F493788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1416 | 715 | 796 | 440 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_100002388|Ga0070661_1000023885 |
| Length | 478 |
| Sequence | MPPDRIRKQGLPLSRDRHRGETLVLIAGSGCYPALMPAYTPLSNVALTGLARDLAKRADDNKPIRIGVIGSGEMGTDLVTQCMLMRGVEVAAIATRRPHTALEATAIAYGDTSHAIEADTLGKVSAAIGSKKLAITSADTLVRTPEIDVVIDATGKPGVAADFDLLAMEHGKHLVMMNVEADVTIGRYLKHEADRLGVVYSVGAGDEPSSCMELIEFATALGYRIVAAGKGKNNAFNRDAVPDDYREEATRRNMNPRMLVEFVDGSKTMVEMACIANATGLVPDVPGMHGPAADRDQMVKVLIPKADGGILDKKGVVDFTVGKGVAPGVFVIVEAEHPRIIERMDDLHIGHGPYYSFFRPYHLTSLEVPLTAARIMLTGKPDMVPLAHPVAEVCAVAKRDLAVGEKFDAIGETCYRSFTLTAADARNRNAVPVGLLEGGRVIAPVKKGELLTTANSAPDQTTRLYALRQRQDQMGSES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 8 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 9 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 10 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 11 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 12 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 13 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 14 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 15 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 16 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 17 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 18 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 19 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 20 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 21 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 22 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 23 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 24 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 25 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 26 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 27 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 28 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 29 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 30 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 31 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 32 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 33 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 34 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 35 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 36 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 37 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 38 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 39 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 40 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 41 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 42 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 43 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 44 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 45 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 46 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 47 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 48 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 49 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 50 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 51 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 52 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 53 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 54 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 55 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 56 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 57 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 58 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 59 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 60 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 61 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 62 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 63 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 64 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 65 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 66 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 67 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 68 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 69 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 70 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 71 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 72 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 73 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 74 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 75 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 76 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 77 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 78 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 79 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 80 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 81 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 82 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 83 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 84 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 85 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 86 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 87 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 88 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 89 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 90 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 91 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 92 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 93 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 94 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 95 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 96 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 97 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 98 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 99 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 100 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 101 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 102 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 103 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 104 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 105 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 106 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 107 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 108 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 109 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 110 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 111 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 112 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 113 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 114 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 115 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 116 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 117 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 118 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 119 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 120 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 121 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 122 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 123 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 124 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 125 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 126 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 127 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 128 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 129 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 130 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 131 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 132 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 133 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 134 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 135 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 136 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 137 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 138 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 139 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 140 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 141 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 142 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 143 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 144 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 145 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 146 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 147 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 148 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 149 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 150 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 151 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 152 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 153 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 154 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 155 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 156 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 157 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 158 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 159 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 160 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 161 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 162 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 163 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 164 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 165 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 166 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 167 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 168 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 169 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 170 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 171 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 172 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 173 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 174 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 175 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 176 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 177 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 178 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 179 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 180 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 181 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 182 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 183 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 184 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 185 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 186 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 187 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 188 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 189 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 190 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 191 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 192 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 193 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 194 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 195 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 196 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 197 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 198 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 199 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 200 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 201 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 202 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 203 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 204 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 205 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 206 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 207 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 208 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 209 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 210 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 211 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 212 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 213 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 214 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 215 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 216 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 217 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 218 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 219 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 220 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 221 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 222 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 223 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 224 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 225 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 226 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 227 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 228 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 229 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 230 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 231 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 232 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 233 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 234 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 235 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 236 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 237 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 238 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 239 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 240 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 241 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 242 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 243 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 244 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 245 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 246 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 247 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 248 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 249 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 250 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 251 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 252 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 253 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 254 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 255 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 256 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 257 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 258 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 259 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 260 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 261 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 262 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 263 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 264 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 265 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 266 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 267 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 268 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 269 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 270 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 271 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 272 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 273 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 274 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 275 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 276 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 277 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 278 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 279 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 280 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 281 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 282 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 283 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 284 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 285 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 286 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 287 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 288 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 289 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 290 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 291 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 292 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 293 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 294 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 295 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 296 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 297 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 298 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 299 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 300 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 301 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 302 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 303 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 304 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 305 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 306 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 307 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 308 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 309 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 310 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 311 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 312 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 313 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 314 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 315 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 316 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 317 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 318 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 319 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 320 