118969 | 3300046683 | Bacteria | 502 |
| 1029 | Ga0495669_0020229 | 3300046684 | Bacteria | 2879 |
| 1030 | Ga0495669_0085587 | 3300046684 | Bacteria | 1451 |
| 1031 | Ga0495613_0034941 | 3300046689 | Bacteria | 3732 |
| 1032 | Ga0495613_0153601 | 3300046689 | Bacteria | 1640 |
| 1033 | Ga0495624_0018605 | 3300046690 | Bacteria | 4645 |
| 1034 | Ga0495624_0027306 | 3300046690 | Bacteria | 3737 |
| 1035 | Ga0495670_0008274 | 3300046691 | Bacteria | 5114 |
| 1036 | Ga0495670_0030996 | 3300046691 | Bacteria | 2656 |
| 1037 | Ga0495670_0793193 | 3300046691 | Bacteria | 517 |
| 1038 | Ga0495671_0123171 | 3300046692 | Bacteria | 1264 |
| 1039 | Ga0495649_0040457 | 3300046694 | Bacteria | 2553 |
| 1040 | Ga0495589_0186331 | 3300046794 | Bacteria | 983 |
| 1041 | Ga0495589_0237976 | 3300046794 | Bacteria | 852 |
| 1042 | Ga0495600_0006388 | 3300046809 | Bacteria | 7175 |
| 1043 | Ga0495600_0156242 | 3300046809 | Bacteria | 1475 |
| 1044 | Ga0495581_0003432 | 3300047315 | Bacteria | 9101 |
| 1045 | Ga0495581_0010955 | 3300047315 | Bacteria | 5240 |
| 1046 | Ga0495581_0019117 | 3300047315 | Bacteria | 3977 |
| 1047 | Ga0495581_0626326 | 3300047315 | Bacteria | 622 |
| 1048 | Ga0495604_0013474 | 3300047317 | Bacteria | 6513 |
| 1049 | Ga0495604_0064795 | 3300047317 | Bacteria | 2783 |
| 1050 | Ga0495604_0261884 | 3300047317 | Bacteria | 1175 |
| 1051 | Ga0495604_0572959 | 3300047317 | Bacteria | 726 |
| 1052 | Ga0495636_0176187 | 3300047318 | Bacteria | 969 |
| 1053 | Ga0495674_0026343 | 3300047319 | Bacteria | 5320 |
| 1054 | Ga0495674_0177497 | 3300047319 | Bacteria | 1774 |
| 1055 | Ga0495674_0326614 | 3300047319 | Bacteria | 1249 |
| 1056 | Ga0495674_0626821 | 3300047319 | Bacteria | 850 |
| 1057 | Ga0495674_1253152 | 3300047319 | Unclassified | 558 |
| 1058 | Ga0495672_0101953 | 3300047320 | Bacteria | 1555 |
| 1059 | Ga0495672_0106572 | 3300047320 | Bacteria | 1511 |
| 1060 | Ga0495672_0179645 | 3300047320 | Bacteria | 1073 |
| 1061 | Ga0495676_0013899 | 3300047321 | Bacteria | 7217 |
| 1062 | Ga0495676_0035160 | 3300047321 | Bacteria | 4193 |
| 1063 | Ga0495676_0125529 | 3300047321 | Bacteria | 1860 |
| 1064 | Ga0495676_0233848 | 3300047321 | Bacteria | 1261 |
| 1065 | Ga0495680_0006933 | 3300047322 | Bacteria | 10457 |
| 1066 | Ga0495680_0012328 | 3300047322 | Bacteria | 7529 |
| 1067 | Ga0495680_0061381 | 3300047322 | Bacteria | 2892 |
| 1068 | Ga0495680_0330036 | 3300047322 | Bacteria | 1066 |
| 1069 | Ga0495683_0249865 | 3300047323 | Bacteria | 779 |
| 1070 | Ga0495683_0286823 | 3300047323 | Bacteria | 711 |
| 1071 | Ga0495675_0020224 | 3300047444 | Bacteria | 4232 |
| 1072 | Ga0495675_0253145 | 3300047444 | Bacteria | 1057 |
| 1073 | Ga0495679_027076 | 3300047446 | Bacteria | 1896 |
| 1074 | Ga0495684_0055089 | 3300047471 | Bacteria | 3032 |
| 1075 | Ga0495684_0058031 | 3300047471 | Bacteria | 2949 |
| 1076 | Ga0495684_0193134 | 3300047471 | Unclassified | 1504 |
| 1077 | Ga0495684_0886100 | 3300047471 | Bacteria | 576 |
| 1078 | Ga0495593_0003620 | 3300047673 | Bacteria | 9229 |
| 1079 | Ga0495593_0333250 | 3300047673 | Bacteria | 758 |
| 1080 | Ga0495602_0070224 | 3300048088 | Bacteria | 2999 |
| 1081 | Ga0495602_0412012 | 3300048088 | Bacteria | 961 |
| 1082 | Ga0495602_0462834 | 3300048088 | Bacteria | 893 |
| 1083 | Ga0495614_0019302 | 3300048089 | Bacteria | 2950 |
| 1084 | Ga0496100_0003363 | 3300048903 | Bacteria | 8326 |
| 1085 | Ga0496100_0015421 | 3300048903 | Bacteria | 4462 |
| 1086 | Ga0496100_0016403 | 3300048903 | Bacteria | 4350 |
| 1087 | Ga0496100_0031260 | 3300048903 | Bacteria | 3308 |
| 1088 | Ga0496100_0116497 | 3300048903 | Bacteria | 1864 |
| 1089 | Ga0496100_0194514 | 3300048903 | Bacteria | 1474 |
| 1090 | Ga0496100_0389634 | 3300048903 | Bacteria | 1059 |
| 1091 | Ga0496101_0001983 | 3300048904 | Bacteria | 12419 |
| 1092 | Ga0496101_0002395 | 3300048904 | Bacteria | 11503 |
| 1093 | Ga0496101_0029082 | 3300048904 | Bacteria | 3863 |
| 1094 | Ga0496101_0127119 | 3300048904 | Bacteria | 1932 |
| 1095 | Ga0496101_0182014 | 3300048904 | Bacteria | 1618 |
| 1096 | Ga0496101_0242662 | 3300048904 | Bacteria | 1402 |
| 1097 | Ga0496101_0388549 | 3300048904 | Bacteria | 1098 |
| 1098 | Ga0496101_0431248 | 3300048904 | Unclassified | 1039 |
| 1099 | Ga0496101_1179423 | 3300048904 | Bacteria | 600 |
| 1100 | Ga0496102_0002614 | 3300048905 | Bacteria | 15316 |
| 1101 | Ga0496102_0002793 | 3300048905 | Bacteria | 14888 |
| 1102 | Ga0496102_0016941 | 3300048905 | Bacteria | 6377 |
| 1103 | Ga0496102_0028300 | 3300048905 | Bacteria | 5005 |
| 1104 | Ga0496102_0031173 | 3300048905 | Bacteria | 4780 |
| 1105 | Ga0496102_0220102 | 3300048905 | Bacteria | 1789 |
| 1106 | Ga0496102_0222643 | 3300048905 | Bacteria | 1779 |
| 1107 | Ga0496102_1061322 | 3300048905 | Bacteria | 730 |
| 1108 | Ga0496103_0002369 | 3300048906 | Bacteria | 11883 |
| 1109 | Ga0496103_0020821 | 3300048906 | Bacteria | 3943 |
| 1110 | Ga0496103_0021619 | 3300048906 | Bacteria | 3871 |
| 1111 | Ga0496103_0058182 | 3300048906 | Bacteria | 2401 |
| 1112 | Ga0496103_0183089 | 3300048906 | Bacteria | 1346 |
| 1113 | Ga0496103_0207186 | 3300048906 | Bacteria | 1261 |
| 1114 | Ga0496103_0716510 | 3300048906 | Bacteria | 634 |
| 1115 | Ga0496104_0003070 | 3300048907 | Bacteria | 14395 |
| 1116 | Ga0496104_0004660 | 3300048907 | Bacteria | 11929 |
| 1117 | Ga0496104_0017458 | 3300048907 | Bacteria | 6534 |
| 1118 | Ga0496104_0042670 | 3300048907 | Bacteria | 4257 |
| 1119 | Ga0496104_0053307 | 3300048907 | Bacteria | 3820 |
| 1120 | Ga0496104_0073885 | 3300048907 | Bacteria | 3244 |
| 1121 | Ga0496104_0137363 | 3300048907 | Bacteria | 2348 |
| 1122 | Ga0496104_0146743 | 3300048907 | Bacteria | 2265 |
| 1123 | Ga0496105_0003019 | 3300048908 | Bacteria | 12365 |
| 1124 | Ga0496105_0007082 | 3300048908 | Bacteria | 8644 |
| 1125 | Ga0496105_0016356 | 3300048908 | Bacteria | 5921 |
| 1126 | Ga0496105_0034082 | 3300048908 | Bacteria | 4186 |
| 1127 | Ga0496105_0173296 | 3300048908 | Bacteria | 1768 |
| 1128 | Ga0496105_0384483 | 3300048908 | Bacteria | 1116 |
| 1129 | Ga0496105_0715503 | 3300048908 | Bacteria | 767 |
| 1130 | Ga0496105_0784515 | 3300048908 | Unclassified | 725 |
| 1131 | Ga0496105_1042679 | 3300048908 | Unclassified | 610 |
| 1132 | Ga0496106_0001912 | 3300048909 | Bacteria | 15607 |
| 1133 | Ga0496106_0007123 | 3300048909 | Bacteria | 8258 |
| 1134 | Ga0496106_0010646 | 3300048909 | Bacteria | 6795 |
| 1135 | Ga0496106_0033866 | 3300048909 | Bacteria | 3813 |
| 1136 | Ga0496106_0049304 | 3300048909 | Bacteria | 3172 |
| 1137 | Ga0496106_0102418 | 3300048909 | Bacteria | 2221 |
| 1138 | Ga0496106_0210567 | 3300048909 | Bacteria | 1548 |
| 1139 | Ga0496106_0359577 | 3300048909 | Bacteria | 1169 |
| 1140 | Ga0496106_1222185 | 3300048909 | Unclassified | 585 |
| 1141 | Ga0496107_0000684 | 3300048910 | Bacteria | 19232 |
| 1142 | Ga0496107_0005855 | 3300048910 | Bacteria | 8416 |
| 1143 | Ga0496107_0006823 | 3300048910 | Bacteria | 7864 |
| 1144 | Ga0496107_0019014 | 3300048910 | Bacteria | 4844 |
| 1145 | Ga0496107_0039820 | 3300048910 | Bacteria | 3372 |
| 1146 | Ga0496107_0051559 | 3300048910 | Bacteria | 2968 |
| 1147 | Ga0496107_0365581 | 3300048910 | Bacteria | 1073 |
| 1148 | Ga0496107_0820707 | 3300048910 | Bacteria | 680 |
| 1149 | Ga0496107_1039177 | 3300048910 | Bacteria | 593 |
| 1150 | Ga0496108_0000951 | 3300048911 | Bacteria | 22499 |
| 1151 | Ga0496108_0016761 | 3300048911 | Bacteria | 5985 |
| 1152 | Ga0496108_0017326 | 3300048911 | Bacteria | 5892 |
| 1153 | Ga0496108_0029894 | 3300048911 | Bacteria | 4515 |
| 1154 | Ga0496108_0052548 | 3300048911 | Bacteria | 3415 |
| 1155 | Ga0496108_0426480 | 3300048911 | Unclassified | 1158 |
| 1156 | Ga0496108_0448572 | 3300048911 | Bacteria | 1127 |
| 1157 | Ga0496108_0481997 | 3300048911 | Bacteria | 1083 |
| 1158 | Ga0496108_0725892 | 3300048911 | Bacteria | 860 |
| 1159 | Ga0496108_0850189 | 3300048911 | Bacteria | 785 |
| 1160 | Ga0496108_1623085 | 3300048911 | Bacteria | 534 |
| 1161 | Ga0496109_0004879 | 3300048912 | Bacteria | 11202 |
| 1162 | Ga0496109_0010573 | 3300048912 | Bacteria | 7892 |
| 1163 | Ga0496109_0017589 | 3300048912 | Bacteria | 6269 |
| 1164 | Ga0496109_0021372 | 3300048912 | Bacteria | 5721 |
| 1165 | Ga0496109_0037905 | 3300048912 | Bacteria | 4356 |
| 1166 | Ga0496109_0277762 | 3300048912 | Bacteria | 1578 |
| 1167 | Ga0496109_0469346 | 3300048912 | Bacteria | 1188 |
| 1168 | Ga0496109_0547916 | 3300048912 | Bacteria | 1091 |
| 1169 | Ga0496109_0572689 | 3300048912 | Bacteria | 1064 |
| 1170 | Ga0496109_1081041 | 3300048912 | Unclassified | 739 |
| 1171 | Ga0496110_0010330 | 3300048913 | Bacteria | 7588 |
| 1172 | Ga0496110_0025021 | 3300048913 | Bacteria | 5096 |
| 1173 | Ga0496110_0033011 | 3300048913 | Bacteria | 4475 |
| 1174 | Ga0496110_0148396 | 3300048913 | Bacteria | 2122 |
| 1175 | Ga0496110_0195249 | 3300048913 | Bacteria | 1838 |
| 1176 | Ga0496110_0235839 | 3300048913 | Bacteria | 1664 |
| 1177 | Ga0496110_0413577 | 3300048913 | Bacteria | 1229 |
| 1178 | Ga0496110_0766572 | 3300048913 | Bacteria | 868 |
| 1179 | Ga0496111_0002467 | 3300048914 | Bacteria | 11163 |
| 1180 | Ga0496111_0015671 | 3300048914 | Bacteria | 5209 |
| 1181 | Ga0496111_0028559 | 3300048914 | Bacteria | 3953 |
| 1182 | Ga0496111_0033708 | 3300048914 | Bacteria | 3653 |
| 1183 | Ga0496111_0040561 | 3300048914 | Bacteria | 3339 |
| 1184 | Ga0496111_0341480 | 3300048914 | Bacteria | 1108 |
| 1185 | Ga0496112_0007378 | 3300048915 | Bacteria | 9759 |
| 1186 | Ga0496112_0023680 | 3300048915 | Bacteria | 5872 |
| 1187 | Ga0496112_0057371 | 3300048915 | Bacteria | 3833 |
| 1188 | Ga0496112_0060168 | 3300048915 | Bacteria | 3742 |
| 1189 | Ga0496112_0063132 | 3300048915 | Bacteria | 3653 |
| 1190 | Ga0496112_0189422 | 3300048915 | Bacteria | 2019 |
| 1191 | Ga0496112_0612371 | 3300048915 | Bacteria | 1020 |
| 1192 | Ga0496112_0615256 | 3300048915 | Bacteria | 1017 |
| 1193 | Ga0496112_0643787 | 3300048915 | Unclassified | 990 |
| 1194 | Ga0496113_0000043 | 3300048916 | Bacteria | 52544 |
| 1195 | Ga0496113_0004559 | 3300048916 | Bacteria | 8532 |
| 1196 | Ga0496113_0019261 | 3300048916 | Bacteria | 4771 |
| 1197 | Ga0496113_0022484 | 3300048916 | Bacteria | 4461 |
| 1198 | Ga0496113_0023083 | 3300048916 | Bacteria | 4408 |
| 1199 | Ga0496113_0070377 | 3300048916 | Bacteria | 2659 |
| 1200 | Ga0496113_0105396 | 3300048916 | Bacteria | 2189 |
| 1201 | Ga0496114_0007468 | 3300048917 | Bacteria | 8642 |
| 1202 | Ga0496114_0036470 | 3300048917 | Bacteria | 4065 |
| 1203 | Ga0496114_0045150 | 3300048917 | Bacteria | 3659 |
| 1204 | Ga0496114_0080971 | 3300048917 | Bacteria | 2742 |
| 1205 | Ga0496114_0221242 | 3300048917 | Bacteria | 1662 |
| 1206 | Ga0496114_0375589 | 3300048917 | Bacteria | 1258 |
| 1207 | Ga0496115_0002647 | 3300048918 | Bacteria | 12855 |
| 1208 | Ga0496115_0003701 | 3300048918 | Bacteria | 11002 |
| 1209 | Ga0496115_0008385 | 3300048918 | Bacteria | 7647 |
| 1210 | Ga0496115_0030611 | 3300048918 | Bacteria | 4235 |
| 1211 | Ga0496115_0090923 | 3300048918 | Bacteria | 2494 |
| 1212 | Ga0496115_0097906 | 3300048918 | Bacteria | 2402 |
| 1213 | Ga0496115_0132287 | 3300048918 | Bacteria | 2056 |
| 1214 | Ga0496115_0307845 | 3300048918 | Bacteria | 1297 |
| 1215 | Ga0496115_0798912 | 3300048918 | Bacteria | 734 |
| 1216 | Ga0496119_0320507 | 3300048922 | Bacteria | 759 |
| 1217 | Ga0496121_0280117 | 3300048924 | Bacteria | 1141 |
| 1218 | Ga0501031_0104617 | 3300049568 | Bacteria | 1847 |
| 1219 | Ga0501031_0248268 | 3300049568 | Bacteria | 1157 |
| 1220 | Ga0501031_0466125 | 3300049568 | Bacteria | 816 |
| 1221 | Ga0501032_0078980 | 3300049569 | Bacteria | 2191 |
| 1222 | Ga0501032_0285164 | 3300049569 | Bacteria | 1069 |
| 1223 | Ga0501032_0310148 | 3300049569 | Bacteria | 1019 |
| 1224 | Ga0501033_0037850 | 3300049570 | Bacteria | 3609 |
| 1225 | Ga0501033_0061139 | 3300049570 | Bacteria | 2777 |
| 1226 | Ga0501033_0305697 | 3300049570 | Bacteria | 1119 |
| 1227 | Ga0501033_0815407 | 3300049570 | Bacteria | 630 |
| 1228 | Ga0501033_0864931 | 3300049570 | Bacteria | 609 |
| 1229 | Ga0501034_0011170 | 3300049571 | Bacteria | 9321 |
| 1230 | Ga0501034_0114840 | 3300049571 | Bacteria | 2681 |
| 1231 | Ga0501034_0126832 | 3300049571 | Bacteria | 2537 |
| 1232 | Ga0501034_0166390 | 3300049571 | Bacteria | 2173 |
| 1233 | Ga0501034_0265926 | 3300049571 | Bacteria | 1657 |
| 1234 | Ga0501034_0406002 | 3300049571 | Bacteria | 1285 |
| 1235 | Ga0501034_0441180 | 3300049571 | Bacteria | 1220 |
| 1236 | Ga0501034_0488249 | 3300049571 | Bacteria | 1146 |
| 1237 | Ga0501036_0247682 | 3300049572 | Bacteria | 1494 |
| 1238 | Ga0501036_1129081 | 3300049572 | Bacteria | 640 |
| 1239 | Ga0501036_1546404 | 3300049572 | Bacteria | 536 |
| 1240 | Ga0501036_1582149 | 3300049572 | Bacteria | 529 |
| 1241 | Ga0501036_1737362 | 3300049572 | Bacteria | 502 |
| 1242 | Ga0501036_1741801 | 3300049572 | Bacteria | 502 |
| 1243 | Ga0501037_0083329 | 3300049573 | Bacteria | 2316 |
| 1244 | Ga0501037_0117592 | 3300049573 | Bacteria | 1913 |
| 1245 | Ga0501037_0701989 | 3300049573 | Bacteria | 673 |
| 1246 | Ga0501038_0037153 | 3300049574 | Bacteria | 4272 |
| 1247 | Ga0501038_0106265 | 3300049574 | Bacteria | 2330 |
| 1248 | Ga0501038_0196973 | 3300049574 | Bacteria | 1619 |
| 1249 | Ga0501038_0671420 | 3300049574 | Bacteria | 778 |
| 1250 | Ga0501038_1077093 | 3300049574 | Bacteria | 588 |
| 1251 | Ga0501039_0119194 | 3300049575 | Bacteria | 2067 |
| 1252 | Ga0501039_0665796 | 3300049575 | Bacteria | 815 |
| 1253 | Ga0501041_0970653 | 3300049577 | Bacteria | 546 |
| 1254 | Ga0501043_0354867 | 3300049579 | Bacteria | 1113 |
| 1255 | Ga0501043_1172341 | 3300049579 | Bacteria | 540 |
| 1256 | Ga0501046_0614014 | 3300049580 | Bacteria | 771 |
| 1257 | Ga0501046_0858666 | 3300049580 | Bacteria | 634 |
| 1258 | Ga0501047_0011566 | 3300049581 | Bacteria | 8352 |
| 1259 | Ga0501047_0096320 | 3300049581 | Bacteria | 2838 |
| 1260 | Ga0501047_0264236 | 3300049581 | Bacteria | 1568 |
| 1261 | Ga0501047_0315037 | 3300049581 | Bacteria | 1405 |
| 1262 | Ga0501047_0326096 | 3300049581 | Bacteria | 1374 |
| 1263 | Ga0501047_0338253 | 3300049581 | Bacteria | 1343 |
| 1264 | Ga0501047_0872598 | 3300049581 | Bacteria | 713 |
| 1265 | Ga0501047_1090625 | 3300049581 | Bacteria | 612 |
| 1266 | Ga0501048_0395343 | 3300049582 | Bacteria | 988 |
| 1267 | Ga0501048_0495679 | 3300049582 | Bacteria | 876 |
| 1268 | Ga0501067_0316199 | 3300049583 | Bacteria | 870 |
| 1269 | Ga0501068_0530139 | 3300049584 | Bacteria | 765 |
| 1270 | Ga0501068_1094629 | 3300049584 | Bacteria | 527 |
| 1271 | Ga0501069_0334441 | 3300049585 | Bacteria | 891 |
| 1272 | Ga0501070_0024998 | 3300049586 | Bacteria | 5009 |
| 1273 | Ga0501070_0199114 | 3300049586 | Bacteria | 1645 |
| 1274 | Ga0501070_0341850 | 3300049586 | Bacteria | 1216 |
| 1275 | Ga0501070_1119183 | 3300049586 | Bacteria | 607 |
| 1276 | Ga0501071_0022307 | 3300049587 | Bacteria | 4414 |
| 1277 | Ga0501071_0397018 | 3300049587 | Bacteria | 1053 |
| 1278 | Ga0501071_0923688 | 3300049587 | Bacteria | 673 |
| 1279 | Ga0501072_0248999 | 3300049588 | Bacteria | 1415 |
| 1280 | Ga0501072_0294764 | 3300049588 | Bacteria | 1289 |
| 1281 | Ga0501072_0525835 | 3300049588 | Bacteria | 935 |
| 1282 | Ga0501072_1106201 | 3300049588 | Bacteria | 616 |
| 1283 | Ga0501073_0161294 | 3300049589 | Bacteria | 1553 |
| 1284 | Ga0501073_0164878 | 3300049589 | Bacteria | 1534 |
| 1285 | Ga0501073_0682250 | 3300049589 | Bacteria | 709 |
| 1286 | Ga0501073_0851019 | 3300049589 | Bacteria | 628 |
| 1287 | Ga0501074_0058920 | 3300049590 | Bacteria | 2767 |
| 1288 | Ga0501074_0174760 | 3300049590 | Bacteria | 1533 |
| 1289 | Ga0501074_0826878 | 3300049590 | Bacteria | 652 |
| 1290 | Ga0501075_0197119 | 3300049591 | Bacteria | 1536 |
| 1291 | Ga0501075_0776258 | 3300049591 | Bacteria | 729 |
| 1292 | Ga0501076_0004238 | 3300049592 | Bacteria | 10148 |
| 1293 | Ga0501076_0613872 | 3300049592 | Bacteria | 897 |
| 1294 | Ga0501076_0622134 | 3300049592 | Bacteria | 891 |
| 1295 | Ga0501077_0090161 | 3300049593 | Bacteria | 1943 |