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 321 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 322 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 323 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 324 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 325 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 326 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 327 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 328 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 329 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 330 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 331 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 332 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 333 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 334 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 335 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 336 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 337 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 338 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 339 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 340 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 341 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 342 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 343 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 344 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 345 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 346 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 349 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 350 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 352 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 354 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 355 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 357 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 364 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 365 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 367 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 368 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 369 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 370 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 372 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 373 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 374 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 375 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 376 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 377 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 378 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 379 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 380 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 381 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 382 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 383 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 384 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 385 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 386 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 387 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 388 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 389 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 390 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 391 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 392 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 393 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 394 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 395 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 396 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 397 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 398 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 399 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 400 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 401 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 402 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 403 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 404 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 405 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 406 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 407 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 408 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 409 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 410 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 411 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 412 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 413 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 414 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 415 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 416 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 418 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 419 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 420 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 422 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 423 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 424 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 426 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 430 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 431 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 432 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 433 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 434 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 435 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 436 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 437 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 438 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 439 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 440 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 441 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 442 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 443 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 444 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 445 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 446 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 447 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 448 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 449 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 450 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 453 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 455 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 457 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 461 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 462 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 465 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 466 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 467 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 527 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 528 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 529 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 530 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 531 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 532 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 533 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 534 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 535 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 536 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 537 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 538 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 539 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 540 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 541 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 542 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 543 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 544 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 545 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 546 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 547 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 548 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 549 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 550 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 551 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 553 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 554 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 555 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 556 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 557 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 558 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 559 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 560 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 561 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 562 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 563 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 564 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 565 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 566 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 567 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 568 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 569 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 570 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 571 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 572 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 573 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 574 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 575 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 576 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 577 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 578 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 579 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 580 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 581 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 582 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 583 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 584 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 585 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 586 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 587 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 588 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 589 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 590 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 608 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 609 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 610 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 611 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 612 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 613 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 614 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 615 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 616 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 617 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 618 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 619 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 620 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 621 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 622 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 623 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 624 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 625 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 626 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 627 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 628 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 629 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 635 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 637 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 638 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 641 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 659 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 660 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 661 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 662 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 663 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 664 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 665 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 666 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 667 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 669 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 670 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 671 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 672 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 673 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 674 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 675 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 676 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 677 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 678 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 679 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 680 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 681 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 682 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 685 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 686 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 687 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 688 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 689 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 690 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 691 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 692 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 693 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 694 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 695 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 696 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 697 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 698 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 699 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 700 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 701 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 702 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 703 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 704 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 705 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 706 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 707 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 708 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 709 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 710 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 711 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 712 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 713 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 714 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 715 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.14 |
| Metatranscriptomes | 0.07 |
| Isolates | 43.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.29 |
| Nodule | 35.95 |
| Rhizoplane | 1.62 |
| Rhizosphere | 46.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1004893 | 3300002705 | Bacteria | 3980 |
| 2 | JGI25157J39369_1000725 | 3300002741 | Bacteria | 17573 |
| 3 | JGI25406J46586_10006582 | 3300003203 | Bacteria | 5341 |
| 4 | JGI25165J46597_1000219 | 3300003214 | Bacteria | 79946 |
| 5 | JGI25165J46597_1004311 | 3300003214 | Bacteria | 3104 |
| 6 | JGI25153J46596_10000062 | 3300003215 | Bacteria | 129749 |
| 7 | JGI25153J46596_10000095 | 3300003215 | Bacteria | 102154 |
| 8 | Ga0055533_1000947 | 3300003756 | Bacteria | 8562 |
| 9 | Ga0055532_1000220 | 3300003758 | Bacteria | 43379 |
| 10 | Ga0055527_1000173 | 3300003760 | Bacteria | 44198 |
| 11 | Ga0055535_1000360 | 3300003761 | Bacteria | 43957 |
| 12 | Ga0055542_1000391 | 3300003762 | Bacteria | 44080 |
| 13 | Ga0055542_1000549 | 3300003762 | Bacteria | 33335 |
| 14 | Ga0055542_1001448 | 3300003762 | Bacteria | 11795 |
| 15 | Ga0055542_1001730 | 3300003762 | Bacteria | 9386 |
| 16 | Ga0055529_1001879 | 3300003763 | Bacteria | 4878 |
| 17 | Ga0055529_1002315 | 3300003763 | Bacteria | 3800 |
| 18 | Ga0055526_1000065 | 3300003771 | Bacteria | 102410 |
| 19 | Ga0055524_1000058 | 3300003775 | Bacteria | 139138 |
| 20 | Ga0055531_10029522 | 3300003794 | Bacteria | 1866 |
| 21 | Ga0065165_1000384 | 3300005262 | Bacteria | 71731 |
| 22 | Ga0070658_10014984 | 3300005327 | Bacteria | 6206 |
| 23 | Ga0070676_10073131 | 3300005328 | Bacteria | 2062 |
| 24 | Ga0070676_10096805 | 3300005328 | Bacteria | 1817 |
| 25 | Ga0070683_100014390 | 3300005329 | Bacteria | 6920 |
| 26 | Ga0070683_100047346 | 3300005329 | Bacteria | 3972 |
| 27 | Ga0070690_100019376 | 3300005330 | Bacteria | 4128 |
| 28 | Ga0070670_100000668 | 3300005331 | Bacteria | 26607 |
| 29 | Ga0070670_100002946 | 3300005331 | Bacteria | 14099 |
| 30 | Ga0070670_100020520 | 3300005331 | Bacteria | 5681 |
| 31 | Ga0070670_100053262 | 3300005331 | Bacteria | 3475 |
| 32 | Ga0068869_100006892 | 3300005334 | Bacteria | 7229 |
| 33 | Ga0068869_100018208 | 3300005334 | Bacteria | 4777 |
| 34 | Ga0068869_100053101 | 3300005334 | Bacteria | 2945 |
| 35 | Ga0068869_100116859 | 3300005334 | Bacteria | 2035 |
| 36 | Ga0070666_10007302 | 3300005335 | Bacteria | 6808 |
| 37 | Ga0070666_10014351 | 3300005335 | Bacteria | 5043 |
| 38 | Ga0070680_100181603 | 3300005336 | Bacteria | 1772 |
| 39 | Ga0068868_100016709 | 3300005338 | Bacteria | 5457 |
| 40 | Ga0068868_100024514 | 3300005338 | Bacteria | 4579 |
| 41 | Ga0068868_100063418 | 3300005338 | Bacteria | 2931 |
| 42 | Ga0070660_100004532 | 3300005339 | Bacteria | 9600 |
| 43 | Ga0070660_100005052 | 3300005339 | Bacteria | 9115 |
| 44 | Ga0070660_100110075 | 3300005339 | Bacteria | 2190 |
| 45 | Ga0070689_100035473 | 3300005340 | Bacteria | 3811 |
| 46 | Ga0070689_100146032 | 3300005340 | Bacteria | 1905 |
| 47 | Ga0070661_100000805 | 3300005344 | Bacteria | 22549 |
| 48 | Ga0070661_100002388 | 3300005344 | Bacteria | 12873 |
| 49 | Ga0070661_100013058 | 3300005344 | Bacteria | 5825 |
| 50 | Ga0070661_100019583 | 3300005344 | Bacteria | 4823 |
| 51 | Ga0070661_100062246 | 3300005344 | Bacteria | 2740 |
| 52 | Ga0070661_100099493 | 3300005344 | Bacteria | 2161 |
| 53 | Ga0070668_100002303 | 3300005347 | Bacteria | 14077 |
| 54 | Ga0070668_100003690 | 3300005347 | Bacteria | 11310 |
| 55 | Ga0070668_100032042 | 3300005347 | Bacteria | 3999 |
| 56 | Ga0070668_100114564 | 3300005347 | Bacteria | 2148 |
| 57 | Ga0070668_100187207 | 3300005347 | Bacteria | 1694 |
| 58 | Ga0070668_100212067 | 3300005347 | Bacteria | 1593 |
| 59 | Ga0070669_100035899 | 3300005353 | Bacteria | 3591 |
| 60 | Ga0070675_100003065 | 3300005354 | Bacteria | 12622 |
| 61 | Ga0070675_100006887 | 3300005354 | Bacteria | 8726 |
| 62 | Ga0070671_100003942 | 3300005355 | Bacteria | 11678 |
| 63 | Ga0070671_100010180 | 3300005355 | Bacteria | 7546 |
| 64 | Ga0070671_100015873 | 3300005355 | Bacteria | 6084 |
| 65 | Ga0070673_100003212 | 3300005364 | Bacteria | 10130 |
| 66 | Ga0070673_100003475 | 3300005364 | Bacteria | 9811 |
| 67 | Ga0070673_100006227 | 3300005364 | Bacteria | 7743 |
| 68 | Ga0070673_100027283 | 3300005364 | Bacteria | 4232 |
| 69 | Ga0070673_100095403 | 3300005364 | Bacteria | 2440 |
| 70 | Ga0070688_100009915 | 3300005365 | Bacteria | 5234 |
| 71 | Ga0070659_100000244 | 3300005366 | Bacteria | 42804 |
| 72 | Ga0070659_100001492 | 3300005366 | Bacteria | 16851 |
| 73 | Ga0070659_100018306 | 3300005366 | Bacteria | 5286 |
| 74 | Ga0070659_100068038 | 3300005366 | Bacteria | 2824 |
| 75 | Ga0070667_100005826 | 3300005367 | Bacteria | 10278 |
| 76 | Ga0070667_100022980 | 3300005367 | Bacteria | 5171 |
| 77 | Ga0070667_100031165 | 3300005367 | Bacteria | 4445 |
| 78 | Ga0070667_100085354 | 3300005367 | Bacteria | 2707 |
| 79 | Ga0070667_100263775 | 3300005367 | Bacteria | 1543 |
| 80 | Ga0070709_10011270 | 3300005434 | Bacteria | 4976 |
| 81 | Ga0070714_100007403 | 3300005435 | Bacteria | 8540 |
| 82 | Ga0070714_100062106 | 3300005435 | Bacteria | 3210 |
| 83 | Ga0070713_100002027 | 3300005436 | Bacteria | 13093 |
| 84 | Ga0070713_100033297 | 3300005436 | Bacteria | 4126 |
| 85 | Ga0070711_100000713 | 3300005439 | Bacteria | 17378 |
| 86 | Ga0070705_100020514 | 3300005440 | Bacteria | 3500 |
| 87 | Ga0070694_100021211 | 3300005444 | Bacteria | 4147 |
| 88 | Ga0070663_100011344 | 3300005455 | Bacteria | 5590 |
| 89 | Ga0070663_100080278 | 3300005455 | Bacteria | 2395 |
| 90 | Ga0070678_100010805 | 3300005456 | Bacteria | 5596 |
| 91 | Ga0070678_100059065 | 3300005456 | Bacteria | 2817 |
| 92 | Ga0070662_100000091 | 3300005457 | Bacteria | 49732 |
| 93 | Ga0070662_100015098 | 3300005457 | Bacteria | 5167 |
| 94 | Ga0070681_10001647 | 3300005458 | Bacteria | 19943 |
| 95 | Ga0068867_100157928 | 3300005459 | Bacteria | 1786 |
| 96 | Ga0068867_100210218 | 3300005459 | Bacteria | 1562 |
| 97 | Ga0070685_10013266 | 3300005466 | Bacteria | 4344 |
| 98 | Ga0070685_10089620 | 3300005466 | Bacteria | 1860 |
| 99 | Ga0070706_100047499 | 3300005467 | Bacteria | 3961 |
| 100 | Ga0070707_100022437 | 3300005468 | Bacteria | 5967 |
| 101 | Ga0070699_100054158 | 3300005518 | Bacteria | 3473 |
| 102 | Ga0070699_100055004 | 3300005518 | Bacteria | 3447 |
| 103 | Ga0070679_100015230 | 3300005530 | Bacteria | 7387 |
| 104 | Ga0070679_100044151 | 3300005530 | Bacteria | 4441 |
| 105 | Ga0070684_100026823 | 3300005535 | Bacteria | 4857 |
| 106 | Ga0068853_100000517 | 3300005539 | Bacteria | 26170 |
| 107 | Ga0068853_100001848 | 3300005539 | Bacteria | 15550 |
| 108 | Ga0068853_100002399 | 3300005539 | Bacteria | 14011 |
| 109 | Ga0068853_100007892 | 3300005539 | Bacteria | 8537 |
| 110 | Ga0068853_100009275 | 3300005539 | Bacteria | 7935 |
| 111 | Ga0068853_100031540 | 3300005539 | Bacteria | 4482 |
| 112 | Ga0068853_100048415 | 3300005539 | Bacteria | 3651 |
| 113 | Ga0068853_100088048 | 3300005539 | Bacteria | 2725 |
| 114 | Ga0070672_100001196 | 3300005543 | Bacteria | 15877 |
| 115 | Ga0070672_100107121 | 3300005543 | Bacteria | 2274 |
| 116 | Ga0070672_100178448 | 3300005543 | Bacteria | 1769 |
| 117 | Ga0070686_100003766 | 3300005544 | Bacteria | 8335 |
| 118 | Ga0070693_100002360 | 3300005547 | Bacteria | 8681 |
| 119 | Ga0070665_100001730 | 3300005548 | Bacteria | 24965 |
| 120 | Ga0070665_100130147 | 3300005548 | Bacteria | 2519 |
| 121 | Ga0070665_100196582 | 3300005548 | Bacteria | 2018 |
| 122 | Ga0070704_100039503 | 3300005549 | Bacteria | 3240 |
| 123 | Ga0068855_100000310 | 3300005563 | Bacteria | 60449 |
| 124 | Ga0068855_100001384 | 3300005563 | Bacteria | 30026 |
| 125 | Ga0068855_100207408 | 3300005563 | Bacteria | 2204 |
| 126 | Ga0070664_100000116 | 3300005564 | Bacteria | 52626 |
| 127 | Ga0070664_100000463 | 3300005564 | Bacteria | 30826 |
| 128 | Ga0070664_100037059 | 3300005564 | Bacteria | 4098 |
| 129 | Ga0070664_100166104 | 3300005564 | Bacteria | 1955 |
| 130 | Ga0068857_100001049 | 3300005577 | Bacteria | 21409 |
| 131 | Ga0068857_100003640 | 3300005577 | Bacteria | 12921 |
| 132 | Ga0068854_100007622 | 3300005578 | Bacteria | 6923 |
| 133 | Ga0068854_100009688 | 3300005578 | Bacteria | 6225 |
| 134 | Ga0068854_100076819 | 3300005578 | Bacteria | 2456 |
| 135 | Ga0068856_100001465 | 3300005614 | Bacteria | 24722 |
| 136 | Ga0068856_100077695 | 3300005614 | Bacteria | 3290 |
| 137 | Ga0068856_100081953 | 3300005614 | Bacteria | 3201 |
| 138 | Ga0068856_100089267 | 3300005614 | Bacteria | 3065 |
| 139 | Ga0068856_100101391 | 3300005614 | Bacteria | 2871 |
| 140 | Ga0070702_100009038 | 3300005615 | Bacteria | 4857 |
| 141 | Ga0070702_100017853 | 3300005615 | Bacteria | 3668 |
| 142 | Ga0068852_100000730 | 3300005616 | Bacteria | 21553 |
| 143 | Ga0068852_100003680 | 3300005616 | Bacteria | 10744 |
| 144 | Ga0068852_100013701 | 3300005616 | Bacteria | 6213 |
| 145 | Ga0068859_100001046 | 3300005617 | Bacteria | 28371 |
| 146 | Ga0068859_100008936 | 3300005617 | Bacteria | 10121 |
| 147 | Ga0068859_100198345 | 3300005617 | Bacteria | 2091 |
| 148 | Ga0068864_100003022 | 3300005618 | Bacteria | 13902 |
| 149 | Ga0068864_100005142 | 3300005618 | Bacteria | 10716 |
| 150 | Ga0068864_100018179 | 3300005618 | Bacteria | 5868 |
| 151 | Ga0068866_10049999 | 3300005718 | Bacteria | 2121 |
| 152 | Ga0068861_100002478 | 3300005719 | Bacteria | 12028 |
| 153 | Ga0068861_100024828 | 3300005719 | Bacteria | 4339 |
| 154 | Ga0068851_10001016 | 3300005834 | Bacteria | 12178 |
| 155 | Ga0068851_10019646 | 3300005834 | Bacteria | 3266 |
| 156 | Ga0068851_10068128 | 3300005834 | Bacteria | 1836 |
| 157 | Ga0068870_10008506 | 3300005840 | Bacteria | 4621 |
| 158 | Ga0068863_100002482 | 3300005841 | Bacteria | 18334 |
| 159 | Ga0068863_100039528 | 3300005841 | Bacteria | 4487 |
| 160 | Ga0068863_100060273 | 3300005841 | Bacteria | 3589 |
| 161 | Ga0068858_100001816 | 3300005842 | Bacteria | 21723 |
| 162 | Ga0068858_100007123 | 3300005842 | Bacteria | 10860 |
| 163 | Ga0068860_100018543 | 3300005843 | Bacteria | 6769 |
| 164 | Ga0068860_100022845 | 3300005843 | Bacteria | 6048 |
| 165 | Ga0068860_100023458 | 3300005843 | Bacteria | 5962 |
| 166 | Ga0068860_100025648 | 3300005843 | Bacteria | 5685 |
| 167 | Ga0068860_100038314 | 3300005843 | Bacteria | 4585 |
| 168 | Ga0068860_100108737 | 3300005843 | Bacteria | 2650 |
| 169 | Ga0068862_100019100 | 3300005844 | Bacteria | 5714 |
| 170 | Ga0068862_100117821 | 3300005844 | Bacteria | 2337 |
| 171 | Ga0081455_10070723 | 3300005937 | Bacteria | 2896 |
| 172 | Ga0081540_1011720 | 3300005983 | Bacteria | 5835 |
| 173 | Ga0081539_10000646 | 3300005985 | Bacteria | 70179 |
| 174 | Ga0081539_10060736 | 3300005985 | Bacteria | 2074 |
| 175 | Ga0075365_10003273 | 3300006038 | Bacteria | 8304 |
| 176 | Ga0075365_10016399 | 3300006038 | Bacteria | 4506 |
| 177 | Ga0075365_10078577 | 3300006038 | Bacteria | 2231 |
| 178 | Ga0075363_100001186 | 3300006048 | Bacteria | 9612 |
| 179 | Ga0075363_100066087 | 3300006048 | Bacteria | 1956 |
| 180 | Ga0075364_10007855 | 3300006051 | Bacteria | 6349 |
| 181 | Ga0070712_100001191 | 3300006175 | Bacteria | 15718 |
| 182 | Ga0070712_100066548 | 3300006175 | Bacteria | 2561 |
| 183 | Ga0075362_10020779 | 3300006177 | Bacteria | 2747 |
| 184 | Ga0075367_10000725 | 3300006178 | Bacteria | 12789 |
| 185 | Ga0075367_10148074 | 3300006178 | Bacteria | 1456 |
| 186 | Ga0075366_10080786 | 3300006195 | Bacteria | 1941 |
| 187 | Ga0097621_100021138 | 3300006237 | Bacteria | 5026 |
| 188 | Ga0075370_10016387 | 3300006353 | Bacteria | 3988 |
| 189 | Ga0075370_10050746 | 3300006353 | Bacteria | 2353 |
| 190 | Ga0068871_100015024 | 3300006358 | Bacteria | 5789 |
| 191 | Ga0068871_100100015 | 3300006358 | Bacteria | 2428 |
| 192 | Ga0068865_100020658 | 3300006881 | Bacteria | 4272 |
| 193 | Ga0097620_100001046 | 3300006931 | Bacteria | 28371 |
| 194 | Ga0097620_100008936 | 3300006931 | Bacteria | 10121 |
| 195 | Ga0097620_100198336 | 3300006931 | Bacteria | 2091 |
| 196 | Ga0105240_10003226 | 3300009093 | Bacteria | 25530 |
| 197 | Ga0105240_10016842 | 3300009093 | Bacteria | 9878 |
| 198 | Ga0105240_10116984 | 3300009093 | Bacteria | 3215 |
| 199 | Ga0105240_10143184 | 3300009093 | Bacteria | 2856 |
| 200 | Ga0105245_10024593 | 3300009098 | Bacteria | 5290 |
| 201 | Ga0105245_10069375 | 3300009098 | Bacteria | 3196 |
| 202 | Ga0105245_10201186 | 3300009098 | Bacteria | 1913 |
| 203 | Ga0105247_10029551 | 3300009101 | Bacteria | 3322 |
| 204 | Ga0114129_10360722 | 3300009147 | Bacteria | 1923 |
| 205 | Ga0105242_10021962 | 3300009176 | Bacteria | 5016 |
| 206 | Ga0105242_10074880 | 3300009176 | Bacteria | 2817 |
| 207 | Ga0105248_10006667 | 3300009177 | Bacteria | 12669 |
| 208 | Ga0105248_10016381 | 3300009177 | Bacteria | 8157 |
| 209 | Ga0105248_10052380 | 3300009177 | Bacteria | 4580 |
| 210 | Ga0105248_10081104 | 3300009177 | Bacteria | 3647 |
| 211 | Ga0105237_10000203 | 3300009545 | Bacteria | 84732 |
| 212 | Ga0105237_10011201 | 3300009545 | Bacteria | 9505 |
| 213 | Ga0105237_10014190 | 3300009545 | Bacteria | 8342 |
| 214 | Ga0105237_10043543 | 3300009545 | Bacteria | 4521 |
| 215 | Ga0105237_10161251 | 3300009545 | Bacteria | 2241 |
| 216 | Ga0105238_10001144 | 3300009551 | Bacteria | 26753 |
| 217 | Ga0105238_10004964 | 3300009551 | Bacteria | 13155 |
| 218 | Ga0105238_10008979 | 3300009551 | Bacteria | 10005 |
| 219 | Ga0105238_10045842 | 3300009551 | Bacteria | 4416 |
| 220 | Ga0105238_10199345 | 3300009551 | Bacteria | 1977 |
| 221 | Ga0105249_10085726 | 3300009553 | Bacteria | 2936 |
| 222 | Ga0105249_10103831 | 3300009553 | Bacteria | 2678 |
| 223 | Ga0105147_101143 | 3300009982 | Bacteria | 2124 |
| 224 | Ga0105239_10008429 | 3300010375 | Bacteria | 11735 |
| 225 | Ga0105239_10010565 | 3300010375 | Bacteria | 10322 |
| 226 | Ga0105239_10012345 | 3300010375 | Bacteria | 9514 |
| 227 | Ga0105239_10050525 | 3300010375 | Bacteria | 4560 |
| 228 | Ga0105246_10025696 | 3300011119 | Bacteria | 3840 |
| 229 | Ga0105246_10032896 | 3300011119 | Bacteria | 3442 |
| 230 | Ga0157373_10000693 | 3300013100 | Bacteria | 26417 |
| 231 | Ga0157373_10059802 | 3300013100 | Bacteria | 2700 |
| 232 | Ga0157373_10114254 | 3300013100 | Bacteria | 1898 |
| 233 | Ga0157371_10001323 | 3300013102 | Bacteria | 26014 |
| 234 | Ga0157371_10012188 | 3300013102 | Bacteria | 6582 |
| 235 | Ga0157371_10018740 | 3300013102 | Bacteria | 5114 |
| 236 | Ga0157371_10024324 | 3300013102 | Bacteria | 4424 |
| 237 | Ga0157370_10033003 | 3300013104 | Bacteria | 5049 |
| 238 | Ga0157370_10053070 | 3300013104 | Bacteria | 3867 |
| 239 | Ga0157370_10075236 | 3300013104 | Bacteria | 3184 |
| 240 | Ga0157370_10077232 | 3300013104 | Bacteria | 3137 |
| 241 | Ga0157369_10000383 | 3300013105 | Bacteria | 58625 |
| 242 | Ga0157369_10012421 | 3300013105 | Bacteria | 9667 |
| 243 | Ga0157374_10005410 | 3300013296 | Bacteria | 10726 |
| 244 | Ga0157374_10028264 | 3300013296 | Bacteria | 5066 |
| 245 | Ga0157374_10163668 | 3300013296 | Bacteria | 2168 |
| 246 | Ga0157378_10048083 | 3300013297 | Bacteria | 3793 |
| 247 | Ga0163162_10030510 | 3300013306 | Bacteria | 5341 |
| 248 | Ga0163162_10040685 | 3300013306 | Bacteria | 4649 |
| 249 | Ga0163162_10084688 | 3300013306 | Bacteria | 3246 |
| 250 | Ga0163162_10115796 | 3300013306 | Bacteria | 2781 |
| 251 | Ga0157372_10001544 | 3300013307 | Bacteria | 25070 |
| 252 | Ga0157372_10001853 | 3300013307 | Bacteria | 22920 |
| 253 | Ga0157372_10017769 | 3300013307 | Bacteria | 7635 |
| 254 | Ga0157372_10222960 | 3300013307 | Bacteria | 2185 |
| 255 | Ga0157372_10265638 | 3300013307 | Bacteria | 1993 |
| 256 | Ga0157375_10010879 | 3300013308 | Bacteria | 8020 |
| 257 | Ga0157375_10013535 | 3300013308 | Bacteria | 7263 |
| 258 | Ga0157375_10071698 | 3300013308 | Bacteria | 3478 |
| 259 | Ga0163163_10005125 | 3300014325 | Bacteria | 11296 |
| 260 | Ga0163163_10051110 | 3300014325 | Bacteria | 4074 |
| 261 | Ga0163163_10097029 | 3300014325 | Bacteria | 2968 |
| 262 | Ga0157380_10070934 | 3300014326 | Bacteria | 2817 |
| 263 | Ga0157379_10002363 | 3300014968 | Bacteria | 15761 |
| 264 | Ga0157379_10015544 | 3300014968 | Bacteria | 6682 |
| 265 | Ga0157376_10023919 | 3300014969 | Bacteria | 4790 |
| 266 | Ga0157376_10028070 | 3300014969 | Bacteria | 4469 |
| 267 | Ga0157376_10175185 | 3300014969 | Bacteria | 1956 |
| 268 | Ga0182006_1020041 | 3300015261 | Bacteria | 2806 |
| 269 | Ga0163161_10075274 | 3300017792 | Bacteria | 2477 |
| 270 | Ga0213876_10000567 | 3300021384 | Bacteria | 27564 |
| 271 | Ga0213876_10001071 | 3300021384 | Bacteria | 17602 |
| 272 | Ga0213875_10004301 | 3300021388 | Bacteria | 7840 |
| 273 | Ga0213875_10014734 | 3300021388 | Bacteria | 3812 |
| 274 | Ga0209674_100130 | 3300025226 | Bacteria | 119638 |
| 275 | Ga0209672_100225 | 3300025228 | Bacteria | 43500 |
| 276 | Ga0209672_100330 | 3300025228 | Bacteria | 30805 |
| 277 | Ga0209147_100283 | 3300025229 | Bacteria | 43500 |
| 278 | Ga0209258_100467 | 3300025242 | Bacteria | 43500 |
| 279 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 280 | Ga0209026_1000116 | 3300025250 | Bacteria | 133228 |
| 281 | Ga0209148_1000165 | 3300025254 | Bacteria | 136396 |
| 282 | Ga0209148_1000256 | 3300025254 | Bacteria | 83479 |
| 283 | Ga0209148_1000460 | 3300025254 | Bacteria | 44026 |
| 284 | Ga0209759_1000153 | 3300025256 | Bacteria | 119494 |
| 285 | Ga0209759_1000156 | 3300025256 | Bacteria | 117222 |
| 286 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 287 | Ga0209233_1000258 | 3300025261 | Bacteria | 80118 |
| 288 | Ga0209455_1000143 | 3300025272 | Bacteria | 137976 |
| 289 | Ga0209455_1000314 | 3300025272 | Bacteria | 48752 |
| 290 | Ga0209455_1000365 | 3300025272 | Bacteria | 41954 |
| 291 | Ga0209130_1000393 | 3300025284 | Bacteria | 47764 |
| 292 | Ga0209675_1001542 | 3300025291 | Bacteria | 13112 |
| 293 | Ga0209564_1000197 | 3300025295 | Bacteria | 139914 |
| 294 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 295 | Ga0209758_1006672 | 3300025297 | Bacteria | 8153 |
| 296 | Ga0209050_1003786 | 3300025298 | Bacteria | 10810 |
| 297 | Ga0209256_1000159 | 3300025299 | Bacteria | 139961 |
| 298 | Ga0207426_1016931 | 3300025302 | Bacteria | 2602 |
| 299 | Ga0209257_1002768 | 3300025304 | Bacteria | 16581 |
| 300 | Ga0207656_10000583 | 3300025321 | Bacteria | 12069 |
| 301 | Ga0207642_10002916 | 3300025899 | Bacteria | 5352 |
| 302 | Ga0207680_10003490 | 3300025903 | Bacteria | 7405 |
| 303 | Ga0207680_10023934 | 3300025903 | Bacteria | 3343 |
| 304 | Ga0207699_10027727 | 3300025906 | Bacteria | 3140 |
| 305 | Ga0207645_10020503 | 3300025907 | Bacteria | 4327 |
| 306 | Ga0207705_10106962 | 3300025909 | Bacteria | 2063 |
| 307 | Ga0207707_10035378 | 3300025912 | Bacteria | 4368 |
| 308 | Ga0207707_10081742 | 3300025912 | Bacteria | 2820 |
| 309 | Ga0207695_10042224 | 3300025913 | Bacteria | 4874 |
| 310 | Ga0207695_10084812 | 3300025913 | Bacteria | 3197 |
| 311 | Ga0207695_10088252 | 3300025913 | Bacteria | 3122 |
| 312 | Ga0207695_10103333 | 3300025913 | Bacteria | 2841 |
| 313 | Ga0207695_10117359 | 3300025913 | Bacteria | 2634 |
| 314 | Ga0207695_10143562 | 3300025913 | Bacteria | 2333 |
| 315 | Ga0207671_10002706 | 3300025914 | Bacteria | 18584 |
| 316 | Ga0207693_10000459 | 3300025915 | Bacteria | 37224 |
| 317 | Ga0207693_10042011 | 3300025915 | Bacteria | 3599 |
| 318 | Ga0207663_10001764 | 3300025916 | Bacteria | 10202 |
| 319 | Ga0207660_10145513 | 3300025917 | Bacteria | 1816 |
| 320 | Ga0207662_10008462 | 3300025918 | Bacteria | 5633 |
| 321 | Ga0207657_10000522 | 3300025919 | Bacteria | 40660 |
| 322 | Ga0207657_10002338 | 3300025919 | Bacteria | 20555 |
| 323 | Ga0207657_10002480 | 3300025919 | Bacteria | 19962 |
| 324 | Ga0207657_10010187 | 3300025919 | Bacteria | 9390 |
| 325 | Ga0207657_10045049 | 3300025919 | Bacteria | 3875 |
| 326 | Ga0207657_10069011 | 3300025919 | Bacteria | 3001 |
| 327 | Ga0207649_10001900 | 3300025920 | Bacteria | 11926 |
| 328 | Ga0207649_10004443 | 3300025920 | Bacteria | 7610 |
| 329 | Ga0207649_10006979 | 3300025920 | Bacteria | 6135 |
| 330 | Ga0207649_10046621 | 3300025920 | Bacteria | 2664 |
| 331 | Ga0207649_10057662 | 3300025920 | Bacteria | 2429 |
| 332 | Ga0207649_10069616 | 3300025920 | Bacteria | 2241 |
| 333 | Ga0207649_10131094 | 3300025920 | Bacteria | 1703 |
| 334 | Ga0207652_10028379 | 3300025921 | Bacteria | 4669 |
| 335 | Ga0207652_10055282 | 3300025921 | Bacteria | 3413 |
| 336 | Ga0207652_10190883 | 3300025921 | Bacteria | 1843 |
| 337 | Ga0207646_10010499 | 3300025922 | Bacteria | 9042 |
| 338 | Ga0207646_10034835 | 3300025922 | Bacteria | 4551 |
| 339 | Ga0207681_10172332 | 3300025923 | Bacteria | 1641 |
| 340 | Ga0207681_10175646 | 3300025923 | Bacteria | 1627 |
| 341 | Ga0207694_10007102 | 3300025924 | Bacteria | 8510 |
| 342 | Ga0207694_10067138 | 3300025924 | Bacteria | 2799 |
| 343 | Ga0207694_10068887 | 3300025924 | Bacteria | 2764 |
| 344 | Ga0207650_10013390 | 3300025925 | Bacteria | 5679 |
| 345 | Ga0207650_10050335 | 3300025925 | Bacteria | 3080 |
| 346 | Ga0207650_10059558 | 3300025925 | Bacteria | 2847 |
| 347 | Ga0207659_10002597 | 3300025926 | Bacteria | 10759 |
| 348 | Ga0207659_10145740 | 3300025926 | Bacteria | 1843 |
| 349 | Ga0207687_10003000 | 3300025927 | Bacteria | 11445 |
| 350 | Ga0207687_10015981 | 3300025927 | Bacteria | 4924 |
| 351 | Ga0207700_10004901 | 3300025928 | Bacteria | 7952 |
| 352 | Ga0207700_10044413 | 3300025928 | Bacteria | 3271 |
| 353 | Ga0207700_10161393 | 3300025928 | Bacteria | 1862 |
| 354 | Ga0207664_10000761 | 3300025929 | Bacteria | 21889 |
| 355 | Ga0207664_10066458 | 3300025929 | Bacteria | 2890 |
| 356 | Ga0207644_10011666 | 3300025931 | Bacteria | 5820 |
| 357 | Ga0207644_10069433 | 3300025931 | Bacteria | 2573 |
| 358 | Ga0207690_10000719 | 3300025932 | Bacteria | 21322 |
| 359 | Ga0207690_10173577 | 3300025932 | Bacteria | 1617 |
| 360 | Ga0207706_10000093 | 3300025933 | Bacteria | 93173 |
| 361 | Ga0207706_10016532 | 3300025933 | Bacteria | 6660 |
| 362 | Ga0207706_10071786 | 3300025933 | Bacteria | 3045 |
| 363 | Ga0207686_10002984 | 3300025934 | Bacteria | 9121 |
| 364 | Ga0207686_10027885 | 3300025934 | Bacteria | 3312 |
| 365 | Ga0207686_10150833 | 3300025934 | Bacteria | 1618 |