| 1296 | Ga0501077_0250185 | 3300049593 | Bacteria | 1127 |
| 1297 | Ga0501077_1113334 | 3300049593 | Unclassified | 508 |
| 1298 | Ga0501079_0189607 | 3300049741 | Bacteria | 1604 |
| 1299 | Ga0501080_0155676 | 3300049742 | Bacteria | 2111 |
| 1300 | Ga0501080_0181125 | 3300049742 | Bacteria | 1939 |
| 1301 | Ga0501080_0218938 | 3300049742 | Bacteria | 1743 |
| 1302 | Ga0501080_0298760 | 3300049742 | Bacteria | 1461 |
| 1303 | Ga0501081_0116221 | 3300049743 | Bacteria | 1902 |
| 1304 | Ga0501081_0462783 | 3300049743 | Bacteria | 943 |
| 1305 | Ga0501083_0014091 | 3300049744 | Bacteria | 5590 |
| 1306 | Ga0501083_0102673 | 3300049744 | Bacteria | 1885 |
| 1307 | Ga0501083_0396630 | 3300049744 | Bacteria | 898 |
| 1308 | Ga0501083_0571174 | 3300049744 | Bacteria | 736 |
| 1309 | Ga0501035_0025517 | 3300049822 | Bacteria | 5417 |
| 1310 | Ga0501035_0250857 | 3300049822 | Bacteria | 1503 |
| 1311 | Ga0501035_0459518 | 3300049822 | Bacteria | 1052 |
| 1312 | Ga0501044_0036606 | 3300049823 | Bacteria | 5134 |
| 1313 | Ga0501044_0119053 | 3300049823 | Bacteria | 2643 |
| 1314 | Ga0501044_0215110 | 3300049823 | Bacteria | 1875 |
| 1315 | Ga0501044_0248327 | 3300049823 | Bacteria | 1721 |
| 1316 | Ga0501044_0762780 | 3300049823 | Bacteria | 849 |
| 1317 | Ga0501044_1364163 | 3300049823 | Bacteria | 575 |
| 1318 | Ga0501044_1532839 | 3300049823 | Bacteria | 531 |
| 1319 | Ga0501045_0445821 | 3300049824 | Bacteria | 962 |
| 1320 | Ga0501045_0720253 | 3300049824 | Bacteria | 736 |
| 1321 | nmdc:mga03683_259195_c1 | 3300050489 | Bacteria | 809 |
| 1322 | nmdc:mga03683_357801_c1 | 3300050489 | Bacteria | 692 |
| 1323 | nmdc:mga03n38_188377_c1 | 3300050490 | Bacteria | 1061 |
| 1324 | nmdc:mga03n38_518282_c1 | 3300050490 | Bacteria | 671 |
| 1325 | nmdc:mga0yw44_10242_c2 | 3300050492 | Bacteria | 4376 |
| 1326 | nmdc:mga0yw44_1082862_c1 | 3300050492 | Unclassified | 542 |
| 1327 | nmdc:mga0yw44_303410_c1 | 3300050492 | Bacteria | 1070 |
| 1328 | nmdc:mga0yw44_56590_c1 | 3300050492 | Bacteria | 2390 |
| 1329 | nmdc:mga0yw44_813_c1 | 3300050492 | Bacteria | 11629 |
| 1330 | nmdc:mga0k408_184574_c1 | 3300050493 | Bacteria | 1244 |
| 1331 | nmdc:mga06z11_1002996_c1 | 3300050494 | Bacteria | 509 |
| 1332 | nmdc:mga06z11_181820_c1 | 3300050494 | Bacteria | 1213 |
| 1333 | nmdc:mga06z11_51514_c1 | 3300050494 | Bacteria | 2108 |
| 1334 | nmdc:mga06z11_923611_c1 | 3300050494 | Bacteria | 532 |
| 1335 | nmdc:mga04h51_27546_c1 | 3300050495 | Bacteria | 1766 |
| 1336 | nmdc:mga04h51_481589_c1 | 3300050495 | Unclassified | 528 |
| 1337 | nmdc:mga07m45_139450_c1 | 3300050496 | Bacteria | 1404 |
| 1338 | nmdc:mga07m45_61289_c1 | 3300050496 | Bacteria | 1134 |
| 1339 | nmdc:mga05p37_23570_c1 | 3300050507 | Bacteria | 7469 |
| 1340 | nmdc:mga05p37_300683_c1 | 3300050507 | Bacteria | 1907 |
| 1341 | nmdc:mga05p37_604329_c1 | 3300050507 | Bacteria | 1237 |
| 1342 | nmdc:mga09592_1341318_c1 | 3300050508 | Bacteria | 587 |
| 1343 | nmdc:mga09592_224426_c1 | 3300050508 | Bacteria | 1628 |
| 1344 | nmdc:mga09592_425938_c1 | 3300050508 | Bacteria | 1146 |
| 1345 | nmdc:mga09592_70139_c1 | 3300050508 | Bacteria | 2973 |
| 1346 | nmdc:mga0qj67_229704_c1 | 3300050509 | Bacteria | 1506 |
| 1347 | nmdc:mga0qj67_50_c1 | 3300050509 | Bacteria | 50243 |
| 1348 | nmdc:mga0qj67_595131_c1 | 3300050509 | Bacteria | 885 |
| 1349 | nmdc:mga0qj67_667110_c1 | 3300050509 | Bacteria | 829 |
| 1350 | nmdc:mga06r32_118088_c1 | 3300050510 | Bacteria | 2614 |
| 1351 | nmdc:mga06r32_135238_c1 | 3300050510 | Bacteria | 2440 |
| 1352 | nmdc:mga06r32_391370_c1 | 3300050510 | Bacteria | 1372 |
| 1353 | nmdc:mga06r32_79786_c1 | 3300050510 | Bacteria | 3184 |
| 1354 | nmdc:mga08y16_100861_c1 | 3300050511 | Bacteria | 3005 |
| 1355 | nmdc:mga08y16_274487_c1 | 3300050511 | Bacteria | 1740 |
| 1356 | nmdc:mga08y16_310668_c1 | 3300050511 | Bacteria | 1624 |
| 1357 | nmdc:mga08y16_356875_c1 | 3300050511 | Bacteria | 1501 |
| 1358 | nmdc:mga08y16_71155_c1 | 3300050511 | Bacteria | 3625 |
| 1359 | nmdc:mga0n895_117132_c1 | 3300050512 | Bacteria | 2683 |
| 1360 | nmdc:mga0n895_1184061_c1 | 3300050512 | Bacteria | 739 |
| 1361 | nmdc:mga0n895_246323_c1 | 3300050512 | Bacteria | 1814 |
| 1362 | nmdc:mga0n895_50546_c1 | 3300050512 | Bacteria | 4076 |
| 1363 | nmdc:mga0n895_692285_c1 | 3300050512 | Bacteria | 1016 |
| 1364 | nmdc:mga0n895_70607_c1 | 3300050512 | Bacteria | 3461 |
| 1365 | nmdc:mga0n895_840329_c1 | 3300050512 | Bacteria | 907 |
| 1366 | nmdc:mga0rr50_158771_c1 | 3300050513 | Bacteria | 1834 |
| 1367 | nmdc:mga0rr50_247128_c1 | 3300050513 | Bacteria | 1480 |
| 1368 | nmdc:mga0rr50_53320_c1 | 3300050513 | Bacteria | 3008 |
| 1369 | nmdc:mga08x19_1193104_c1 | 3300050514 | Bacteria | 540 |
| 1370 | nmdc:mga08x19_500277_c1 | 3300050514 | Bacteria | 858 |
| 1371 | nmdc:mga08x19_56031_c1 | 3300050514 | Bacteria | 2543 |
| 1372 | nmdc:mga0a205_11361_c1 | 3300050515 | Bacteria | 8196 |
| 1373 | nmdc:mga0a205_1151012_c1 | 3300050515 | Unclassified | 623 |
| 1374 | nmdc:mga0a205_1240444_c1 | 3300050515 | Bacteria | 593 |
| 1375 | nmdc:mga0a205_348188_c1 | 3300050515 | Bacteria | 1349 |
| 1376 | Ga0495601_0001376 | 3300053077 | Bacteria | 13385 |
| 1377 | Ga0495601_0001735 | 3300053077 | Bacteria | 12053 |
| 1378 | Ga0495601_0062873 | 3300053077 | Bacteria | 2358 |
| 1379 | Ga0495601_0082471 | 3300053077 | Bacteria | 2064 |
| 1380 | Ga0495601_0439416 | 3300053077 | Bacteria | 844 |
| 1381 | Ga0495612_0000562 | 3300053078 | Bacteria | 14913 |
| 1382 | Ga0495612_0057057 | 3300053078 | Bacteria | 1612 |
| 1383 | Ga0495612_0089880 | 3300053078 | Bacteria | 1299 |
| 1384 | Ga0495612_0453878 | 3300053078 | Bacteria | 586 |
| 1385 | Ga0495655_0007915 | 3300053083 | Bacteria | 1998 |
| 1386 | Ga0495655_0022803 | 3300053083 | Bacteria | 1435 |
| 1387 | Ga0495595_0003174 | 3300053084 | Bacteria | 6518 |
| 1388 | Ga0495595_0007422 | 3300053084 | Bacteria | 4489 |
| 1389 | Ga0495595_0018837 | 3300053084 | Bacteria | 2987 |
| 1390 | Ga0495595_0281332 | 3300053084 | Bacteria | 835 |
| 1391 | Ga0495595_0447850 | 3300053084 | Bacteria | 656 |
| 1392 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 1393 | Ga0495619_0000484 | 3300053085 | Bacteria | 26647 |
| 1394 | Ga0495619_0016005 | 3300053085 | Bacteria | 4746 |
| 1395 | Ga0495619_0016140 | 3300053085 | Bacteria | 4727 |
| 1396 | Ga0495619_0112163 | 3300053085 | Bacteria | 1864 |
| 1397 | Ga0495619_0286387 | 3300053085 | Bacteria | 1141 |
| 1398 | Ga0500566_0142694 | 3300053094 | Bacteria | 1269 |
| 1399 | Ga0500641_0002785 | 3300053096 | Bacteria | 6188 |
| 1400 | Ga0500593_018605 | 3300053117 | Bacteria | 3032 |
| 1401 | Ga0500657_225075 | 3300053728 | Bacteria | 590 |
| 1402 | Ga0500645_063080 | 3300053730 | Bacteria | 1070 |
| 1403 | Ga0501084_0422455 | 3300054114 | Bacteria | 1127 |
| 1404 | Ga0501084_0448276 | 3300054114 | Bacteria | 1091 |
| 1405 | Ga0501084_0624656 | 3300054114 | Bacteria | 910 |
| 1406 | Ga0501084_0707419 | 3300054114 | Bacteria | 850 |
| 1407 | Ga0501084_1301103 | 3300054114 | Bacteria | 609 |
| 1408 | Ga0501082_0018385 | 3300060353 | Bacteria | 6020 |
| 1409 | Ga0501082_0159213 | 3300060353 | Bacteria | 1962 |
| 1410 | Ga0501082_0784497 | 3300060353 | Bacteria | 834 |
| 1411 | Ga0501082_1666857 | 3300060353 | Unclassified | 556 |
| 1412 | Ga0530510_0294726 | 3300061734 | Bacteria | 1213 |
| 1413 | Ga0530510_0552549 | 3300061734 | Bacteria | 874 |
| 1414 | Ga0530510_0870287 | 3300061734 | Unclassified | 688 |
| 1415 | Ga0530510_0891222 | 3300061734 | Bacteria | 680 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025911 | Ga0207654_11011474 | Ga0207654_110114741 | 71 |
| 2 | 3300049571 | Ga0501034_0406002 | Ga0501034_0406002_255_518 | 72 |
| 3 | 3300049823 | Ga0501044_0215110 | Ga0501044_0215110_1417_1680 | 72 |
| 4 | 3300005327 | Ga0070658_10130781 | Ga0070658_101307812 | 78 |
| 5 | 3300005336 | Ga0070680_100824459 | Ga0070680_1008244592 | 78 |
| 6 | 3300005458 | Ga0070681_11993746 | Ga0070681_119937461 | 78 |
| 7 | 3300005530 | Ga0070679_100023364 | Ga0070679_1000233647 | 78 |
| 8 | 3300025909 | Ga0207705_10517875 | Ga0207705_105178752 | 78 |
| 9 | 3300025912 | Ga0207707_10425930 | Ga0207707_104259302 | 78 |
| 10 | 3300025917 | Ga0207660_10073080 | Ga0207660_100730803 | 78 |
| 11 | 3300025921 | Ga0207652_10169574 | Ga0207652_101695742 | 78 |
| 12 | 3300005937 | Ga0081455_10415523 | Ga0081455_104155232 | 83 |
| 13 | 3300005983 | Ga0081540_1010849 | Ga0081540_10108496 | 83 |
| 14 | iso_pu_bacteria | 2643221651 | 2644289457 | 83 |
| 15 | 3300000041 | ARcpr5oldR_c011245 | ARcpr5oldR_0112451 | 87 |
| 16 | 3300000043 | ARcpr5yngRDRAFT_c016622 | ARcpr5yngRDRAFT_0166221 | 87 |
| 17 | 3300000652 | ARCol0yngRDRAFT_1007988 | ARCol0yngRDRAFT_10079882 | 87 |
| 18 | 3300001430 | JGI24032J14994_100616 | JGI24032J14994_1006164 | 87 |
| 19 | 3300001904 | JGI24736J21556_1039826 | JGI24736J21556_10398262 | 87 |
| 20 | 3300001915 | JGI24741J21665_1022668 | JGI24741J21665_10226681 | 87 |
| 21 | 3300001976 | JGI24752J21851_1032527 | JGI24752J21851_10325272 | 87 |
| 22 | 3300001976 | JGI24752J21851_1048551 | JGI24752J21851_10485512 | 87 |
| 23 | 3300001977 | JGI24746J21847_1000660 | JGI24746J21847_10006604 | 87 |
| 24 | 3300001978 | JGI24747J21853_1000065 | JGI24747J21853_10000655 | 87 |
| 25 | 3300001989 | JGI24739J22299_10005070 | JGI24739J22299_100050703 | 87 |
| 26 | 3300001990 | JGI24737J22298_10001725 | JGI24737J22298_100017255 | 87 |
| 27 | 3300001991 | JGI24743J22301_10042470 | JGI24743J22301_100424701 | 87 |
| 28 | 3300001991 | JGI24743J22301_10071357 | JGI24743J22301_100713573 | 87 |
| 29 | 3300002067 | JGI24735J21928_10122357 | JGI24735J21928_101223572 | 87 |
| 30 | 3300002070 | JGI24750J21931_1000201 | JGI24750J21931_10002017 | 87 |
| 31 | 3300002073 | JGI24745J21846_1000444 | JGI24745J21846_10004445 | 87 |
| 32 | 3300002073 | JGI24745J21846_1011211 | JGI24745J21846_10112112 | 87 |
| 33 | 3300002075 | JGI24738J21930_10008541 | JGI24738J21930_100085413 | 87 |
| 34 | 3300002075 | JGI24738J21930_10014356 | JGI24738J21930_100143561 | 87 |
| 35 | 3300002076 | JGI24749J21850_1002447 | JGI24749J21850_10024474 | 87 |
| 36 | 3300002077 | JGI24744J21845_10036039 | JGI24744J21845_100360391 | 87 |
| 37 | 3300002126 | JGI24035J26624_1000749 | JGI24035J26624_10007494 | 87 |
| 38 | 3300002155 | JGI24033J26618_1001273 | JGI24033J26618_10012731 | 87 |
| 39 | 3300002239 | JGI24034J26672_10001663 | JGI24034J26672_100016635 | 87 |
| 40 | 3300002244 | JGI24742J22300_10000548 | JGI24742J22300_100005483 | 87 |
| 41 | 3300002244 | JGI24742J22300_10079592 | JGI24742J22300_100795922 | 87 |
| 42 | 3300002459 | JGI24751J29686_10030467 | JGI24751J29686_100304672 | 87 |
| 43 | 3300003349 | JGI26129J50193_1019387 | JGI26129J50193_10193871 | 87 |
| 44 | 3300003659 | JGI25404J52841_10001785 | JGI25404J52841_100017854 | 87 |
| 45 | 3300003659 | JGI25404J52841_10072301 | JGI25404J52841_100723012 | 87 |
| 46 | 3300003911 | JGI25405J52794_10002720 | JGI25405J52794_100027202 | 87 |
| 47 | 3300003911 | JGI25405J52794_10106706 | JGI25405J52794_101067062 | 87 |
| 48 | 3300005290 | Ga0065712_10020878 | Ga0065712_100208783 | 87 |
| 49 | 3300005293 | Ga0065715_10096595 | Ga0065715_100965952 | 87 |
| 50 | 3300005293 | Ga0065715_10280231 | Ga0065715_102802311 | 87 |
| 51 | 3300005295 | Ga0065707_10114838 | Ga0065707_101148382 | 87 |
| 52 | 3300005327 | Ga0070658_10450839 | Ga0070658_104508392 | 87 |
| 53 | 3300005327 | Ga0070658_11010666 | Ga0070658_110106662 | 87 |
| 54 | 3300005328 | Ga0070676_10004291 | Ga0070676_100042915 | 87 |
| 55 | 3300005328 | Ga0070676_10081138 | Ga0070676_100811383 | 87 |
| 56 | 3300005328 | Ga0070676_10874899 | Ga0070676_108748991 | 87 |
| 57 | 3300005329 | Ga0070683_100004677 | Ga0070683_1000046777 | 87 |
| 58 | 3300005329 | Ga0070683_100148684 | Ga0070683_1001486843 | 87 |
| 59 | 3300005329 | Ga0070683_100189798 | Ga0070683_1001897983 | 87 |
| 60 | 3300005330 | Ga0070690_100008757 | Ga0070690_1000087575 | 87 |
| 61 | 3300005330 | Ga0070690_100012125 | Ga0070690_1000121252 | 87 |
| 62 | 3300005330 | Ga0070690_100092303 | Ga0070690_1000923033 | 87 |
| 63 | 3300005330 | Ga0070690_100270903 | Ga0070690_1002709032 | 87 |
| 64 | 3300005331 | Ga0070670_100004378 | Ga0070670_1000043785 | 87 |
| 65 | 3300005331 | Ga0070670_100006765 | Ga0070670_1000067657 | 87 |
| 66 | 3300005331 | Ga0070670_100016298 | Ga0070670_1000162985 | 87 |
| 67 | 3300005331 | Ga0070670_100198783 | Ga0070670_1001987832 | 87 |
| 68 | 3300005333 | Ga0070677_10011104 | Ga0070677_100111043 | 87 |
| 69 | 3300005333 | Ga0070677_10061625 | Ga0070677_100616252 | 87 |
| 70 | 3300005334 | Ga0068869_100000546 | Ga0068869_10000054612 | 87 |
| 71 | 3300005334 | Ga0068869_100377194 | Ga0068869_1003771942 | 87 |
| 72 | 3300005335 | Ga0070666_10016324 | Ga0070666_100163243 | 87 |
| 73 | 3300005335 | Ga0070666_10048506 | Ga0070666_100485062 | 87 |
| 74 | 3300005335 | Ga0070666_10127353 | Ga0070666_101273532 | 87 |
| 75 | 3300005336 | Ga0070680_100391835 | Ga0070680_1003918352 | 87 |
| 76 | 3300005337 | Ga0070682_100003445 | Ga0070682_1000034456 | 87 |
| 77 | 3300005337 | Ga0070682_100085382 | Ga0070682_1000853822 | 87 |
| 78 | 3300005337 | Ga0070682_100316557 | Ga0070682_1003165572 | 87 |
| 79 | 3300005338 | Ga0068868_100012769 | Ga0068868_1000127696 | 87 |
| 80 | 3300005338 | Ga0068868_100196629 | Ga0068868_1001966292 | 87 |
| 81 | 3300005338 | Ga0068868_100554164 | Ga0068868_1005541641 | 87 |
| 82 | 3300005339 | Ga0070660_100006773 | Ga0070660_1000067738 | 87 |
| 83 | 3300005339 | Ga0070660_100217996 | Ga0070660_1002179962 | 87 |
| 84 | 3300005339 | Ga0070660_100254080 | Ga0070660_1002540802 | 87 |
| 85 | 3300005340 | Ga0070689_100002392 | Ga0070689_1000023927 | 87 |
| 86 | 3300005340 | Ga0070689_100023289 | Ga0070689_1000232891 | 87 |
| 87 | 3300005340 | Ga0070689_100220758 | Ga0070689_1002207583 | 87 |
| 88 | 3300005340 | Ga0070689_100323917 | Ga0070689_1003239172 | 87 |
| 89 | 3300005341 | Ga0070691_10003723 | Ga0070691_100037237 | 87 |
| 90 | 3300005341 | Ga0070691_10088425 | Ga0070691_100884251 | 87 |
| 91 | 3300005343 | Ga0070687_100001017 | Ga0070687_1000010176 | 87 |
| 92 | 3300005343 | Ga0070687_100038673 | Ga0070687_1000386732 | 87 |
| 93 | 3300005343 | Ga0070687_100515088 | Ga0070687_1005150882 | 87 |
| 94 | 3300005344 | Ga0070661_100001763 | Ga0070661_10000176315 | 87 |
| 95 | 3300005344 | Ga0070661_100068356 | Ga0070661_1000683564 | 87 |
| 96 | 3300005344 | Ga0070661_100260178 | Ga0070661_1002601782 | 87 |
| 97 | 3300005344 | Ga0070661_100406702 | Ga0070661_1004067022 | 87 |
| 98 | 3300005345 | Ga0070692_10004423 | Ga0070692_100044236 | 87 |
| 99 | 3300005345 | Ga0070692_10378364 | Ga0070692_103783642 | 87 |
| 100 | 3300005347 | Ga0070668_100098541 | Ga0070668_1000985414 | 87 |
| 101 | 3300005347 | Ga0070668_100137935 | Ga0070668_1001379352 | 87 |
| 102 | 3300005347 | Ga0070668_100143313 | Ga0070668_1001433133 | 87 |
| 103 | 3300005347 | Ga0070668_100638854 | Ga0070668_1006388542 | 87 |
| 104 | 3300005353 | Ga0070669_100009976 | Ga0070669_1000099765 | 87 |
| 105 | 3300005353 | Ga0070669_100018281 | Ga0070669_1000182813 | 87 |
| 106 | 3300005353 | Ga0070669_100568314 | Ga0070669_1005683142 | 87 |
| 107 | 3300005354 | Ga0070675_100029783 | Ga0070675_1000297832 | 87 |
| 108 | 3300005354 | Ga0070675_100110539 | Ga0070675_1001105391 | 87 |
| 109 | 3300005354 | Ga0070675_100335676 | Ga0070675_1003356762 | 87 |
| 110 | 3300005355 | Ga0070671_100007031 | Ga0070671_1000070317 | 87 |
| 111 | 3300005355 | Ga0070671_100033007 | Ga0070671_1000330072 | 87 |
| 112 | 3300005355 | Ga0070671_100128745 | Ga0070671_1001287452 | 87 |
| 113 | 3300005355 | Ga0070671_100739128 | Ga0070671_1007391282 | 87 |
| 114 | 3300005355 | Ga0070671_101865723 | Ga0070671_1018657232 | 87 |
| 115 | 3300005356 | Ga0070674_100018657 | Ga0070674_1000186576 | 87 |
| 116 | 3300005356 | Ga0070674_100068500 | Ga0070674_1000685003 | 87 |
| 117 | 3300005356 | Ga0070674_101146000 | Ga0070674_1011460002 | 87 |
| 118 | 3300005356 | Ga0070674_101919762 | Ga0070674_1019197622 | 87 |
| 119 | 3300005364 | Ga0070673_100000050 | Ga0070673_1000000509 | 87 |
| 120 | 3300005364 | Ga0070673_100018483 | Ga0070673_1000184836 | 87 |