| 366 | Ga0207670_10018933 | 3300025936 | Bacteria | 4196 |
| 367 | Ga0207670_10060853 | 3300025936 | Bacteria | 2574 |
| 368 | Ga0207704_10110404 | 3300025938 | Bacteria | 1858 |
| 369 | Ga0207665_10056974 | 3300025939 | Bacteria | 2639 |
| 370 | Ga0207691_10000646 | 3300025940 | Bacteria | 34475 |
| 371 | Ga0207691_10152380 | 3300025940 | Bacteria | 2032 |
| 372 | Ga0207711_10000626 | 3300025941 | Bacteria | 35493 |
| 373 | Ga0207711_10004393 | 3300025941 | Bacteria | 12023 |
| 374 | Ga0207711_10009353 | 3300025941 | Bacteria | 8183 |
| 375 | Ga0207711_10037332 | 3300025941 | Bacteria | 4126 |
| 376 | Ga0207711_10140254 | 3300025941 | Bacteria | 2174 |
| 377 | Ga0207689_10002893 | 3300025942 | Bacteria | 15839 |
| 378 | Ga0207689_10003783 | 3300025942 | Bacteria | 13789 |
| 379 | Ga0207661_10075423 | 3300025944 | Bacteria | 2767 |
| 380 | Ga0207679_10000841 | 3300025945 | Bacteria | 19766 |
| 381 | Ga0207679_10005872 | 3300025945 | Bacteria | 7713 |
| 382 | Ga0207679_10028039 | 3300025945 | Bacteria | 3902 |
| 383 | Ga0207667_10001461 | 3300025949 | Bacteria | 29643 |
| 384 | Ga0207667_10010611 | 3300025949 | Bacteria | 10757 |
| 385 | Ga0207667_10018838 | 3300025949 | Bacteria | 7729 |
| 386 | Ga0207667_10045520 | 3300025949 | Bacteria | 4647 |
| 387 | Ga0207651_10000481 | 3300025960 | Bacteria | 16781 |
| 388 | Ga0207651_10030620 | 3300025960 | Bacteria | 3429 |
| 389 | Ga0207651_10034483 | 3300025960 | Bacteria | 3278 |
| 390 | Ga0207651_10071061 | 3300025960 | Bacteria | 2465 |
| 391 | Ga0207668_10001564 | 3300025972 | Bacteria | 13399 |
| 392 | Ga0207668_10022902 | 3300025972 | Bacteria | 4005 |
| 393 | Ga0207668_10068254 | 3300025972 | Bacteria | 2527 |
| 394 | Ga0207668_10152002 | 3300025972 | Bacteria | 1793 |
| 395 | Ga0207668_10171059 | 3300025972 | Bacteria | 1704 |
| 396 | Ga0207640_10144072 | 3300025981 | Bacteria | 1741 |
| 397 | Ga0207658_10008591 | 3300025986 | Bacteria | 6950 |
| 398 | Ga0207658_10021254 | 3300025986 | Bacteria | 4502 |
| 399 | Ga0207658_10085436 | 3300025986 | Bacteria | 2430 |
| 400 | Ga0207677_10000359 | 3300026023 | Bacteria | 31912 |
| 401 | Ga0207677_10006888 | 3300026023 | Bacteria | 6246 |
| 402 | Ga0207677_10045142 | 3300026023 | Bacteria | 2941 |
| 403 | Ga0207677_10080268 | 3300026023 | Bacteria | 2337 |
| 404 | Ga0207703_10000552 | 3300026035 | Bacteria | 38477 |
| 405 | Ga0207703_10000739 | 3300026035 | Bacteria | 32194 |
| 406 | Ga0207639_10000537 | 3300026041 | Bacteria | 26056 |
| 407 | Ga0207639_10011614 | 3300026041 | Bacteria | 6119 |
| 408 | Ga0207639_10016779 | 3300026041 | Bacteria | 5187 |
| 409 | Ga0207639_10023642 | 3300026041 | Bacteria | 4439 |
| 410 | Ga0207639_10028163 | 3300026041 | Bacteria | 4100 |
| 411 | Ga0207639_10062122 | 3300026041 | Bacteria | 2887 |
| 412 | Ga0207639_10239364 | 3300026041 | Bacteria | 1577 |
| 413 | Ga0207678_10013615 | 3300026067 | Bacteria | 7145 |
| 414 | Ga0207678_10024835 | 3300026067 | Bacteria | 5232 |
| 415 | Ga0207678_10028324 | 3300026067 | Bacteria | 4891 |
| 416 | Ga0207678_10035621 | 3300026067 | Bacteria | 4333 |
| 417 | Ga0207678_10203829 | 3300026067 | Bacteria | 1692 |
| 418 | Ga0207708_10119516 | 3300026075 | Bacteria | 2053 |
| 419 | Ga0207702_10006174 | 3300026078 | Bacteria | 10363 |
| 420 | Ga0207702_10065797 | 3300026078 | Bacteria | 3105 |
| 421 | Ga0207702_10213384 | 3300026078 | Bacteria | 1795 |
| 422 | Ga0207641_10014253 | 3300026088 | Bacteria | 6514 |
| 423 | Ga0207641_10101909 | 3300026088 | Bacteria | 2531 |
| 424 | Ga0207648_10006217 | 3300026089 | Bacteria | 11901 |
| 425 | Ga0207648_10210092 | 3300026089 | Bacteria | 1727 |
| 426 | Ga0207676_10001145 | 3300026095 | Bacteria | 19988 |
| 427 | Ga0207676_10005255 | 3300026095 | Bacteria | 9163 |
| 428 | Ga0207676_10006255 | 3300026095 | Bacteria | 8403 |
| 429 | Ga0207676_10053410 | 3300026095 | Bacteria | 3163 |
| 430 | Ga0207676_10066982 | 3300026095 | Bacteria | 2867 |
| 431 | Ga0207674_10002105 | 3300026116 | Bacteria | 25194 |
| 432 | Ga0207674_10002729 | 3300026116 | Bacteria | 22016 |
| 433 | Ga0207674_10021953 | 3300026116 | Bacteria | 6865 |
| 434 | Ga0207674_10030401 | 3300026116 | Bacteria | 5679 |
| 435 | Ga0207675_100002730 | 3300026118 | Bacteria | 17376 |
| 436 | Ga0207675_100025292 | 3300026118 | Bacteria | 5525 |
| 437 | Ga0207683_10002860 | 3300026121 | Bacteria | 15061 |
| 438 | Ga0207683_10135517 | 3300026121 | Bacteria | 2217 |
| 439 | Ga0207698_10001255 | 3300026142 | Bacteria | 14824 |
| 440 | Ga0207698_10025428 | 3300026142 | Bacteria | 4171 |
| 441 | Ga0207698_10126249 | 3300026142 | Bacteria | 2176 |
| 442 | Ga0209971_1005290 | 3300027682 | Bacteria | 3069 |
| 443 | Ga0209974_10006933 | 3300027876 | Bacteria | 3925 |
| 444 | Ga0268266_10000343 | 3300028379 | Bacteria | 72589 |
| 445 | Ga0268266_10065643 | 3300028379 | Bacteria | 3137 |
| 446 | Ga0268266_10067880 | 3300028379 | Bacteria | 3087 |
| 447 | Ga0268265_10016646 | 3300028380 | Bacteria | 5057 |
| 448 | Ga0268265_10098371 | 3300028380 | Bacteria | 2356 |
| 449 | Ga0268264_10002815 | 3300028381 | Bacteria | 15191 |
| 450 | Ga0268264_10022582 | 3300028381 | Bacteria | 5135 |
| 451 | Ga0268264_10053802 | 3300028381 | Bacteria | 3359 |
| 452 | Ga0268264_10161717 | 3300028381 | Bacteria | 2018 |
| 453 | Ga0265322_10005386 | 3300028654 | Unclassified | 3787 |
| 454 | Ga0307515_10000600 | 3300028794 | Bacteria | 83981 |
| 455 | Ga0307515_10003037 | 3300028794 | Bacteria | 35563 |
| 456 | Ga0307515_10009737 | 3300028794 | Bacteria | 18519 |
| 457 | Ga0265338_10026374 | 3300028800 | Bacteria | 5863 |
| 458 | Ga0265330_10001752 | 3300031235 | Bacteria | 12192 |
| 459 | Ga0265330_10007518 | 3300031235 | Bacteria | 5304 |
| 460 | Ga0265325_10003409 | 3300031241 | Bacteria | 10390 |
| 461 | Ga0265329_10000755 | 3300031242 | Bacteria | 16455 |
| 462 | Ga0265329_10011891 | 3300031242 | Bacteria | 3152 |
| 463 | Ga0265339_10000370 | 3300031249 | Bacteria | 35343 |
| 464 | Ga0265331_10011736 | 3300031250 | Bacteria | 4787 |
| 465 | Ga0265327_10018629 | 3300031251 | Bacteria | 4295 |
| 466 | Ga0265327_10032158 | 3300031251 | Bacteria | 2939 |
| 467 | Ga0265316_10012488 | 3300031344 | Bacteria | 7614 |
| 468 | Ga0265316_10029152 | 3300031344 | Bacteria | 4542 |
| 469 | Ga0307513_10001801 | 3300031456 | Bacteria | 30442 |
| 470 | Ga0307513_10016761 | 3300031456 | Bacteria | 8816 |
| 471 | Ga0307408_100156674 | 3300031548 | Bacteria | 1804 |
| 472 | Ga0265313_10000070 | 3300031595 | Bacteria | 99384 |
| 473 | Ga0307508_10124520 | 3300031616 | Bacteria | 2180 |
| 474 | Ga0265314_10017190 | 3300031711 | Bacteria | 5684 |
| 475 | Ga0265342_10000868 | 3300031712 | Bacteria | 30196 |
| 476 | Ga0307516_10019483 | 3300031730 | Bacteria | 7029 |
| 477 | Ga0307516_10087485 | 3300031730 | Bacteria | 2950 |
| 478 | Ga0307410_10006982 | 3300031852 | Bacteria | 6146 |
| 479 | Ga0307410_10027439 | 3300031852 | Bacteria | 3599 |
| 480 | Ga0307406_10021641 | 3300031901 | Bacteria | 3806 |
| 481 | Ga0307406_10022479 | 3300031901 | Bacteria | 3742 |
| 482 | Ga0307407_10016459 | 3300031903 | Bacteria | 3682 |
| 483 | Ga0307412_10042132 | 3300031911 | Bacteria | 2964 |
| 484 | Ga0307412_10045455 | 3300031911 | Bacteria | 2871 |
| 485 | Ga0307412_10056432 | 3300031911 | Bacteria | 2617 |
| 486 | Ga0307412_10056954 | 3300031911 | Bacteria | 2607 |
| 487 | Ga0307416_100020419 | 3300032002 | Bacteria | 4726 |
| 488 | Ga0307416_100040290 | 3300032002 | Bacteria | 3627 |
| 489 | Ga0307414_10058099 | 3300032004 | Bacteria | 2724 |
| 490 | Ga0307411_10023546 | 3300032005 | Bacteria | 3650 |
| 491 | Ga0307415_100012352 | 3300032126 | Bacteria | 4936 |
| 492 | Ga0307415_100038108 | 3300032126 | Bacteria | 3165 |
| 493 | Ga0316593_10014798 | 3300032168 | Bacteria | 2336 |
| 494 | Ga0307510_10130942 | 3300033180 | Bacteria | 2182 |
| 495 | Ga0373934_0014977 | 3300035086 | Bacteria | 2940 |
| 496 | Ga0373923_0009060 | 3300035111 | Bacteria | 3577 |
| 497 | Ga0373954_0008292 | 3300035118 | Bacteria | 4558 |
| 498 | Ga0373956_0018083 | 3300035119 | Bacteria | 2980 |
| 499 | Ga0373943_0058448 | 3300035170 | Bacteria | 1919 |
| 500 | Ga0373946_0010335 | 3300035171 | Bacteria | 3452 |
| 501 | Ga0373935_0057841 | 3300035692 | Bacteria | 2474 |
| 502 | Ga0373927_0116804 | 3300035695 | Bacteria | 1740 |
| 503 | Ga0373927_0121836 | 3300035695 | Bacteria | 1702 |
| 504 | Ga0373933_0002724 | 3300035724 | Bacteria | 9880 |
| 505 | Ga0373947_0008837 | 3300035725 | Bacteria | 5794 |
| 506 | Ga0373937_0010034 | 3300036401 | Bacteria | 8258 |
| 507 | Ga0373925_0028153 | 3300037068 | Bacteria | 4116 |
| 508 | Ga0373925_0031977 | 3300037068 | Bacteria | 3871 |
| 509 | Ga0373925_0140635 | 3300037068 | Bacteria | 1889 |
| 510 | Ga0395899_0000036 | 3300037312 | Bacteria | 289502 |
| 511 | Ga0395899_0000217 | 3300037312 | Bacteria | 80044 |
| 512 | Ga0395899_0037973 | 3300037312 | Bacteria | 3610 |
| 513 | Ga0395899_0065027 | 3300037312 | Bacteria | 2680 |
| 514 | Ga0395899_0197203 | 3300037312 | Bacteria | 1406 |
| 515 | Ga0395900_0000270 | 3300037418 | Bacteria | 80046 |
| 516 | Ga0395900_0000872 | 3300037418 | Bacteria | 39599 |
| 517 | Ga0395900_0005117 | 3300037418 | Bacteria | 13768 |
| 518 | Ga0395900_0019483 | 3300037418 | Bacteria | 6917 |
| 519 | Ga0395900_0040659 | 3300037418 | Bacteria | 4792 |
| 520 | Ga0395900_0094090 | 3300037418 | Bacteria | 3078 |
| 521 | Ga0395900_0266153 | 3300037418 | Bacteria | 1710 |
| 522 | Ga0395898_0000254 | 3300037466 | Bacteria | 131247 |
| 523 | Ga0395898_0000470 | 3300037466 | Bacteria | 80783 |
| 524 | Ga0395898_0000626 | 3300037466 | Bacteria | 64794 |
| 525 | Ga0395898_0192406 | 3300037466 | Bacteria | 1949 |
| 526 | Ga0395905_0000253 | 3300037471 | Bacteria | 80046 |
| 527 | Ga0395905_0012419 | 3300037471 | Bacteria | 8198 |
| 528 | Ga0395905_0047736 | 3300037471 | Bacteria | 4011 |
| 529 | Ga0436364_0667648 | 3300037853 | Bacteria | 9219 |
| 530 | Ga0395901_0000095 | 3300038443 | Bacteria | 119290 |
| 531 | Ga0395901_0000285 | 3300038443 | Bacteria | 62844 |
| 532 | Ga0395901_0016751 | 3300038443 | Bacteria | 7468 |
| 533 | Ga0395901_0020801 | 3300038443 | Bacteria | 6717 |
| 534 | Ga0395901_0026852 | 3300038443 | Bacteria | 5911 |
| 535 | Ga0395901_0031362 | 3300038443 | Bacteria | 5481 |
| 536 | Ga0395901_0081590 | 3300038443 | Bacteria | 3378 |
| 537 | Ga0395901_0100135 | 3300038443 | Bacteria | 3039 |
| 538 | Ga0400483_093081 | 3300039062 | Bacteria | 3541 |
| 539 | Ga0400483_132688 | 3300039062 | Bacteria | 6092 |
| 540 | Ga0400483_257466 | 3300039062 | Bacteria | 7961 |
| 541 | Ga0436365_0244982 | 3300039437 | Bacteria | 68861 |
| 542 | Ga0436365_0344984 | 3300039437 | Bacteria | 19388 |
| 543 | Ga0436365_0625375 | 3300039437 | Bacteria | 27116 |
| 544 | Ga0436363_0002125 | 3300039450 | Bacteria | 12690 |
| 545 | Ga0436363_0245198 | 3300039450 | Bacteria | 11089 |
| 546 | Ga0436362_0100789 | 3300039453 | Bacteria | 5877 |
| 547 | Ga0436362_0505409 | 3300039453 | Bacteria | 3143 |
| 548 | Ga0436362_1174928 | 3300039453 | Bacteria | 1712 |
| 549 | Ga0439465_0004781 | 3300041413 | Bacteria | 4359 |
| 550 | Ga0466969_0001253 | 3300044656 | Bacteria | 13700 |
| 551 | Ga0466969_0013222 | 3300044656 | Bacteria | 4347 |
| 552 | Ga0466972_0012437 | 3300044658 | Bacteria | 4278 |
| 553 | Ga0466965_0000665 | 3300044683 | Bacteria | 12612 |
| 554 | Ga0466966_0000107 | 3300044684 | Bacteria | 51017 |
| 555 | Ga0466966_0000309 | 3300044684 | Bacteria | 31554 |
| 556 | Ga0466966_0003129 | 3300044684 | Bacteria | 10886 |
| 557 | Ga0466961_0000068 | 3300044693 | Bacteria | 62703 |
| 558 | Ga0466961_0001012 | 3300044693 | Bacteria | 17356 |
| 559 | Ga0466961_0051677 | 3300044693 | Bacteria | 2624 |
| 560 | Ga0466963_0003296 | 3300044694 | Bacteria | 9206 |
| 561 | Ga0466963_0015643 | 3300044694 | Bacteria | 4705 |
| 562 | Ga0466964_0019698 | 3300044706 | Bacteria | 2595 |
| 563 | Ga0466971_0001111 | 3300044719 | Bacteria | 11172 |
| 564 | Ga0466971_0034091 | 3300044719 | Bacteria | 2281 |
| 565 | Ga0466970_0001042 | 3300044765 | Bacteria | 13405 |
| 566 | Ga0466970_0001083 | 3300044765 | Bacteria | 13193 |
| 567 | Ga0466957_0001559 | 3300044842 | Bacteria | 12067 |
| 568 | Ga0466957_0009634 | 3300044842 | Bacteria | 5517 |
| 569 | Ga0466957_0072670 | 3300044842 | Bacteria | 2130 |
| 570 | Ga0466957_0084073 | 3300044842 | Bacteria | 1986 |
| 571 | Ga0466960_0007399 | 3300044901 | Bacteria | 4460 |
| 572 | Ga0466959_0001053 | 3300045049 | Bacteria | 16528 |
| 573 | Ga0451576_0110114 | 3300045051 | Bacteria | 2866 |
| 574 | Ga0466958_0000689 | 3300045836 | Bacteria | 14702 |
| 575 | Ga0495629_0008811 | 3300046459 | Bacteria | 7418 |
| 576 | Ga0495639_0001280 | 3300046475 | Bacteria | 11299 |
| 577 | Ga0495662_0043851 | 3300046476 | Bacteria | 2159 |
| 578 | Ga0495594_0015858 | 3300046499 | Bacteria | 3964 |
| 579 | Ga0495666_0028710 | 3300046526 | Bacteria | 2737 |
| 580 | Ga0495645_0065986 | 3300046543 | Bacteria | 2617 |
| 581 | Ga0495667_0024865 | 3300046559 | Bacteria | 4034 |
| 582 | Ga0495625_0023432 | 3300046660 | Bacteria | 4715 |
| 583 | Ga0495635_0006358 | 3300046663 | Bacteria | 8232 |
| 584 | Ga0495599_0054732 | 3300046678 | Bacteria | 2500 |
| 585 | Ga0495623_0006009 | 3300046679 | Bacteria | 7899 |
| 586 | Ga0495647_0001465 | 3300046681 | Bacteria | 7320 |
| 587 | Ga0495613_0008295 | 3300046689 | Bacteria | 7713 |
| 588 | Ga0495649_0095898 | 3300046694 | Bacteria | 1579 |
| 589 | Ga0495581_0017609 | 3300047315 | Bacteria | 4149 |
| 590 | Ga0495686_0023847 | 3300047472 | Bacteria | 4026 |
| 591 | Ga0495686_0062520 | 3300047472 | Bacteria | 2309 |
| 592 | Ga0495686_0090188 | 3300047472 | Bacteria | 1862 |
| 593 | Ga0495593_0014536 | 3300047673 | Bacteria | 4474 |
| 594 | Ga0496101_0015675 | 3300048904 | Bacteria | 5114 |
| 595 | Ga0496102_0012989 | 3300048905 | Bacteria | 7212 |
| 596 | Ga0496102_0024334 | 3300048905 | Bacteria | 5383 |
| 597 | Ga0496102_0028747 | 3300048905 | Bacteria | 4969 |
| 598 | Ga0496103_0097966 | 3300048906 | Bacteria | 1854 |
| 599 | Ga0496105_0014812 | 3300048908 | Bacteria | 6208 |
| 600 | Ga0496106_0000060 | 3300048909 | Bacteria | 87287 |
| 601 | Ga0496106_0000759 | 3300048909 | Bacteria | 23295 |
| 602 | Ga0496107_0000490 | 3300048910 | Bacteria | 21809 |
| 603 | Ga0496107_0101813 | 3300048910 | Bacteria | 2106 |
| 604 | Ga0496108_0155938 | 3300048911 | Bacteria | 1972 |
| 605 | Ga0496108_0171572 | 3300048911 | Bacteria | 1877 |
| 606 | Ga0496109_0053655 | 3300048912 | Bacteria | 3677 |
| 607 | Ga0496109_0103881 | 3300048912 | Bacteria | 2638 |
| 608 | Ga0496110_0038670 | 3300048913 | Bacteria | 4153 |
| 609 | Ga0496112_0003779 | 3300048915 | Bacteria | 12642 |
| 610 | Ga0496112_0015983 | 3300048915 | Bacteria | 7017 |
| 611 | Ga0496112_0020791 | 3300048915 | Bacteria | 6229 |
| 612 | Ga0496112_0295672 | 3300048915 | Bacteria | 1565 |
| 613 | Ga0496115_0062801 | 3300048918 | Bacteria | 2997 |
| 614 | Ga0496116_0024425 | 3300048919 | Bacteria | 4471 |
| 615 | Ga0496117_0017509 | 3300048920 | Bacteria | 5982 |
| 616 | Ga0496118_0020548 | 3300048921 | Bacteria | 5851 |
| 617 | Ga0496118_0023118 | 3300048921 | Bacteria | 5411 |
| 618 | Ga0496119_0001526 | 3300048922 | Bacteria | 27676 |
| 619 | Ga0496119_0008324 | 3300048922 | Bacteria | 9141 |
| 620 | Ga0496119_0030431 | 3300048922 | Bacteria | 3639 |
| 621 | Ga0496119_0039372 | 3300048922 | Bacteria | 3039 |
| 622 | Ga0496120_0000832 | 3300048923 | Bacteria | 44048 |
| 623 | Ga0496120_0001687 | 3300048923 | Bacteria | 25349 |
| 624 | Ga0496120_0069628 | 3300048923 | Bacteria | 1937 |
| 625 | Ga0496121_0000102 | 3300048924 | Bacteria | 195341 |
| 626 | Ga0496121_0123526 | 3300048924 | Bacteria | 1951 |
| 627 | Ga0496122_0001710 | 3300048925 | Bacteria | 34034 |
| 628 | Ga0496122_0005877 | 3300048925 | Bacteria | 14371 |
| 629 | Ga0496122_0011460 | 3300048925 | Bacteria | 8974 |
| 630 | Ga0496122_0030297 | 3300048925 | Bacteria | 4538 |
| 631 | Ga0496123_0003513 | 3300048926 | Bacteria | 17460 |
| 632 | Ga0496123_0018083 | 3300048926 | Bacteria | 5634 |
| 633 | Ga0496123_0032777 | 3300048926 | Bacteria | 3752 |
| 634 | Ga0496124_0031050 | 3300048927 | Bacteria | 4733 |
| 635 | Ga0496124_0144699 | 3300048927 | Bacteria | 1872 |
| 636 | Ga0496125_0001362 | 3300048928 | Bacteria | 35992 |
| 637 | Ga0496125_0032187 | 3300048928 | Bacteria | 4661 |
| 638 | Ga0496125_0038629 | 3300048928 | Bacteria | 4127 |
| 639 | Ga0496125_0070130 | 3300048928 | Bacteria | 2745 |
| 640 | Ga0496125_0107130 | 3300048928 | Bacteria | 2037 |
| 641 | Ga0496126_0000400 | 3300048929 | Bacteria | 88670 |
| 642 | Ga0496126_0140254 | 3300048929 | Bacteria | 2081 |
| 643 | Ga0501031_0014510 | 3300049568 | Bacteria | 5122 |
| 644 | Ga0501031_0075906 | 3300049568 | Bacteria | 2188 |
| 645 | Ga0501031_0086033 | 3300049568 | Bacteria | 2049 |
| 646 | Ga0501032_0000234 | 3300049569 | Bacteria | 46284 |
| 647 | Ga0501032_0006640 | 3300049569 | Bacteria | 8492 |
| 648 | Ga0501032_0008069 | 3300049569 | Bacteria | 7673 |
| 649 | Ga0501032_0044497 | 3300049569 | Bacteria | 3004 |
| 650 | Ga0501032_0098083 | 3300049569 | Bacteria | 1942 |
| 651 | Ga0501033_0000076 | 3300049570 | Bacteria | 93921 |
| 652 | Ga0501033_0000334 | 3300049570 | Bacteria | 44929 |
| 653 | Ga0501033_0009070 | 3300049570 | Bacteria | 7673 |
| 654 | Ga0501033_0085604 | 3300049570 | Bacteria | 2309 |
| 655 | Ga0501033_0107461 | 3300049570 | Bacteria | 2032 |
| 656 | Ga0501034_0000408 | 3300049571 | Bacteria | 72244 |
| 657 | Ga0501034_0000475 | 3300049571 | Bacteria | 66162 |
| 658 | Ga0501034_0000873 | 3300049571 | Bacteria | 44385 |
| 659 | Ga0501034_0018012 | 3300049571 | Bacteria | 7247 |
| 660 | Ga0501034_0019824 | 3300049571 | Bacteria | 6873 |
| 661 | Ga0501034_0025999 | 3300049571 | Bacteria | 5963 |
| 662 | Ga0501034_0068252 | 3300049571 | Bacteria | 3566 |
| 663 | Ga0501034_0126952 | 3300049571 | Bacteria | 2535 |
| 664 | Ga0501034_0161781 | 3300049571 | Bacteria | 2209 |
| 665 | Ga0501034_0197976 | 3300049571 | Bacteria | 1968 |
| 666 | Ga0501034_0234211 | 3300049571 | Bacteria | 1784 |
| 667 | Ga0501034_0253866 | 3300049571 | Bacteria | 1702 |
| 668 | Ga0501036_0000159 | 3300049572 | Bacteria | 44385 |
| 669 | Ga0501036_0001942 | 3300049572 | Bacteria | 16039 |
| 670 | Ga0501037_0000035 | 3300049573 | Bacteria | 125589 |
| 671 | Ga0501037_0000533 | 3300049573 | Bacteria | 30360 |
| 672 | Ga0501037_0018609 | 3300049573 | Bacteria | 5118 |
| 673 | Ga0501037_0035735 | 3300049573 | Bacteria | 3662 |
| 674 | Ga0501038_0000241 | 3300049574 | Bacteria | 46177 |
| 675 | Ga0501038_0000262 | 3300049574 | Bacteria | 44385 |
| 676 | Ga0501038_0043054 | 3300049574 | Bacteria | 3928 |
| 677 | Ga0501038_0052644 | 3300049574 | Bacteria | 3508 |
| 678 | Ga0501038_0113349 | 3300049574 | Bacteria | 2244 |
| 679 | Ga0501039_0008835 | 3300049575 | Bacteria | 7673 |