| 121 | 3300005364 | Ga0070673_100025735 | Ga0070673_1000257352 | 87 |
| 122 | 3300005365 | Ga0070688_100000781 | Ga0070688_10000078116 | 87 |
| 123 | 3300005365 | Ga0070688_100006605 | Ga0070688_1000066056 | 87 |
| 124 | 3300005365 | Ga0070688_100557685 | Ga0070688_1005576852 | 87 |
| 125 | 3300005366 | Ga0070659_100014541 | Ga0070659_1000145416 | 87 |
| 126 | 3300005366 | Ga0070659_100177726 | Ga0070659_1001777262 | 87 |
| 127 | 3300005366 | Ga0070659_100199243 | Ga0070659_1001992433 | 87 |
| 128 | 3300005366 | Ga0070659_100263800 | Ga0070659_1002638002 | 87 |
| 129 | 3300005367 | Ga0070667_100007711 | Ga0070667_1000077112 | 87 |
| 130 | 3300005367 | Ga0070667_100040047 | Ga0070667_1000400472 | 87 |
| 131 | 3300005367 | Ga0070667_100069618 | Ga0070667_1000696184 | 87 |
| 132 | 3300005367 | Ga0070667_100099804 | Ga0070667_1000998042 | 87 |
| 133 | 3300005406 | Ga0070703_10050731 | Ga0070703_100507313 | 87 |
| 134 | 3300005434 | Ga0070709_10002579 | Ga0070709_100025794 | 87 |
| 135 | 3300005434 | Ga0070709_10021978 | Ga0070709_100219784 | 87 |
| 136 | 3300005434 | Ga0070709_10080777 | Ga0070709_100807772 | 87 |
| 137 | 3300005434 | Ga0070709_10386789 | Ga0070709_103867892 | 87 |
| 138 | 3300005435 | Ga0070714_100004606 | Ga0070714_1000046067 | 87 |
| 139 | 3300005435 | Ga0070714_100006031 | Ga0070714_1000060317 | 87 |
| 140 | 3300005435 | Ga0070714_100413285 | Ga0070714_1004132851 | 87 |
| 141 | 3300005435 | Ga0070714_101056293 | Ga0070714_1010562931 | 87 |
| 142 | 3300005435 | Ga0070714_101362992 | Ga0070714_1013629922 | 87 |
| 143 | 3300005436 | Ga0070713_100016906 | Ga0070713_1000169066 | 87 |
| 144 | 3300005436 | Ga0070713_100017576 | Ga0070713_1000175764 | 87 |
| 145 | 3300005436 | Ga0070713_100768913 | Ga0070713_1007689132 | 87 |
| 146 | 3300005436 | Ga0070713_100999547 | Ga0070713_1009995472 | 87 |
| 147 | 3300005436 | Ga0070713_101434521 | Ga0070713_1014345212 | 87 |
| 148 | 3300005437 | Ga0070710_10003313 | Ga0070710_100033136 | 87 |
| 149 | 3300005437 | Ga0070710_10009139 | Ga0070710_100091394 | 87 |
| 150 | 3300005437 | Ga0070710_10195953 | Ga0070710_101959532 | 87 |
| 151 | 3300005437 | Ga0070710_11028345 | Ga0070710_110283452 | 87 |
| 152 | 3300005438 | Ga0070701_10002148 | Ga0070701_100021483 | 87 |
| 153 | 3300005438 | Ga0070701_10350596 | Ga0070701_103505962 | 87 |
| 154 | 3300005439 | Ga0070711_100070490 | Ga0070711_1000704903 | 87 |
| 155 | 3300005439 | Ga0070711_100093042 | Ga0070711_1000930422 | 87 |
| 156 | 3300005439 | Ga0070711_100581667 | Ga0070711_1005816672 | 87 |
| 157 | 3300005439 | Ga0070711_100923648 | Ga0070711_1009236481 | 87 |
| 158 | 3300005439 | Ga0070711_101856275 | Ga0070711_1018562752 | 87 |
| 159 | 3300005440 | Ga0070705_100003118 | Ga0070705_1000031187 | 87 |
| 160 | 3300005440 | Ga0070705_101036197 | Ga0070705_1010361972 | 87 |
| 161 | 3300005440 | Ga0070705_101271323 | Ga0070705_1012713231 | 87 |
| 162 | 3300005440 | Ga0070705_101542001 | Ga0070705_1015420012 | 87 |
| 163 | 3300005441 | Ga0070700_100002692 | Ga0070700_1000026927 | 87 |
| 164 | 3300005441 | Ga0070700_100057652 | Ga0070700_1000576523 | 87 |
| 165 | 3300005441 | Ga0070700_100129666 | Ga0070700_1001296662 | 87 |
| 166 | 3300005441 | Ga0070700_100558403 | Ga0070700_1005584032 | 87 |
| 167 | 3300005441 | Ga0070700_101634796 | Ga0070700_1016347961 | 87 |
| 168 | 3300005444 | Ga0070694_100005972 | Ga0070694_1000059727 | 87 |
| 169 | 3300005444 | Ga0070694_100071334 | Ga0070694_1000713342 | 87 |
| 170 | 3300005444 | Ga0070694_100562943 | Ga0070694_1005629432 | 87 |
| 171 | 3300005445 | Ga0070708_100092810 | Ga0070708_1000928105 | 87 |
| 172 | 3300005455 | Ga0070663_100020225 | Ga0070663_1000202256 | 87 |
| 173 | 3300005455 | Ga0070663_100044767 | Ga0070663_1000447674 | 87 |
| 174 | 3300005455 | Ga0070663_101451948 | Ga0070663_1014519482 | 87 |
| 175 | 3300005456 | Ga0070678_100000518 | Ga0070678_10000051810 | 87 |
| 176 | 3300005456 | Ga0070678_100212529 | Ga0070678_1002125292 | 87 |
| 177 | 3300005456 | Ga0070678_101629124 | Ga0070678_1016291242 | 87 |
| 178 | 3300005457 | Ga0070662_100021515 | Ga0070662_1000215152 | 87 |
| 179 | 3300005457 | Ga0070662_100086443 | Ga0070662_1000864434 | 87 |
| 180 | 3300005457 | Ga0070662_100708797 | Ga0070662_1007087972 | 87 |
| 181 | 3300005457 | Ga0070662_101498811 | Ga0070662_1014988111 | 87 |
| 182 | 3300005458 | Ga0070681_10027987 | Ga0070681_100279876 | 87 |
| 183 | 3300005458 | Ga0070681_11392097 | Ga0070681_113920972 | 87 |
| 184 | 3300005458 | Ga0070681_11601729 | Ga0070681_116017291 | 87 |
| 185 | 3300005459 | Ga0068867_100009022 | Ga0068867_1000090226 | 87 |
| 186 | 3300005459 | Ga0068867_100047831 | Ga0068867_1000478312 | 87 |
| 187 | 3300005459 | Ga0068867_102149891 | Ga0068867_1021498912 | 87 |
| 188 | 3300005466 | Ga0070685_10003674 | Ga0070685_100036744 | 87 |
| 189 | 3300005466 | Ga0070685_10007039 | Ga0070685_100070396 | 87 |
| 190 | 3300005466 | Ga0070685_10045141 | Ga0070685_100451412 | 87 |
| 191 | 3300005466 | Ga0070685_10484104 | Ga0070685_104841042 | 87 |
| 192 | 3300005468 | Ga0070707_100977112 | Ga0070707_1009771122 | 87 |
| 193 | 3300005471 | Ga0070698_100279765 | Ga0070698_1002797652 | 87 |
| 194 | 3300005518 | Ga0070699_100010972 | Ga0070699_1000109722 | 87 |
| 195 | 3300005518 | Ga0070699_101089575 | Ga0070699_1010895751 | 87 |
| 196 | 3300005518 | Ga0070699_101607915 | Ga0070699_1016079152 | 87 |
| 197 | 3300005530 | Ga0070679_100007667 | Ga0070679_1000076676 | 87 |
| 198 | 3300005530 | Ga0070679_100252356 | Ga0070679_1002523562 | 87 |
| 199 | 3300005535 | Ga0070684_100004205 | Ga0070684_1000042058 | 87 |
| 200 | 3300005535 | Ga0070684_100050710 | Ga0070684_1000507102 | 87 |
| 201 | 3300005535 | Ga0070684_100180708 | Ga0070684_1001807082 | 87 |
| 202 | 3300005536 | Ga0070697_100535918 | Ga0070697_1005359182 | 87 |
| 203 | 3300005539 | Ga0068853_100030067 | Ga0068853_1000300676 | 87 |
| 204 | 3300005539 | Ga0068853_100362410 | Ga0068853_1003624102 | 87 |
| 205 | 3300005539 | Ga0068853_101191682 | Ga0068853_1011916822 | 87 |
| 206 | 3300005543 | Ga0070672_100000643 | Ga0070672_1000006439 | 87 |
| 207 | 3300005543 | Ga0070672_100052229 | Ga0070672_1000522292 | 87 |
| 208 | 3300005543 | Ga0070672_100377859 | Ga0070672_1003778592 | 87 |
| 209 | 3300005544 | Ga0070686_100001304 | Ga0070686_1000013042 | 87 |
| 210 | 3300005544 | Ga0070686_100040350 | Ga0070686_1000403502 | 87 |
| 211 | 3300005544 | Ga0070686_100522866 | Ga0070686_1005228661 | 87 |
| 212 | 3300005545 | Ga0070695_100187822 | Ga0070695_1001878221 | 87 |
| 213 | 3300005546 | Ga0070696_100241197 | Ga0070696_1002411972 | 87 |
| 214 | 3300005546 | Ga0070696_100254152 | Ga0070696_1002541522 | 87 |
| 215 | 3300005546 | Ga0070696_100436747 | Ga0070696_1004367472 | 87 |
| 216 | 3300005546 | Ga0070696_101855335 | Ga0070696_1018553351 | 87 |
| 217 | 3300005547 | Ga0070693_100008992 | Ga0070693_1000089922 | 87 |
| 218 | 3300005547 | Ga0070693_100237109 | Ga0070693_1002371092 | 87 |
| 219 | 3300005548 | Ga0070665_100021396 | Ga0070665_1000213966 | 87 |
| 220 | 3300005548 | Ga0070665_100097872 | Ga0070665_1000978722 | 87 |
| 221 | 3300005548 | Ga0070665_100115368 | Ga0070665_1001153682 | 87 |
| 222 | 3300005548 | Ga0070665_100250570 | Ga0070665_1002505704 | 87 |
| 223 | 3300005548 | Ga0070665_102210335 | Ga0070665_1022103351 | 87 |
| 224 | 3300005549 | Ga0070704_100007534 | Ga0070704_1000075346 | 87 |
| 225 | 3300005549 | Ga0070704_101706686 | Ga0070704_1017066861 | 87 |
| 226 | 3300005549 | Ga0070704_102009305 | Ga0070704_1020093052 | 87 |
| 227 | 3300005563 | Ga0068855_100035984 | Ga0068855_1000359842 | 87 |
| 228 | 3300005564 | Ga0070664_100026948 | Ga0070664_1000269486 | 87 |
| 229 | 3300005564 | Ga0070664_100065477 | Ga0070664_1000654775 | 87 |
| 230 | 3300005564 | Ga0070664_100389898 | Ga0070664_1003898982 | 87 |
| 231 | 3300005577 | Ga0068857_100001038 | Ga0068857_1000010386 | 87 |
| 232 | 3300005577 | Ga0068857_100128885 | Ga0068857_1001288854 | 87 |
| 233 | 3300005577 | Ga0068857_101250275 | Ga0068857_1012502752 | 87 |
| 234 | 3300005577 | Ga0068857_101780054 | Ga0068857_1017800542 | 87 |
| 235 | 3300005578 | Ga0068854_100014606 | Ga0068854_1000146062 | 87 |
| 236 | 3300005578 | Ga0068854_100055227 | Ga0068854_1000552274 | 87 |
| 237 | 3300005614 | Ga0068856_100009104 | Ga0068856_1000091045 | 87 |
| 238 | 3300005614 | Ga0068856_101206742 | Ga0068856_1012067422 | 87 |
| 239 | 3300005614 | Ga0068856_102584251 | Ga0068856_1025842512 | 87 |
| 240 | 3300005615 | Ga0070702_100004502 | Ga0070702_1000045022 | 87 |
| 241 | 3300005615 | Ga0070702_100010693 | Ga0070702_1000106934 | 87 |
| 242 | 3300005616 | Ga0068852_100005996 | Ga0068852_1000059962 | 87 |
| 243 | 3300005616 | Ga0068852_100135825 | Ga0068852_1001358253 | 87 |
| 244 | 3300005617 | Ga0068859_100095197 | Ga0068859_1000951972 | 87 |
| 245 | 3300005617 | Ga0068859_100189786 | Ga0068859_1001897864 | 87 |
| 246 | 3300005617 | Ga0068859_100245444 | Ga0068859_1002454443 | 87 |
| 247 | 3300005618 | Ga0068864_100001882 | Ga0068864_10000188219 | 87 |
| 248 | 3300005618 | Ga0068864_100006391 | Ga0068864_1000063918 | 87 |
| 249 | 3300005618 | Ga0068864_100022271 | Ga0068864_1000222711 | 87 |
| 250 | 3300005618 | Ga0068864_100501285 | Ga0068864_1005012851 | 87 |
| 251 | 3300005618 | Ga0068864_101877383 | Ga0068864_1018773832 | 87 |
| 252 | 3300005718 | Ga0068866_10000791 | Ga0068866_100007915 | 87 |
| 253 | 3300005719 | Ga0068861_100002491 | Ga0068861_1000024916 | 87 |
| 254 | 3300005719 | Ga0068861_100292563 | Ga0068861_1002925632 | 87 |
| 255 | 3300005719 | Ga0068861_100467199 | Ga0068861_1004671992 | 87 |
| 256 | 3300005719 | Ga0068861_101176387 | Ga0068861_1011763872 | 87 |
| 257 | 3300005834 | Ga0068851_10427726 | Ga0068851_104277261 | 87 |
| 258 | 3300005840 | Ga0068870_10001431 | Ga0068870_100014314 | 87 |
| 259 | 3300005840 | Ga0068870_10280768 | Ga0068870_102807682 | 87 |
| 260 | 3300005840 | Ga0068870_11343338 | Ga0068870_113433381 | 87 |
| 261 | 3300005841 | Ga0068863_100025687 | Ga0068863_1000256876 | 87 |
| 262 | 3300005841 | Ga0068863_100051180 | Ga0068863_1000511805 | 87 |
| 263 | 3300005841 | Ga0068863_101062945 | Ga0068863_1010629452 | 87 |
| 264 | 3300005842 | Ga0068858_100109053 | Ga0068858_1001090532 | 87 |
| 265 | 3300005842 | Ga0068858_100208230 | Ga0068858_1002082302 | 87 |
| 266 | 3300005842 | Ga0068858_100456267 | Ga0068858_1004562672 | 87 |
| 267 | 3300005843 | Ga0068860_100002530 | Ga0068860_10000253016 | 87 |
| 268 | 3300005843 | Ga0068860_100047790 | Ga0068860_1000477905 | 87 |
| 269 | 3300005844 | Ga0068862_100090157 | Ga0068862_1000901575 | 87 |
| 270 | 3300005844 | Ga0068862_100258676 | Ga0068862_1002586762 | 87 |
| 271 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008157 | 87 |
| 272 | 3300005937 | Ga0081455_10003729 | Ga0081455_100037299 | 87 |
| 273 | 3300005937 | Ga0081455_10048513 | Ga0081455_100485135 | 87 |
| 274 | 3300005937 | Ga0081455_10342622 | Ga0081455_103426222 | 87 |
| 275 | 3300005937 | Ga0081455_10463321 | Ga0081455_104633212 | 87 |
| 276 | 3300005981 | Ga0081538_10001580 | Ga0081538_1000158016 | 87 |
| 277 | 3300005981 | Ga0081538_10053594 | Ga0081538_100535943 | 87 |
| 278 | 3300005983 | Ga0081540_1000027 | Ga0081540_100002739 | 87 |
| 279 | 3300005983 | Ga0081540_1003265 | Ga0081540_10032657 | 87 |
| 280 | 3300005983 | Ga0081540_1175043 | Ga0081540_11750432 | 87 |
| 281 | 3300006028 | Ga0070717_10000485 | Ga0070717_1000048518 | 87 |
| 282 | 3300006028 | Ga0070717_10000980 | Ga0070717_1000098015 | 87 |
| 283 | 3300006028 | Ga0070717_10097524 | Ga0070717_100975243 | 87 |
| 284 | 3300006028 | Ga0070717_10434999 | Ga0070717_104349993 | 87 |
| 285 | 3300006028 | Ga0070717_10914905 | Ga0070717_109149052 | 87 |
| 286 | 3300006038 | Ga0075365_10001829 | Ga0075365_100018298 | 87 |
| 287 | 3300006038 | Ga0075365_10044104 | Ga0075365_100441044 | 87 |
| 288 | 3300006038 | Ga0075365_10194423 | Ga0075365_101944232 | 87 |
| 289 | 3300006038 | Ga0075365_10331494 | Ga0075365_103314942 | 87 |
| 290 | 3300006042 | Ga0075368_10014387 | Ga0075368_100143872 | 87 |
| 291 | 3300006048 | Ga0075363_100086742 | Ga0075363_1000867423 | 87 |
| 292 | 3300006048 | Ga0075363_100142372 | Ga0075363_1001423722 | 87 |
| 293 | 3300006048 | Ga0075363_100217271 | Ga0075363_1002172712 | 87 |
| 294 | 3300006048 | Ga0075363_100332782 | Ga0075363_1003327822 | 87 |
| 295 | 3300006048 | Ga0075363_100850194 | Ga0075363_1008501942 | 87 |
| 296 | 3300006058 | Ga0075432_10218624 | Ga0075432_102186242 | 87 |
| 297 | 3300006163 | Ga0070715_10000289 | Ga0070715_100002897 | 87 |
| 298 | 3300006163 | Ga0070715_10001137 | Ga0070715_100011372 | 87 |
| 299 | 3300006163 | Ga0070715_10184904 | Ga0070715_101849042 | 87 |
| 300 | 3300006163 | Ga0070715_10946657 | Ga0070715_109466572 | 87 |
| 301 | 3300006173 | Ga0070716_100004371 | Ga0070716_1000043712 | 87 |
| 302 | 3300006173 | Ga0070716_100010832 | Ga0070716_1000108322 | 87 |
| 303 | 3300006173 | Ga0070716_100379709 | Ga0070716_1003797092 | 87 |
| 304 | 3300006173 | Ga0070716_101020403 | Ga0070716_1010204031 | 87 |
| 305 | 3300006175 | Ga0070712_100000381 | Ga0070712_10000038116 | 87 |
| 306 | 3300006175 | Ga0070712_100003511 | Ga0070712_1000035112 | 87 |
| 307 | 3300006175 | Ga0070712_100179123 | Ga0070712_1001791233 | 87 |
| 308 | 3300006175 | Ga0070712_100589747 | Ga0070712_1005897471 | 87 |
| 309 | 3300006175 | Ga0070712_100879196 | Ga0070712_1008791962 | 87 |
| 310 | 3300006175 | Ga0070712_101221002 | Ga0070712_1012210022 | 87 |
| 311 | 3300006177 | Ga0075362_10060551 | Ga0075362_100605512 | 87 |
| 312 | 3300006178 | Ga0075367_10012404 | Ga0075367_100124042 | 87 |
| 313 | 3300006178 | Ga0075367_10018813 | Ga0075367_100188135 | 87 |
| 314 | 3300006178 | Ga0075367_10113914 | Ga0075367_101139143 | 87 |
| 315 | 3300006178 | Ga0075367_10192846 | Ga0075367_101928462 | 87 |
| 316 | 3300006178 | Ga0075367_10713727 | Ga0075367_107137272 | 87 |
| 317 | 3300006195 | Ga0075366_10525448 | Ga0075366_105254482 | 87 |
| 318 | 3300006237 | Ga0097621_100001425 | Ga0097621_10000142510 | 87 |
| 319 | 3300006237 | Ga0097621_100010536 | Ga0097621_1000105362 | 87 |
| 320 | 3300006237 | Ga0097621_100109482 | Ga0097621_1001094821 | 87 |
| 321 | 3300006353 | Ga0075370_10102861 | Ga0075370_101028612 | 87 |
| 322 | 3300006353 | Ga0075370_10356799 | Ga0075370_103567992 | 87 |
| 323 | 3300006358 | Ga0068871_100002394 | Ga0068871_10000239412 | 87 |
| 324 | 3300006358 | Ga0068871_100006790 | Ga0068871_1000067902 | 87 |
| 325 | 3300006358 | Ga0068871_100648687 | Ga0068871_1006486872 | 87 |
| 326 | 3300006844 | Ga0075428_100272670 | Ga0075428_1002726701 | 87 |
| 327 | 3300006844 | Ga0075428_100373229 | Ga0075428_1003732293 | 87 |
| 328 | 3300006844 | Ga0075428_100659124 | Ga0075428_1006591242 | 87 |
| 329 | 3300006844 | Ga0075428_100816747 | Ga0075428_1008167472 | 87 |
| 330 | 3300006846 | Ga0075430_100000403 | Ga0075430_10000040324 | 87 |
| 331 | 3300006846 | Ga0075430_100006792 | Ga0075430_1000067922 | 87 |
| 332 | 3300006846 | Ga0075430_100659732 | Ga0075430_1006597321 | 87 |
| 333 | 3300006847 | Ga0075431_100057713 | Ga0075431_1000577135 | 87 |
| 334 | 3300006847 | Ga0075431_100067535 | Ga0075431_1000675351 | 87 |
| 335 | 3300006847 | Ga0075431_100221962 | Ga0075431_1002219623 | 87 |
| 336 | 3300006847 | Ga0075431_100342061 | Ga0075431_1003420613 | 87 |
| 337 | 3300006847 | Ga0075431_101248697 | Ga0075431_1012486972 | 87 |
| 338 | 3300006852 | Ga0075433_10111705 | Ga0075433_101117054 | 87 |
| 339 | 3300006852 | Ga0075433_10404315 | Ga0075433_104043152 | 87 |
| 340 | 3300006852 | Ga0075433_10563575 | Ga0075433_105635752 | 87 |
| 341 | 3300006852 | Ga0075433_11340954 | Ga0075433_113409542 | 87 |
| 342 | 3300006852 | Ga0075433_11415695 | Ga0075433_114156951 | 87 |
| 343 | 3300006871 | Ga0075434_100004560 | Ga0075434_1000045609 | 87 |
| 344 | 3300006871 | Ga0075434_100031153 | Ga0075434_1000311535 | 87 |
| 345 | 3300006871 | Ga0075434_100178126 | Ga0075434_1001781263 | 87 |
| 346 | 3300006871 | Ga0075434_100226134 | Ga0075434_1002261343 | 87 |
| 347 | 3300006871 | Ga0075434_100264005 | Ga0075434_1002640052 | 87 |
| 348 | 3300006871 | Ga0075434_100391020 | Ga0075434_1003910202 | 87 |