| 680 | Ga0501039_0086332 | 3300049575 | Bacteria | 2443 |
| 681 | Ga0501040_0015223 | 3300049576 | Bacteria | 5082 |
| 682 | Ga0501041_0059528 | 3300049577 | Bacteria | 2338 |
| 683 | Ga0501043_0000031 | 3300049579 | Bacteria | 140707 |
| 684 | Ga0501043_0000043 | 3300049579 | Bacteria | 115410 |
| 685 | Ga0501043_0025732 | 3300049579 | Bacteria | 4616 |
| 686 | Ga0501043_0032472 | 3300049579 | Bacteria | 4104 |
| 687 | Ga0501043_0041697 | 3300049579 | Bacteria | 3606 |
| 688 | Ga0501043_0045434 | 3300049579 | Bacteria | 3455 |
| 689 | Ga0501046_0015199 | 3300049580 | Bacteria | 6473 |
| 690 | Ga0501046_0082989 | 3300049580 | Bacteria | 2475 |
| 691 | Ga0501047_0004343 | 3300049581 | Bacteria | 13343 |
| 692 | Ga0501047_0010435 | 3300049581 | Bacteria | 8790 |
| 693 | Ga0501047_0080823 | 3300049581 | Bacteria | 3124 |
| 694 | Ga0501047_0092225 | 3300049581 | Bacteria | 2907 |
| 695 | Ga0501047_0128590 | 3300049581 | Bacteria | 2413 |
| 696 | Ga0501067_0008599 | 3300049583 | Bacteria | 5659 |
| 697 | Ga0501068_0003453 | 3300049584 | Bacteria | 8509 |
| 698 | Ga0501068_0065393 | 3300049584 | Bacteria | 2213 |
| 699 | Ga0501069_0000056 | 3300049585 | Bacteria | 65784 |
| 700 | Ga0501069_0012324 | 3300049585 | Bacteria | 4542 |
| 701 | Ga0501070_0000141 | 3300049586 | Bacteria | 65875 |
| 702 | Ga0501070_0000299 | 3300049586 | Bacteria | 46014 |
| 703 | Ga0501070_0001617 | 3300049586 | Bacteria | 19979 |
| 704 | Ga0501070_0037296 | 3300049586 | Bacteria | 4058 |
| 705 | Ga0501070_0056901 | 3300049586 | Bacteria | 3242 |
| 706 | Ga0501070_0097706 | 3300049586 | Bacteria | 2429 |
| 707 | Ga0501070_0141751 | 3300049586 | Bacteria | 1984 |
| 708 | Ga0501070_0204135 | 3300049586 | Bacteria | 1623 |
| 709 | Ga0501071_0128426 | 3300049587 | Bacteria | 1882 |
| 710 | Ga0501072_0024457 | 3300049588 | Bacteria | 4698 |
| 711 | Ga0501072_0073549 | 3300049588 | Bacteria | 2702 |
| 712 | Ga0501073_0003703 | 3300049589 | Bacteria | 11485 |
| 713 | Ga0501073_0023174 | 3300049589 | Bacteria | 4462 |
| 714 | Ga0501073_0039218 | 3300049589 | Bacteria | 3356 |
| 715 | Ga0501073_0040875 | 3300049589 | Bacteria | 3278 |
| 716 | Ga0501073_0253121 | 3300049589 | Bacteria | 1216 |
| 717 | Ga0501074_0000223 | 3300049590 | Bacteria | 31404 |
| 718 | Ga0501074_0018196 | 3300049590 | Bacteria | 5104 |
| 719 | Ga0501074_0032102 | 3300049590 | Bacteria | 3806 |
| 720 | Ga0501074_0034107 | 3300049590 | Bacteria | 3690 |
| 721 | Ga0501075_0001104 | 3300049591 | Bacteria | 17384 |
| 722 | Ga0501076_0004052 | 3300049592 | Bacteria | 10359 |
| 723 | Ga0501077_0020854 | 3300049593 | Bacteria | 4149 |
| 724 | Ga0501079_0003253 | 3300049741 | Bacteria | 11904 |
| 725 | Ga0501079_0171986 | 3300049741 | Bacteria | 1689 |
| 726 | Ga0501080_0001620 | 3300049742 | Bacteria | 19137 |
| 727 | Ga0501080_0007967 | 3300049742 | Bacteria | 9600 |
| 728 | Ga0501080_0013039 | 3300049742 | Bacteria | 7632 |
| 729 | Ga0501080_0016746 | 3300049742 | Bacteria | 6769 |
| 730 | Ga0501081_0001170 | 3300049743 | Bacteria | 15892 |
| 731 | Ga0501083_0000098 | 3300049744 | Bacteria | 59246 |
| 732 | Ga0501083_0043013 | 3300049744 | Bacteria | 3061 |
| 733 | Ga0501083_0124110 | 3300049744 | Bacteria | 1693 |
| 734 | Ga0501035_0000036 | 3300049822 | Bacteria | 165008 |
| 735 | Ga0501035_0000449 | 3300049822 | Bacteria | 46083 |
| 736 | Ga0501035_0002751 | 3300049822 | Bacteria | 17045 |
| 737 | Ga0501035_0004065 | 3300049822 | Bacteria | 13918 |
| 738 | Ga0501035_0013126 | 3300049822 | Bacteria | 7645 |
| 739 | Ga0501035_0019154 | 3300049822 | Bacteria | 6300 |
| 740 | Ga0501035_0031137 | 3300049822 | Bacteria | 4859 |
| 741 | Ga0501035_0031401 | 3300049822 | Bacteria | 4837 |
| 742 | Ga0501035_0056671 | 3300049822 | Bacteria | 3495 |
| 743 | Ga0501035_0171446 | 3300049822 | Bacteria | 1874 |
| 744 | Ga0501035_0260778 | 3300049822 | Bacteria | 1469 |
| 745 | Ga0501035_0263574 | 3300049822 | Bacteria | 1460 |
| 746 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 747 | Ga0501044_0001088 | 3300049823 | Bacteria | 32411 |
| 748 | Ga0501044_0001093 | 3300049823 | Bacteria | 32295 |
| 749 | Ga0501044_0003690 | 3300049823 | Bacteria | 17210 |
| 750 | Ga0501044_0010367 | 3300049823 | Bacteria | 10114 |
| 751 | Ga0501044_0031017 | 3300049823 | Bacteria | 5628 |
| 752 | Ga0501044_0052703 | 3300049823 | Bacteria | 4190 |
| 753 | Ga0501044_0070373 | 3300049823 | Bacteria | 3558 |
| 754 | nmdc:mga03683_19466_c1 | 3300050489 | Bacteria | 2591 |
| 755 | nmdc:mga03683_3365_c1 | 3300050489 | Bacteria | 5146 |
| 756 | nmdc:mga03n38_108851_c1 | 3300050490 | Bacteria | 1347 |
| 757 | nmdc:mga03n38_29553_c1 | 3300050490 | Bacteria | 2295 |
| 758 | nmdc:mga03n38_6325_c1 | 3300050490 | Bacteria | 4106 |
| 759 | nmdc:mga00v17_135289_c1 | 3300050491 | Bacteria | 1577 |
| 760 | nmdc:mga00v17_6957_c1 | 3300050491 | Bacteria | 6018 |
| 761 | nmdc:mga00v17_99966_c1 | 3300050491 | Bacteria | 1830 |
| 762 | nmdc:mga0yw44_22796_c1 | 3300050492 | Bacteria | 3517 |
| 763 | nmdc:mga0yw44_38866_c1 | 3300050492 | Bacteria | 2818 |
| 764 | nmdc:mga0yw44_467_c1 | 3300050492 | Bacteria | 14356 |
| 765 | nmdc:mga0k408_113916_c1 | 3300050493 | Bacteria | 1599 |
| 766 | nmdc:mga0k408_21121_c1 | 3300050493 | Bacteria | 3654 |
| 767 | nmdc:mga06z11_16687_c1 | 3300050494 | Bacteria | 3314 |
| 768 | nmdc:mga0sz30_1241_c3 | 3300050516 | Bacteria | 6851 |
| 769 | Ga0500610_0026504 | 3300053079 | Bacteria | 2900 |
| 770 | Ga0500610_0029999 | 3300053079 | Bacteria | 2752 |
| 771 | Ga0495655_0002042 | 3300053083 | Bacteria | 3158 |
| 772 | Ga0500641_0003709 | 3300053096 | Bacteria | 5394 |
| 773 | Ga0500555_001043 | 3300053103 | Bacteria | 9345 |
| 774 | Ga0500556_0000220 | 3300053104 | Bacteria | 46311 |
| 775 | Ga0500594_0021662 | 3300053118 | Bacteria | 1614 |
| 776 | Ga0500595_000738 | 3300053119 | Bacteria | 19430 |
| 777 | Ga0500642_0000868 | 3300053130 | Bacteria | 8788 |
| 778 | Ga0500652_052720 | 3300053131 | Bacteria | 1663 |
| 779 | Ga0500658_0070660 | 3300053134 | Bacteria | 1472 |
| 780 | Ga0500568_0000019 | 3300053139 | Bacteria | 195696 |
| 781 | Ga0500568_0000489 | 3300053139 | Bacteria | 29208 |
| 782 | Ga0500568_0018969 | 3300053139 | Bacteria | 3001 |
| 783 | Ga0500568_0032134 | 3300053139 | Bacteria | 2159 |
| 784 | Ga0500604_0012950 | 3300053151 | Bacteria | 2257 |
| 785 | Ga0500604_0018203 | 3300053151 | Bacteria | 1955 |
| 786 | Ga0500616_0005076 | 3300053153 | Bacteria | 9085 |
| 787 | Ga0500616_0008291 | 3300053153 | Bacteria | 6472 |
| 788 | Ga0500620_000055 | 3300053155 | Bacteria | 20744 |
| 789 | Ga0500620_000167 | 3300053155 | Bacteria | 13238 |
| 790 | Ga0500627_0004191 | 3300053158 | Bacteria | 4589 |
| 791 | Ga0500634_0000017 | 3300053161 | Bacteria | 111983 |
| 792 | Ga0501084_0019517 | 3300054114 | Bacteria | 5647 |
| 793 | Ga0501082_0004262 | 3300060353 | Bacteria | 12496 |
| 794 | Ga0501082_0008450 | 3300060353 | Bacteria | 8879 |
| 795 | Ga0466962_0001601 | 3300061719 | Bacteria | 10603 |
| 796 | Ga0466962_0001884 | 3300061719 | Bacteria | 9882 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100146032 | Ga0070689_1001460322 | 365 |
| 2 | 3300049589 | Ga0501073_0253121 | Ga0501073_0253121_35_1177 | 380 |
| 3 | 3300025939 | Ga0207665_10056974 | Ga0207665_100569742 | 387 |
| 4 | iso_pu_bacteria | 2970540015 | 2970541772 | 390 |
| 5 | iso_pu_bacteria | 2838701080 | 2838701089 | 392 |
| 6 | 3300049581 | Ga0501047_0080823 | Ga0501047_0080823_16_1206 | 395 |
| 7 | 3300048911 | Ga0496108_0171572 | Ga0496108_0171572_669_1862 | 396 |
| 8 | 3300048911 | Ga0496108_0155938 | Ga0496108_0155938_759_1955 | 397 |
| 9 | 3300050489 | nmdc:mga03683_19466_c1 | nmdc:mga03683_19466_c1_1379_2575 | 397 |
| 10 | iso_pu_bacteria | 2965040258 | 2965046072 | 397 |
| 11 | 3300045051 | Ga0451576_0110114 | Ga0451576_0110114_1297_2598 | 400 |
| 12 | iso_pu_bacteria | 2838061910 | 2838068458 | 403 |
| 13 | iso_pu_bacteria | 2838668709 | 2838669250 | 403 |
| 14 | iso_pu_bacteria | 2841864319 | 2841868407 | 403 |
| 15 | iso_pu_bacteria | 2842146304 | 2842146845 | 403 |
| 16 | iso_pu_bacteria | 2842250916 | 2842250925 | 403 |
| 17 | iso_pu_bacteria | 2842264693 | 2842268459 | 403 |
| 18 | iso_pu_bacteria | 2842428310 | 2842432431 | 403 |
| 19 | iso_pu_bacteria | 2842434925 | 2842438735 | 403 |
| 20 | iso_pu_bacteria | 2842441272 | 2842445428 | 403 |
| 21 | iso_pu_bacteria | 2842469257 | 2842473350 | 403 |
| 22 | iso_pu_bacteria | 2913295892 | 2913301224 | 403 |
| 23 | iso_pu_bacteria | 2840764183 | 2840768850 | 404 |
| 24 | iso_pu_bacteria | 2958041894 | 2958044045 | 404 |
| 25 | 3300005347 | Ga0070668_100187207 | Ga0070668_1001872071 | 405 |
| 26 | 3300025972 | Ga0207668_10171059 | Ga0207668_101710591 | 405 |
| 27 | 3300039062 | Ga0400483_132688 | Ga0400483_132688_4512_5735 | 406 |
| 28 | 3300039062 | Ga0400483_257466 | Ga0400483_257466_4154_5377 | 406 |
| 29 | 3300039450 | Ga0436363_0245198 | Ga0436363_0245198_845_2212 | 406 |
| 30 | 3300039453 | Ga0436362_1174928 | Ga0436362_1174928_121_1485 | 406 |
| 31 | 3300026041 | Ga0207639_10239364 | Ga0207639_102393642 | 407 |
| 32 | 3300031616 | Ga0307508_10124520 | Ga0307508_101245202 | 407 |
| 33 | 3300031548 | Ga0307408_100156674 | Ga0307408_1001566742 | 408 |
| 34 | 3300031911 | Ga0307412_10056954 | Ga0307412_100569541 | 408 |
| 35 | 3300032005 | Ga0307411_10023546 | Ga0307411_100235464 | 408 |
| 36 | 3300032126 | Ga0307415_100012352 | Ga0307415_1000123524 | 408 |
| 37 | 3300050490 | nmdc:mga03n38_108851_c1 | nmdc:mga03n38_108851_c1_11_1240 | 408 |
| 38 | 3300050492 | nmdc:mga0yw44_467_c1 | nmdc:mga0yw44_467_c1_5719_7041 | 408 |
| 39 | 3300050516 | nmdc:mga0sz30_1241_c3 | nmdc:mga0sz30_1241_c3_1349_2671 | 408 |
| 40 | 3300053131 | Ga0500652_052720 | Ga0500652_052720_32_1366 | 408 |
| 41 | 3300053079 | Ga0500610_0026504 | Ga0500610_0026504_923_2245 | 409 |
| 42 | 3300053155 | Ga0500620_000167 | Ga0500620_000167_4082_5404 | 409 |
| 43 | 3300028794 | Ga0307515_10000600 | Ga0307515_1000060017 | 410 |
| 44 | 3300031456 | Ga0307513_10001801 | Ga0307513_1000180117 | 410 |
| 45 | 3300039437 | Ga0436365_0244982 | Ga0436365_0244982_21371_22612 | 410 |
| 46 | 3300039450 | Ga0436363_0002125 | Ga0436363_0002125_8193_9434 | 410 |
| 47 | 3300039453 | Ga0436362_0100789 | Ga0436362_0100789_640_1881 | 410 |
| 48 | 3300044719 | Ga0466971_0034091 | Ga0466971_0034091_1000_2235 | 410 |
| 49 | 3300028379 | Ga0268266_10065643 | Ga0268266_100656432 | 411 |
| 50 | 3300046689 | Ga0495613_0008295 | Ga0495613_0008295_6452_7702 | 414 |
| 51 | 3300006051 | Ga0075364_10007855 | Ga0075364_100078552 | 416 |
| 52 | 3300050491 | nmdc:mga00v17_99966_c1 | nmdc:mga00v17_99966_c1_164_1486 | 416 |
| 53 | 3300037312 | Ga0395899_0000036 | Ga0395899_0000036_241928_243259 | 419 |
| 54 | 3300037418 | Ga0395900_0000872 | Ga0395900_0000872_9089_10420 | 419 |
| 55 | 3300037466 | Ga0395898_0000626 | Ga0395898_0000626_17649_18980 | 419 |
| 56 | 3300025228 | Ga0209672_100330 | Ga0209672_1003309 | 422 |
| 57 | 3300049571 | Ga0501034_0019824 | Ga0501034_0019824_4838_6157 | 422 |
| 58 | 3300049579 | Ga0501043_0025732 | Ga0501043_0025732_1801_3114 | 423 |
| 59 | 3300049587 | Ga0501071_0128426 | Ga0501071_0128426_293_1606 | 423 |
| 60 | 3300049589 | Ga0501073_0023174 | Ga0501073_0023174_2044_3402 | 423 |
| 61 | 3300049590 | Ga0501074_0034107 | Ga0501074_0034107_1634_2947 | 423 |
| 62 | 3300049591 | Ga0501075_0001104 | Ga0501075_0001104_9205_10518 | 423 |
| 63 | 3300049592 | Ga0501076_0004052 | Ga0501076_0004052_5331_6644 | 423 |
| 64 | 3300049593 | Ga0501077_0020854 | Ga0501077_0020854_2192_3505 | 423 |
| 65 | 3300049741 | Ga0501079_0003253 | Ga0501079_0003253_1504_2817 | 423 |
| 66 | 3300049743 | Ga0501081_0001170 | Ga0501081_0001170_2650_3963 | 423 |
| 67 | 3300054114 | Ga0501084_0019517 | Ga0501084_0019517_2198_3511 | 423 |
| 68 | 3300060353 | Ga0501082_0004262 | Ga0501082_0004262_6532_7845 | 423 |
| 69 | 3300041413 | Ga0439465_0004781 | Ga0439465_0004781_2358_3638 | 425 |
| 70 | 3300036401 | Ga0373937_0010034 | Ga0373937_0010034_883_2241 | 426 |
| 71 | 3300053104 | Ga0500556_0000220 | Ga0500556_0000220_14197_15531 | 426 |
| 72 | 3300009177 | Ga0105248_10081104 | Ga0105248_100811042 | 427 |
| 73 | 3300028654 | Ga0265322_10005386 | Ga0265322_100053862 | 427 |
| 74 | 3300031235 | Ga0265330_10001752 | Ga0265330_100017524 | 427 |
| 75 | 3300031242 | Ga0265329_10000755 | Ga0265329_100007555 | 427 |
| 76 | 3300031344 | Ga0265316_10029152 | Ga0265316_100291524 | 427 |
| 77 | 3300031712 | Ga0265342_10000868 | Ga0265342_1000086817 | 427 |
| 78 | 3300035695 | Ga0373927_0116804 | Ga0373927_0116804_180_1535 | 427 |
| 79 | 3300035725 | Ga0373947_0008837 | Ga0373947_0008837_2302_3657 | 427 |
| 80 | 3300037068 | Ga0373925_0031977 | Ga0373925_0031977_482_1837 | 427 |
| 81 | 3300025941 | Ga0207711_10037332 | Ga0207711_100373324 | 428 |
| 82 | 3300047472 | Ga0495686_0090188 | Ga0495686_0090188_161_1492 | 428 |
| 83 | 3300049569 | Ga0501032_0006640 | Ga0501032_0006640_4113_5435 | 428 |
| 84 | 3300049570 | Ga0501033_0000334 | Ga0501033_0000334_5073_6395 | 428 |
| 85 | 3300049573 | Ga0501037_0000035 | Ga0501037_0000035_94851_96173 | 428 |
| 86 | 3300049579 | Ga0501043_0000031 | Ga0501043_0000031_19885_21207 | 428 |
| 87 | 3300049585 | Ga0501069_0000056 | Ga0501069_0000056_28365_29687 | 428 |
| 88 | 3300049586 | Ga0501070_0000141 | Ga0501070_0000141_28367_29689 | 428 |
| 89 | 3300049590 | Ga0501074_0000223 | Ga0501074_0000223_6290_7612 | 428 |
| 90 | 3300049742 | Ga0501080_0016746 | Ga0501080_0016746_248_1570 | 428 |
| 91 | 3300049744 | Ga0501083_0000098 | Ga0501083_0000098_42289_43611 | 428 |
| 92 | 3300049822 | Ga0501035_0000036 | Ga0501035_0000036_134270_135592 | 428 |
| 93 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_242984_244306 | 428 |
| 94 | 3300005344 | Ga0070661_100099493 | Ga0070661_1000994932 | 429 |
| 95 | 3300005578 | Ga0068854_100076819 | Ga0068854_1000768193 | 429 |
| 96 | 3300005616 | Ga0068852_100013701 | Ga0068852_1000137015 | 429 |
| 97 | 3300013102 | Ga0157371_10012188 | Ga0157371_100121885 | 429 |
| 98 | 3300013104 | Ga0157370_10053070 | Ga0157370_100530704 | 429 |
| 99 | 3300013307 | Ga0157372_10265638 | Ga0157372_102656383 | 429 |
| 100 | 3300025920 | Ga0207649_10057662 | Ga0207649_100576622 | 429 |
| 101 | 3300026041 | Ga0207639_10016779 | Ga0207639_100167795 | 429 |
| 102 | 3300026067 | Ga0207678_10203829 | Ga0207678_102038291 | 429 |
| 103 | 3300026142 | Ga0207698_10025428 | Ga0207698_100254283 | 429 |
| 104 | 3300037312 | Ga0395899_0065027 | Ga0395899_0065027_708_2042 | 429 |
| 105 | 3300038443 | Ga0395901_0100135 | Ga0395901_0100135_1004_2338 | 429 |
| 106 | 3300053118 | Ga0500594_0021662 | Ga0500594_0021662_284_1579 | 429 |
| 107 | iso_pu_bacteria | 2767802442 | 2770200461 | 429 |
| 108 | iso_pu_bacteria | 637000159 | 637078464 | 429 |
| 109 | 3300032002 | Ga0307416_100040290 | Ga0307416_1000402903 | 430 |
| 110 | 3300049569 | Ga0501032_0098083 | Ga0501032_0098083_23_1324 | 431 |
| 111 | 3300005985 | Ga0081539_10060736 | Ga0081539_100607362 | 432 |
| 112 | 3300049571 | Ga0501034_0025999 | Ga0501034_0025999_1400_2716 | 432 |
| 113 | iso_pu_bacteria | 2856349417 | 2856349597 | 432 |
| 114 | iso_pu_bacteria | 2881155292 | 2881158464 | 432 |
| 115 | iso_pu_bacteria | 2881853255 | 2881854719 | 432 |
| 116 | iso_pu_bacteria | 2885342637 | 2885349512 | 432 |
| 117 | iso_pu_bacteria | 2885350715 | 2885357677 | 432 |
| 118 | iso_pu_bacteria | 2508501123 | 2509116856 | 433 |
| 119 | iso_pu_bacteria | 2510065059 | 2510316368 | 433 |
| 120 | iso_pu_bacteria | 2513237090 | 2513612396 | 433 |
| 121 | iso_pu_bacteria | 2534681786 | 2535486913 | 433 |
| 122 | iso_pu_bacteria | 2643221550 | 2643772461 | 433 |
| 123 | iso_pu_bacteria | 2643221551 | 2643778032 | 433 |
| 124 | iso_pu_bacteria | 2643221555 | 2643796480 | 433 |
| 125 | iso_pu_bacteria | 2643221564 | 2643837887 | 433 |
| 126 | iso_pu_bacteria | 2738543024 | 2739307116 | 433 |
| 127 | iso_pu_bacteria | 2751185800 | 2753360023 | 433 |
| 128 | iso_pu_bacteria | 2758568016 | 2758642342 | 433 |
| 129 | iso_pu_bacteria | 2837678835 | 2837681274 | 433 |
| 130 | iso_pu_bacteria | 2839993093 | 2839997400 | 433 |
| 131 | iso_pu_bacteria | 2841734538 | 2841735657 | 433 |
| 132 | iso_pu_bacteria | 2844009547 | 2844009884 | 433 |
| 133 | iso_pu_bacteria | 2847670302 | 2847672649 | 433 |
| 134 | iso_pu_bacteria | 2854911287 | 2854912692 | 433 |
| 135 | iso_pu_bacteria | 2856314179 | 2856315126 | 433 |
| 136 | iso_pu_bacteria | 2856320880 | 2856328195 | 433 |
| 137 | iso_pu_bacteria | 2856342000 | 2856344833 | 433 |
| 138 | iso_pu_bacteria | 2856356410 | 2856358772 | 433 |
| 139 | iso_pu_bacteria | 2869162929 | 2869167309 | 433 |
| 140 | iso_pu_bacteria | 2869169390 | 2869175855 | 433 |
| 141 | iso_pu_bacteria | 2869242130 | 2869244400 | 433 |
| 142 | iso_pu_bacteria | 2869256925 | 2869259814 | 433 |
| 143 | iso_pu_bacteria | 2869278585 | 2869284270 | 433 |
| 144 | iso_pu_bacteria | 2871474448 | 2871480634 | 433 |
| 145 | iso_pu_bacteria | 2871481445 | 2871486483 | 433 |
| 146 | iso_pu_bacteria | 2871488783 | 2871490111 | 433 |
| 147 | iso_pu_bacteria | 2871495908 | 2871502020 | 433 |
| 148 | iso_pu_bacteria | 2874116593 | 2874121253 | 433 |
| 149 | iso_pu_bacteria | 2874123672 | 2874125284 | 433 |
| 150 | iso_pu_bacteria | 2874139085 | 2874139267 | 433 |
| 151 | iso_pu_bacteria | 2876386047 | 2876391820 | 433 |
| 152 | iso_pu_bacteria | 2876392853 | 2876393754 | 433 |
| 153 | iso_pu_bacteria | 2876420981 | 2876421499 | 433 |
| 154 | iso_pu_bacteria | 2878035449 | 2878042016 | 433 |
| 155 | iso_pu_bacteria | 2878730984 | 2878733393 | 433 |
| 156 | iso_pu_bacteria | 2878738818 | 2878740114 | 433 |
| 157 | iso_pu_bacteria | 2878753008 | 2878753204 | 433 |
| 158 | iso_pu_bacteria | 2878760144 | 2878765743 | 433 |
| 159 | iso_pu_bacteria | 2878767105 | 2878772417 | 433 |
| 160 | iso_pu_bacteria | 2878788777 | 2878789281 | 433 |
| 161 | iso_pu_bacteria | 2881147464 | 2881154705 | 433 |
| 162 | iso_pu_bacteria | 2881161766 | 2881164116 | 433 |
| 163 | iso_pu_bacteria | 2881845957 | 2881848162 | 433 |
| 164 | iso_pu_bacteria | 2881861095 | 2881862743 | 433 |
| 165 | iso_pu_bacteria | 2882632389 | 2882634339 | 433 |
| 166 | iso_pu_bacteria | 2882912400 | 2882915444 | 433 |
| 167 | iso_pu_bacteria | 2885318864 | 2885319173 | 433 |
| 168 | iso_pu_bacteria | 2888337043 | 2888342487 | 433 |
| 169 | iso_pu_bacteria | 2903492973 | 2903498032 | 433 |
| 170 | iso_pu_bacteria | 2903540706 | 2903546689 | 433 |
| 171 | iso_pu_bacteria | 2904659560 | 2904660479 | 433 |
| 172 | iso_pu_bacteria | 2906401398 | 2906401713 | 433 |
| 173 | iso_pu_bacteria | 2906414383 | 2906415123 | 433 |
| 174 | iso_pu_bacteria | 2906427513 | 2906432928 | 433 |
| 175 | iso_pu_bacteria | 2915650412 | 2915653411 | 433 |
| 176 | iso_pu_bacteria | 2919119836 | 2919124325 | 433 |