| 349 | 3300006871 | Ga0075434_100519711 | Ga0075434_1005197112 | 87 |
| 350 | 3300006880 | Ga0075429_100195306 | Ga0075429_1001953061 | 87 |
| 351 | 3300006880 | Ga0075429_100437345 | Ga0075429_1004373452 | 87 |
| 352 | 3300006880 | Ga0075429_101038743 | Ga0075429_1010387432 | 87 |
| 353 | 3300006881 | Ga0068865_100001097 | Ga0068865_1000010976 | 87 |
| 354 | 3300006881 | Ga0068865_100134918 | Ga0068865_1001349183 | 87 |
| 355 | 3300006881 | Ga0068865_100249461 | Ga0068865_1002494613 | 87 |
| 356 | 3300006881 | Ga0068865_100631968 | Ga0068865_1006319681 | 87 |
| 357 | 3300006914 | Ga0075436_100068349 | Ga0075436_1000683492 | 87 |
| 358 | 3300006931 | Ga0097620_100095196 | Ga0097620_1000951964 | 87 |
| 359 | 3300006931 | Ga0097620_100189785 | Ga0097620_1001897854 | 87 |
| 360 | 3300006931 | Ga0097620_100245421 | Ga0097620_1002454213 | 87 |
| 361 | 3300007076 | Ga0075435_100075222 | Ga0075435_1000752222 | 87 |
| 362 | 3300007076 | Ga0075435_100247382 | Ga0075435_1002473822 | 87 |
| 363 | 3300007076 | Ga0075435_100304901 | Ga0075435_1003049012 | 87 |
| 364 | 3300007076 | Ga0075435_100493958 | Ga0075435_1004939582 | 87 |
| 365 | 3300007076 | Ga0075435_100765232 | Ga0075435_1007652321 | 87 |
| 366 | 3300009011 | Ga0105251_10036136 | Ga0105251_100361364 | 87 |
| 367 | 3300009011 | Ga0105251_10091272 | Ga0105251_100912722 | 87 |
| 368 | 3300009036 | Ga0105244_10023607 | Ga0105244_100236072 | 87 |
| 369 | 3300009036 | Ga0105244_10435472 | Ga0105244_104354722 | 87 |
| 370 | 3300009092 | Ga0105250_10078729 | Ga0105250_100787292 | 87 |
| 371 | 3300009092 | Ga0105250_10616440 | Ga0105250_106164401 | 87 |
| 372 | 3300009093 | Ga0105240_10067050 | Ga0105240_100670504 | 87 |
| 373 | 3300009093 | Ga0105240_11464700 | Ga0105240_114647002 | 87 |
| 374 | 3300009094 | Ga0111539_10026539 | Ga0111539_100265395 | 87 |
| 375 | 3300009094 | Ga0111539_10034470 | Ga0111539_100344706 | 87 |
| 376 | 3300009094 | Ga0111539_10189267 | Ga0111539_101892673 | 87 |
| 377 | 3300009094 | Ga0111539_10263224 | Ga0111539_102632242 | 87 |
| 378 | 3300009094 | Ga0111539_11078790 | Ga0111539_110787902 | 87 |
| 379 | 3300009094 | Ga0111539_11664275 | Ga0111539_116642752 | 87 |
| 380 | 3300009094 | Ga0111539_12606955 | Ga0111539_126069552 | 87 |
| 381 | 3300009098 | Ga0105245_10025559 | Ga0105245_100255593 | 87 |
| 382 | 3300009098 | Ga0105245_10133583 | Ga0105245_101335834 | 87 |
| 383 | 3300009098 | Ga0105245_11173960 | Ga0105245_111739602 | 87 |
| 384 | 3300009098 | Ga0105245_12571918 | Ga0105245_125719181 | 87 |
| 385 | 3300009101 | Ga0105247_10003270 | Ga0105247_1000327012 | 87 |
| 386 | 3300009101 | Ga0105247_10024258 | Ga0105247_100242582 | 87 |
| 387 | 3300009101 | Ga0105247_10025129 | Ga0105247_100251292 | 87 |
| 388 | 3300009101 | Ga0105247_10046239 | Ga0105247_100462392 | 87 |
| 389 | 3300009101 | Ga0105247_10420950 | Ga0105247_104209502 | 87 |
| 390 | 3300009147 | Ga0114129_10024067 | Ga0114129_100240674 | 87 |
| 391 | 3300009147 | Ga0114129_10027094 | Ga0114129_100270945 | 87 |
| 392 | 3300009147 | Ga0114129_10035205 | Ga0114129_100352052 | 87 |
| 393 | 3300009147 | Ga0114129_10349738 | Ga0114129_103497382 | 87 |
| 394 | 3300009147 | Ga0114129_10511680 | Ga0114129_105116802 | 87 |
| 395 | 3300009147 | Ga0114129_10837248 | Ga0114129_108372482 | 87 |
| 396 | 3300009147 | Ga0114129_13056179 | Ga0114129_130561791 | 87 |
| 397 | 3300009148 | Ga0105243_10002400 | Ga0105243_1000240013 | 87 |
| 398 | 3300009148 | Ga0105243_10004402 | Ga0105243_100044027 | 87 |
| 399 | 3300009148 | Ga0105243_11781848 | Ga0105243_117818482 | 87 |
| 400 | 3300009174 | Ga0105241_10008636 | Ga0105241_100086366 | 87 |
| 401 | 3300009176 | Ga0105242_10007578 | Ga0105242_100075786 | 87 |
| 402 | 3300009176 | Ga0105242_10008734 | Ga0105242_100087347 | 87 |
| 403 | 3300009176 | Ga0105242_10169037 | Ga0105242_101690373 | 87 |
| 404 | 3300009177 | Ga0105248_10010839 | Ga0105248_100108395 | 87 |
| 405 | 3300009177 | Ga0105248_10014218 | Ga0105248_100142186 | 87 |
| 406 | 3300009177 | Ga0105248_10081366 | Ga0105248_100813662 | 87 |
| 407 | 3300009177 | Ga0105248_10462007 | Ga0105248_104620072 | 87 |
| 408 | 3300009545 | Ga0105237_10030610 | Ga0105237_100306102 | 87 |
| 409 | 3300009545 | Ga0105237_10072688 | Ga0105237_100726884 | 87 |
| 410 | 3300009545 | Ga0105237_10198301 | Ga0105237_101983012 | 87 |
| 411 | 3300009545 | Ga0105237_10233019 | Ga0105237_102330194 | 87 |
| 412 | 3300009545 | Ga0105237_10921939 | Ga0105237_109219392 | 87 |
| 413 | 3300009545 | Ga0105237_12173966 | Ga0105237_121739662 | 87 |
| 414 | 3300009551 | Ga0105238_10009678 | Ga0105238_100096782 | 87 |
| 415 | 3300009551 | Ga0105238_10704814 | Ga0105238_107048142 | 87 |
| 416 | 3300009551 | Ga0105238_10923956 | Ga0105238_109239562 | 87 |
| 417 | 3300009553 | Ga0105249_10011450 | Ga0105249_100114503 | 87 |
| 418 | 3300009553 | Ga0105249_10060226 | Ga0105249_100602263 | 87 |
| 419 | 3300009553 | Ga0105249_10190476 | Ga0105249_101904763 | 87 |
| 420 | 3300009553 | Ga0105249_10635830 | Ga0105249_106358302 | 87 |
| 421 | 3300009553 | Ga0105249_10835085 | Ga0105249_108350852 | 87 |
| 422 | 3300009553 | Ga0105249_10889730 | Ga0105249_108897302 | 87 |
| 423 | 3300009553 | Ga0105249_11209839 | Ga0105249_112098391 | 87 |
| 424 | 3300010375 | Ga0105239_10024088 | Ga0105239_100240886 | 87 |
| 425 | 3300010375 | Ga0105239_10060055 | Ga0105239_100600555 | 87 |
| 426 | 3300010375 | Ga0105239_10194362 | Ga0105239_101943623 | 87 |
| 427 | 3300010375 | Ga0105239_11542931 | Ga0105239_115429311 | 87 |
| 428 | 3300010375 | Ga0105239_13644122 | Ga0105239_136441222 | 87 |
| 429 | 3300011119 | Ga0105246_10022159 | Ga0105246_100221593 | 87 |
| 430 | 3300011119 | Ga0105246_10025827 | Ga0105246_100258273 | 87 |
| 431 | 3300011119 | Ga0105246_10064420 | Ga0105246_100644202 | 87 |
| 432 | 3300011119 | Ga0105246_10293961 | Ga0105246_102939612 | 87 |
| 433 | 3300011119 | Ga0105246_10516105 | Ga0105246_105161052 | 87 |
| 434 | 3300012485 | Ga0157325_1001090 | Ga0157325_10010902 | 87 |
| 435 | 3300012505 | Ga0157339_1006614 | Ga0157339_10066142 | 87 |
| 436 | 3300012507 | Ga0157342_1016394 | Ga0157342_10163942 | 87 |
| 437 | 3300012510 | Ga0157316_1000861 | Ga0157316_10008612 | 87 |
| 438 | 3300012515 | Ga0157338_1041924 | Ga0157338_10419242 | 87 |
| 439 | 3300013100 | Ga0157373_10045749 | Ga0157373_100457494 | 87 |
| 440 | 3300013100 | Ga0157373_10185997 | Ga0157373_101859972 | 87 |
| 441 | 3300013100 | Ga0157373_11039297 | Ga0157373_110392972 | 87 |
| 442 | 3300013102 | Ga0157371_10070112 | Ga0157371_100701123 | 87 |
| 443 | 3300013104 | Ga0157370_10100379 | Ga0157370_101003792 | 87 |
| 444 | 3300013104 | Ga0157370_10377576 | Ga0157370_103775762 | 87 |
| 445 | 3300013104 | Ga0157370_10989840 | Ga0157370_109898402 | 87 |
| 446 | 3300013105 | Ga0157369_10618176 | Ga0157369_106181762 | 87 |
| 447 | 3300013296 | Ga0157374_10001167 | Ga0157374_100011674 | 87 |
| 448 | 3300013296 | Ga0157374_10338893 | Ga0157374_103388933 | 87 |
| 449 | 3300013296 | Ga0157374_10418172 | Ga0157374_104181722 | 87 |
| 450 | 3300013296 | Ga0157374_11019193 | Ga0157374_110191931 | 87 |
| 451 | 3300013296 | Ga0157374_11253782 | Ga0157374_112537822 | 87 |
| 452 | 3300013297 | Ga0157378_10008023 | Ga0157378_100080234 | 87 |
| 453 | 3300013297 | Ga0157378_10034938 | Ga0157378_100349382 | 87 |
| 454 | 3300013297 | Ga0157378_10103420 | Ga0157378_101034204 | 87 |
| 455 | 3300013297 | Ga0157378_10230936 | Ga0157378_102309362 | 87 |
| 456 | 3300013306 | Ga0163162_10010853 | Ga0163162_100108534 | 87 |
| 457 | 3300013306 | Ga0163162_10102479 | Ga0163162_101024792 | 87 |
| 458 | 3300013306 | Ga0163162_10156327 | Ga0163162_101563272 | 87 |
| 459 | 3300013307 | Ga0157372_10070864 | Ga0157372_100708643 | 87 |
| 460 | 3300013307 | Ga0157372_10788245 | Ga0157372_107882452 | 87 |
| 461 | 3300013307 | Ga0157372_13397406 | Ga0157372_133974061 | 87 |
| 462 | 3300013308 | Ga0157375_10031874 | Ga0157375_100318747 | 87 |
| 463 | 3300013308 | Ga0157375_10058370 | Ga0157375_100583704 | 87 |
| 464 | 3300013308 | Ga0157375_10307243 | Ga0157375_103072432 | 87 |
| 465 | 3300013308 | Ga0157375_11513626 | Ga0157375_115136262 | 87 |
| 466 | 3300013308 | Ga0157375_12241485 | Ga0157375_122414852 | 87 |
| 467 | 3300014325 | Ga0163163_10007288 | Ga0163163_100072887 | 87 |
| 468 | 3300014325 | Ga0163163_10011174 | Ga0163163_100111749 | 87 |
| 469 | 3300014325 | Ga0163163_10072774 | Ga0163163_100727745 | 87 |
| 470 | 3300014325 | Ga0163163_10303092 | Ga0163163_103030922 | 87 |
| 471 | 3300014325 | Ga0163163_10638904 | Ga0163163_106389042 | 87 |
| 472 | 3300014325 | Ga0163163_11160597 | Ga0163163_111605972 | 87 |
| 473 | 3300014326 | Ga0157380_10001551 | Ga0157380_100015518 | 87 |
| 474 | 3300014326 | Ga0157380_10141506 | Ga0157380_101415062 | 87 |
| 475 | 3300014326 | Ga0157380_10484984 | Ga0157380_104849842 | 87 |
| 476 | 3300014326 | Ga0157380_11535554 | Ga0157380_115355541 | 87 |
| 477 | 3300014326 | Ga0157380_12279306 | Ga0157380_122793062 | 87 |
| 478 | 3300014497 | Ga0182008_10154603 | Ga0182008_101546032 | 87 |
| 479 | 3300014497 | Ga0182008_10676170 | Ga0182008_106761702 | 87 |
| 480 | 3300014745 | Ga0157377_10009300 | Ga0157377_100093005 | 87 |
| 481 | 3300014745 | Ga0157377_10053554 | Ga0157377_100535544 | 87 |
| 482 | 3300014745 | Ga0157377_10134432 | Ga0157377_101344322 | 87 |
| 483 | 3300014968 | Ga0157379_10008646 | Ga0157379_100086463 | 87 |
| 484 | 3300014968 | Ga0157379_10081393 | Ga0157379_100813934 | 87 |
| 485 | 3300014968 | Ga0157379_10112149 | Ga0157379_101121492 | 87 |
| 486 | 3300014968 | Ga0157379_10291285 | Ga0157379_102912852 | 87 |
| 487 | 3300014968 | Ga0157379_11158923 | Ga0157379_111589232 | 87 |
| 488 | 3300014969 | Ga0157376_10580618 | Ga0157376_105806182 | 87 |
| 489 | 3300014969 | Ga0157376_12255506 | Ga0157376_122555061 | 87 |
| 490 | 3300014969 | Ga0157376_12564712 | Ga0157376_125647122 | 87 |
| 491 | 3300017792 | Ga0163161_10011103 | Ga0163161_100111036 | 87 |
| 492 | 3300017792 | Ga0163161_10078053 | Ga0163161_100780532 | 87 |
| 493 | 3300017792 | Ga0163161_10214200 | Ga0163161_102142003 | 87 |
| 494 | 3300017792 | Ga0163161_10480441 | Ga0163161_104804412 | 87 |
| 495 | 3300021361 | Ga0213872_10280375 | Ga0213872_102803752 | 87 |
| 496 | 3300021384 | Ga0213876_10029343 | Ga0213876_100293433 | 87 |
| 497 | 3300025271 | Ga0207666_1000153 | Ga0207666_10001536 | 87 |
| 498 | 3300025290 | Ga0207673_1000206 | Ga0207673_10002066 | 87 |
| 499 | 3300025315 | Ga0207697_10001059 | Ga0207697_100010598 | 87 |
| 500 | 3300025315 | Ga0207697_10296209 | Ga0207697_102962092 | 87 |
| 501 | 3300025321 | Ga0207656_10230074 | Ga0207656_102300742 | 87 |
| 502 | 3300025735 | Ga0207713_1051898 | Ga0207713_10518983 | 87 |
| 503 | 3300025735 | Ga0207713_1084833 | Ga0207713_10848332 | 87 |
| 504 | 3300025885 | Ga0207653_10020183 | Ga0207653_100201833 | 87 |
| 505 | 3300025893 | Ga0207682_10002885 | Ga0207682_100028853 | 87 |
| 506 | 3300025898 | Ga0207692_10000282 | Ga0207692_1000028212 | 87 |
| 507 | 3300025898 | Ga0207692_10020210 | Ga0207692_100202102 | 87 |
| 508 | 3300025898 | Ga0207692_10436411 | Ga0207692_104364112 | 87 |
| 509 | 3300025899 | Ga0207642_10119120 | Ga0207642_101191202 | 87 |
| 510 | 3300025899 | Ga0207642_10347258 | Ga0207642_103472582 | 87 |
| 511 | 3300025900 | Ga0207710_10000382 | Ga0207710_1000038215 | 87 |
| 512 | 3300025900 | Ga0207710_10010435 | Ga0207710_100104353 | 87 |
| 513 | 3300025900 | Ga0207710_10012560 | Ga0207710_100125604 | 87 |
| 514 | 3300025900 | Ga0207710_10036246 | Ga0207710_100362462 | 87 |
| 515 | 3300025901 | Ga0207688_10001072 | Ga0207688_100010725 | 87 |
| 516 | 3300025901 | Ga0207688_10004597 | Ga0207688_100045974 | 87 |
| 517 | 3300025903 | Ga0207680_10008936 | Ga0207680_100089365 | 87 |
| 518 | 3300025903 | Ga0207680_10018703 | Ga0207680_100187032 | 87 |
| 519 | 3300025903 | Ga0207680_10552131 | Ga0207680_105521311 | 87 |
| 520 | 3300025904 | Ga0207647_10033262 | Ga0207647_100332623 | 87 |
| 521 | 3300025904 | Ga0207647_10071757 | Ga0207647_100717573 | 87 |
| 522 | 3300025905 | Ga0207685_10000164 | Ga0207685_100001642 | 87 |
| 523 | 3300025905 | Ga0207685_10189110 | Ga0207685_101891101 | 87 |
| 524 | 3300025906 | Ga0207699_10148435 | Ga0207699_101484352 | 87 |
| 525 | 3300025906 | Ga0207699_10230402 | Ga0207699_102304021 | 87 |
| 526 | 3300025906 | Ga0207699_10300091 | Ga0207699_103000912 | 87 |
| 527 | 3300025906 | Ga0207699_10315460 | Ga0207699_103154601 | 87 |
| 528 | 3300025906 | Ga0207699_10405395 | Ga0207699_104053952 | 87 |
| 529 | 3300025906 | Ga0207699_10411845 | Ga0207699_104118452 | 87 |
| 530 | 3300025906 | Ga0207699_11077179 | Ga0207699_110771792 | 87 |
| 531 | 3300025907 | Ga0207645_10002745 | Ga0207645_100027456 | 87 |
| 532 | 3300025907 | Ga0207645_10036554 | Ga0207645_100365546 | 87 |
| 533 | 3300025907 | Ga0207645_10065071 | Ga0207645_100650712 | 87 |
| 534 | 3300025907 | Ga0207645_10245704 | Ga0207645_102457043 | 87 |
| 535 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000479 | 87 |
| 536 | 3300025908 | Ga0207643_10000532 | Ga0207643_100005324 | 87 |
| 537 | 3300025911 | Ga0207654_10008032 | Ga0207654_100080325 | 87 |
| 538 | 3300025911 | Ga0207654_10158904 | Ga0207654_101589041 | 87 |
| 539 | 3300025912 | Ga0207707_10140307 | Ga0207707_101403072 | 87 |
| 540 | 3300025912 | Ga0207707_10273104 | Ga0207707_102731043 | 87 |
| 541 | 3300025912 | Ga0207707_11133418 | Ga0207707_111334182 | 87 |
| 542 | 3300025913 | Ga0207695_10072726 | Ga0207695_100727264 | 87 |
| 543 | 3300025913 | Ga0207695_10542897 | Ga0207695_105428972 | 87 |
| 544 | 3300025914 | Ga0207671_10086564 | Ga0207671_100865643 | 87 |
| 545 | 3300025914 | Ga0207671_10137614 | Ga0207671_101376142 | 87 |
| 546 | 3300025914 | Ga0207671_11387138 | Ga0207671_113871382 | 87 |
| 547 | 3300025915 | Ga0207693_10001038 | Ga0207693_1000103810 | 87 |
| 548 | 3300025915 | Ga0207693_10005381 | Ga0207693_100053814 | 87 |
| 549 | 3300025916 | Ga0207663_10001206 | Ga0207663_1000120611 | 87 |
| 550 | 3300025916 | Ga0207663_10020826 | Ga0207663_100208265 | 87 |
| 551 | 3300025916 | Ga0207663_10062599 | Ga0207663_100625992 | 87 |
| 552 | 3300025917 | Ga0207660_10009992 | Ga0207660_100099923 | 87 |
| 553 | 3300025917 | Ga0207660_10592331 | Ga0207660_105923312 | 87 |
| 554 | 3300025918 | Ga0207662_10000392 | Ga0207662_100003927 | 87 |
| 555 | 3300025918 | Ga0207662_10001199 | Ga0207662_1000119910 | 87 |
| 556 | 3300025918 | Ga0207662_10124829 | Ga0207662_101248292 | 87 |
| 557 | 3300025919 | Ga0207657_10002007 | Ga0207657_1000200715 | 87 |
| 558 | 3300025919 | Ga0207657_10019229 | Ga0207657_100192295 | 87 |
| 559 | 3300025919 | Ga0207657_10039060 | Ga0207657_100390605 | 87 |
| 560 | 3300025920 | Ga0207649_10005404 | Ga0207649_100054043 | 87 |
| 561 | 3300025920 | Ga0207649_10228759 | Ga0207649_102287592 | 87 |
| 562 | 3300025920 | Ga0207649_10360867 | Ga0207649_103608672 | 87 |
| 563 | 3300025920 | Ga0207649_10365921 | Ga0207649_103659212 | 87 |
| 564 | 3300025921 | Ga0207652_10058342 | Ga0207652_100583422 | 87 |
| 565 | 3300025921 | Ga0207652_10128917 | Ga0207652_101289172 | 87 |
| 566 | 3300025922 | Ga0207646_10869308 | Ga0207646_108693082 | 87 |
| 567 | 3300025923 | Ga0207681_10024530 | Ga0207681_100245302 | 87 |
| 568 | 3300025923 | Ga0207681_10077414 | Ga0207681_100774142 | 87 |
| 569 | 3300025924 | Ga0207694_10363721 | Ga0207694_103637212 | 87 |
| 570 | 3300025925 | Ga0207650_10004542 | Ga0207650_100045424 | 87 |
| 571 | 3300025925 | Ga0207650_10017240 | Ga0207650_100172404 | 87 |
| 572 | 3300025925 | Ga0207650_10412758 | Ga0207650_104127582 | 87 |
| 573 | 3300025926 | Ga0207659_10000374 | Ga0207659_1000037418 | 87 |
| 574 | 3300025926 | Ga0207659_10025170 | Ga0207659_100251704 | 87 |
| 575 | 3300025926 | Ga0207659_10383099 | Ga0207659_103830992 | 87 |
| 576 | 3300025926 | Ga0207659_11675219 | Ga0207659_116752191 | 87 |
| 577 | 3300025927 | Ga0207687_10036426 | Ga0207687_100364264 | 87 |
| 578 | 3300025927 | Ga0207687_10041087 | Ga0207687_100410872 | 87 |
| 579 | 3300025928 | Ga0207700_10003347 | Ga0207700_100033477 | 87 |
| 580 | 3300025928 | Ga0207700_10031654 | Ga0207700_100316543 | 87 |
| 581 | 3300025928 | Ga0207700_10067428 | Ga0207700_100674282 | 87 |
| 582 | 3300025928 | Ga0207700_10287224 | Ga0207700_102872242 | 87 |
| 583 | 3300025928 | Ga0207700_10999172 | Ga0207700_109991722 | 87 |
| 584 | 3300025928 | Ga0207700_11152062 | Ga0207700_111520621 | 87 |
| 585 | 3300025929 | Ga0207664_10012974 | Ga0207664_100129743 | 87 |
| 586 | 3300025929 | Ga0207664_10339181 | Ga0207664_103391813 | 87 |
| 587 | 3300025929 | Ga0207664_11341152 | Ga0207664_113411522 | 87 |
| 588 | 3300025929 | Ga0207664_11733889 | Ga0207664_117338892 | 87 |
| 589 | 3300025931 | Ga0207644_10004888 | Ga0207644_100048884 | 87 |
| 590 | 3300025931 | Ga0207644_10073489 | Ga0207644_100734892 | 87 |
| 591 | 3300025931 | Ga0207644_10328146 | Ga0207644_103281463 | 87 |
| 592 | 3300025932 | Ga0207690_10088497 | Ga0207690_100884972 | 87 |
| 593 | 3300025932 | Ga0207690_10410738 | Ga0207690_104107382 | 87 |
| 594 | 3300025932 | Ga0207690_10536168 | Ga0207690_105361682 | 87 |
| 595 | 3300025932 | Ga0207690_10806594 | Ga0207690_108065942 | 87 |
| 596 | 3300025933 | Ga0207706_10010623 | Ga0207706_100106232 | 87 |
| 597 | 3300025933 | Ga0207706_10095775 | Ga0207706_100957753 | 87 |
| 598 | 3300025934 | Ga0207686_10007542 | Ga0207686_100075426 | 87 |
| 599 | 3300025934 | Ga0207686_10025932 | Ga0207686_100259325 | 87 |
| 600 | 3300025934 | Ga0207686_10102145 | Ga0207686_101021452 | 87 |
| 601 | 3300025935 | Ga0207709_10003882 | Ga0207709_100038822 | 87 |
| 602 | 3300025935 | Ga0207709_10027047 | Ga0207709_100270473 | 87 |
| 603 | 3300025935 | Ga0207709_10069241 | Ga0207709_100692412 | 87 |
| 604 | 3300025936 | Ga0207670_10004902 | Ga0207670_100049026 | 87 |
| 605 | 3300025936 | Ga0207670_10043451 | Ga0207670_100434514 | 87 |
| 606 | 3300025936 | Ga0207670_10177322 | Ga0207670_101773222 | 87 |
| 607 | 3300025936 | Ga0207670_10217320 | Ga0207670_102173202 | 87 |
| 608 | 3300025937 | Ga0207669_10000275 | Ga0207669_1000027523 | 87 |
| 609 | 3300025937 | Ga0207669_10083520 | Ga0207669_100835203 | 87 |
| 610 | 3300025938 | Ga0207704_10002620 | Ga0207704_100026207 | 87 |
| 611 | 3300025938 | Ga0207704_10105952 | Ga0207704_101059523 | 87 |
| 612 | 3300025939 | Ga0207665_10000541 | Ga0207665_100005417 | 87 |
| 613 | 3300025939 | Ga0207665_10013741 | Ga0207665_100137416 | 87 |
| 614 | 3300025939 | Ga0207665_10205088 | Ga0207665_102050882 | 87 |
| 615 | 3300025939 | Ga0207665_10288681 | Ga0207665_102886812 | 87 |
| 616 | 3300025940 | Ga0207691_10004396 | Ga0207691_100043967 | 87 |
| 617 | 3300025940 | Ga0207691_10030766 | Ga0207691_100307662 | 87 |
| 618 | 3300025941 | Ga0207711_10002645 | Ga0207711_100026452 | 87 |
| 619 | 3300025941 | Ga0207711_10005696 | Ga0207711_100056962 | 87 |
| 620 | 3300025941 | Ga0207711_10021126 | Ga0207711_100211262 | 87 |
| 621 | 3300025941 | Ga0207711_11283095 | Ga0207711_112830952 | 87 |
| 622 | 3300025942 | Ga0207689_10002724 | Ga0207689_100027249 | 87 |
| 623 | 3300025942 | Ga0207689_10077139 | Ga0207689_100771394 | 87 |
| 624 | 3300025942 | Ga0207689_10496678 | Ga0207689_104966782 | 87 |
| 625 | 3300025944 | Ga0207661_10015256 | Ga0207661_100152562 | 87 |
| 626 | 3300025944 | Ga0207661_10112752 | Ga0207661_101127523 | 87 |
| 627 | 3300025944 | Ga0207661_10159486 | Ga0207661_101594861 | 87 |
| 628 | 3300025944 | Ga0207661_10248476 | Ga0207661_102484763 | 87 |
| 629 | 3300025945 | Ga0207679_10001617 | Ga0207679_100016177 | 87 |
| 630 | 3300025945 | Ga0207679_10151996 | Ga0207679_101519962 | 87 |
| 631 | 3300025949 | Ga0207667_10702478 | Ga0207667_107024782 | 87 |
| 632 | 3300025960 | Ga0207651_10004195 | Ga0207651_100041956 | 87 |
| 633 | 3300025960 | Ga0207651_10057280 | Ga0207651_100572805 | 87 |
| 634 | 3300025960 | Ga0207651_10101715 | Ga0207651_101017152 | 87 |
| 635 | 3300025960 | Ga0207651_11533688 | Ga0207651_115336882 | 87 |
| 636 | 3300025961 | Ga0207712_10033211 | Ga0207712_100332114 | 87 |
| 637 | 3300025961 | Ga0207712_10069490 | Ga0207712_100694902 | 87 |
| 638 | 3300025961 | Ga0207712_10218996 | Ga0207712_102189963 | 87 |
| 639 | 3300025961 | Ga0207712_10298718 | Ga0207712_102987182 | 87 |
| 640 | 3300025961 | Ga0207712_10413420 | Ga0207712_104134202 | 87 |
| 641 | 3300025961 | Ga0207712_11079490 | Ga0207712_110794902 | 87 |
| 642 | 3300025972 | Ga0207668_10005763 | Ga0207668_100057632 | 87 |
| 643 | 3300025972 | Ga0207668_10288942 | Ga0207668_102889422 | 87 |
| 644 | 3300025972 | Ga0207668_10298681 | Ga0207668_102986812 | 87 |
| 645 | 3300025981 | Ga0207640_10015642 | Ga0207640_100156425 | 87 |
| 646 | 3300025981 | Ga0207640_10105178 | Ga0207640_101051783 | 87 |
| 647 | 3300025986 | Ga0207658_10084208 | Ga0207658_100842084 | 87 |
| 648 | 3300025986 | Ga0207658_10251997 | Ga0207658_102519973 | 87 |
| 649 | 3300025986 | Ga0207658_11480453 | Ga0207658_114804531 | 87 |
| 650 | 3300026023 | Ga0207677_10044077 | Ga0207677_100440773 | 87 |
| 651 | 3300026023 | Ga0207677_10044426 | Ga0207677_100444262 | 87 |
| 652 | 3300026023 | Ga0207677_10094078 | Ga0207677_100940783 | 87 |
| 653 | 3300026035 | Ga0207703_10001822 | Ga0207703_1000182213 | 87 |
| 654 | 3300026035 | Ga0207703_10019332 | Ga0207703_100193327 | 87 |
| 655 | 3300026035 | Ga0207703_10041983 | Ga0207703_100419832 | 87 |
| 656 | 3300026035 | Ga0207703_10537759 | Ga0207703_105377592 | 87 |
| 657 | 3300026041 | Ga0207639_10019446 | Ga0207639_100194466 | 87 |
| 658 | 3300026041 | Ga0207639_10313517 | Ga0207639_103135172 | 87 |
| 659 | 3300026041 | Ga0207639_11168052 | Ga0207639_111680522 | 87 |
| 660 | 3300026067 | Ga0207678_10002471 | Ga0207678_1000247111 | 87 |
| 661 | 3300026067 | Ga0207678_10019865 | Ga0207678_100198652 | 87 |
| 662 | 3300026067 | Ga0207678_10032268 | Ga0207678_100322684 | 87 |
| 663 | 3300026075 | Ga0207708_10001992 | Ga0207708_100019927 | 87 |
| 664 | 3300026075 | Ga0207708_10047755 | Ga0207708_100477553 | 87 |
| 665 | 3300026075 | Ga0207708_10196640 | Ga0207708_101966402 | 87 |
| 666 | 3300026078 | Ga0207702_10021444 | Ga0207702_100214442 | 87 |
| 667 | 3300026078 | Ga0207702_10886104 | Ga0207702_108861042 | 87 |
| 668 | 3300026078 | Ga0207702_11214162 | Ga0207702_112141621 | 87 |
| 669 | 3300026088 | Ga0207641_10019509 | Ga0207641_100195092 | 87 |
| 670 | 3300026088 | Ga0207641_10493316 | Ga0207641_104933162 | 87 |
| 671 | 3300026088 | Ga0207641_10848924 | Ga0207641_108489242 | 87 |
| 672 | 3300026089 | Ga0207648_10004767 | Ga0207648_100047677 | 87 |
| 673 | 3300026089 | Ga0207648_10010273 | Ga0207648_100102733 | 87 |
| 674 | 3300026095 | Ga0207676_10001979 | Ga0207676_1000197914 | 87 |
| 675 | 3300026095 | Ga0207676_10002246 | Ga0207676_100022467 | 87 |
| 676 | 3300026095 | Ga0207676_10375764 | Ga0207676_103757642 | 87 |
| 677 | 3300026095 | Ga0207676_10473035 | Ga0207676_104730352 | 87 |
| 678 | 3300026095 | Ga0207676_11118263 | Ga0207676_111182632 | 87 |
| 679 | 3300026116 | Ga0207674_10007733 | Ga0207674_100077337 | 87 |
| 680 | 3300026116 | Ga0207674_10340244 | Ga0207674_103402442 | 87 |
| 681 | 3300026116 | Ga0207674_12165721 | Ga0207674_121657212 | 87 |
| 682 | 3300026118 | Ga0207675_100003883 | Ga0207675_1000038836 | 87 |
| 683 | 3300026118 | Ga0207675_100007986 | Ga0207675_1000079866 | 87 |
| 684 | 3300026118 | Ga0207675_100255645 | Ga0207675_1002556452 | 87 |
| 685 | 3300026121 | Ga0207683_10002044 | Ga0207683_100020449 | 87 |
| 686 | 3300026121 | Ga0207683_10009279 | Ga0207683_100092793 | 87 |
| 687 | 3300026121 | Ga0207683_10124841 | Ga0207683_101248415 | 87 |
| 688 | 3300026142 | Ga0207698_10031944 | Ga0207698_100319445 | 87 |
| 689 | 3300026142 | Ga0207698_10079168 | Ga0207698_100791683 | 87 |
| 690 | 3300026142 | Ga0207698_10828466 | Ga0207698_108284661 | 87 |
| 691 | 3300027462 | Ga0210000_1028337 | Ga0210000_10283372 | 87 |
| 692 | 3300027614 | Ga0209970_1001300 | Ga0209970_10013003 | 87 |
| 693 | 3300027617 | Ga0210002_1002503 | Ga0210002_10025034 | 87 |
| 694 | 3300027682 | Ga0209971_1051991 | Ga0209971_10519912 | 87 |
| 695 | 3300027695 | Ga0209966_1049627 | Ga0209966_10496272 | 87 |
| 696 | 3300027717 | Ga0209998_10001985 | Ga0209998_100019853 | 87 |
| 697 | 3300027717 | Ga0209998_10027289 | Ga0209998_100272892 | 87 |
| 698 | 3300027866 | Ga0209813_10042324 | Ga0209813_100423241 | 87 |
| 699 | 3300027876 | Ga0209974_10010843 | Ga0209974_100108434 | 87 |
| 700 | 3300027876 | Ga0209974_10013531 | Ga0209974_100135313 | 87 |
| 701 | 3300027907 | Ga0207428_10000501 | Ga0207428_1000050146 | 87 |
| 702 | 3300027907 | Ga0207428_10240725 | Ga0207428_102407252 | 87 |
| 703 | 3300028379 | Ga0268266_10003041 | Ga0268266_1000304118 | 87 |
| 704 | 3300028379 | Ga0268266_10268549 | Ga0268266_102685492 | 87 |
| 705 | 3300028379 | Ga0268266_10288641 | Ga0268266_102886412 | 87 |
| 706 | 3300028380 | Ga0268265_10027065 | Ga0268265_100270653 | 87 |
| 707 | 3300028380 | Ga0268265_10055116 | Ga0268265_100551165 | 87 |
| 708 | 3300028381 | Ga0268264_10041889 | Ga0268264_100418895 | 87 |
| 709 | 3300028381 | Ga0268264_10342531 | Ga0268264_103425312 | 87 |
| 710 | 3300028381 | Ga0268264_10542243 | Ga0268264_105422432 | 87 |
| 711 | 3300028381 | Ga0268264_11402776 | Ga0268264_114027762 | 87 |
| 712 | 3300028381 | Ga0268264_12184799 | Ga0268264_121847992 | 87 |
| 713 | 3300028800 | Ga0265338_10806974 | Ga0265338_108069742 | 87 |
| 714 | 3300031235 | Ga0265330_10221819 | Ga0265330_102218192 | 87 |
| 715 | 3300031238 | Ga0265332_10011394 | Ga0265332_100113945 | 87 |
| 716 | 3300031238 | Ga0265332_10045090 | Ga0265332_100450903 | 87 |
| 717 | 3300031240 | Ga0265320_10502443 | Ga0265320_105024431 | 87 |
| 718 | 3300031241 | Ga0265325_10000073 | Ga0265325_1000007332 | 87 |
| 719 | 3300031241 | Ga0265325_10051523 | Ga0265325_100515231 | 87 |
| 720 | 3300031242 | Ga0265329_10021345 | Ga0265329_100213452 | 87 |
| 721 | 3300031247 | Ga0265340_10009552 | Ga0265340_100095525 | 87 |
| 722 | 3300031247 | Ga0265340_10105527 | Ga0265340_101055272 | 87 |
| 723 | 3300031249 | Ga0265339_10052691 | Ga0265339_100526914 | 87 |
| 724 | 3300031249 | Ga0265339_10145540 | Ga0265339_101455402 | 87 |
| 725 | 3300031249 | Ga0265339_10152032 | Ga0265339_101520323 | 87 |
| 726 | 3300031250 | Ga0265331_10055553 | Ga0265331_100555533 | 87 |
| 727 | 3300031250 | Ga0265331_10063698 | Ga0265331_100636981 | 87 |
| 728 | 3300031344 | Ga0265316_10470323 | Ga0265316_104703232 | 87 |
| 729 | 3300031344 | Ga0265316_10508621 | Ga0265316_105086211 | 87 |
| 730 | 3300031344 | Ga0265316_10744580 | Ga0265316_107445802 | 87 |
| 731 | 3300031344 | Ga0265316_11293843 | Ga0265316_112938431 | 87 |
| 732 | 3300031548 | Ga0307408_101670668 | Ga0307408_1016706682 | 87 |
| 733 | 3300031595 | Ga0265313_10022124 | Ga0265313_100221244 | 87 |
| 734 | 3300031595 | Ga0265313_10027730 | Ga0265313_100277302 | 87 |
| 735 | 3300031595 | Ga0265313_10320954 | Ga0265313_103209542 | 87 |
| 736 | 3300031665 | Ga0316575_10078991 | Ga0316575_100789911 | 87 |
| 737 | 3300031665 | Ga0316575_10401431 | Ga0316575_104014312 | 87 |
| 738 | 3300031665 | Ga0316575_10485878 | Ga0316575_104858782 | 87 |
| 739 | 3300031711 | Ga0265314_10040448 | Ga0265314_100404483 | 87 |
| 740 | 3300031711 | Ga0265314_10459996 | Ga0265314_104599961 | 87 |
| 741 | 3300031712 | Ga0265342_10088384 | Ga0265342_100883843 | 87 |
| 742 | 3300031712 | Ga0265342_10092487 | Ga0265342_100924873 | 87 |
| 743 | 3300031824 | Ga0307413_11908229 | Ga0307413_119082292 | 87 |
| 744 | 3300031995 | Ga0307409_101253998 | Ga0307409_1012539982 | 87 |
| 745 | 3300032002 | Ga0307416_103338916 | Ga0307416_1033389162 | 87 |
| 746 | 3300032133 | Ga0316583_10005022 | Ga0316583_100050223 | 87 |
| 747 | 3300032133 | Ga0316583_10101660 | Ga0316583_101016602 | 87 |
| 748 | 3300034816 | Ga0373930_0001440 | Ga0373930_0001440_2205_2468 | 87 |
| 749 | 3300034816 | Ga0373930_0026002 | Ga0373930_0026002_883_1146 | 87 |
| 750 | 3300034818 | Ga0373950_0007742 | Ga0373950_0007742_69_332 | 87 |
| 751 | 3300034818 | Ga0373950_0051411 | Ga0373950_0051411_296_559 | 87 |
| 752 | 3300034820 | Ga0373959_0034325 | Ga0373959_0034325_120_383 | 87 |
| 753 | 3300034820 | Ga0373959_0089070 | Ga0373959_0089070_323_586 | 87 |
| 754 | 3300034957 | Ga0373938_0006145 | Ga0373938_0006145_1118_1381 | 87 |
| 755 | 3300034957 | Ga0373938_0016299 | Ga0373938_0016299_16_279 | 87 |
| 756 | 3300035083 | Ga0373926_0012934 | Ga0373926_0012934_1509_1772 | 87 |
| 757 | 3300035083 | Ga0373926_0026591 | Ga0373926_0026591_46_309 | 87 |
| 758 | 3300035083 | Ga0373926_0086034 | Ga0373926_0086034_779_1042 | 87 |
| 759 | 3300035084 | Ga0373928_0000779 | Ga0373928_0000779_4616_4879 | 87 |
| 760 | 3300035085 | Ga0373929_0094396 | Ga0373929_0094396_184_447 | 87 |
| 761 | 3300035085 | Ga0373929_0177484 | Ga0373929_0177484_306_569 | 87 |
| 762 | 3300035086 | Ga0373934_0007860 | Ga0373934_0007860_2845_3108 | 87 |
| 763 | 3300035086 | Ga0373934_0089028 | Ga0373934_0089028_688_951 | 87 |
| 764 | 3300035089 | Ga0373944_0000648 | Ga0373944_0000648_2478_2741 | 87 |
| 765 | 3300035089 | Ga0373944_0006736 | Ga0373944_0006736_1638_1901 | 87 |
| 766 | 3300035089 | Ga0373944_0007628 | Ga0373944_0007628_808_1071 | 87 |
| 767 | 3300035090 | Ga0373949_0001783 | Ga0373949_0001783_2515_2778 | 87 |
| 768 | 3300035090 | Ga0373949_0030756 | Ga0373949_0030756_513_776 | 87 |
| 769 | 3300035091 | Ga0373951_0024865 | Ga0373951_0024865_1061_1324 | 87 |
| 770 | 3300035091 | Ga0373951_0052435 | Ga0373951_0052435_615_878 | 87 |
| 771 | 3300035092 | Ga0373952_0014213 | Ga0373952_0014213_969_1232 | 87 |
| 772 | 3300035092 | Ga0373952_0238562 | Ga0373952_0238562_24_287 | 87 |
| 773 | 3300035111 | Ga0373923_0000903 | Ga0373923_0000903_2402_2665 | 87 |
| 774 | 3300035112 | Ga0373932_0007032 | Ga0373932_0007032_1755_2018 | 87 |
| 775 | 3300035113 | Ga0373936_0025442 | Ga0373936_0025442_863_1126 | 87 |
| 776 | 3300035113 | Ga0373936_0040602 | Ga0373936_0040602_1469_1732 | 87 |
| 777 | 3300035114 | Ga0373939_0005507 | Ga0373939_0005507_1164_1427 | 87 |
| 778 | 3300035114 | Ga0373939_0014215 | Ga0373939_0014215_529_792 | 87 |
| 779 | 3300035114 | Ga0373939_0060939 | Ga0373939_0060939_366_662 | 87 |
| 780 | 3300035114 | Ga0373939_0183290 | Ga0373939_0183290_14_277 | 87 |
| 781 | 3300035115 | Ga0373941_0007122 | Ga0373941_0007122_332_595 | 87 |
| 782 | 3300035115 | Ga0373941_0080731 | Ga0373941_0080731_70_336 | 87 |
| 783 | 3300035116 | Ga0373945_0000024 | Ga0373945_0000024_17137_17400 | 87 |
| 784 | 3300035116 | Ga0373945_0005743 | Ga0373945_0005743_1252_1515 | 87 |
| 785 | 3300035116 | Ga0373945_0009935 | Ga0373945_0009935_402_665 | 87 |
| 786 | 3300035116 | Ga0373945_0020687 | Ga0373945_0020687_1376_1639 | 87 |
| 787 | 3300035117 | Ga0373953_0065822 | Ga0373953_0065822_916_1179 | 87 |
| 788 | 3300035117 | Ga0373953_0066423 | Ga0373953_0066423_98_361 | 87 |
| 789 | 3300035117 | Ga0373953_0183570 | Ga0373953_0183570_459_722 | 87 |
| 790 | 3300035118 | Ga0373954_0047403 | Ga0373954_0047403_145_408 | 87 |
| 791 | 3300035118 | Ga0373954_0091021 | Ga0373954_0091021_1035_1298 | 87 |
| 792 | 3300035118 | Ga0373954_0119964 | Ga0373954_0119964_380_643 | 87 |
| 793 | 3300035118 | Ga0373954_0344467 | Ga0373954_0344467_408_671 | 87 |
| 794 | 3300035119 | Ga0373956_0009220 | Ga0373956_0009220_1485_1748 | 87 |
| 795 | 3300035120 | Ga0373957_0031324 | Ga0373957_0031324_1314_1577 | 87 |
| 796 | 3300035120 | Ga0373957_0032882 | Ga0373957_0032882_859_1122 | 87 |
| 797 | 3300035120 | Ga0373957_0045943 | Ga0373957_0045943_232_495 | 87 |
| 798 | 3300035121 | Ga0373960_0008365 | Ga0373960_0008365_1025_1288 | 87 |
| 799 | 3300035170 | Ga0373943_0016457 | Ga0373943_0016457_1038_1301 | 87 |
| 800 | 3300035170 | Ga0373943_0027886 | Ga0373943_0027886_1417_1680 | 87 |
| 801 | 3300035170 | Ga0373943_0153384 | Ga0373943_0153384_962_1225 | 87 |
| 802 | 3300035171 | Ga0373946_0001675 | Ga0373946_0001675_1166_1429 | 87 |
| 803 | 3300035171 | Ga0373946_0003685 | Ga0373946_0003685_1144_1407 | 87 |
| 804 | 3300035171 | Ga0373946_0084970 | Ga0373946_0084970_240_503 | 87 |
| 805 | 3300035172 | Ga0373955_0003013 | Ga0373955_0003013_2949_3212 | 87 |
| 806 | 3300035172 | Ga0373955_0004843 | Ga0373955_0004843_3508_3771 | 87 |
| 807 | 3300035172 | Ga0373955_0010601 | Ga0373955_0010601_3972_4235 | 87 |
| 808 | 3300035172 | Ga0373955_0049136 | Ga0373955_0049136_1808_2071 | 87 |