| 177 | iso_pu_bacteria | 2924710171 | 2924717362 | 433 |
| 178 | iso_pu_bacteria | 2924718760 | 2924723820 | 433 |
| 179 | iso_pu_bacteria | 2924741084 | 2924744566 | 433 |
| 180 | iso_pu_bacteria | 2924762789 | 2924767151 | 433 |
| 181 | iso_pu_bacteria | 2924776078 | 2924777713 | 433 |
| 182 | iso_pu_bacteria | 2924784321 | 2924791199 | 433 |
| 183 | iso_pu_bacteria | 2937836603 | 2937837080 | 433 |
| 184 | iso_pu_bacteria | 2937848649 | 2937850852 | 433 |
| 185 | iso_pu_bacteria | 2937861824 | 2937868449 | 433 |
| 186 | iso_pu_bacteria | 2937877337 | 2937883931 | 433 |
| 187 | iso_pu_bacteria | 2937972304 | 2937976682 | 433 |
| 188 | iso_pu_bacteria | 2937994558 | 2938000548 | 433 |
| 189 | iso_pu_bacteria | 2954011201 | 2954012315 | 433 |
| 190 | iso_pu_bacteria | 2958034702 | 2958038368 | 433 |
| 191 | iso_pu_bacteria | 2958041894 | 2958055978 | 433 |
| 192 | iso_pu_bacteria | 2958064165 | 2958066482 | 433 |
| 193 | iso_pu_bacteria | 2958071322 | 2958076490 | 433 |
| 194 | iso_pu_bacteria | 2958084443 | 2958091209 | 433 |
| 195 | iso_pu_bacteria | 2958092219 | 2958100278 | 433 |
| 196 | iso_pu_bacteria | 2958108152 | 2958113523 | 433 |
| 197 | iso_pu_bacteria | 2958144490 | 2958146768 | 433 |
| 198 | iso_pu_bacteria | 2958165035 | 2958170919 | 433 |
| 199 | iso_pu_bacteria | 2961114664 | 2961120801 | 433 |
| 200 | iso_pu_bacteria | 2961163497 | 2961169363 | 433 |
| 201 | iso_pu_bacteria | 2961170736 | 2961177028 | 433 |
| 202 | iso_pu_bacteria | 2961183825 | 2961187293 | 433 |
| 203 | iso_pu_bacteria | 2965018300 | 2965023615 | 433 |
| 204 | iso_pu_bacteria | 2967996073 | 2968002846 | 433 |
| 205 | iso_pu_bacteria | 2968003550 | 2968005243 | 433 |
| 206 | iso_pu_bacteria | 2968016561 | 2968021327 | 433 |
| 207 | iso_pu_bacteria | 2968110612 | 2968111538 | 433 |
| 208 | iso_pu_bacteria | 2968171901 | 2968177753 | 433 |
| 209 | iso_pu_bacteria | 2970469710 | 2970476432 | 433 |
| 210 | iso_pu_bacteria | 2970489779 | 2970493843 | 433 |
| 211 | iso_pu_bacteria | 2970503327 | 2970509701 | 433 |
| 212 | iso_pu_bacteria | 2970510686 | 2970515404 | 433 |
| 213 | iso_pu_bacteria | 2970524798 | 2970527763 | 433 |
| 214 | iso_pu_bacteria | 2970554993 | 2970560599 | 433 |
| 215 | iso_pu_bacteria | 2970593180 | 2970598886 | 433 |
| 216 | iso_pu_bacteria | 2970619444 | 2970620348 | 433 |
| 217 | iso_pu_bacteria | 2970627176 | 2970628747 | 433 |
| 218 | iso_pu_bacteria | 2977821940 | 2977822136 | 433 |
| 219 | iso_pu_bacteria | 2977828996 | 2977836959 | 433 |
| 220 | iso_pu_bacteria | 2977851361 | 2977851776 | 433 |
| 221 | iso_pu_bacteria | 2977898635 | 2977907029 | 433 |
| 222 | iso_pu_bacteria | 2977907340 | 2977914774 | 433 |
| 223 | iso_pu_bacteria | 2977922695 | 2977923828 | 433 |
| 224 | iso_pu_bacteria | 2979772303 | 2979778012 | 433 |
| 225 | iso_pu_bacteria | 2979808191 | 2979814488 | 433 |
| 226 | iso_pu_bacteria | 2987659509 | 2987665659 | 433 |
| 227 | iso_pu_bacteria | 2987666974 | 2987671104 | 433 |
| 228 | iso_pu_bacteria | 2996386984 | 2996387917 | 433 |
| 229 | iso_pu_bacteria | 3004167301 | 3004172330 | 433 |
| 230 | iso_pu_bacteria | 3004188549 | 3004194551 | 433 |
| 231 | iso_pu_bacteria | 3004211236 | 3004213266 | 433 |
| 232 | iso_pu_bacteria | 3004218560 | 3004221338 | 433 |
| 233 | iso_pu_bacteria | 3004232784 | 3004238593 | 433 |
| 234 | iso_pu_bacteria | 3004248173 | 3004251057 | 433 |
| 235 | iso_pu_bacteria | 3004268573 | 3004271638 | 433 |
| 236 | iso_pu_bacteria | 3004289098 | 3004293436 | 433 |
| 237 | iso_pu_bacteria | 3004334049 | 3004338331 | 433 |
| 238 | iso_pu_bacteria | 8004374579 | 8004374775 | 433 |
| 239 | iso_pu_bacteria | 8004633249 | 8004635715 | 433 |
| 240 | iso_pu_bacteria | 8004640170 | 8004645328 | 433 |
| 241 | iso_pu_bacteria | 8004727605 | 8004731414 | 433 |
| 242 | iso_pu_bacteria | 8045864390 | 8045867390 | 433 |
| 243 | 3300021388 | Ga0213875_10004301 | Ga0213875_100043013 | 434 |
| 244 | 3300025934 | Ga0207686_10150833 | Ga0207686_101508331 | 434 |
| 245 | 3300048922 | Ga0496119_0001526 | Ga0496119_0001526_23487_24821 | 434 |
| 246 | iso_pu_bacteria | 2508501127 | 2509145609 | 434 |
| 247 | iso_pu_bacteria | 2509276018 | 2509372636 | 434 |
| 248 | iso_pu_bacteria | 2511231027 | 2511388449 | 434 |
| 249 | iso_pu_bacteria | 2512875016 | 2512928765 | 434 |
| 250 | iso_pu_bacteria | 2512875024 | 2512963502 | 434 |
| 251 | iso_pu_bacteria | 2512875024 | 2512963740 | 434 |
| 252 | iso_pu_bacteria | 2513237164 | 2514039389 | 434 |
| 253 | iso_pu_bacteria | 2513237305 | 2514419622 | 434 |
| 254 | iso_pu_bacteria | 2588253730 | 2588514309 | 434 |
| 255 | iso_pu_bacteria | 2643221591 | 2643966349 | 434 |
| 256 | iso_pu_bacteria | 2643221595 | 2643989882 | 434 |
| 257 | iso_pu_bacteria | 2643221627 | 2644153534 | 434 |
| 258 | iso_pu_bacteria | 2687453392 | 2688597725 | 434 |
| 259 | iso_pu_bacteria | 2721755686 | 2723578275 | 434 |
| 260 | iso_pu_bacteria | 2751185800 | 2753356988 | 434 |
| 261 | iso_pu_bacteria | 2756170246 | 2756676378 | 434 |
| 262 | iso_pu_bacteria | 2757320392 | 2757572538 | 434 |
| 263 | iso_pu_bacteria | 2758568016 | 2758640534 | 434 |
| 264 | iso_pu_bacteria | 2775506902 | 2776267712 | 434 |
| 265 | iso_pu_bacteria | 2775506902 | 2776270538 | 434 |
| 266 | iso_pu_bacteria | 2775506904 | 2776281541 | 434 |
| 267 | iso_pu_bacteria | 2791355123 | 2792750152 | 434 |
| 268 | iso_pu_bacteria | 2842871566 | 2842875442 | 434 |
| 269 | iso_pu_bacteria | 2844002411 | 2844004323 | 434 |
| 270 | iso_pu_bacteria | 2854911287 | 2854916007 | 434 |
| 271 | iso_pu_bacteria | 2856328259 | 2856332249 | 434 |
| 272 | iso_pu_bacteria | 2856334872 | 2856338799 | 434 |
| 273 | iso_pu_bacteria | 2857367948 | 2857369527 | 434 |
| 274 | iso_pu_bacteria | 2869249662 | 2869250769 | 434 |
| 275 | iso_pu_bacteria | 2869264136 | 2869269584 | 434 |
| 276 | iso_pu_bacteria | 2869271264 | 2869272639 | 434 |
| 277 | iso_pu_bacteria | 2871435913 | 2871439175 | 434 |
| 278 | iso_pu_bacteria | 2871451962 | 2871458947 | 434 |
| 279 | iso_pu_bacteria | 2871459585 | 2871459702 | 434 |
| 280 | iso_pu_bacteria | 2871466892 | 2871473922 | 434 |
| 281 | iso_pu_bacteria | 2874131515 | 2874138422 | 434 |
| 282 | iso_pu_bacteria | 2874162495 | 2874167539 | 434 |
| 283 | iso_pu_bacteria | 2874168670 | 2874170924 | 434 |
| 284 | iso_pu_bacteria | 2876363079 | 2876369192 | 434 |
| 285 | iso_pu_bacteria | 2876399893 | 2876404423 | 434 |
| 286 | iso_pu_bacteria | 2876406927 | 2876410644 | 434 |
| 287 | iso_pu_bacteria | 2878774303 | 2878780759 | 434 |
| 288 | iso_pu_bacteria | 2885312484 | 2885318846 | 434 |
| 289 | iso_pu_bacteria | 2894652903 | 2894655868 | 434 |
| 290 | iso_pu_bacteria | 2894817345 | 2894817950 | 434 |
| 291 | iso_pu_bacteria | 2903448605 | 2903449400 | 434 |
| 292 | iso_pu_bacteria | 2903521522 | 2903526340 | 434 |
| 293 | iso_pu_bacteria | 2903528002 | 2903529627 | 434 |
| 294 | iso_pu_bacteria | 2906363423 | 2906365368 | 434 |
| 295 | iso_pu_bacteria | 2906370794 | 2906371302 | 434 |
| 296 | iso_pu_bacteria | 2906378014 | 2906385316 | 434 |
| 297 | iso_pu_bacteria | 2906386501 | 2906387450 | 434 |
| 298 | iso_pu_bacteria | 2906393657 | 2906394829 | 434 |
| 299 | iso_pu_bacteria | 2906408224 | 2906411419 | 434 |
| 300 | iso_pu_bacteria | 2909042592 | 2909044422 | 434 |
| 301 | iso_pu_bacteria | 2919119836 | 2919123245 | 434 |
| 302 | iso_pu_bacteria | 2922172374 | 2922175170 | 434 |
| 303 | iso_pu_bacteria | 2922178524 | 2922179538 | 434 |
| 304 | iso_pu_bacteria | 2924748358 | 2924749159 | 434 |
| 305 | iso_pu_bacteria | 2928521798 | 2928526544 | 434 |
| 306 | iso_pu_bacteria | 2937822353 | 2937828753 | 434 |
| 307 | iso_pu_bacteria | 2958122699 | 2958125050 | 434 |
| 308 | iso_pu_bacteria | 2958137437 | 2958139364 | 434 |
| 309 | iso_pu_bacteria | 2958158011 | 2958160299 | 434 |
| 310 | iso_pu_bacteria | 2961136820 | 2961137144 | 434 |
| 311 | iso_pu_bacteria | 2963644680 | 2963650468 | 434 |
| 312 | iso_pu_bacteria | 2965025482 | 2965029056 | 434 |
| 313 | iso_pu_bacteria | 2965040258 | 2965047612 | 434 |
| 314 | iso_pu_bacteria | 2965047637 | 2965048713 | 434 |
| 315 | iso_pu_bacteria | 2965089291 | 2965095545 | 434 |
| 316 | iso_pu_bacteria | 2965102966 | 2965106883 | 434 |
| 317 | iso_pu_bacteria | 2965110997 | 2965115555 | 434 |
| 318 | iso_pu_bacteria | 2968083720 | 2968085641 | 434 |
| 319 | iso_pu_bacteria | 2970547951 | 2970554109 | 434 |
| 320 | iso_pu_bacteria | 2977872689 | 2977875802 | 434 |
| 321 | iso_pu_bacteria | 2977915119 | 2977917976 | 434 |
| 322 | iso_pu_bacteria | 2977935797 | 2977940114 | 434 |
| 323 | iso_pu_bacteria | 2977950692 | 2977953485 | 434 |
| 324 | iso_pu_bacteria | 2977986579 | 2977990013 | 434 |
| 325 | iso_pu_bacteria | 2987645492 | 2987649499 | 434 |
| 326 | iso_pu_bacteria | 2987673487 | 2987679945 | 434 |
| 327 | iso_pu_bacteria | 2996336353 | 2996337120 | 434 |
| 328 | iso_pu_bacteria | 3000135777 | 3000142406 | 434 |
| 329 | iso_pu_bacteria | 3002141150 | 3002144850 | 434 |
| 330 | iso_pu_bacteria | 3002141150 | 3002146384 | 434 |
| 331 | iso_pu_bacteria | 3004195979 | 3004197315 | 434 |
| 332 | iso_pu_bacteria | 3004239961 | 3004247142 | 434 |
| 333 | iso_pu_bacteria | 649633066 | 649872267 | 434 |
| 334 | iso_pu_bacteria | 8004300914 | 8004307295 | 434 |
| 335 | iso_pu_bacteria | 8004361976 | 8004362019 | 434 |
| 336 | iso_pu_bacteria | 8004695233 | 8004699051 | 434 |
| 337 | iso_pu_bacteria | 8055617313 | 8055619039 | 434 |
| 338 | 3300005937 | Ga0081455_10070723 | Ga0081455_100707231 | 435 |
| 339 | 3300032168 | Ga0316593_10014798 | Ga0316593_100147981 | 435 |
| 340 | 3300037471 | Ga0395905_0047736 | Ga0395905_0047736_17_1327 | 435 |
| 341 | iso_pu_bacteria | 2643221674 | 2644413181 | 435 |
| 342 | iso_pu_bacteria | 2721755686 | 2723577835 | 435 |
| 343 | iso_pu_bacteria | 2841734538 | 2841735206 | 435 |
| 344 | iso_pu_bacteria | 2847670302 | 2847672198 | 435 |
| 345 | iso_pu_bacteria | 2847686936 | 2847688549 | 435 |
| 346 | iso_pu_bacteria | 2856314179 | 2856316867 | 435 |
| 347 | iso_pu_bacteria | 2856342000 | 2856349347 | 435 |
| 348 | iso_pu_bacteria | 2856356410 | 2856362269 | 435 |
| 349 | iso_pu_bacteria | 2856356410 | 2856363035 | 435 |
| 350 | iso_pu_bacteria | 2871444079 | 2871447563 | 435 |
| 351 | iso_pu_bacteria | 2871474448 | 2871481410 | 435 |
| 352 | iso_pu_bacteria | 2871488783 | 2871489606 | 435 |
| 353 | iso_pu_bacteria | 2871488783 | 2871492672 | 435 |
| 354 | iso_pu_bacteria | 2871495908 | 2871499209 | 435 |
| 355 | iso_pu_bacteria | 2874102143 | 2874104265 | 435 |
| 356 | iso_pu_bacteria | 2874123672 | 2874126578 | 435 |
| 357 | iso_pu_bacteria | 2876369609 | 2876373055 | 435 |
| 358 | iso_pu_bacteria | 2878035449 | 2878037117 | 435 |
| 359 | iso_pu_bacteria | 2878753008 | 2878753990 | 435 |
| 360 | iso_pu_bacteria | 2878753008 | 2878758553 | 435 |
| 361 | iso_pu_bacteria | 2878760144 | 2878763399 | 435 |
| 362 | iso_pu_bacteria | 2878767105 | 2878770397 | 435 |
| 363 | iso_pu_bacteria | 2881147464 | 2881154166 | 435 |
| 364 | iso_pu_bacteria | 2881155292 | 2881157897 | 435 |
| 365 | iso_pu_bacteria | 2881161766 | 2881163238 | 435 |
| 366 | iso_pu_bacteria | 2881845957 | 2881850919 | 435 |
| 367 | iso_pu_bacteria | 2881861095 | 2881863750 | 435 |
| 368 | iso_pu_bacteria | 2881861095 | 2881866808 | 435 |
| 369 | iso_pu_bacteria | 2882632389 | 2882639895 | 435 |
| 370 | iso_pu_bacteria | 2882912400 | 2882913447 | 435 |
| 371 | iso_pu_bacteria | 2882912400 | 2882916919 | 435 |
| 372 | iso_pu_bacteria | 2885305155 | 2885312198 | 435 |
| 373 | iso_pu_bacteria | 2885312484 | 2885315733 | 435 |
| 374 | iso_pu_bacteria | 2885318864 | 2885324557 | 435 |
| 375 | iso_pu_bacteria | 2885318864 | 2885325735 | 435 |
| 376 | iso_pu_bacteria | 2885334103 | 2885336146 | 435 |
| 377 | iso_pu_bacteria | 2885342637 | 2885345992 | 435 |
| 378 | iso_pu_bacteria | 2885350715 | 2885352252 | 435 |
| 379 | iso_pu_bacteria | 2888343758 | 2888349222 | 435 |
| 380 | iso_pu_bacteria | 2903492973 | 2903494708 | 435 |
| 381 | iso_pu_bacteria | 2903492973 | 2903496596 | 435 |
| 382 | iso_pu_bacteria | 2903540706 | 2903544014 | 435 |
| 383 | iso_pu_bacteria | 2904659560 | 2904665550 | 435 |
| 384 | iso_pu_bacteria | 2906328253 | 2906331710 | 435 |
| 385 | iso_pu_bacteria | 2906414383 | 2906416922 | 435 |
| 386 | iso_pu_bacteria | 2922158528 | 2922160939 | 435 |
| 387 | iso_pu_bacteria | 2924726620 | 2924731327 | 435 |
| 388 | iso_pu_bacteria | 2924754689 | 2924760066 | 435 |
| 389 | iso_pu_bacteria | 2924762789 | 2924766214 | 435 |
| 390 | iso_pu_bacteria | 2924784321 | 2924785130 | 435 |
| 391 | iso_pu_bacteria | 2924784321 | 2924788935 | 435 |
| 392 | iso_pu_bacteria | 2932401849 | 2932405980 | 435 |
| 393 | iso_pu_bacteria | 2937836603 | 2937840421 | 435 |
| 394 | iso_pu_bacteria | 2937891427 | 2937893780 | 435 |
| 395 | iso_pu_bacteria | 2937994558 | 2937997860 | 435 |
| 396 | iso_pu_bacteria | 2958071322 | 2958075794 | 435 |
| 397 | iso_pu_bacteria | 2958115193 | 2958115876 | 435 |
| 398 | iso_pu_bacteria | 2958165035 | 2958168334 | 435 |
| 399 | iso_pu_bacteria | 2961114664 | 2961120550 | 435 |
| 400 | iso_pu_bacteria | 2961127735 | 2961132186 | 435 |
| 401 | iso_pu_bacteria | 2961163497 | 2961166798 | 435 |
| 402 | iso_pu_bacteria | 2961170736 | 2961171623 | 435 |
| 403 | iso_pu_bacteria | 2961170736 | 2961173252 | 435 |
| 404 | iso_pu_bacteria | 2965018300 | 2965021622 | 435 |
| 405 | iso_pu_bacteria | 2965062239 | 2965068344 | 435 |
| 406 | iso_pu_bacteria | 2967996073 | 2967996672 | 435 |
| 407 | iso_pu_bacteria | 2967996073 | 2967998423 | 435 |
| 408 | iso_pu_bacteria | 2968003550 | 2968006151 | 435 |
| 409 | iso_pu_bacteria | 2968003550 | 2968010116 | 435 |
| 410 | iso_pu_bacteria | 2968091066 | 2968095493 | 435 |
| 411 | iso_pu_bacteria | 2968097103 | 2968103291 | 435 |
| 412 | iso_pu_bacteria | 2968110612 | 2968117017 | 435 |
| 413 | iso_pu_bacteria | 2968128360 | 2968128393 | 435 |
| 414 | iso_pu_bacteria | 2968171901 | 2968175204 | 435 |
| 415 | iso_pu_bacteria | 2970503327 | 2970504219 | 435 |
| 416 | iso_pu_bacteria | 2970503327 | 2970505846 | 435 |
| 417 | iso_pu_bacteria | 2970524798 | 2970531185 | 435 |
| 418 | iso_pu_bacteria | 2970540015 | 2970544734 | 435 |
| 419 | iso_pu_bacteria | 2970554993 | 2970558242 | 435 |
| 420 | iso_pu_bacteria | 2977821940 | 2977823206 | 435 |
| 421 | iso_pu_bacteria | 2977821940 | 2977827087 | 435 |
| 422 | iso_pu_bacteria | 2977828996 | 2977831110 | 435 |
| 423 | iso_pu_bacteria | 2977828996 | 2977832713 | 435 |
| 424 | iso_pu_bacteria | 2977858184 | 2977863677 | 435 |
| 425 | iso_pu_bacteria | 2977864932 | 2977870484 | 435 |
| 426 | iso_pu_bacteria | 2979808191 | 2979808856 | 435 |
| 427 | iso_pu_bacteria | 2979808191 | 2979810567 | 435 |
| 428 | iso_pu_bacteria | 2987659509 | 2987662810 | 435 |
| 429 | iso_pu_bacteria | 2987666974 | 2987670706 | 435 |
| 430 | iso_pu_bacteria | 2996310559 | 2996315903 | 435 |
| 431 | iso_pu_bacteria | 2996341866 | 2996342679 | 435 |
| 432 | iso_pu_bacteria | 3004188549 | 3004191862 | 435 |
| 433 | iso_pu_bacteria | 8004374579 | 8004375567 | 435 |
| 434 | iso_pu_bacteria | 8004374579 | 8004380070 | 435 |
| 435 | iso_pu_bacteria | 8004395343 | 8004397031 | 435 |
| 436 | iso_pu_bacteria | 8004633249 | 8004637931 | 435 |
| 437 | iso_pu_bacteria | 8004703790 | 8004704115 | 435 |
| 438 | iso_pu_bacteria | 8018150411 | 8018150623 | 435 |
| 439 | iso_pu_bacteria | 8055617313 | 8055623644 | 435 |
| 440 | 3300005347 | Ga0070668_100002303 | Ga0070668_1000023033 | 436 |
| 441 | 3300005983 | Ga0081540_1011720 | Ga0081540_10117202 | 436 |
| 442 | 3300009093 | Ga0105240_10143184 | Ga0105240_101431842 | 436 |
| 443 | 3300025913 | Ga0207695_10088252 | Ga0207695_100882523 | 436 |
| 444 | 3300025913 | Ga0207695_10103333 | Ga0207695_101033333 | 436 |
| 445 | 3300025972 | Ga0207668_10001564 | Ga0207668_100015643 | 436 |
| 446 | 3300028794 | Ga0307515_10003037 | Ga0307515_1000303724 | 436 |
| 447 | 3300035695 | Ga0373927_0121836 | Ga0373927_0121836_16_1341 | 436 |
| 448 | 3300037312 | Ga0395899_0000217 | Ga0395899_0000217_2625_3941 | 436 |
| 449 | 3300037418 | Ga0395900_0000270 | Ga0395900_0000270_2625_3941 | 436 |
| 450 | 3300037466 | Ga0395898_0000470 | Ga0395898_0000470_3362_4678 | 436 |
| 451 | 3300037471 | Ga0395905_0000253 | Ga0395905_0000253_76106_77422 | 436 |
| 452 | 3300038443 | Ga0395901_0000285 | Ga0395901_0000285_58904_60220 | 436 |
| 453 | 3300044901 | Ga0466960_0007399 | Ga0466960_0007399_2943_4259 | 436 |
| 454 | 3300048922 | Ga0496119_0008324 | Ga0496119_0008324_3595_4911 | 436 |
| 455 | 3300048926 | Ga0496123_0032777 | Ga0496123_0032777_2191_3507 | 436 |
| 456 | 3300048928 | Ga0496125_0001362 | Ga0496125_0001362_21137_22450 | 436 |
| 457 | 3300048928 | Ga0496125_0107130 | Ga0496125_0107130_15_1331 | 436 |
| 458 | 3300049573 | Ga0501037_0035735 | Ga0501037_0035735_1248_2561 | 436 |
| 459 | 3300053139 | Ga0500568_0000489 | Ga0500568_0000489_8942_10261 | 436 |
| 460 | iso_pu_bacteria | 2512047086 | 2512528675 | 436 |
| 461 | iso_pu_bacteria | 2516143018 | 2516207677 | 436 |
| 462 | iso_pu_bacteria | 2524023207 | 2524453233 | 436 |
| 463 | iso_pu_bacteria | 2643221623 | 2644129442 | 436 |
| 464 | iso_pu_bacteria | 2718217927 | 2719389203 | 436 |
| 465 | iso_pu_bacteria | 2718218423 | 2721401970 | 436 |
| 466 | iso_pu_bacteria | 2721755809 | 2724035803 | 436 |
| 467 | iso_pu_bacteria | 2721755823 | 2724113337 | 436 |
| 468 | iso_pu_bacteria | 2791355256 | 2793299072 | 436 |
| 469 | iso_pu_bacteria | 2791355261 | 2793331919 | 436 |
| 470 | iso_pu_bacteria | 2791355262 | 2793336933 | 436 |
| 471 | iso_pu_bacteria | 2791355263 | 2793340865 | 436 |
| 472 | iso_pu_bacteria | 2838729681 | 2838733519 | 436 |
| 473 | iso_pu_bacteria | 2838742623 | 2838746189 | 436 |
| 474 | iso_pu_bacteria | 2841851746 | 2841858101 | 436 |
| 475 | iso_pu_bacteria | 2842229732 | 2842234307 | 436 |
| 476 | iso_pu_bacteria | 2842243621 | 2842247829 | 436 |
| 477 | iso_pu_bacteria | 2842257432 | 2842259424 | 436 |
| 478 | iso_pu_bacteria | 2842395702 | 2842402067 | 436 |
| 479 | iso_pu_bacteria | 2844454524 | 2844459751 | 436 |
| 480 | iso_pu_bacteria | 2891373044 | 2891375663 | 436 |
| 481 | iso_pu_bacteria | 2936381700 | 2936384354 | 436 |
| 482 | iso_pu_bacteria | 2961127735 | 2961136766 | 436 |
| 483 | iso_pu_bacteria | 2989776772 | 2989781421 | 436 |
| 484 | iso_pu_bacteria | 643692032 | 643823793 | 436 |
| 485 | iso_pu_bacteria | 8002285264 | 8002289098 | 436 |
| 486 | iso_pu_bacteria | 8005275841 | 8005277545 | 436 |
| 487 | iso_pu_bacteria | 8005382845 | 8005382883 | 436 |
| 488 | iso_pu_bacteria | 8005395548 | 8005398488 | 436 |
| 489 | iso_pu_bacteria | 8005430974 | 8005436489 | 436 |
| 490 | iso_pu_bacteria | 8005626139 | 8005629688 | 436 |
| 491 | iso_pu_bacteria | 8005695170 | 8005701056 | 436 |
| 492 | iso_pu_bacteria | 8018176218 | 8018179201 | 436 |
| 493 | iso_pu_bacteria | 8024501048 | 8024505685 | 436 |
| 494 | 3300005339 | Ga0070660_100004532 | Ga0070660_1000045323 | 437 |
| 495 | 3300005339 | Ga0070660_100110075 | Ga0070660_1001100752 | 437 |
| 496 | 3300005344 | Ga0070661_100002388 | Ga0070661_1000023885 | 437 |
| 497 | 3300005344 | Ga0070661_100019583 | Ga0070661_1000195836 | 437 |
| 498 | 3300005539 | Ga0068853_100000517 | Ga0068853_1000005176 | 437 |
| 499 | 3300005563 | Ga0068855_100207408 | Ga0068855_1002074082 | 437 |
| 500 | 3300005834 | Ga0068851_10001016 | Ga0068851_100010168 | 437 |
| 501 | 3300006038 | Ga0075365_10078577 | Ga0075365_100785772 | 437 |
| 502 | 3300006048 | Ga0075363_100066087 | Ga0075363_1000660872 | 437 |
| 503 | 3300006177 | Ga0075362_10020779 | Ga0075362_100207792 | 437 |
| 504 | 3300006353 | Ga0075370_10050746 | Ga0075370_100507462 | 437 |
| 505 | 3300009551 | Ga0105238_10004964 | Ga0105238_100049648 | 437 |
| 506 | 3300010375 | Ga0105239_10010565 | Ga0105239_100105659 | 437 |
| 507 | 3300025321 | Ga0207656_10000583 | Ga0207656_100005835 | 437 |
| 508 | 3300025909 | Ga0207705_10106962 | Ga0207705_101069621 | 437 |
| 509 | 3300025913 | Ga0207695_10143562 | Ga0207695_101435622 | 437 |
| 510 | 3300025919 | Ga0207657_10000522 | Ga0207657_1000052231 | 437 |
| 511 | 3300025919 | Ga0207657_10069011 | Ga0207657_100690112 | 437 |
| 512 | 3300025920 | Ga0207649_10001900 | Ga0207649_100019008 | 437 |
| 513 | 3300025924 | Ga0207694_10068887 | Ga0207694_100688873 | 437 |
| 514 | 3300025938 | Ga0207704_10110404 | Ga0207704_101104042 | 437 |
| 515 | 3300025949 | Ga0207667_10018838 | Ga0207667_100188381 | 437 |
| 516 | 3300026041 | Ga0207639_10000537 | Ga0207639_1000053719 | 437 |
| 517 | 3300026067 | Ga0207678_10028324 | Ga0207678_100283246 | 437 |
| 518 | 3300026116 | Ga0207674_10030401 | Ga0207674_100304012 | 437 |
| 519 | 3300026142 | Ga0207698_10126249 | Ga0207698_101262491 | 437 |
| 520 | 3300031251 | Ga0265327_10032158 | Ga0265327_100321582 | 437 |
| 521 | 3300031852 | Ga0307410_10006982 | Ga0307410_100069824 | 437 |
| 522 | 3300032004 | Ga0307414_10058099 | Ga0307414_100580991 | 437 |
| 523 | 3300037068 | Ga0373925_0140635 | Ga0373925_0140635_493_1824 | 437 |
| 524 | 3300037312 | Ga0395899_0037973 | Ga0395899_0037973_1518_2849 | 437 |
| 525 | 3300044842 | Ga0466957_0072670 | Ga0466957_0072670_498_1829 | 437 |
| 526 | 3300046660 | Ga0495625_0023432 | Ga0495625_0023432_1559_2872 | 437 |
| 527 | 3300046694 | Ga0495649_0095898 | Ga0495649_0095898_147_1460 | 437 |
| 528 | 3300048915 | Ga0496112_0295672 | Ga0496112_0295672_208_1521 | 437 |
| 529 | 3300048922 | Ga0496119_0030431 | Ga0496119_0030431_260_1579 | 437 |
| 530 | 3300048925 | Ga0496122_0011460 | Ga0496122_0011460_7281_8600 | 437 |
| 531 | 3300048925 | Ga0496122_0030297 | Ga0496122_0030297_2783_4171 | 437 |
| 532 | 3300048926 | Ga0496123_0018083 | Ga0496123_0018083_655_1974 | 437 |
| 533 | 3300048928 | Ga0496125_0032187 | Ga0496125_0032187_178_1566 | 437 |
| 534 | 3300048928 | Ga0496125_0038629 | Ga0496125_0038629_1180_2568 | 437 |
| 535 | 3300048928 | Ga0496125_0070130 | Ga0496125_0070130_1180_2499 | 437 |
| 536 | 3300049568 | Ga0501031_0086033 | Ga0501031_0086033_242_1561 | 437 |
| 537 | 3300049569 | Ga0501032_0044497 | Ga0501032_0044497_302_1633 | 437 |
| 538 | 3300049570 | Ga0501033_0085604 | Ga0501033_0085604_854_2173 | 437 |
| 539 | 3300049571 | Ga0501034_0018012 | Ga0501034_0018012_1787_3100 | 437 |
| 540 | 3300049571 | Ga0501034_0068252 | Ga0501034_0068252_1725_3056 | 437 |
| 541 | 3300049571 | Ga0501034_0126952 | Ga0501034_0126952_745_2076 | 437 |
| 542 | 3300049571 | Ga0501034_0253866 | Ga0501034_0253866_287_1627 | 437 |
| 543 | 3300049574 | Ga0501038_0043054 | Ga0501038_0043054_658_1989 | 437 |
| 544 | 3300049574 | Ga0501038_0052644 | Ga0501038_0052644_265_1584 | 437 |
| 545 | 3300049575 | Ga0501039_0086332 | Ga0501039_0086332_24_1343 | 437 |
| 546 | 3300049579 | Ga0501043_0032472 | Ga0501043_0032472_179_1510 | 437 |
| 547 | 3300049584 | Ga0501068_0065393 | Ga0501068_0065393_443_1762 | 437 |
| 548 | 3300049586 | Ga0501070_0141751 | Ga0501070_0141751_500_1831 | 437 |
| 549 | 3300049822 | Ga0501035_0019154 | Ga0501035_0019154_941_2260 | 437 |
| 550 | 3300049822 | Ga0501035_0031137 | Ga0501035_0031137_2043_3413 | 437 |
| 551 | 3300049822 | Ga0501035_0031401 | Ga0501035_0031401_2850_4169 | 437 |
| 552 | 3300049822 | Ga0501035_0171446 | Ga0501035_0171446_492_1823 | 437 |
| 553 | 3300049822 | Ga0501035_0260778 | Ga0501035_0260778_21_1370 | 437 |
| 554 | 3300049823 | Ga0501044_0031017 | Ga0501044_0031017_1976_3346 | 437 |
| 555 | 3300050489 | nmdc:mga03683_3365_c1 | nmdc:mga03683_3365_c1_2259_3584 | 437 |
| 556 | 3300050490 | nmdc:mga03n38_6325_c1 | nmdc:mga03n38_6325_c1_2326_3651 | 437 |
| 557 | 3300050491 | nmdc:mga00v17_135289_c1 | nmdc:mga00v17_135289_c1_221_1552 | 437 |
| 558 | 3300050493 | nmdc:mga0k408_21121_c1 | nmdc:mga0k408_21121_c1_207_1538 | 437 |
| 559 | 3300053079 | Ga0500610_0029999 | Ga0500610_0029999_959_2272 | 437 |
| 560 | 3300053083 | Ga0495655_0002042 | Ga0495655_0002042_1819_3132 | 437 |
| 561 | 3300053155 | Ga0500620_000055 | Ga0500620_000055_3179_4504 | 437 |
| 562 | 3300053161 | Ga0500634_0000017 | Ga0500634_0000017_7637_8953 | 437 |
| 563 | iso_pu_bacteria | 2503198000 | 2503199515 | 437 |
| 564 | iso_pu_bacteria | 2508501123 | 2509113530 | 437 |
| 565 | iso_pu_bacteria | 2509276022 | 2509394449 | 437 |
| 566 | iso_pu_bacteria | 2510065059 | 2510320245 | 437 |
| 567 | iso_pu_bacteria | 2512875016 | 2512933081 | 437 |
| 568 | iso_pu_bacteria | 2512875024 | 2512961127 | 437 |
| 569 | iso_pu_bacteria | 2513237090 | 2513611695 | 437 |
| 570 | iso_pu_bacteria | 2513237164 | 2514035179 | 437 |
| 571 | iso_pu_bacteria | 2513237305 | 2514420990 | 437 |
| 572 | iso_pu_bacteria | 2513237351 | 2514591405 | 437 |
| 573 | iso_pu_bacteria | 2599185301 | 2599937486 | 437 |
| 574 | iso_pu_bacteria | 2643221595 | 2643988144 | 437 |
| 575 | iso_pu_bacteria | 2643221627 | 2644155139 | 437 |
| 576 | iso_pu_bacteria | 2687453392 | 2688596776 | 437 |
| 577 | iso_pu_bacteria | 2693429783 | 2694633875 | 437 |
| 578 | iso_pu_bacteria | 2693429784 | 2694637720 | 437 |
| 579 | iso_pu_bacteria | 2721755686 | 2723578004 | 437 |
| 580 | iso_pu_bacteria | 2756170246 | 2756674210 | 437 |
| 581 | iso_pu_bacteria | 2791355123 | 2792750489 | 437 |
| 582 | iso_pu_bacteria | 2844002411 | 2844009267 | 437 |
| 583 | iso_pu_bacteria | 2844009547 | 2844012032 | 437 |
| 584 | iso_pu_bacteria | 2856320880 | 2856324137 | 437 |
| 585 | iso_pu_bacteria | 2856328259 | 2856329649 | 437 |
| 586 | iso_pu_bacteria | 2856334872 | 2856339428 | 437 |
| 587 | iso_pu_bacteria | 2856364286 | 2856368578 | 437 |
| 588 | iso_pu_bacteria | 2857349434 | 2857355451 | 437 |
| 589 | iso_pu_bacteria | 2857367948 | 2857374405 | 437 |
| 590 | iso_pu_bacteria | 2869169390 | 2869170828 | 437 |
| 591 | iso_pu_bacteria | 2869234852 | 2869235573 | 437 |
| 592 | iso_pu_bacteria | 2869242130 | 2869248542 | 437 |
| 593 | iso_pu_bacteria | 2869249662 | 2869256525 | 437 |
| 594 | iso_pu_bacteria | 2869256925 | 2869259129 | 437 |
| 595 | iso_pu_bacteria | 2869264136 | 2869266927 | 437 |
| 596 | iso_pu_bacteria | 2869278585 | 2869285571 | 437 |
| 597 | iso_pu_bacteria | 2869285874 | 2869292006 | 437 |
| 598 | iso_pu_bacteria | 2871429161 | 2871435213 | 437 |
| 599 | iso_pu_bacteria | 2871451962 | 2871456904 | 437 |
| 600 | iso_pu_bacteria | 2871459585 | 2871461701 | 437 |
| 601 | iso_pu_bacteria | 2871466892 | 2871470282 | 437 |
| 602 | iso_pu_bacteria | 2871481445 | 2871481873 | 437 |
| 603 | iso_pu_bacteria | 2874109183 | 2874112408 | 437 |
| 604 | iso_pu_bacteria | 2874116593 | 2874118141 | 437 |
| 605 | iso_pu_bacteria | 2874131515 | 2874138299 | 437 |
| 606 | iso_pu_bacteria | 2874139085 | 2874146187 | 437 |
| 607 | iso_pu_bacteria | 2874146452 | 2874151137 | 437 |
| 608 | iso_pu_bacteria | 2874155637 | 2874161164 | 437 |
| 609 | iso_pu_bacteria | 2874162495 | 2874165266 | 437 |
| 610 | iso_pu_bacteria | 2874168670 | 2874175791 | 437 |
| 611 | iso_pu_bacteria | 2876363079 | 2876364672 | 437 |
| 612 | iso_pu_bacteria | 2876386047 | 2876389650 | 437 |
| 613 | iso_pu_bacteria | 2876399893 | 2876401344 | 437 |
| 614 | iso_pu_bacteria | 2876406927 | 2876409954 | 437 |
| 615 | iso_pu_bacteria | 2876413966 | 2876417157 | 437 |
| 616 | iso_pu_bacteria | 2876420981 | 2876421245 | 437 |
| 617 | iso_pu_bacteria | 2878730984 | 2878735715 | 437 |
| 618 | iso_pu_bacteria | 2878738818 | 2878741229 | 437 |
| 619 | iso_pu_bacteria | 2878745973 | 2878752348 | 437 |
| 620 | iso_pu_bacteria | 2878774303 | 2878775438 | 437 |
| 621 | iso_pu_bacteria | 2878781027 | 2878783239 | 437 |
| 622 | iso_pu_bacteria | 2888337043 | 2888337893 | 437 |
| 623 | iso_pu_bacteria | 2888350351 | 2888357060 | 437 |
| 624 | iso_pu_bacteria | 2889010040 | 2889012074 | 437 |
| 625 | iso_pu_bacteria | 2889016732 | 2889022996 | 437 |
| 626 | iso_pu_bacteria | 2889790730 | 2889791214 | 437 |
| 627 | iso_pu_bacteria | 2889790730 | 2889793894 | 437 |
| 628 | iso_pu_bacteria | 2889914905 | 2889916034 | 437 |
| 629 | iso_pu_bacteria | 2889914905 | 2889916168 | 437 |
| 630 | iso_pu_bacteria | 2900634093 | 2900642128 | 437 |
| 631 | iso_pu_bacteria | 2903448605 | 2903454802 | 437 |
| 632 | iso_pu_bacteria | 2903492973 | 2903505479 | 437 |
| 633 | iso_pu_bacteria | 2903513507 | 2903520291 | 437 |
| 634 | iso_pu_bacteria | 2903521522 | 2903522592 | 437 |
| 635 | iso_pu_bacteria | 2903528002 | 2903528971 | 437 |
| 636 | iso_pu_bacteria | 2906308376 | 2906314742 | 437 |
| 637 | iso_pu_bacteria | 2906321335 | 2906327914 | 437 |
| 638 | iso_pu_bacteria | 2906363423 | 2906364769 | 437 |
| 639 | iso_pu_bacteria | 2906370794 | 2906372932 | 437 |
| 640 | iso_pu_bacteria | 2906378014 | 2906382897 | 437 |
| 641 | iso_pu_bacteria | 2906386501 | 2906393324 | 437 |
| 642 | iso_pu_bacteria | 2906401398 | 2906402808 | 437 |
| 643 | iso_pu_bacteria | 2906408224 | 2906410936 | 437 |
| 644 | iso_pu_bacteria | 2906427513 | 2906433152 | 437 |
| 645 | iso_pu_bacteria | 2922130491 | 2922134679 | 437 |
| 646 | iso_pu_bacteria | 2922151315 | 2922157525 | 437 |
| 647 | iso_pu_bacteria | 2922172374 | 2922177996 | 437 |
| 648 | iso_pu_bacteria | 2922185730 | 2922193792 | 437 |
| 649 | iso_pu_bacteria | 2924710171 | 2924718321 | 437 |
| 650 | iso_pu_bacteria | 2924718760 | 2924726609 | 437 |
| 651 | iso_pu_bacteria | 2924733363 | 2924735699 | 437 |
| 652 | iso_pu_bacteria | 2924741084 | 2924748259 | 437 |
| 653 | iso_pu_bacteria | 2924748358 | 2924750353 | 437 |
| 654 | iso_pu_bacteria | 2924776078 | 2924778911 | 437 |
| 655 | iso_pu_bacteria | 2937813078 | 2937821069 | 437 |
| 656 | iso_pu_bacteria | 2937848649 | 2937855515 | 437 |
| 657 | iso_pu_bacteria | 2937861824 | 2937862062 | 437 |
| 658 | iso_pu_bacteria | 2937868953 | 2937874665 | 437 |
| 659 | iso_pu_bacteria | 2937877337 | 2937883430 | 437 |
| 660 | iso_pu_bacteria | 2937972304 | 2937973590 | 437 |
| 661 | iso_pu_bacteria | 2937980651 | 2937982258 | 437 |
| 662 | iso_pu_bacteria | 2938014810 | 2938016773 | 437 |
| 663 | iso_pu_bacteria | 2958034702 | 2958041275 | 437 |
| 664 | iso_pu_bacteria | 2958041894 | 2958057769 | 437 |
| 665 | iso_pu_bacteria | 2958064165 | 2958070010 | 437 |
| 666 | iso_pu_bacteria | 2958084443 | 2958090597 | 437 |
| 667 | iso_pu_bacteria | 2958092219 | 2958096561 | 437 |
| 668 | iso_pu_bacteria | 2958100919 | 2958107983 | 437 |
| 669 | iso_pu_bacteria | 2958108152 | 2958109922 | 437 |
| 670 | iso_pu_bacteria | 2958122699 | 2958127880 | 437 |
| 671 | iso_pu_bacteria | 2958130278 | 2958136406 | 437 |
| 672 | iso_pu_bacteria | 2958137437 | 2958137813 | 437 |
| 673 | iso_pu_bacteria | 2958144490 | 2958147965 | 437 |
| 674 | iso_pu_bacteria | 2958158011 | 2958162167 | 437 |
| 675 | iso_pu_bacteria | 2958172287 | 2958173302 | 437 |
| 676 | iso_pu_bacteria | 2958179912 | 2958185873 | 437 |
| 677 | iso_pu_bacteria | 2961077736 | 2961084354 | 437 |
| 678 | iso_pu_bacteria | 2961136820 | 2961138010 | 437 |
| 679 | iso_pu_bacteria | 2961183825 | 2961187010 | 437 |
| 680 | iso_pu_bacteria | 2963644680 | 2963646128 | 437 |
| 681 | iso_pu_bacteria | 2965025482 | 2965025602 | 437 |
| 682 | iso_pu_bacteria | 2965047637 | 2965049036 | 437 |
| 683 | iso_pu_bacteria | 2965089291 | 2965091311 | 437 |
| 684 | iso_pu_bacteria | 2965102966 | 2965106735 | 437 |
| 685 | iso_pu_bacteria | 2968016561 | 2968016611 | 437 |
| 686 | iso_pu_bacteria | 2968083720 | 2968089640 | 437 |
| 687 | iso_pu_bacteria | 2968117919 | 2968123751 | 437 |
| 688 | iso_pu_bacteria | 2968138860 | 2968143188 | 437 |
| 689 | iso_pu_bacteria | 2970469710 | 2970469953 | 437 |
| 690 | iso_pu_bacteria | 2970489779 | 2970493748 | 437 |
| 691 | iso_pu_bacteria | 2970510686 | 2970510812 | 437 |
| 692 | iso_pu_bacteria | 2970532167 | 2970537707 | 437 |
| 693 | iso_pu_bacteria | 2970547951 | 2970552892 | 437 |
| 694 | iso_pu_bacteria | 2970593180 | 2970600186 | 437 |
| 695 | iso_pu_bacteria | 2970619444 | 2970620575 | 437 |
| 696 | iso_pu_bacteria | 2970627176 | 2970629252 | 437 |
| 697 | iso_pu_bacteria | 2977843712 | 2977849729 | 437 |
| 698 | iso_pu_bacteria | 2977851361 | 2977851835 | 437 |
| 699 | iso_pu_bacteria | 2977872689 | 2977879909 | 437 |
| 700 | iso_pu_bacteria | 2977907340 | 2977908407 | 437 |
| 701 | iso_pu_bacteria | 2977915119 | 2977921380 | 437 |
| 702 | iso_pu_bacteria | 2977922695 | 2977928778 | 437 |
| 703 | iso_pu_bacteria | 2977935797 | 2977935942 | 437 |
| 704 | iso_pu_bacteria | 2977942078 | 2977948954 | 437 |
| 705 | iso_pu_bacteria | 2977950692 | 2977952776 | 437 |
| 706 | iso_pu_bacteria | 2977957713 | 2977961637 | 437 |
| 707 | iso_pu_bacteria | 2977986579 | 2977989168 | 437 |
| 708 | iso_pu_bacteria | 2979710463 | 2979714376 | 437 |
| 709 | iso_pu_bacteria | 2979764755 | 2979771020 | 437 |
| 710 | iso_pu_bacteria | 2979772303 | 2979775610 | 437 |
| 711 | iso_pu_bacteria | 2987636660 | 2987640584 | 437 |
| 712 | iso_pu_bacteria | 2987645492 | 2987647504 | 437 |
| 713 | iso_pu_bacteria | 2987652177 | 2987654490 | 437 |
| 714 | iso_pu_bacteria | 2987673487 | 2987674478 | 437 |
| 715 | iso_pu_bacteria | 2996348954 | 2996353116 | 437 |
| 716 | iso_pu_bacteria | 2996386984 | 2996390396 | 437 |
| 717 | iso_pu_bacteria | 3000135777 | 3000141411 | 437 |
| 718 | iso_pu_bacteria | 3004167301 | 3004174164 | 437 |
| 719 | iso_pu_bacteria | 3004203850 | 3004208782 | 437 |
| 720 | iso_pu_bacteria | 3004211236 | 3004211422 | 437 |
| 721 | iso_pu_bacteria | 3004218560 | 3004225029 | 437 |
| 722 | iso_pu_bacteria | 3004232784 | 3004236179 | 437 |
| 723 | iso_pu_bacteria | 3004239961 | 3004245026 | 437 |
| 724 | iso_pu_bacteria | 3004248173 | 3004248387 | 437 |
| 725 | iso_pu_bacteria | 3004268573 | 3004271384 | 437 |
| 726 | iso_pu_bacteria | 3004275668 | 3004279798 | 437 |
| 727 | iso_pu_bacteria | 3004334049 | 3004336286 | 437 |
| 728 | iso_pu_bacteria | 637000159 | 637076162 | 437 |
| 729 | iso_pu_bacteria | 649633066 | 649871330 | 437 |
| 730 | iso_pu_bacteria | 8004300914 | 8004302650 | 437 |
| 731 | iso_pu_bacteria | 8004312739 | 8004312960 | 437 |
| 732 | iso_pu_bacteria | 8004361976 | 8004364005 | 437 |
| 733 | iso_pu_bacteria | 8004387939 | 8004395014 | 437 |
| 734 | iso_pu_bacteria | 8004640170 | 8004642969 | 437 |
| 735 | iso_pu_bacteria | 8004695233 | 8004696123 | 437 |
| 736 | iso_pu_bacteria | 8004714634 | 8004721003 | 437 |
| 737 | iso_pu_bacteria | 8021120328 | 8021127674 | 437 |
| 738 | 3300003214 | JGI25165J46597_1004311 | JGI25165J46597_10043112 | 438 |
| 739 | 3300003762 | Ga0055542_1000391 | Ga0055542_10003918 | 438 |
| 740 | 3300003762 | Ga0055542_1000549 | Ga0055542_100054914 | 438 |
| 741 | 3300003763 | Ga0055529_1002315 | Ga0055529_10023152 | 438 |
| 742 | 3300005327 | Ga0070658_10014984 | Ga0070658_100149846 | 438 |
| 743 | 3300005328 | Ga0070676_10096805 | Ga0070676_100968052 | 438 |
| 744 | 3300005334 | Ga0068869_100053101 | Ga0068869_1000531012 | 438 |
| 745 | 3300005347 | Ga0070668_100212067 | Ga0070668_1002120671 | 438 |
| 746 | 3300005353 | Ga0070669_100035899 | Ga0070669_1000358992 | 438 |
| 747 | 3300005366 | Ga0070659_100018306 | Ga0070659_1000183064 | 438 |
| 748 | 3300005367 | Ga0070667_100263775 | Ga0070667_1002637751 | 438 |
| 749 | 3300005455 | Ga0070663_100080278 | Ga0070663_1000802782 | 438 |
| 750 | 3300005459 | Ga0068867_100210218 | Ga0068867_1002102181 | 438 |
| 751 | 3300005518 | Ga0070699_100055004 | Ga0070699_1000550043 | 438 |
| 752 | 3300005539 | Ga0068853_100002399 | Ga0068853_1000023997 | 438 |
| 753 | 3300005548 | Ga0070665_100196582 | Ga0070665_1001965822 | 438 |
| 754 | 3300005614 | Ga0068856_100089267 | Ga0068856_1000892672 | 438 |
| 755 | 3300005616 | Ga0068852_100003680 | Ga0068852_10000368011 | 438 |
| 756 | 3300006038 | Ga0075365_10003273 | Ga0075365_100032734 | 438 |
| 757 | 3300006048 | Ga0075363_100001186 | Ga0075363_1000011865 | 438 |
| 758 | 3300006178 | Ga0075367_10000725 | Ga0075367_100007256 | 438 |
| 759 | 3300006195 | Ga0075366_10080786 | Ga0075366_100807861 | 438 |
| 760 | 3300009093 | Ga0105240_10116984 | Ga0105240_101169843 | 438 |
| 761 | 3300009147 | Ga0114129_10360722 | Ga0114129_103607221 | 438 |
| 762 | 3300009545 | Ga0105237_10000203 | Ga0105237_1000020376 | 438 |
| 763 | 3300009545 | Ga0105237_10014190 | Ga0105237_100141903 | 438 |
| 764 | 3300009551 | Ga0105238_10008979 | Ga0105238_100089793 | 438 |
| 765 | 3300009553 | Ga0105249_10085726 | Ga0105249_100857261 | 438 |
| 766 | 3300010375 | Ga0105239_10008429 | Ga0105239_100084297 | 438 |
| 767 | 3300010375 | Ga0105239_10012345 | Ga0105239_100123454 | 438 |
| 768 | 3300010375 | Ga0105239_10050525 | Ga0105239_100505253 | 438 |
| 769 | 3300021384 | Ga0213876_10000567 | Ga0213876_100005677 | 438 |
| 770 | 3300021388 | Ga0213875_10014734 | Ga0213875_100147342 | 438 |
| 771 | 3300025254 | Ga0209148_1000256 | Ga0209148_100025640 | 438 |
| 772 | 3300025272 | Ga0209455_1000314 | Ga0209455_100031432 | 438 |
| 773 | 3300025913 | Ga0207695_10042224 | Ga0207695_100422245 | 438 |
| 774 | 3300025913 | Ga0207695_10084812 | Ga0207695_100848123 | 438 |
| 775 | 3300025914 | Ga0207671_10002706 | Ga0207671_100027067 | 438 |
| 776 | 3300025919 | Ga0207657_10045049 | Ga0207657_100450493 | 438 |
| 777 | 3300025922 | Ga0207646_10034835 | Ga0207646_100348351 | 438 |
| 778 | 3300025923 | Ga0207681_10172332 | Ga0207681_101723322 | 438 |
| 779 | 3300025924 | Ga0207694_10067138 | Ga0207694_100671383 | 438 |
| 780 | 3300025949 | Ga0207667_10010611 | Ga0207667_1001061111 | 438 |
| 781 | 3300026067 | Ga0207678_10024835 | Ga0207678_100248354 | 438 |
| 782 | 3300026078 | Ga0207702_10213384 | Ga0207702_102133842 | 438 |
| 783 | 3300028379 | Ga0268266_10000343 | Ga0268266_1000034348 | 438 |
| 784 | 3300028800 | Ga0265338_10026374 | Ga0265338_100263748 | 438 |
| 785 | 3300031235 | Ga0265330_10007518 | Ga0265330_100075185 | 438 |