| 809 | 3300035172 | Ga0373955_0374692 | Ga0373955_0374692_35_298 | 87 |
| 810 | 3300035207 | Ga0373942_0002310 | Ga0373942_0002310_200_463 | 87 |
| 811 | 3300035207 | Ga0373942_0112143 | Ga0373942_0112143_529_792 | 87 |
| 812 | 3300035241 | Ga0373961_0031030 | Ga0373961_0031030_358_621 | 87 |
| 813 | 3300035241 | Ga0373961_0041626 | Ga0373961_0041626_117_380 | 87 |
| 814 | 3300035241 | Ga0373961_0362807 | Ga0373961_0362807_203_499 | 87 |
| 815 | 3300035242 | Ga0373962_0003472 | Ga0373962_0003472_2929_3192 | 87 |
| 816 | 3300035242 | Ga0373962_0044976 | Ga0373962_0044976_979_1242 | 87 |
| 817 | 3300035242 | Ga0373962_0055949 | Ga0373962_0055949_874_1137 | 87 |
| 818 | 3300035410 | Ga0373924_0001803 | Ga0373924_0001803_498_761 | 87 |
| 819 | 3300035410 | Ga0373924_0170261 | Ga0373924_0170261_546_809 | 87 |
| 820 | 3300035410 | Ga0373924_0237640 | Ga0373924_0237640_29_292 | 87 |
| 821 | 3300035410 | Ga0373924_0453123 | Ga0373924_0453123_263_526 | 87 |
| 822 | 3300035691 | Ga0373931_0008043 | Ga0373931_0008043_3034_3297 | 87 |
| 823 | 3300035691 | Ga0373931_0025914 | Ga0373931_0025914_1897_2160 | 87 |
| 824 | 3300035691 | Ga0373931_0145273 | Ga0373931_0145273_583_846 | 87 |
| 825 | 3300035692 | Ga0373935_0008653 | Ga0373935_0008653_4778_5041 | 87 |
| 826 | 3300035692 | Ga0373935_0009334 | Ga0373935_0009334_1038_1301 | 87 |
| 827 | 3300035692 | Ga0373935_0017120 | Ga0373935_0017120_1696_1959 | 87 |
| 828 | 3300035692 | Ga0373935_0315659 | Ga0373935_0315659_600_863 | 87 |
| 829 | 3300035692 | Ga0373935_0545746 | Ga0373935_0545746_139_402 | 87 |
| 830 | 3300035695 | Ga0373927_0003867 | Ga0373927_0003867_2445_2708 | 87 |
| 831 | 3300035695 | Ga0373927_0025567 | Ga0373927_0025567_1672_1935 | 87 |
| 832 | 3300035695 | Ga0373927_0047557 | Ga0373927_0047557_1835_2098 | 87 |
| 833 | 3300035695 | Ga0373927_1053640 | Ga0373927_1053640_96_359 | 87 |
| 834 | 3300035724 | Ga0373933_0011420 | Ga0373933_0011420_885_1148 | 87 |
| 835 | 3300035724 | Ga0373933_0132734 | Ga0373933_0132734_891_1154 | 87 |
| 836 | 3300035724 | Ga0373933_0579332 | Ga0373933_0579332_399_662 | 87 |
| 837 | 3300035724 | Ga0373933_0676686 | Ga0373933_0676686_274_537 | 87 |
| 838 | 3300035725 | Ga0373947_0009320 | Ga0373947_0009320_5197_5460 | 87 |
| 839 | 3300035725 | Ga0373947_0012283 | Ga0373947_0012283_4525_4788 | 87 |
| 840 | 3300035725 | Ga0373947_0020184 | Ga0373947_0020184_2559_2822 | 87 |
| 841 | 3300035725 | Ga0373947_0171729 | Ga0373947_0171729_1065_1328 | 87 |
| 842 | 3300035725 | Ga0373947_0611576 | Ga0373947_0611576_341_604 | 87 |
| 843 | 3300036401 | Ga0373937_0004490 | Ga0373937_0004490_10319_10582 | 87 |
| 844 | 3300036401 | Ga0373937_0013915 | Ga0373937_0013915_3196_3459 | 87 |
| 845 | 3300036401 | Ga0373937_0053957 | Ga0373937_0053957_2705_2968 | 87 |
| 846 | 3300036401 | Ga0373937_0074055 | Ga0373937_0074055_70_333 | 87 |
| 847 | 3300036401 | Ga0373937_0146662 | Ga0373937_0146662_1351_1614 | 87 |
| 848 | 3300036401 | Ga0373937_0240075 | Ga0373937_0240075_663_926 | 87 |
| 849 | 3300036401 | Ga0373937_0488169 | Ga0373937_0488169_390_653 | 87 |
| 850 | 3300036401 | Ga0373937_0946801 | Ga0373937_0946801_348_611 | 87 |
| 851 | 3300037068 | Ga0373925_0011259 | Ga0373925_0011259_2479_2742 | 87 |
| 852 | 3300037068 | Ga0373925_0017194 | Ga0373925_0017194_954_1217 | 87 |
| 853 | 3300037068 | Ga0373925_0080367 | Ga0373925_0080367_363_626 | 87 |
| 854 | 3300037068 | Ga0373925_0518917 | Ga0373925_0518917_535_798 | 87 |
| 855 | 3300037068 | Ga0373925_0550777 | Ga0373925_0550777_392_655 | 87 |
| 856 | 3300037068 | Ga0373925_0977997 | Ga0373925_0977997_420_683 | 87 |
| 857 | 3300037068 | Ga0373925_1643243 | Ga0373925_1643243_201_464 | 87 |
| 858 | 3300037466 | Ga0395898_0318698 | Ga0395898_0318698_872_1135 | 87 |
| 859 | 3300037853 | Ga0436364_0054321 | Ga0436364_0054321_374_637 | 87 |
| 860 | 3300037853 | Ga0436364_1490302 | Ga0436364_1490302_463_726 | 87 |
| 861 | 3300038443 | Ga0395901_0435780 | Ga0395901_0435780_461_724 | 87 |
| 862 | 3300039437 | Ga0436365_0630650 | Ga0436365_0630650_248_511 | 87 |
| 863 | 3300039437 | Ga0436365_0653482 | Ga0436365_0653482_117_380 | 87 |
| 864 | 3300039437 | Ga0436365_0842200 | Ga0436365_0842200_2019_2282 | 87 |
| 865 | 3300039437 | Ga0436365_0884037 | Ga0436365_0884037_144_407 | 87 |
| 866 | 3300039437 | Ga0436365_0925593 | Ga0436365_0925593_202_465 | 87 |
| 867 | 3300039437 | Ga0436365_1179558 | Ga0436365_1179558_357_620 | 87 |
| 868 | 3300039437 | Ga0436365_1841819 | Ga0436365_1841819_1243_1506 | 87 |
| 869 | 3300039447 | Ga0436361_0973070 | Ga0436361_0973070_312_575 | 87 |
| 870 | 3300039450 | Ga0436363_1533352 | Ga0436363_1533352_1073_1336 | 87 |
| 871 | 3300041408 | Ga0439453_0125858 | Ga0439453_0125858_202_465 | 87 |
| 872 | 3300041459 | Ga0451800_1492021 | Ga0451800_1492021_630_893 | 87 |
| 873 | 3300041486 | Ga0451807_0870982 | Ga0451807_0870982_287_550 | 87 |
| 874 | 3300042000 | Ga0439437_034738 | Ga0439437_034738_104_367 | 87 |
| 875 | 3300042001 | Ga0439441_025351 | Ga0439441_025351_828_1091 | 87 |
| 876 | 3300042008 | Ga0439450_052964 | Ga0439450_052964_112_375 | 87 |
| 877 | 3300042016 | Ga0439463_182751 | Ga0439463_182751_232_495 | 87 |
| 878 | 3300042156 | Ga0439446_0157950 | Ga0439446_0157950_42_305 | 87 |
| 879 | 3300042439 | Ga0439464_0082917 | Ga0439464_0082917_567_830 | 87 |
| 880 | 3300042461 | Ga0439460_0192335 | Ga0439460_0192335_416_679 | 87 |
| 881 | 3300044694 | Ga0466963_0193222 | Ga0466963_0193222_124_387 | 87 |
| 882 | 3300045976 | Ga0466967_0033052 | Ga0466967_0033052_2126_2389 | 87 |
| 883 | 3300045976 | Ga0466967_2158738 | Ga0466967_2158738_126_389 | 87 |
| 884 | 3300046452 | Ga0495617_047776 | Ga0495617_047776_80_343 | 87 |
| 885 | 3300046453 | Ga0495627_071409 | Ga0495627_071409_41_304 | 87 |
| 886 | 3300046454 | Ga0495592_0016847 | Ga0495592_0016847_5153_5416 | 87 |
| 887 | 3300046454 | Ga0495592_0028202 | Ga0495592_0028202_3860_4123 | 87 |
| 888 | 3300046455 | Ga0495603_0024080 | Ga0495603_0024080_1814_2077 | 87 |
| 889 | 3300046455 | Ga0495603_0042104 | Ga0495603_0042104_1001_1264 | 87 |
| 890 | 3300046455 | Ga0495603_0059379 | Ga0495603_0059379_975_1238 | 87 |
| 891 | 3300046458 | Ga0495591_018137 | Ga0495591_018137_1454_1717 | 87 |
| 892 | 3300046459 | Ga0495629_0001465 | Ga0495629_0001465_14085_14348 | 87 |
| 893 | 3300046459 | Ga0495629_0031322 | Ga0495629_0031322_1141_1404 | 87 |
| 894 | 3300046459 | Ga0495629_0285196 | Ga0495629_0285196_473_736 | 87 |
| 895 | 3300046461 | Ga0495641_0006019 | Ga0495641_0006019_957_1220 | 87 |
| 896 | 3300046461 | Ga0495641_0010900 | Ga0495641_0010900_1680_1943 | 87 |
| 897 | 3300046461 | Ga0495641_0086781 | Ga0495641_0086781_166_429 | 87 |
| 898 | 3300046462 | Ga0495651_0002165 | Ga0495651_0002165_12714_12977 | 87 |
| 899 | 3300046462 | Ga0495651_0050457 | Ga0495651_0050457_928_1191 | 87 |
| 900 | 3300046462 | Ga0495651_0137084 | Ga0495651_0137084_837_1100 | 87 |
| 901 | 3300046462 | Ga0495651_0188281 | Ga0495651_0188281_605_868 | 87 |
| 902 | 3300046462 | Ga0495651_0661335 | Ga0495651_0661335_357_620 | 87 |
| 903 | 3300046463 | Ga0495653_0018668 | Ga0495653_0018668_5229_5492 | 87 |
| 904 | 3300046463 | Ga0495653_0327263 | Ga0495653_0327263_551_814 | 87 |
| 905 | 3300046463 | Ga0495653_0383617 | Ga0495653_0383617_581_844 | 87 |
| 906 | 3300046463 | Ga0495653_0443862 | Ga0495653_0443862_36_299 | 87 |
| 907 | 3300046463 | Ga0495653_0517306 | Ga0495653_0517306_248_511 | 87 |
| 908 | 3300046472 | Ga0495580_0005009 | Ga0495580_0005009_4014_4277 | 87 |
| 909 | 3300046472 | Ga0495580_0125642 | Ga0495580_0125642_1318_1581 | 87 |
| 910 | 3300046472 | Ga0495580_0473017 | Ga0495580_0473017_92_355 | 87 |
| 911 | 3300046473 | Ga0495582_0000570 | Ga0495582_0000570_9580_9843 | 87 |
| 912 | 3300046473 | Ga0495582_0004754 | Ga0495582_0004754_602_865 | 87 |
| 913 | 3300046473 | Ga0495582_0038169 | Ga0495582_0038169_560_823 | 87 |
| 914 | 3300046473 | Ga0495582_0170849 | Ga0495582_0170849_509_772 | 87 |
| 915 | 3300046473 | Ga0495582_0461088 | Ga0495582_0461088_129_392 | 87 |
| 916 | 3300046473 | Ga0495582_0498982 | Ga0495582_0498982_203_466 | 87 |
| 917 | 3300046474 | Ga0495605_0048845 | Ga0495605_0048845_987_1250 | 87 |
| 918 | 3300046475 | Ga0495639_0022702 | Ga0495639_0022702_1222_1485 | 87 |
| 919 | 3300046476 | Ga0495662_0002431 | Ga0495662_0002431_4525_4788 | 87 |
| 920 | 3300046476 | Ga0495662_0042738 | Ga0495662_0042738_1905_2168 | 87 |
| 921 | 3300046476 | Ga0495662_0520017 | Ga0495662_0520017_129_392 | 87 |
| 922 | 3300046477 | Ga0495664_0000563 | Ga0495664_0000563_12704_12967 | 87 |
| 923 | 3300046477 | Ga0495664_0547996 | Ga0495664_0547996_210_473 | 87 |
| 924 | 3300046477 | Ga0495664_0605882 | Ga0495664_0605882_77_340 | 87 |
| 925 | 3300046491 | Ga0495584_0045363 | Ga0495584_0045363_1756_2019 | 87 |
| 926 | 3300046491 | Ga0495584_0164348 | Ga0495584_0164348_92_355 | 87 |
| 927 | 3300046492 | Ga0495585_0002912 | Ga0495585_0002912_9071_9334 | 87 |
| 928 | 3300046492 | Ga0495585_0015407 | Ga0495585_0015407_2190_2453 | 87 |
| 929 | 3300046499 | Ga0495594_0003570 | Ga0495594_0003570_6296_6559 | 87 |
| 930 | 3300046499 | Ga0495594_0074658 | Ga0495594_0074658_1445_1708 | 87 |
| 931 | 3300046499 | Ga0495594_0311049 | Ga0495594_0311049_14_277 | 87 |
| 932 | 3300046500 | Ga0495596_0258994 | Ga0495596_0258994_110_373 | 87 |
| 933 | 3300046501 | Ga0495607_0010398 | Ga0495607_0010398_4773_5036 | 87 |
| 934 | 3300046506 | Ga0495583_0083008 | Ga0495583_0083008_272_535 | 87 |
| 935 | 3300046511 | Ga0495608_0015292 | Ga0495608_0015292_1645_1908 | 87 |
| 936 | 3300046511 | Ga0495608_0058752 | Ga0495608_0058752_1868_2131 | 87 |
| 937 | 3300046511 | Ga0495608_0264149 | Ga0495608_0264149_353_616 | 87 |
| 938 | 3300046511 | Ga0495608_0845019 | Ga0495608_0845019_67_330 | 87 |
| 939 | 3300046513 | Ga0495616_0069100 | Ga0495616_0069100_992_1255 | 87 |
| 940 | 3300046513 | Ga0495616_0141795 | Ga0495616_0141795_263_526 | 87 |
| 941 | 3300046514 | Ga0495618_0088636 | Ga0495618_0088636_551_814 | 87 |
| 942 | 3300046514 | Ga0495618_0288003 | Ga0495618_0288003_749_1012 | 87 |
| 943 | 3300046514 | Ga0495618_0344270 | Ga0495618_0344270_403_666 | 87 |
| 944 | 3300046515 | Ga0495620_0412356 | Ga0495620_0412356_72_335 | 87 |
| 945 | 3300046516 | Ga0495628_0011495 | Ga0495628_0011495_741_1004 | 87 |
| 946 | 3300046516 | Ga0495628_0197535 | Ga0495628_0197535_158_421 | 87 |
| 947 | 3300046517 | Ga0495630_0017154 | Ga0495630_0017154_3200_3463 | 87 |
| 948 | 3300046517 | Ga0495630_0138809 | Ga0495630_0138809_1248_1511 | 87 |
| 949 | 3300046517 | Ga0495630_0305316 | Ga0495630_0305316_816_1079 | 87 |
| 950 | 3300046518 | Ga0495631_0102226 | Ga0495631_0102226_652_915 | 87 |
| 951 | 3300046518 | Ga0495631_0213349 | Ga0495631_0213349_12_275 | 87 |
| 952 | 3300046520 | Ga0495637_0046164 | Ga0495637_0046164_1235_1498 | 87 |
| 953 | 3300046522 | Ga0495643_0156009 | Ga0495643_0156009_157_420 | 87 |
| 954 | 3300046523 | Ga0495644_0003284 | Ga0495644_0003284_3104_3367 | 87 |
| 955 | 3300046523 | Ga0495644_0006910 | Ga0495644_0006910_1105_1368 | 87 |
| 956 | 3300046523 | Ga0495644_0077657 | Ga0495644_0077657_731_994 | 87 |
| 957 | 3300046525 | Ga0495663_0005215 | Ga0495663_0005215_480_743 | 87 |
| 958 | 3300046525 | Ga0495663_0056811 | Ga0495663_0056811_943_1206 | 87 |
| 959 | 3300046526 | Ga0495666_0010760 | Ga0495666_0010760_2569_2832 | 87 |
| 960 | 3300046526 | Ga0495666_0016580 | Ga0495666_0016580_981_1244 | 87 |
| 961 | 3300046528 | Ga0495642_0176577 | Ga0495642_0176577_622_885 | 87 |
| 962 | 3300046529 | Ga0495652_0046062 | Ga0495652_0046062_1248_1511 | 87 |
| 963 | 3300046529 | Ga0495652_0246050 | Ga0495652_0246050_337_600 | 87 |
| 964 | 3300046529 | Ga0495652_0265955 | Ga0495652_0265955_706_969 | 87 |
| 965 | 3300046529 | Ga0495652_0266252 | Ga0495652_0266252_953_1216 | 87 |
| 966 | 3300046531 | Ga0495665_0038357 | Ga0495665_0038357_345_608 | 87 |
| 967 | 3300046533 | Ga0495640_0032280 | Ga0495640_0032280_356_619 | 87 |
| 968 | 3300046533 | Ga0495640_0061356 | Ga0495640_0061356_1627_1890 | 87 |
| 969 | 3300046533 | Ga0495640_0194843 | Ga0495640_0194843_261_524 | 87 |
| 970 | 3300046533 | Ga0495640_0489042 | Ga0495640_0489042_78_341 | 87 |
| 971 | 3300046535 | Ga0495586_0029902 | Ga0495586_0029902_1946_2209 | 87 |
| 972 | 3300046536 | Ga0495587_0142855 | Ga0495587_0142855_337_600 | 87 |
| 973 | 3300046536 | Ga0495587_0493686 | Ga0495587_0493686_92_355 | 87 |
| 974 | 3300046537 | Ga0495598_0014447 | Ga0495598_0014447_1191_1454 | 87 |
| 975 | 3300046537 | Ga0495598_0015165 | Ga0495598_0015165_239_502 | 87 |
| 976 | 3300046537 | Ga0495598_0064546 | Ga0495598_0064546_686_949 | 87 |
| 977 | 3300046538 | Ga0495609_0041279 | Ga0495609_0041279_821_1084 | 87 |
| 978 | 3300046538 | Ga0495609_0239370 | Ga0495609_0239370_225_488 | 87 |
| 979 | 3300046538 | Ga0495609_0329814 | Ga0495609_0329814_94_357 | 87 |
| 980 | 3300046539 | Ga0495621_0049037 | Ga0495621_0049037_158_421 | 87 |
| 981 | 3300046539 | Ga0495621_0151086 | Ga0495621_0151086_166_429 | 87 |
| 982 | 3300046543 | Ga0495645_0081407 | Ga0495645_0081407_1901_2164 | 87 |
| 983 | 3300046543 | Ga0495645_0268481 | Ga0495645_0268481_809_1072 | 87 |
| 984 | 3300046543 | Ga0495645_0962271 | Ga0495645_0962271_79_345 | 87 |
| 985 | 3300046557 | Ga0495622_0000406 | Ga0495622_0000406_23493_23756 | 87 |
| 986 | 3300046557 | Ga0495622_0052146 | Ga0495622_0052146_1356_1619 | 87 |
| 987 | 3300046558 | Ga0495633_0005373 | Ga0495633_0005373_2182_2445 | 87 |
| 988 | 3300046559 | Ga0495667_0017377 | Ga0495667_0017377_2361_2624 | 87 |
| 989 | 3300046559 | Ga0495667_0020065 | Ga0495667_0020065_3344_3607 | 87 |
| 990 | 3300046559 | Ga0495667_0137156 | Ga0495667_0137156_261_524 | 87 |
| 991 | 3300046559 | Ga0495667_0172601 | Ga0495667_0172601_912_1175 | 87 |
| 992 | 3300046559 | Ga0495667_1003053 | Ga0495667_1003053_89_352 | 87 |
| 993 | 3300046615 | Ga0495656_0000554 | Ga0495656_0000554_2269_2532 | 87 |
| 994 | 3300046615 | Ga0495656_0108803 | Ga0495656_0108803_991_1254 | 87 |
| 995 | 3300046615 | Ga0495656_0408502 | Ga0495656_0408502_302_565 | 87 |
| 996 | 3300046616 | Ga0495668_0201057 | Ga0495668_0201057_435_698 | 87 |
| 997 | 3300046642 | Ga0495634_0154428 | Ga0495634_0154428_120_383 | 87 |
| 998 | 3300046642 | Ga0495634_0410072 | Ga0495634_0410072_434_697 | 87 |
| 999 | 3300046642 | Ga0495634_0410270 | Ga0495634_0410270_159_422 | 87 |
| 1000 | 3300046642 | Ga0495634_0832807 | Ga0495634_0832807_184_447 | 87 |
| 1001 | 3300046648 | Ga0495611_0197505 | Ga0495611_0197505_249_512 | 87 |
| 1002 | 3300046663 | Ga0495635_0016723 | Ga0495635_0016723_4239_4502 | 87 |
| 1003 | 3300046663 | Ga0495635_0024301 | Ga0495635_0024301_3411_3674 | 87 |
| 1004 | 3300046663 | Ga0495635_0304205 | Ga0495635_0304205_297_560 | 87 |
| 1005 | 3300046663 | Ga0495635_0621395 | Ga0495635_0621395_335_598 | 87 |
| 1006 | 3300046663 | Ga0495635_0752914 | Ga0495635_0752914_74_337 | 87 |
| 1007 | 3300046663 | Ga0495635_1011378 | Ga0495635_1011378_75_338 | 87 |
| 1008 | 3300046664 | Ga0495659_0005523 | Ga0495659_0005523_925_1188 | 87 |
| 1009 | 3300046664 | Ga0495659_0093023 | Ga0495659_0093023_131_394 | 87 |
| 1010 | 3300046665 | Ga0495661_0076068 | Ga0495661_0076068_1357_1620 | 87 |
| 1011 | 3300046665 | Ga0495661_0122326 | Ga0495661_0122326_881_1144 | 87 |
| 1012 | 3300046665 | Ga0495661_0170850 | Ga0495661_0170850_46_309 | 87 |
| 1013 | 3300046674 | Ga0495588_0029913 | Ga0495588_0029913_851_1114 | 87 |
| 1014 | 3300046674 | Ga0495588_0088794 | Ga0495588_0088794_145_408 | 87 |
| 1015 | 3300046675 | Ga0495657_0008729 | Ga0495657_0008729_6045_6308 | 87 |
| 1016 | 3300046675 | Ga0495657_0196933 | Ga0495657_0196933_107_370 | 87 |
| 1017 | 3300046675 | Ga0495657_0589601 | Ga0495657_0589601_135_398 | 87 |
| 1018 | 3300046678 | Ga0495599_0020724 | Ga0495599_0020724_3229_3492 | 87 |
| 1019 | 3300046679 | Ga0495623_0688389 | Ga0495623_0688389_94_357 | 87 |
| 1020 | 3300046680 | Ga0495646_0042474 | Ga0495646_0042474_1946_2209 | 87 |
| 1021 | 3300046680 | Ga0495646_0144375 | Ga0495646_0144375_728_991 | 87 |
| 1022 | 3300046680 | Ga0495646_0307843 | Ga0495646_0307843_331_594 | 87 |
| 1023 | 3300046681 | Ga0495647_0001486 | Ga0495647_0001486_5546_5809 | 87 |