| 786 | 3300031241 | Ga0265325_10003409 | Ga0265325_100034093 | 438 |
| 787 | 3300031242 | Ga0265329_10011891 | Ga0265329_100118912 | 438 |
| 788 | 3300031249 | Ga0265339_10000370 | Ga0265339_1000037027 | 438 |
| 789 | 3300031250 | Ga0265331_10011736 | Ga0265331_100117363 | 438 |
| 790 | 3300031344 | Ga0265316_10012488 | Ga0265316_100124888 | 438 |
| 791 | 3300031595 | Ga0265313_10000070 | Ga0265313_1000007069 | 438 |
| 792 | 3300031711 | Ga0265314_10017190 | Ga0265314_100171903 | 438 |
| 793 | 3300031730 | Ga0307516_10019483 | Ga0307516_100194836 | 438 |
| 794 | 3300031730 | Ga0307516_10087485 | Ga0307516_100874853 | 438 |
| 795 | 3300031911 | Ga0307412_10045455 | Ga0307412_100454553 | 438 |
| 796 | 3300033180 | Ga0307510_10130942 | Ga0307510_101309422 | 438 |
| 797 | 3300037312 | Ga0395899_0197203 | Ga0395899_0197203_79_1395 | 438 |
| 798 | 3300037418 | Ga0395900_0266153 | Ga0395900_0266153_79_1395 | 438 |
| 799 | 3300037466 | Ga0395898_0192406 | Ga0395898_0192406_543_1859 | 438 |
| 800 | 3300038443 | Ga0395901_0081590 | Ga0395901_0081590_1704_3020 | 438 |
| 801 | 3300047472 | Ga0495686_0023847 | Ga0495686_0023847_406_1845 | 438 |
| 802 | 3300048927 | Ga0496124_0031050 | Ga0496124_0031050_1825_3144 | 438 |
| 803 | 3300049568 | Ga0501031_0075906 | Ga0501031_0075906_359_1684 | 438 |
| 804 | 3300049569 | Ga0501032_0000234 | Ga0501032_0000234_2276_3601 | 438 |
| 805 | 3300049570 | Ga0501033_0000076 | Ga0501033_0000076_37145_38470 | 438 |
| 806 | 3300049570 | Ga0501033_0107461 | Ga0501033_0107461_192_1511 | 438 |
| 807 | 3300049571 | Ga0501034_0000408 | Ga0501034_0000408_54933_56258 | 438 |
| 808 | 3300049571 | Ga0501034_0161781 | Ga0501034_0161781_748_2067 | 438 |
| 809 | 3300049571 | Ga0501034_0234211 | Ga0501034_0234211_40_1359 | 438 |
| 810 | 3300049572 | Ga0501036_0001942 | Ga0501036_0001942_11889_13214 | 438 |
| 811 | 3300049573 | Ga0501037_0000533 | Ga0501037_0000533_11803_13128 | 438 |
| 812 | 3300049574 | Ga0501038_0000241 | Ga0501038_0000241_42570_43895 | 438 |
| 813 | 3300049574 | Ga0501038_0113349 | Ga0501038_0113349_63_1382 | 438 |
| 814 | 3300049577 | Ga0501041_0059528 | Ga0501041_0059528_609_1934 | 438 |
| 815 | 3300049579 | Ga0501043_0000043 | Ga0501043_0000043_41868_43193 | 438 |
| 816 | 3300049579 | Ga0501043_0041697 | Ga0501043_0041697_2096_3415 | 438 |
| 817 | 3300049579 | Ga0501043_0045434 | Ga0501043_0045434_1411_2730 | 438 |
| 818 | 3300049580 | Ga0501046_0015199 | Ga0501046_0015199_2033_3358 | 438 |
| 819 | 3300049581 | Ga0501047_0010435 | Ga0501047_0010435_7127_8449 | 438 |
| 820 | 3300049581 | Ga0501047_0092225 | Ga0501047_0092225_880_2277 | 438 |
| 821 | 3300049585 | Ga0501069_0012324 | Ga0501069_0012324_1472_2794 | 438 |
| 822 | 3300049586 | Ga0501070_0000299 | Ga0501070_0000299_9872_11269 | 438 |
| 823 | 3300049586 | Ga0501070_0001617 | Ga0501070_0001617_1813_3135 | 438 |
| 824 | 3300049586 | Ga0501070_0037296 | Ga0501070_0037296_2622_3941 | 438 |
| 825 | 3300049586 | Ga0501070_0204135 | Ga0501070_0204135_192_1511 | 438 |
| 826 | 3300049589 | Ga0501073_0039218 | Ga0501073_0039218_378_1775 | 438 |
| 827 | 3300049590 | Ga0501074_0032102 | Ga0501074_0032102_1526_2923 | 438 |
| 828 | 3300049742 | Ga0501080_0001620 | Ga0501080_0001620_8029_9426 | 438 |
| 829 | 3300049744 | Ga0501083_0124110 | Ga0501083_0124110_311_1630 | 438 |
| 830 | 3300049822 | Ga0501035_0000449 | Ga0501035_0000449_42603_43928 | 438 |
| 831 | 3300049822 | Ga0501035_0002751 | Ga0501035_0002751_9723_11045 | 438 |
| 832 | 3300049822 | Ga0501035_0004065 | Ga0501035_0004065_1000_2397 | 438 |
| 833 | 3300049823 | Ga0501044_0001093 | Ga0501044_0001093_8547_9944 | 438 |
| 834 | 3300049823 | Ga0501044_0003690 | Ga0501044_0003690_4150_5475 | 438 |
| 835 | 3300049823 | Ga0501044_0010367 | Ga0501044_0010367_811_2133 | 438 |
| 836 | 3300049823 | Ga0501044_0052703 | Ga0501044_0052703_2421_3740 | 438 |
| 837 | 3300049823 | Ga0501044_0070373 | Ga0501044_0070373_523_1842 | 438 |
| 838 | 3300050491 | nmdc:mga00v17_6957_c1 | nmdc:mga00v17_6957_c1_3714_5030 | 438 |
| 839 | 3300050493 | nmdc:mga0k408_113916_c1 | nmdc:mga0k408_113916_c1_77_1402 | 438 |
| 840 | 3300050494 | nmdc:mga06z11_16687_c1 | nmdc:mga06z11_16687_c1_344_1660 | 438 |
| 841 | 3300053103 | Ga0500555_001043 | Ga0500555_001043_1346_2671 | 438 |
| 842 | 3300053134 | Ga0500658_0070660 | Ga0500658_0070660_98_1414 | 438 |
| 843 | 3300053139 | Ga0500568_0018969 | Ga0500568_0018969_950_2293 | 438 |
| 844 | 3300053153 | Ga0500616_0008291 | Ga0500616_0008291_3106_4449 | 438 |
| 845 | iso_pu_bacteria | 2643221629 | 2644164789 | 438 |
| 846 | iso_pu_bacteria | 2643221662 | 2644345939 | 438 |
| 847 | iso_pu_bacteria | 2643221734 | 2644734133 | 438 |
| 848 | iso_pu_bacteria | 2919450847 | 2919454822 | 438 |
| 849 | iso_pu_bacteria | 8001845381 | 8001850291 | 438 |
| 850 | iso_pu_bacteria | 8057529695 | 8057533603 | 438 |
| 851 | 3300003215 | JGI25153J46596_10000062 | JGI25153J46596_10000062101 | 439 |
| 852 | 3300003215 | JGI25153J46596_10000095 | JGI25153J46596_1000009595 | 439 |
| 853 | 3300003794 | Ga0055531_10029522 | Ga0055531_100295221 | 439 |
| 854 | 3300005344 | Ga0070661_100062246 | Ga0070661_1000622462 | 439 |
| 855 | 3300005458 | Ga0070681_10001647 | Ga0070681_100016471 | 439 |
| 856 | 3300005518 | Ga0070699_100054158 | Ga0070699_1000541584 | 439 |
| 857 | 3300005530 | Ga0070679_100015230 | Ga0070679_1000152305 | 439 |
| 858 | 3300005539 | Ga0068853_100007892 | Ga0068853_10000789210 | 439 |
| 859 | 3300005539 | Ga0068853_100009275 | Ga0068853_1000092757 | 439 |
| 860 | 3300005543 | Ga0070672_100178448 | Ga0070672_1001784482 | 439 |
| 861 | 3300005841 | Ga0068863_100039528 | Ga0068863_1000395284 | 439 |
| 862 | 3300005843 | Ga0068860_100022845 | Ga0068860_1000228453 | 439 |
| 863 | 3300005844 | Ga0068862_100117821 | Ga0068862_1001178211 | 439 |
| 864 | 3300013100 | Ga0157373_10059802 | Ga0157373_100598021 | 439 |
| 865 | 3300013104 | Ga0157370_10075236 | Ga0157370_100752362 | 439 |
| 866 | 3300013296 | Ga0157374_10028264 | Ga0157374_100282645 | 439 |
| 867 | 3300013307 | Ga0157372_10017769 | Ga0157372_100177691 | 439 |
| 868 | 3300025297 | Ga0209758_1000029 | Ga0209758_1000029347 | 439 |
| 869 | 3300025298 | Ga0209050_1003786 | Ga0209050_10037866 | 439 |
| 870 | 3300025304 | Ga0209257_1002768 | Ga0209257_100276810 | 439 |
| 871 | 3300025921 | Ga0207652_10055282 | Ga0207652_100552823 | 439 |
| 872 | 3300025922 | Ga0207646_10010499 | Ga0207646_100104997 | 439 |
| 873 | 3300025972 | Ga0207668_10152002 | Ga0207668_101520022 | 439 |
| 874 | 3300026041 | Ga0207639_10023642 | Ga0207639_100236424 | 439 |
| 875 | 3300026067 | Ga0207678_10013615 | Ga0207678_100136155 | 439 |
| 876 | 3300027682 | Ga0209971_1005290 | Ga0209971_10052902 | 439 |
| 877 | 3300027876 | Ga0209974_10006933 | Ga0209974_100069333 | 439 |
| 878 | 3300028794 | Ga0307515_10009737 | Ga0307515_100097378 | 439 |
| 879 | 3300031251 | Ga0265327_10018629 | Ga0265327_100186294 | 439 |
| 880 | 3300031456 | Ga0307513_10016761 | Ga0307513_100167613 | 439 |
| 881 | 3300031911 | Ga0307412_10042132 | Ga0307412_100421322 | 439 |
| 882 | 3300047472 | Ga0495686_0062520 | Ga0495686_0062520_930_2264 | 439 |
| 883 | 3300049568 | Ga0501031_0014510 | Ga0501031_0014510_3451_4776 | 439 |
| 884 | 3300049569 | Ga0501032_0008069 | Ga0501032_0008069_3451_4776 | 439 |
| 885 | 3300049570 | Ga0501033_0009070 | Ga0501033_0009070_3451_4776 | 439 |
| 886 | 3300049571 | Ga0501034_0000873 | Ga0501034_0000873_39610_40935 | 439 |
| 887 | 3300049571 | Ga0501034_0197976 | Ga0501034_0197976_407_1741 | 439 |
| 888 | 3300049572 | Ga0501036_0000159 | Ga0501036_0000159_3451_4776 | 439 |
| 889 | 3300049573 | Ga0501037_0018609 | Ga0501037_0018609_3439_4764 | 439 |
| 890 | 3300049574 | Ga0501038_0000262 | Ga0501038_0000262_39610_40935 | 439 |
| 891 | 3300049575 | Ga0501039_0008835 | Ga0501039_0008835_2898_4223 | 439 |
| 892 | 3300049576 | Ga0501040_0015223 | Ga0501040_0015223_3294_4619 | 439 |
| 893 | 3300049580 | Ga0501046_0082989 | Ga0501046_0082989_599_1933 | 439 |
| 894 | 3300049581 | Ga0501047_0004343 | Ga0501047_0004343_5361_6695 | 439 |
| 895 | 3300049581 | Ga0501047_0128590 | Ga0501047_0128590_826_2160 | 439 |
| 896 | 3300049583 | Ga0501067_0008599 | Ga0501067_0008599_3017_4351 | 439 |
| 897 | 3300049584 | Ga0501068_0003453 | Ga0501068_0003453_1855_3189 | 439 |
| 898 | 3300049586 | Ga0501070_0056901 | Ga0501070_0056901_1855_3180 | 439 |
| 899 | 3300049588 | Ga0501072_0024457 | Ga0501072_0024457_711_2045 | 439 |
| 900 | 3300049588 | Ga0501072_0073549 | Ga0501072_0073549_446_1780 | 439 |
| 901 | 3300049589 | Ga0501073_0003703 | Ga0501073_0003703_3474_4808 | 439 |
| 902 | 3300049589 | Ga0501073_0040875 | Ga0501073_0040875_645_1979 | 439 |
| 903 | 3300049590 | Ga0501074_0018196 | Ga0501074_0018196_1585_2919 | 439 |
| 904 | 3300049741 | Ga0501079_0171986 | Ga0501079_0171986_57_1391 | 439 |
| 905 | 3300049742 | Ga0501080_0007967 | Ga0501080_0007967_6662_7996 | 439 |
| 906 | 3300049742 | Ga0501080_0013039 | Ga0501080_0013039_4229_5563 | 439 |
| 907 | 3300049744 | Ga0501083_0043013 | Ga0501083_0043013_1681_3015 | 439 |
| 908 | 3300049822 | Ga0501035_0013126 | Ga0501035_0013126_3451_4776 | 439 |
| 909 | 3300049822 | Ga0501035_0263574 | Ga0501035_0263574_26_1360 | 439 |
| 910 | 3300049823 | Ga0501044_0001088 | Ga0501044_0001088_27636_28961 | 439 |
| 911 | 3300053096 | Ga0500641_0003709 | Ga0500641_0003709_213_1547 | 439 |
| 912 | 3300053119 | Ga0500595_000738 | Ga0500595_000738_623_1957 | 439 |
| 913 | 3300053130 | Ga0500642_0000868 | Ga0500642_0000868_604_1938 | 439 |
| 914 | 3300053139 | Ga0500568_0000019 | Ga0500568_0000019_42360_43682 | 439 |
| 915 | 3300053139 | Ga0500568_0032134 | Ga0500568_0032134_242_1576 | 439 |
| 916 | 3300053151 | Ga0500604_0012950 | Ga0500604_0012950_659_1993 | 439 |
| 917 | 3300053151 | Ga0500604_0018203 | Ga0500604_0018203_435_1769 | 439 |
| 918 | 3300053153 | Ga0500616_0005076 | Ga0500616_0005076_2187_3521 | 439 |
| 919 | 3300053158 | Ga0500627_0004191 | Ga0500627_0004191_2983_4305 | 439 |
| 920 | 3300060353 | Ga0501082_0008450 | Ga0501082_0008450_97_1431 | 439 |
| 921 | iso_pu_bacteria | 2937843397 | 2937845228 | 439 |
| 922 | 3300003214 | JGI25165J46597_1000219 | JGI25165J46597_100021985 | 440 |
| 923 | 3300003762 | Ga0055542_1001448 | Ga0055542_10014487 | 440 |
| 924 | 3300005331 | Ga0070670_100000668 | Ga0070670_10000066813 | 440 |
| 925 | 3300005331 | Ga0070670_100020520 | Ga0070670_1000205205 | 440 |
| 926 | 3300005331 | Ga0070670_100053262 | Ga0070670_1000532623 | 440 |
| 927 | 3300005334 | Ga0068869_100018208 | Ga0068869_1000182081 | 440 |
| 928 | 3300005339 | Ga0070660_100005052 | Ga0070660_1000050524 | 440 |
| 929 | 3300005344 | Ga0070661_100013058 | Ga0070661_1000130583 | 440 |
| 930 | 3300005347 | Ga0070668_100003690 | Ga0070668_1000036903 | 440 |
| 931 | 3300005347 | Ga0070668_100114564 | Ga0070668_1001145642 | 440 |
| 932 | 3300005354 | Ga0070675_100003065 | Ga0070675_1000030656 | 440 |
| 933 | 3300005354 | Ga0070675_100006887 | Ga0070675_1000068875 | 440 |
| 934 | 3300005355 | Ga0070671_100003942 | Ga0070671_10000394210 | 440 |
| 935 | 3300005355 | Ga0070671_100010180 | Ga0070671_1000101806 | 440 |
| 936 | 3300005364 | Ga0070673_100003475 | Ga0070673_1000034755 | 440 |
| 937 | 3300005364 | Ga0070673_100006227 | Ga0070673_1000062273 | 440 |
| 938 | 3300005364 | Ga0070673_100095403 | Ga0070673_1000954032 | 440 |
| 939 | 3300005366 | Ga0070659_100000244 | Ga0070659_10000024433 | 440 |
| 940 | 3300005366 | Ga0070659_100068038 | Ga0070659_1000680382 | 440 |
| 941 | 3300005367 | Ga0070667_100022980 | Ga0070667_1000229805 | 440 |
| 942 | 3300005455 | Ga0070663_100011344 | Ga0070663_1000113442 | 440 |
| 943 | 3300005456 | Ga0070678_100059065 | Ga0070678_1000590652 | 440 |
| 944 | 3300005457 | Ga0070662_100000091 | Ga0070662_1000000917 | 440 |
| 945 | 3300005459 | Ga0068867_100157928 | Ga0068867_1001579282 | 440 |
| 946 | 3300005466 | Ga0070685_10089620 | Ga0070685_100896201 | 440 |
| 947 | 3300005530 | Ga0070679_100044151 | Ga0070679_1000441512 | 440 |
| 948 | 3300005539 | Ga0068853_100001848 | Ga0068853_1000018486 | 440 |
| 949 | 3300005539 | Ga0068853_100031540 | Ga0068853_1000315406 | 440 |
| 950 | 3300005543 | Ga0070672_100001196 | Ga0070672_1000011966 | 440 |
| 951 | 3300005543 | Ga0070672_100107121 | Ga0070672_1001071212 | 440 |
| 952 | 3300005548 | Ga0070665_100130147 | Ga0070665_1001301472 | 440 |
| 953 | 3300005563 | Ga0068855_100000310 | Ga0068855_10000031045 | 440 |
| 954 | 3300005564 | Ga0070664_100000116 | Ga0070664_10000011620 | 440 |
| 955 | 3300005564 | Ga0070664_100037059 | Ga0070664_1000370592 | 440 |
| 956 | 3300005564 | Ga0070664_100166104 | Ga0070664_1001661042 | 440 |
| 957 | 3300005614 | Ga0068856_100077695 | Ga0068856_1000776953 | 440 |
| 958 | 3300005614 | Ga0068856_100081953 | Ga0068856_1000819534 | 440 |
| 959 | 3300005617 | Ga0068859_100198345 | Ga0068859_1001983451 | 440 |
| 960 | 3300005618 | Ga0068864_100018179 | Ga0068864_1000181795 | 440 |
| 961 | 3300005718 | Ga0068866_10049999 | Ga0068866_100499992 | 440 |
| 962 | 3300005719 | Ga0068861_100002478 | Ga0068861_10000247810 | 440 |
| 963 | 3300005841 | Ga0068863_100002482 | Ga0068863_1000024827 | 440 |
| 964 | 3300005841 | Ga0068863_100060273 | Ga0068863_1000602733 | 440 |
| 965 | 3300005843 | Ga0068860_100018543 | Ga0068860_1000185437 | 440 |
| 966 | 3300005843 | Ga0068860_100108737 | Ga0068860_1001087373 | 440 |
| 967 | 3300005844 | Ga0068862_100019100 | Ga0068862_1000191001 | 440 |
| 968 | 3300006038 | Ga0075365_10016399 | Ga0075365_100163994 | 440 |
| 969 | 3300006178 | Ga0075367_10148074 | Ga0075367_101480741 | 440 |
| 970 | 3300006353 | Ga0075370_10016387 | Ga0075370_100163871 | 440 |
| 971 | 3300006931 | Ga0097620_100198336 | Ga0097620_1001983361 | 440 |
| 972 | 3300009093 | Ga0105240_10016842 | Ga0105240_100168426 | 440 |
| 973 | 3300009098 | Ga0105245_10201186 | Ga0105245_102011862 | 440 |
| 974 | 3300009176 | Ga0105242_10021962 | Ga0105242_100219622 | 440 |
| 975 | 3300009177 | Ga0105248_10052380 | Ga0105248_100523804 | 440 |
| 976 | 3300009545 | Ga0105237_10043543 | Ga0105237_100435433 | 440 |
| 977 | 3300009551 | Ga0105238_10045842 | Ga0105238_100458424 | 440 |
| 978 | 3300009551 | Ga0105238_10199345 | Ga0105238_101993451 | 440 |
| 979 | 3300009553 | Ga0105249_10103831 | Ga0105249_101038312 | 440 |
| 980 | 3300013100 | Ga0157373_10000693 | Ga0157373_1000069327 | 440 |
| 981 | 3300013102 | Ga0157371_10001323 | Ga0157371_1000132311 | 440 |
| 982 | 3300013306 | Ga0163162_10040685 | Ga0163162_100406854 | 440 |
| 983 | 3300013306 | Ga0163162_10084688 | Ga0163162_100846883 | 440 |
| 984 | 3300013306 | Ga0163162_10115796 | Ga0163162_101157961 | 440 |
| 985 | 3300013307 | Ga0157372_10001853 | Ga0157372_100018537 | 440 |
| 986 | 3300013307 | Ga0157372_10222960 | Ga0157372_102229602 | 440 |
| 987 | 3300013308 | Ga0157375_10010879 | Ga0157375_100108796 | 440 |
| 988 | 3300013308 | Ga0157375_10013535 | Ga0157375_100135353 | 440 |
| 989 | 3300013308 | Ga0157375_10071698 | Ga0157375_100716983 | 440 |
| 990 | 3300014325 | Ga0163163_10051110 | Ga0163163_100511102 | 440 |
| 991 | 3300014326 | Ga0157380_10070934 | Ga0157380_100709342 | 440 |
| 992 | 3300014969 | Ga0157376_10028070 | Ga0157376_100280704 | 440 |
| 993 | 3300014969 | Ga0157376_10175185 | Ga0157376_101751852 | 440 |
| 994 | 3300015261 | Ga0182006_1020041 | Ga0182006_10200412 | 440 |
| 995 | 3300017792 | Ga0163161_10075274 | Ga0163161_100752742 | 440 |
| 996 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002829 | 440 |
| 997 | 3300025254 | Ga0209148_1000165 | Ga0209148_1000165142 | 440 |
| 998 | 3300025256 | Ga0209759_1000156 | Ga0209759_100015640 | 440 |
| 999 | 3300025261 | Ga0209233_1000258 | Ga0209233_100025886 | 440 |
| 1000 | 3300025272 | Ga0209455_1000143 | Ga0209455_10001434 | 440 |
| 1001 | 3300025906 | Ga0207699_10027727 | Ga0207699_100277271 | 440 |
| 1002 | 3300025912 | Ga0207707_10081742 | Ga0207707_100817422 | 440 |
| 1003 | 3300025913 | Ga0207695_10117359 | Ga0207695_101173591 | 440 |
| 1004 | 3300025919 | Ga0207657_10002338 | Ga0207657_1000233810 | 440 |
| 1005 | 3300025920 | Ga0207649_10004443 | Ga0207649_100044433 | 440 |
| 1006 | 3300025920 | Ga0207649_10069616 | Ga0207649_100696161 | 440 |
| 1007 | 3300025920 | Ga0207649_10131094 | Ga0207649_101310942 | 440 |
| 1008 | 3300025923 | Ga0207681_10175646 | Ga0207681_101756462 | 440 |
| 1009 | 3300025925 | Ga0207650_10050335 | Ga0207650_100503352 | 440 |
| 1010 | 3300025925 | Ga0207650_10059558 | Ga0207650_100595582 | 440 |
| 1011 | 3300025926 | Ga0207659_10002597 | Ga0207659_100025974 | 440 |
| 1012 | 3300025926 | Ga0207659_10145740 | Ga0207659_101457401 | 440 |
| 1013 | 3300025931 | Ga0207644_10011666 | Ga0207644_100116665 | 440 |
| 1014 | 3300025931 | Ga0207644_10069433 | Ga0207644_100694333 | 440 |
| 1015 | 3300025932 | Ga0207690_10000719 | Ga0207690_100007195 | 440 |
| 1016 | 3300025933 | Ga0207706_10000093 | Ga0207706_1000009361 | 440 |
| 1017 | 3300025933 | Ga0207706_10016532 | Ga0207706_100165323 | 440 |
| 1018 | 3300025940 | Ga0207691_10000646 | Ga0207691_1000064622 | 440 |
| 1019 | 3300025940 | Ga0207691_10152380 | Ga0207691_101523801 | 440 |
| 1020 | 3300025942 | Ga0207689_10003783 | Ga0207689_100037834 | 440 |
| 1021 | 3300025945 | Ga0207679_10000841 | Ga0207679_100008415 | 440 |
| 1022 | 3300025945 | Ga0207679_10028039 | Ga0207679_100280393 | 440 |
| 1023 | 3300025949 | Ga0207667_10001461 | Ga0207667_1000146121 | 440 |
| 1024 | 3300025960 | Ga0207651_10034483 | Ga0207651_100344833 | 440 |
| 1025 | 3300025960 | Ga0207651_10071061 | Ga0207651_100710612 | 440 |
| 1026 | 3300025972 | Ga0207668_10068254 | Ga0207668_100682542 | 440 |
| 1027 | 3300025981 | Ga0207640_10144072 | Ga0207640_101440721 | 440 |
| 1028 | 3300026023 | Ga0207677_10080268 | Ga0207677_100802682 | 440 |
| 1029 | 3300026041 | Ga0207639_10011614 | Ga0207639_100116142 | 440 |
| 1030 | 3300026041 | Ga0207639_10028163 | Ga0207639_100281634 | 440 |
| 1031 | 3300026041 | Ga0207639_10062122 | Ga0207639_100621222 | 440 |
| 1032 | 3300026067 | Ga0207678_10035621 | Ga0207678_100356212 | 440 |
| 1033 | 3300026075 | Ga0207708_10119516 | Ga0207708_101195162 | 440 |
| 1034 | 3300026078 | Ga0207702_10065797 | Ga0207702_100657972 | 440 |
| 1035 | 3300026088 | Ga0207641_10014253 | Ga0207641_100142533 | 440 |
| 1036 | 3300026088 | Ga0207641_10101909 | Ga0207641_101019092 | 440 |
| 1037 | 3300026089 | Ga0207648_10210092 | Ga0207648_102100921 | 440 |
| 1038 | 3300026095 | Ga0207676_10005255 | Ga0207676_100052557 | 440 |
| 1039 | 3300026095 | Ga0207676_10053410 | Ga0207676_100534103 | 440 |
| 1040 | 3300026095 | Ga0207676_10066982 | Ga0207676_100669823 | 440 |
| 1041 | 3300026118 | Ga0207675_100025292 | Ga0207675_1000252925 | 440 |
| 1042 | 3300026121 | Ga0207683_10135517 | Ga0207683_101355172 | 440 |
| 1043 | 3300028379 | Ga0268266_10067880 | Ga0268266_100678803 | 440 