| 1024 | 3300046681 | Ga0495647_0031744 | Ga0495647_0031744_1603_1866 | 87 |
| 1025 | 3300046681 | Ga0495647_0097708 | Ga0495647_0097708_719_982 | 87 |
| 1026 | 3300046683 | Ga0495658_0000543 | Ga0495658_0000543_20100_20363 | 87 |
| 1027 | 3300046683 | Ga0495658_0002466 | Ga0495658_0002466_1661_1924 | 87 |
| 1028 | 3300046683 | Ga0495658_0028883 | Ga0495658_0028883_1086_1349 | 87 |
| 1029 | 3300046683 | Ga0495658_0053388 | Ga0495658_0053388_1634_1897 | 87 |
| 1030 | 3300046683 | Ga0495658_0239013 | Ga0495658_0239013_369_632 | 87 |
| 1031 | 3300046683 | Ga0495658_1118969 | Ga0495658_1118969_143_406 | 87 |
| 1032 | 3300046684 | Ga0495669_0020229 | Ga0495669_0020229_1825_2088 | 87 |
| 1033 | 3300046684 | Ga0495669_0085587 | Ga0495669_0085587_497_760 | 87 |
| 1034 | 3300046689 | Ga0495613_0034941 | Ga0495613_0034941_2012_2275 | 87 |
| 1035 | 3300046689 | Ga0495613_0153601 | Ga0495613_0153601_773_1036 | 87 |
| 1036 | 3300046690 | Ga0495624_0018605 | Ga0495624_0018605_1027_1290 | 87 |
| 1037 | 3300046690 | Ga0495624_0027306 | Ga0495624_0027306_2873_3136 | 87 |
| 1038 | 3300046691 | Ga0495670_0008274 | Ga0495670_0008274_3727_3990 | 87 |
| 1039 | 3300046691 | Ga0495670_0030996 | Ga0495670_0030996_2228_2491 | 87 |
| 1040 | 3300046691 | Ga0495670_0793193 | Ga0495670_0793193_36_299 | 87 |
| 1041 | 3300046692 | Ga0495671_0123171 | Ga0495671_0123171_168_431 | 87 |
| 1042 | 3300046694 | Ga0495649_0040457 | Ga0495649_0040457_2243_2506 | 87 |
| 1043 | 3300046794 | Ga0495589_0186331 | Ga0495589_0186331_646_909 | 87 |
| 1044 | 3300046794 | Ga0495589_0237976 | Ga0495589_0237976_58_321 | 87 |
| 1045 | 3300046809 | Ga0495600_0006388 | Ga0495600_0006388_3746_4009 | 87 |
| 1046 | 3300046809 | Ga0495600_0156242 | Ga0495600_0156242_44_307 | 87 |
| 1047 | 3300047315 | Ga0495581_0003432 | Ga0495581_0003432_930_1193 | 87 |
| 1048 | 3300047315 | Ga0495581_0010955 | Ga0495581_0010955_2296_2559 | 87 |
| 1049 | 3300047315 | Ga0495581_0019117 | Ga0495581_0019117_960_1223 | 87 |
| 1050 | 3300047315 | Ga0495581_0626326 | Ga0495581_0626326_278_541 | 87 |
| 1051 | 3300047317 | Ga0495604_0013474 | Ga0495604_0013474_1128_1391 | 87 |
| 1052 | 3300047317 | Ga0495604_0064795 | Ga0495604_0064795_77_340 | 87 |
| 1053 | 3300047317 | Ga0495604_0261884 | Ga0495604_0261884_672_935 | 87 |
| 1054 | 3300047317 | Ga0495604_0572959 | Ga0495604_0572959_238_501 | 87 |
| 1055 | 3300047318 | Ga0495636_0176187 | Ga0495636_0176187_273_536 | 87 |
| 1056 | 3300047319 | Ga0495674_0026343 | Ga0495674_0026343_4910_5173 | 87 |
| 1057 | 3300047319 | Ga0495674_0177497 | Ga0495674_0177497_783_1046 | 87 |
| 1058 | 3300047319 | Ga0495674_0326614 | Ga0495674_0326614_792_1055 | 87 |
| 1059 | 3300047319 | Ga0495674_0626821 | Ga0495674_0626821_475_738 | 87 |
| 1060 | 3300047319 | Ga0495674_1253152 | Ga0495674_1253152_220_483 | 87 |
| 1061 | 3300047320 | Ga0495672_0101953 | Ga0495672_0101953_1014_1283 | 87 |
| 1062 | 3300047320 | Ga0495672_0106572 | Ga0495672_0106572_854_1117 | 87 |
| 1063 | 3300047320 | Ga0495672_0179645 | Ga0495672_0179645_18_284 | 87 |
| 1064 | 3300047321 | Ga0495676_0013899 | Ga0495676_0013899_5008_5271 | 87 |
| 1065 | 3300047321 | Ga0495676_0035160 | Ga0495676_0035160_1829_2092 | 87 |
| 1066 | 3300047321 | Ga0495676_0125529 | Ga0495676_0125529_1338_1601 | 87 |
| 1067 | 3300047321 | Ga0495676_0233848 | Ga0495676_0233848_441_704 | 87 |
| 1068 | 3300047322 | Ga0495680_0006933 | Ga0495680_0006933_1036_1299 | 87 |
| 1069 | 3300047322 | Ga0495680_0012328 | Ga0495680_0012328_3655_3918 | 87 |
| 1070 | 3300047322 | Ga0495680_0061381 | Ga0495680_0061381_392_655 | 87 |
| 1071 | 3300047322 | Ga0495680_0330036 | Ga0495680_0330036_89_352 | 87 |
| 1072 | 3300047323 | Ga0495683_0249865 | Ga0495683_0249865_14_277 | 87 |
| 1073 | 3300047323 | Ga0495683_0286823 | Ga0495683_0286823_81_344 | 87 |
| 1074 | 3300047444 | Ga0495675_0020224 | Ga0495675_0020224_144_407 | 87 |
| 1075 | 3300047444 | Ga0495675_0253145 | Ga0495675_0253145_599_862 | 87 |
| 1076 | 3300047446 | Ga0495679_027076 | Ga0495679_027076_843_1106 | 87 |
| 1077 | 3300047471 | Ga0495684_0055089 | Ga0495684_0055089_1521_1784 | 87 |
| 1078 | 3300047471 | Ga0495684_0058031 | Ga0495684_0058031_2062_2325 | 87 |
| 1079 | 3300047471 | Ga0495684_0193134 | Ga0495684_0193134_53_316 | 87 |
| 1080 | 3300047471 | Ga0495684_0886100 | Ga0495684_0886100_136_399 | 87 |
| 1081 | 3300047673 | Ga0495593_0003620 | Ga0495593_0003620_1514_1777 | 87 |
| 1082 | 3300047673 | Ga0495593_0333250 | Ga0495593_0333250_124_387 | 87 |
| 1083 | 3300048088 | Ga0495602_0070224 | Ga0495602_0070224_1794_2057 | 87 |
| 1084 | 3300048088 | Ga0495602_0412012 | Ga0495602_0412012_154_417 | 87 |
| 1085 | 3300048088 | Ga0495602_0462834 | Ga0495602_0462834_411_674 | 87 |
| 1086 | 3300048089 | Ga0495614_0019302 | Ga0495614_0019302_273_536 | 87 |
| 1087 | 3300048903 | Ga0496100_0003363 | Ga0496100_0003363_3904_4167 | 87 |
| 1088 | 3300048903 | Ga0496100_0015421 | Ga0496100_0015421_4182_4445 | 87 |
| 1089 | 3300048903 | Ga0496100_0016403 | Ga0496100_0016403_901_1197 | 87 |
| 1090 | 3300048903 | Ga0496100_0031260 | Ga0496100_0031260_580_843 | 87 |
| 1091 | 3300048903 | Ga0496100_0116497 | Ga0496100_0116497_793_1056 | 87 |
| 1092 | 3300048903 | Ga0496100_0194514 | Ga0496100_0194514_403_666 | 87 |
| 1093 | 3300048903 | Ga0496100_0389634 | Ga0496100_0389634_79_342 | 87 |
| 1094 | 3300048904 | Ga0496101_0001983 | Ga0496101_0001983_4422_4685 | 87 |
| 1095 | 3300048904 | Ga0496101_0002395 | Ga0496101_0002395_2494_2757 | 87 |
| 1096 | 3300048904 | Ga0496101_0029082 | Ga0496101_0029082_3151_3414 | 87 |
| 1097 | 3300048904 | Ga0496101_0127119 | Ga0496101_0127119_245_508 | 87 |
| 1098 | 3300048904 | Ga0496101_0182014 | Ga0496101_0182014_1114_1377 | 87 |
| 1099 | 3300048904 | Ga0496101_0242662 | Ga0496101_0242662_427_690 | 87 |
| 1100 | 3300048904 | Ga0496101_0388549 | Ga0496101_0388549_751_1014 | 87 |
| 1101 | 3300048904 | Ga0496101_0431248 | Ga0496101_0431248_242_505 | 87 |
| 1102 | 3300048904 | Ga0496101_1179423 | Ga0496101_1179423_326_589 | 87 |
| 1103 | 3300048905 | Ga0496102_0002614 | Ga0496102_0002614_2658_2921 | 87 |
| 1104 | 3300048905 | Ga0496102_0002793 | Ga0496102_0002793_5482_5745 | 87 |
| 1105 | 3300048905 | Ga0496102_0016941 | Ga0496102_0016941_2875_3171 | 87 |
| 1106 | 3300048905 | Ga0496102_0028300 | Ga0496102_0028300_1412_1675 | 87 |
| 1107 | 3300048905 | Ga0496102_0031173 | Ga0496102_0031173_683_946 | 87 |
| 1108 | 3300048905 | Ga0496102_0220102 | Ga0496102_0220102_620_883 | 87 |
| 1109 | 3300048905 | Ga0496102_0222643 | Ga0496102_0222643_1306_1569 | 87 |
| 1110 | 3300048905 | Ga0496102_1061322 | Ga0496102_1061322_46_309 | 87 |
| 1111 | 3300048906 | Ga0496103_0002369 | Ga0496103_0002369_4410_4673 | 87 |
| 1112 | 3300048906 | Ga0496103_0020821 | Ga0496103_0020821_1904_2200 | 87 |
| 1113 | 3300048906 | Ga0496103_0021619 | Ga0496103_0021619_3407_3670 | 87 |
| 1114 | 3300048906 | Ga0496103_0058182 | Ga0496103_0058182_1940_2203 | 87 |
| 1115 | 3300048906 | Ga0496103_0183089 | Ga0496103_0183089_212_475 | 87 |
| 1116 | 3300048906 | Ga0496103_0207186 | Ga0496103_0207186_495_758 | 87 |
| 1117 | 3300048906 | Ga0496103_0716510 | Ga0496103_0716510_19_282 | 87 |
| 1118 | 3300048907 | Ga0496104_0003070 | Ga0496104_0003070_12835_13098 | 87 |
| 1119 | 3300048907 | Ga0496104_0004660 | Ga0496104_0004660_9582_9845 | 87 |
| 1120 | 3300048907 | Ga0496104_0017458 | Ga0496104_0017458_4793_5056 | 87 |
| 1121 | 3300048907 | Ga0496104_0042670 | Ga0496104_0042670_1303_1599 | 87 |
| 1122 | 3300048907 | Ga0496104_0053307 | Ga0496104_0053307_2159_2422 | 87 |
| 1123 | 3300048907 | Ga0496104_0073885 | Ga0496104_0073885_425_688 | 87 |
| 1124 | 3300048907 | Ga0496104_0137363 | Ga0496104_0137363_1432_1695 | 87 |
| 1125 | 3300048907 | Ga0496104_0146743 | Ga0496104_0146743_1298_1561 | 87 |
| 1126 | 3300048908 | Ga0496105_0003019 | Ga0496105_0003019_5766_6029 | 87 |
| 1127 | 3300048908 | Ga0496105_0007082 | Ga0496105_0007082_585_881 | 87 |
| 1128 | 3300048908 | Ga0496105_0016356 | Ga0496105_0016356_2865_3128 | 87 |
| 1129 | 3300048908 | Ga0496105_0034082 | Ga0496105_0034082_2040_2303 | 87 |
| 1130 | 3300048908 | Ga0496105_0173296 | Ga0496105_0173296_203_466 | 87 |
| 1131 | 3300048908 | Ga0496105_0384483 | Ga0496105_0384483_761_1024 | 87 |
| 1132 | 3300048908 | Ga0496105_0715503 | Ga0496105_0715503_55_318 | 87 |
| 1133 | 3300048908 | Ga0496105_0784515 | Ga0496105_0784515_452_715 | 87 |
| 1134 | 3300048908 | Ga0496105_1042679 | Ga0496105_1042679_99_362 | 87 |
| 1135 | 3300048909 | Ga0496106_0001912 | Ga0496106_0001912_11843_12106 | 87 |
| 1136 | 3300048909 | Ga0496106_0007123 | Ga0496106_0007123_4339_4602 | 87 |
| 1137 | 3300048909 | Ga0496106_0010646 | Ga0496106_0010646_2594_2857 | 87 |
| 1138 | 3300048909 | Ga0496106_0033866 | Ga0496106_0033866_1418_1714 | 87 |
| 1139 | 3300048909 | Ga0496106_0049304 | Ga0496106_0049304_1057_1320 | 87 |
| 1140 | 3300048909 | Ga0496106_0102418 | Ga0496106_0102418_1932_2195 | 87 |
| 1141 | 3300048909 | Ga0496106_0210567 | Ga0496106_0210567_427_690 | 87 |
| 1142 | 3300048909 | Ga0496106_0359577 | Ga0496106_0359577_427_690 | 87 |
| 1143 | 3300048909 | Ga0496106_1222185 | Ga0496106_1222185_83_346 | 87 |
| 1144 | 3300048910 | Ga0496107_0000684 | Ga0496107_0000684_8590_8853 | 87 |
| 1145 | 3300048910 | Ga0496107_0005855 | Ga0496107_0005855_6006_6269 | 87 |
| 1146 | 3300048910 | Ga0496107_0006823 | Ga0496107_0006823_7152_7415 | 87 |
| 1147 | 3300048910 | Ga0496107_0019014 | Ga0496107_0019014_80_343 | 87 |
| 1148 | 3300048910 | Ga0496107_0039820 | Ga0496107_0039820_1071_1334 | 87 |
| 1149 | 3300048910 | Ga0496107_0051559 | Ga0496107_0051559_940_1236 | 87 |
| 1150 | 3300048910 | Ga0496107_0365581 | Ga0496107_0365581_311_574 | 87 |
| 1151 | 3300048910 | Ga0496107_0820707 | Ga0496107_0820707_351_614 | 87 |
| 1152 | 3300048910 | Ga0496107_1039177 | Ga0496107_1039177_191_454 | 87 |
| 1153 | 3300048911 | Ga0496108_0000951 | Ga0496108_0000951_282_578 | 87 |
| 1154 | 3300048911 | Ga0496108_0016761 | Ga0496108_0016761_825_1088 | 87 |
| 1155 | 3300048911 | Ga0496108_0017326 | Ga0496108_0017326_1235_1498 | 87 |
| 1156 | 3300048911 | Ga0496108_0029894 | Ga0496108_0029894_1545_1808 | 87 |
| 1157 | 3300048911 | Ga0496108_0052548 | Ga0496108_0052548_1123_1386 | 87 |
| 1158 | 3300048911 | Ga0496108_0426480 | Ga0496108_0426480_546_809 | 87 |
| 1159 | 3300048911 | Ga0496108_0448572 | Ga0496108_0448572_133_396 | 87 |
| 1160 | 3300048911 | Ga0496108_0481997 | Ga0496108_0481997_271_534 | 87 |
| 1161 | 3300048911 | Ga0496108_0725892 | Ga0496108_0725892_580_843 | 87 |
| 1162 | 3300048911 | Ga0496108_0850189 | Ga0496108_0850189_147_410 | 87 |
| 1163 | 3300048911 | Ga0496108_1623085 | Ga0496108_1623085_63_326 | 87 |
| 1164 | 3300048912 | Ga0496109_0004879 | Ga0496109_0004879_5155_5418 | 87 |
| 1165 | 3300048912 | Ga0496109_0010573 | Ga0496109_0010573_3193_3456 | 87 |
| 1166 | 3300048912 | Ga0496109_0017589 | Ga0496109_0017589_348_611 | 87 |
| 1167 | 3300048912 | Ga0496109_0021372 | Ga0496109_0021372_1980_2276 | 87 |
| 1168 | 3300048912 | Ga0496109_0037905 | Ga0496109_0037905_2792_3055 | 87 |
| 1169 | 3300048912 | Ga0496109_0277762 | Ga0496109_0277762_271_534 | 87 |
| 1170 | 3300048912 | Ga0496109_0469346 | Ga0496109_0469346_500_763 | 87 |
| 1171 | 3300048912 | Ga0496109_0547916 | Ga0496109_0547916_425_688 | 87 |
| 1172 | 3300048912 | Ga0496109_0572689 | Ga0496109_0572689_571_834 | 87 |
| 1173 | 3300048912 | Ga0496109_1081041 | Ga0496109_1081041_41_304 | 87 |
| 1174 | 3300048913 | Ga0496110_0010330 | Ga0496110_0010330_3480_3743 | 87 |
| 1175 | 3300048913 | Ga0496110_0025021 | Ga0496110_0025021_68_364 | 87 |
| 1176 | 3300048913 | Ga0496110_0033011 | Ga0496110_0033011_1691_1954 | 87 |
| 1177 | 3300048913 | Ga0496110_0148396 | Ga0496110_0148396_705_968 | 87 |
| 1178 | 3300048913 | Ga0496110_0195249 | Ga0496110_0195249_481_744 | 87 |
| 1179 | 3300048913 | Ga0496110_0235839 | Ga0496110_0235839_1222_1485 | 87 |
| 1180 | 3300048913 | Ga0496110_0413577 | Ga0496110_0413577_347_610 | 87 |
| 1181 | 3300048913 | Ga0496110_0766572 | Ga0496110_0766572_179_442 | 87 |
| 1182 | 3300048914 | Ga0496111_0002467 | Ga0496111_0002467_6814_7110 | 87 |
| 1183 | 3300048914 | Ga0496111_0015671 | Ga0496111_0015671_1814_2077 | 87 |
| 1184 | 3300048914 | Ga0496111_0028559 | Ga0496111_0028559_2466_2729 | 87 |
| 1185 | 3300048914 | Ga0496111_0033708 | Ga0496111_0033708_3087_3350 | 87 |
| 1186 | 3300048914 | Ga0496111_0040561 | Ga0496111_0040561_1626_1889 | 87 |
| 1187 | 3300048914 | Ga0496111_0341480 | Ga0496111_0341480_373_636 | 87 |
| 1188 | 3300048915 | Ga0496112_0007378 | Ga0496112_0007378_6047_6310 | 87 |
| 1189 | 3300048915 | Ga0496112_0023680 | Ga0496112_0023680_4733_5029 | 87 |
| 1190 | 3300048915 | Ga0496112_0057371 | Ga0496112_0057371_2068_2331 | 87 |
| 1191 | 3300048915 | Ga0496112_0060168 | Ga0496112_0060168_390_653 | 87 |
| 1192 | 3300048915 | Ga0496112_0063132 | Ga0496112_0063132_2811_3074 | 87 |
| 1193 | 3300048915 | Ga0496112_0189422 | Ga0496112_0189422_1285_1548 | 87 |
| 1194 | 3300048915 | Ga0496112_0612371 | Ga0496112_0612371_398_661 | 87 |
| 1195 | 3300048915 | Ga0496112_0615256 | Ga0496112_0615256_210_473 | 87 |
| 1196 | 3300048915 | Ga0496112_0643787 | Ga0496112_0643787_43_306 | 87 |
| 1197 | 3300048916 | Ga0496113_0000043 | Ga0496113_0000043_941_1237 | 87 |
| 1198 | 3300048916 | Ga0496113_0004559 | Ga0496113_0004559_4728_4991 | 87 |
| 1199 | 3300048916 | Ga0496113_0019261 | Ga0496113_0019261_3082_3345 | 87 |
| 1200 | 3300048916 | Ga0496113_0022484 | Ga0496113_0022484_2962_3225 | 87 |
| 1201 | 3300048916 | Ga0496113_0023083 | Ga0496113_0023083_1558_1821 | 87 |
| 1202 | 3300048916 | Ga0496113_0070377 | Ga0496113_0070377_1878_2141 | 87 |
| 1203 | 3300048916 | Ga0496113_0105396 | Ga0496113_0105396_459_722 | 87 |
| 1204 | 3300048917 | Ga0496114_0007468 | Ga0496114_0007468_7554_7817 | 87 |
| 1205 | 3300048917 | Ga0496114_0036470 | Ga0496114_0036470_3423_3686 | 87 |
| 1206 | 3300048917 | Ga0496114_0045150 | Ga0496114_0045150_3169_3432 | 87 |
| 1207 | 3300048917 | Ga0496114_0080971 | Ga0496114_0080971_452_715 | 87 |
| 1208 | 3300048917 | Ga0496114_0221242 | Ga0496114_0221242_1127_1390 | 87 |
| 1209 | 3300048917 | Ga0496114_0375589 | Ga0496114_0375589_782_1045 | 87 |
| 1210 | 3300048918 | Ga0496115_0002647 | Ga0496115_0002647_4853_5116 | 87 |
| 1211 | 3300048918 | Ga0496115_0003701 | Ga0496115_0003701_3588_3851 | 87 |
| 1212 | 3300048918 | Ga0496115_0008385 | Ga0496115_0008385_2766_3029 | 87 |
| 1213 | 3300048918 | Ga0496115_0030611 | Ga0496115_0030611_1808_2104 | 87 |
| 1214 | 3300048918 | Ga0496115_0090923 | Ga0496115_0090923_284_547 | 87 |
| 1215 | 3300048918 | Ga0496115_0097906 | Ga0496115_0097906_1164_1427 | 87 |
| 1216 | 3300048918 | Ga0496115_0132287 | Ga0496115_0132287_980_1243 | 87 |
| 1217 | 3300048918 | Ga0496115_0307845 | Ga0496115_0307845_960_1223 | 87 |
| 1218 | 3300048918 | Ga0496115_0798912 | Ga0496115_0798912_143_406 | 87 |
| 1219 | 3300048922 | Ga0496119_0320507 | Ga0496119_0320507_37_300 | 87 |
| 1220 | 3300048924 | Ga0496121_0280117 | Ga0496121_0280117_114_377 | 87 |
| 1221 | 3300049568 | Ga0501031_0104617 | Ga0501031_0104617_551_814 | 87 |
| 1222 | 3300049568 | Ga0501031_0248268 | Ga0501031_0248268_182_445 | 87 |
| 1223 | 3300049568 | Ga0501031_0466125 | Ga0501031_0466125_416_679 | 87 |
| 1224 | 3300049569 | Ga0501032_0078980 | Ga0501032_0078980_1509_1772 | 87 |
| 1225 | 3300049569 | Ga0501032_0285164 | Ga0501032_0285164_35_298 | 87 |
| 1226 | 3300049569 | Ga0501032_0310148 | Ga0501032_0310148_694_957 | 87 |
| 1227 | 3300049570 | Ga0501033_0037850 | Ga0501033_0037850_352_615 | 87 |
| 1228 | 3300049570 | Ga0501033_0061139 | Ga0501033_0061139_1382_1645 | 87 |
| 1229 | 3300049570 | Ga0501033_0305697 | Ga0501033_0305697_236_499 | 87 |
| 1230 | 3300049570 | Ga0501033_0815407 | Ga0501033_0815407_105_368 | 87 |
| 1231 | 3300049570 | Ga0501033_0864931 | Ga0501033_0864931_215_478 | 87 |
| 1232 | 3300049571 | Ga0501034_0011170 | Ga0501034_0011170_717_980 | 87 |
| 1233 | 3300049571 | Ga0501034_0114840 | Ga0501034_0114840_2039_2302 | 87 |
| 1234 | 3300049571 | Ga0501034_0126832 | Ga0501034_0126832_1148_1411 | 87 |
| 1235 | 3300049571 | Ga0501034_0166390 | Ga0501034_0166390_1790_2053 | 87 |
| 1236 | 3300049571 | Ga0501034_0265926 | Ga0501034_0265926_765_1028 | 87 |
| 1237 | 3300049571 | Ga0501034_0441180 | Ga0501034_0441180_700_963 | 87 |
| 1238 | 3300049571 | Ga0501034_0488249 | Ga0501034_0488249_438_701 | 87 |
| 1239 | 3300049572 | Ga0501036_0247682 | Ga0501036_0247682_965_1228 | 87 |
| 1240 | 3300049572 | Ga0501036_1129081 | Ga0501036_1129081_112_375 | 87 |
| 1241 | 3300049572 | Ga0501036_1546404 | Ga0501036_1546404_199_462 | 87 |
| 1242 | 3300049572 | Ga0501036_1582149 | Ga0501036_1582149_184_447 | 87 |
| 1243 | 3300049572 | Ga0501036_1737362 | Ga0501036_1737362_121_384 | 87 |
| 1244 | 3300049572 | Ga0501036_1741801 | Ga0501036_1741801_221_484 | 87 |
| 1245 | 3300049573 | Ga0501037_0083329 | Ga0501037_0083329_1919_2182 | 87 |
| 1246 | 3300049573 | Ga0501037_0117592 | Ga0501037_0117592_172_435 | 87 |
| 1247 | 3300049573 | Ga0501037_0701989 | Ga0501037_0701989_332_595 | 87 |
| 1248 | 3300049574 | Ga0501038_0037153 | Ga0501038_0037153_1569_1832 | 87 |
| 1249 | 3300049574 | Ga0501038_0106265 | Ga0501038_0106265_1124_1387 | 87 |
| 1250 | 3300049574 | Ga0501038_0196973 | Ga0501038_0196973_720_983 | 87 |
| 1251 | 3300049574 | Ga0501038_0671420 | Ga0501038_0671420_307_570 | 87 |
| 1252 | 3300049574 | Ga0501038_1077093 | Ga0501038_1077093_275_538 | 87 |
| 1253 | 3300049575 | Ga0501039_0119194 | Ga0501039_0119194_177_440 | 87 |
| 1254 | 3300049575 | Ga0501039_0665796 | Ga0501039_0665796_204_467 | 87 |
| 1255 | 3300049577 | Ga0501041_0970653 | Ga0501041_0970653_160_423 | 87 |
| 1256 | 3300049579 | Ga0501043_0354867 | Ga0501043_0354867_739_1002 | 87 |
| 1257 | 3300049579 | Ga0501043_1172341 | Ga0501043_1172341_149_412 | 87 |
| 1258 | 3300049580 | Ga0501046_0614014 | Ga0501046_0614014_79_342 | 87 |
| 1259 | 3300049580 | Ga0501046_0858666 | Ga0501046_0858666_237_500 | 87 |
| 1260 | 3300049581 | Ga0501047_0011566 | Ga0501047_0011566_60_323 | 87 |
| 1261 | 3300049581 | Ga0501047_0096320 | Ga0501047_0096320_1545_1808 | 87 |
| 1262 | 3300049581 | Ga0501047_0264236 | Ga0501047_0264236_1228_1491 | 87 |
| 1263 | 3300049581 | Ga0501047_0315037 | Ga0501047_0315037_690_953 | 87 |
| 1264 | 3300049581 | Ga0501047_0326096 | Ga0501047_0326096_1089_1352 | 87 |
| 1265 | 3300049581 | Ga0501047_0338253 | Ga0501047_0338253_697_960 | 87 |
| 1266 | 3300049581 | Ga0501047_0872598 | Ga0501047_0872598_313_576 | 87 |
| 1267 | 3300049581 | Ga0501047_1090625 | Ga0501047_1090625_192_458 | 87 |
| 1268 | 3300049582 | Ga0501048_0395343 | Ga0501048_0395343_694_957 | 87 |
| 1269 | 3300049582 | Ga0501048_0495679 | Ga0501048_0495679_378_641 | 87 |
| 1270 | 3300049583 | Ga0501067_0316199 | Ga0501067_0316199_273_536 | 87 |
| 1271 | 3300049584 | Ga0501068_0530139 | Ga0501068_0530139_265_528 | 87 |
| 1272 | 3300049584 | Ga0501068_1094629 | Ga0501068_1094629_224_487 | 87 |
| 1273 | 3300049585 | Ga0501069_0334441 | Ga0501069_0334441_599_862 | 87 |
| 1274 | 3300049586 | Ga0501070_0024998 | Ga0501070_0024998_785_1048 | 87 |
| 1275 | 3300049586 | Ga0501070_0199114 | Ga0501070_0199114_806_1069 | 87 |
| 1276 | 3300049586 | Ga0501070_0341850 | Ga0501070_0341850_746_1009 | 87 |
| 1277 | 3300049586 | Ga0501070_1119183 | Ga0501070_1119183_58_321 | 87 |
| 1278 | 3300049587 | Ga0501071_0022307 | Ga0501071_0022307_906_1169 | 87 |
| 1279 | 3300049587 | Ga0501071_0397018 | Ga0501071_0397018_237_500 | 87 |
| 1280 | 3300049587 | Ga0501071_0923688 | Ga0501071_0923688_333_596 | 87 |
| 1281 | 3300049588 | Ga0501072_0248999 | Ga0501072_0248999_75_338 | 87 |
| 1282 | 3300049588 | Ga0501072_0294764 | Ga0501072_0294764_1006_1269 | 87 |
| 1283 | 3300049588 | Ga0501072_0525835 | Ga0501072_0525835_262_525 | 87 |
| 1284 | 3300049588 | Ga0501072_1106201 | Ga0501072_1106201_179_442 | 87 |
| 1285 | 3300049589 | Ga0501073_0161294 | Ga0501073_0161294_1170_1433 | 87 |
| 1286 | 3300049589 | Ga0501073_0164878 | Ga0501073_0164878_775_1038 | 87 |
| 1287 | 3300049589 | Ga0501073_0682250 | Ga0501073_0682250_334_597 | 87 |
| 1288 | 3300049589 | Ga0501073_0851019 | Ga0501073_0851019_174_437 | 87 |
| 1289 | 3300049590 | Ga0501074_0058920 | Ga0501074_0058920_1939_2202 | 87 |
| 1290 | 3300049590 | Ga0501074_0174760 | Ga0501074_0174760_1149_1412 | 87 |
| 1291 | 3300049590 | Ga0501074_0826878 | Ga0501074_0826878_174_437 | 87 |
| 1292 | 3300049591 | Ga0501075_0197119 | Ga0501075_0197119_944_1207 | 87 |
| 1293 | 3300049591 | Ga0501075_0776258 | Ga0501075_0776258_17_280 | 87 |
| 1294 | 3300049592 | Ga0501076_0004238 | Ga0501076_0004238_5551_5814 | 87 |
| 1295 | 3300049592 | Ga0501076_0613872 | Ga0501076_0613872_442_705 | 87 |
| 1296 | 3300049592 | Ga0501076_0622134 | Ga0501076_0622134_540_803 | 87 |
| 1297 | 3300049593 | Ga0501077_0090161 | Ga0501077_0090161_1196_1459 | 87 |
| 1298 | 3300049593 | Ga0501077_0250185 | Ga0501077_0250185_605_868 | 87 |
| 1299 | 3300049593 | Ga0501077_1113334 | Ga0501077_1113334_86_349 | 87 |
| 1300 | 3300049741 | Ga0501079_0189607 | Ga0501079_0189607_853_1116 | 87 |
| 1301 | 3300049742 | Ga0501080_0155676 | Ga0501080_0155676_1035_1298 | 87 |
| 1302 | 3300049742 | Ga0501080_0181125 | Ga0501080_0181125_1166_1429 | 87 |
| 1303 | 3300049742 | Ga0501080_0218938 | Ga0501080_0218938_247_510 | 87 |
| 1304 | 3300049742 | Ga0501080_0298760 | Ga0501080_0298760_1165_1428 | 87 |
| 1305 | 3300049743 | Ga0501081_0116221 | Ga0501081_0116221_1611_1874 | 87 |
| 1306 | 3300049743 | Ga0501081_0462783 | Ga0501081_0462783_502_765 | 87 |
| 1307 | 3300049744 | Ga0501083_0014091 | Ga0501083_0014091_1735_1998 | 87 |
| 1308 | 3300049744 | Ga0501083_0102673 | Ga0501083_0102673_1426_1689 | 87 |
| 1309 | 3300049744 | Ga0501083_0396630 | Ga0501083_0396630_521_784 | 87 |
| 1310 | 3300049744 | Ga0501083_0571174 | Ga0501083_0571174_72_335 | 87 |
| 1311 | 3300049822 | Ga0501035_0025517 | Ga0501035_0025517_1704_1967 | 87 |
| 1312 | 3300049822 | Ga0501035_0250857 | Ga0501035_0250857_322_585 | 87 |
| 1313 | 3300049822 | Ga0501035_0459518 | Ga0501035_0459518_90_353 | 87 |
| 1314 | 3300049823 | Ga0501044_0036606 | Ga0501044_0036606_1509_1772 | 87 |
| 1315 | 3300049823 | Ga0501044_0119053 | Ga0501044_0119053_1940_2203 | 87 |
| 1316 | 3300049823 | Ga0501044_0248327 | Ga0501044_0248327_700_963 | 87 |
| 1317 | 3300049823 | Ga0501044_0762780 | Ga0501044_0762780_294_557 | 87 |
| 1318 | 3300049823 | Ga0501044_1364163 | Ga0501044_1364163_28_291 | 87 |
| 1319 | 3300049823 | Ga0501044_1532839 | Ga0501044_1532839_133_396 | 87 |
| 1320 | 3300049824 | Ga0501045_0445821 | Ga0501045_0445821_398_661 | 87 |
| 1321 | 3300049824 | Ga0501045_0720253 | Ga0501045_0720253_278_541 | 87 |
| 1322 | 3300050489 | nmdc:mga03683_259195_c1 | nmdc:mga03683_259195_c1_145_408 | 87 |
| 1323 | 3300050489 | nmdc:mga03683_357801_c1 | nmdc:mga03683_357801_c1_366_629 | 87 |
| 1324 | 3300050490 | nmdc:mga03n38_188377_c1 | nmdc:mga03n38_188377_c1_304_567 | 87 |
| 1325 | 3300050490 | nmdc:mga03n38_518282_c1 | nmdc:mga03n38_518282_c1_375_638 | 87 |
| 1326 | 3300050492 | nmdc:mga0yw44_10242_c2 | nmdc:mga0yw44_10242_c2_3944_4207 | 87 |
| 1327 | 3300050492 | nmdc:mga0yw44_1082862_c1 | nmdc:mga0yw44_1082862_c1_219_482 | 87 |
| 1328 | 3300050492 | nmdc:mga0yw44_303410_c1 | nmdc:mga0yw44_303410_c1_675_938 | 87 |
| 1329 | 3300050492 | nmdc:mga0yw44_56590_c1 | nmdc:mga0yw44_56590_c1_41_304 | 87 |
| 1330 | 3300050492 | nmdc:mga0yw44_813_c1 | nmdc:mga0yw44_813_c1_6804_7067 | 87 |
| 1331 | 3300050493 | nmdc:mga0k408_184574_c1 | nmdc:mga0k408_184574_c1_532_795 | 87 |
| 1332 | 3300050494 | nmdc:mga06z11_1002996_c1 | nmdc:mga06z11_1002996_c1_100_363 | 87 |
| 1333 | 3300050494 | nmdc:mga06z11_181820_c1 | nmdc:mga06z11_181820_c1_558_821 | 87 |
| 1334 | 3300050494 | nmdc:mga06z11_51514_c1 | nmdc:mga06z11_51514_c1_847_1110 | 87 |
| 1335 | 3300050494 | nmdc:mga06z11_923611_c1 | nmdc:mga06z11_923611_c1_120_383 | 87 |
| 1336 | 3300050495 | nmdc:mga04h51_27546_c1 | nmdc:mga04h51_27546_c1_1425_1688 | 87 |
| 1337 | 3300050495 | nmdc:mga04h51_481589_c1 | nmdc:mga04h51_481589_c1_252_515 | 87 |
| 1338 | 3300050496 | nmdc:mga07m45_139450_c1 | nmdc:mga07m45_139450_c1_272_535 | 87 |
| 1339 | 3300050496 | nmdc:mga07m45_61289_c1 | nmdc:mga07m45_61289_c1_480_743 | 87 |
| 1340 | 3300050507 | nmdc:mga05p37_23570_c1 | nmdc:mga05p37_23570_c1_3912_4208 | 87 |
| 1341 | 3300050507 | nmdc:mga05p37_300683_c1 | nmdc:mga05p37_300683_c1_1532_1795 | 87 |
| 1342 | 3300050507 | nmdc:mga05p37_604329_c1 | nmdc:mga05p37_604329_c1_430_693 | 87 |
| 1343 | 3300050508 | nmdc:mga09592_1341318_c1 | nmdc:mga09592_1341318_c1_41_304 | 87 |
| 1344 | 3300050508 | nmdc:mga09592_224426_c1 | nmdc:mga09592_224426_c1_1264_1527 | 87 |
| 1345 | 3300050508 | nmdc:mga09592_425938_c1 | nmdc:mga09592_425938_c1_429_725 | 87 |
| 1346 | 3300050508 | nmdc:mga09592_70139_c1 | nmdc:mga09592_70139_c1_2646_2909 | 87 |
| 1347 | 3300050509 | nmdc:mga0qj67_229704_c1 | nmdc:mga0qj67_229704_c1_907_1170 | 87 |
| 1348 | 3300050509 | nmdc:mga0qj67_50_c1 | nmdc:mga0qj67_50_c1_24368_24637 | 87 |
| 1349 | 3300050509 | nmdc:mga0qj67_595131_c1 | nmdc:mga0qj67_595131_c1_387_650 | 87 |
| 1350 | 3300050509 | nmdc:mga0qj67_667110_c1 | nmdc:mga0qj67_667110_c1_52_315 | 87 |
| 1351 | 3300050510 | nmdc:mga06r32_118088_c1 | nmdc:mga06r32_118088_c1_875_1138 | 87 |
| 1352 | 3300050510 | nmdc:mga06r32_135238_c1 | nmdc:mga06r32_135238_c1_552_815 | 87 |
| 1353 | 3300050510 | nmdc:mga06r32_391370_c1 | nmdc:mga06r32_391370_c1_654_917 | 87 |
| 1354 | 3300050510 | nmdc:mga06r32_79786_c1 | nmdc:mga06r32_79786_c1_2157_2420 | 87 |
| 1355 | 3300050511 | nmdc:mga08y16_100861_c1 | nmdc:mga08y16_100861_c1_2501_2764 | 87 |
| 1356 | 3300050511 | nmdc:mga08y16_274487_c1 | nmdc:mga08y16_274487_c1_746_1009 | 87 |
| 1357 | 3300050511 | nmdc:mga08y16_310668_c1 | nmdc:mga08y16_310668_c1_886_1149 | 87 |
| 1358 | 3300050511 | nmdc:mga08y16_356875_c1 | nmdc:mga08y16_356875_c1_543_806 | 87 |
| 1359 | 3300050511 | nmdc:mga08y16_71155_c1 | nmdc:mga08y16_71155_c1_825_1121 | 87 |
| 1360 | 3300050512 | nmdc:mga0n895_117132_c1 | nmdc:mga0n895_117132_c1_527_790 | 87 |
| 1361 | 3300050512 | nmdc:mga0n895_1184061_c1 | nmdc:mga0n895_1184061_c1_53_316 | 87 |
| 1362 | 3300050512 | nmdc:mga0n895_246323_c1 | nmdc:mga0n895_246323_c1_872_1168 | 87 |
| 1363 | 3300050512 | nmdc:mga0n895_50546_c1 | nmdc:mga0n895_50546_c1_2348_2611 | 87 |
| 1364 | 3300050512 | nmdc:mga0n895_692285_c1 | nmdc:mga0n895_692285_c1_398_661 | 87 |
| 1365 | 3300050512 | nmdc:mga0n895_70607_c1 | nmdc:mga0n895_70607_c1_2581_2844 | 87 |
| 1366 | 3300050512 | nmdc:mga0n895_840329_c1 | nmdc:mga0n895_840329_c1_103_366 | 87 |
| 1367 | 3300050513 | nmdc:mga0rr50_158771_c1 | nmdc:mga0rr50_158771_c1_444_707 | 87 |
| 1368 | 3300050513 | nmdc:mga0rr50_247128_c1 | nmdc:mga0rr50_247128_c1_791_1087 | 87 |
| 1369 | 3300050513 | nmdc:mga0rr50_53320_c1 | nmdc:mga0rr50_53320_c1_1325_1588 | 87 |
| 1370 | 3300050514 | nmdc:mga08x19_1193104_c1 | nmdc:mga08x19_1193104_c1_34_297 | 87 |
| 1371 | 3300050514 | nmdc:mga08x19_500277_c1 | nmdc:mga08x19_500277_c1_174_437 | 87 |
| 1372 | 3300050514 | nmdc:mga08x19_56031_c1 | nmdc:mga08x19_56031_c1_747_1010 | 87 |
| 1373 | 3300050515 | nmdc:mga0a205_11361_c1 | nmdc:mga0a205_11361_c1_7818_8081 | 87 |
| 1374 | 3300050515 | nmdc:mga0a205_1151012_c1 | nmdc:mga0a205_1151012_c1_247_510 | 87 |
| 1375 | 3300050515 | nmdc:mga0a205_1240444_c1 | nmdc:mga0a205_1240444_c1_58_321 | 87 |
| 1376 | 3300050515 | nmdc:mga0a205_348188_c1 | nmdc:mga0a205_348188_c1_597_860 | 87 |
| 1377 | 3300053077 | Ga0495601_0001376 | Ga0495601_0001376_4227_4490 | 87 |
| 1378 | 3300053077 | Ga0495601_0001735 | Ga0495601_0001735_1291_1554 | 87 |
| 1379 | 3300053077 | Ga0495601_0062873 | Ga0495601_0062873_1166_1429 | 87 |
| 1380 | 3300053077 | Ga0495601_0082471 | Ga0495601_0082471_701_964 | 87 |
| 1381 | 3300053077 | Ga0495601_0439416 | Ga0495601_0439416_364_627 | 87 |
| 1382 | 3300053078 | Ga0495612_0000562 | Ga0495612_0000562_12480_12743 | 87 |
| 1383 | 3300053078 | Ga0495612_0057057 | Ga0495612_0057057_1206_1469 | 87 |
| 1384 | 3300053078 | Ga0495612_0089880 | Ga0495612_0089880_559_822 | 87 |
| 1385 | 3300053078 | Ga0495612_0453878 | Ga0495612_0453878_150_413 | 87 |
| 1386 | 3300053083 | Ga0495655_0007915 | Ga0495655_0007915_166_429 | 87 |
| 1387 | 3300053083 | Ga0495655_0022803 | Ga0495655_0022803_325_588 | 87 |
| 1388 | 3300053084 | Ga0495595_0003174 | Ga0495595_0003174_409_672 | 87 |
| 1389 | 3300053084 | Ga0495595_0007422 | Ga0495595_0007422_3061_3324 | 87 |
| 1390 | 3300053084 | Ga0495595_0018837 | Ga0495595_0018837_2165_2428 | 87 |
| 1391 | 3300053084 | Ga0495595_0281332 | Ga0495595_0281332_29_292 | 87 |
| 1392 | 3300053084 | Ga0495595_0447850 | Ga0495595_0447850_177_440 | 87 |
| 1393 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_32251_32514 | 87 |
| 1394 | 3300053085 | Ga0495619_0000484 | Ga0495619_0000484_380_643 | 87 |
| 1395 | 3300053085 | Ga0495619_0016005 | Ga0495619_0016005_2241_2504 | 87 |
| 1396 | 3300053085 | Ga0495619_0016140 | Ga0495619_0016140_852_1115 | 87 |
| 1397 | 3300053085 | Ga0495619_0112163 | Ga0495619_0112163_70_333 | 87 |
| 1398 | 3300053085 | Ga0495619_0286387 | Ga0495619_0286387_338_601 | 87 |
| 1399 | 3300053094 | Ga0500566_0142694 | Ga0500566_0142694_130_393 | 87 |
| 1400 | 3300053096 | Ga0500641_0002785 | Ga0500641_0002785_4657_4920 | 87 |
| 1401 | 3300053117 | Ga0500593_018605 | Ga0500593_018605_620_916 | 87 |
| 1402 | 3300053728 | Ga0500657_225075 | Ga0500657_225075_33_296 | 87 |
| 1403 | 3300053730 | Ga0500645_063080 | Ga0500645_063080_139_408 | 87 |
| 1404 | 3300054114 | Ga0501084_0422455 | Ga0501084_0422455_694_957 | 87 |
| 1405 | 3300054114 | Ga0501084_0448276 | Ga0501084_0448276_726_989 | 87 |
| 1406 | 3300054114 | Ga0501084_0624656 | Ga0501084_0624656_490_753 | 87 |
| 1407 | 3300054114 | Ga0501084_0707419 | Ga0501084_0707419_218_481 | 87 |
| 1408 | 3300054114 | Ga0501084_1301103 | Ga0501084_1301103_266_529 | 87 |
| 1409 | 3300060353 | Ga0501082_0018385 | Ga0501082_0018385_746_1009 | 87 |
| 1410 | 3300060353 | Ga0501082_0159213 | Ga0501082_0159213_1277_1540 | 87 |
| 1411 | 3300060353 | Ga0501082_0784497 | Ga0501082_0784497_414_677 | 87 |
| 1412 | 3300060353 | Ga0501082_1666857 | Ga0501082_1666857_229_492 | 87 |
| 1413 | 3300061734 | Ga0530510_0294726 | Ga0530510_0294726_580_843 | 87 |
| 1414 | 3300061734 | Ga0530510_0552549 | Ga0530510_0552549_561_824 | 87 |
| 1415 | 3300061734 | Ga0530510_0870287 | Ga0530510_0870287_52_315 | 87 |
| 1416 | 3300061734 | Ga0530510_0891222 | Ga0530510_0891222_92_382 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fcm-assembly2.cif.gz_B | crystal structure of a nudix hydrolase from clostridium perfringens | 0.8923 | 69 | 86 |
| 6ous-assembly1.cif.gz_D | structure of fusion glycoprotein from human respiratory syncytial virus | 0.5168 | 38 | 82 |
| 2phk-assembly1.cif.gz_A-2 | the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition | 0.4618 | 36 | 81 |
| 4du0-assembly5.cif.gz_D-2 | crystal structure of human alpha-defensin 1, hnp1 (g17a mutant) | 0.3885 | 62 | 84 |
| 1zmk-assembly1.cif.gz_B | crystal structure of human alpha-defensin-2 (variant gly16-> d-ala), p 42 21 2 space group | 0.3361 | 62 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WEQ3_485_592_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5116 | 47 | 81 | 3.30.200.20 |
| af_O06796_1_121_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.4959 | 49 | 87 | 3.30.920.10 |
| af_A4IAU7_107_274_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4912 | 42 | 87 | 1.10.510.10 |
| af_A4HW76_216_470_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4847 | 43 | 87 | 1.10.510.10 |
| af_C0H4G2_2_88_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4728 | 50 | 78 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537VQR1-F1-model_v4 | Uncharacterized protein | 0.8411 | 24 | 87 |
GO:0016020
|
| AF-K7RSY2-F1-model_v4 | HipA N-terminal domain-containing protein | 0.7807 | 63 | 87 |
GO:0004674
GO:0005829 |
| AF-D7A4B6-F1-model_v4 | Uncharacterized protein | 0.6765 | 1 | 87 |
GO:0016020
|
| AF-D7A4B6-F1-model_v4 | Uncharacterized protein | 0.6704 | 1 | 87 |
GO:0016020
|
| AF-A0A537VQR1-F1-model_v4 | Uncharacterized protein | 0.6362 | 24 | 87 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar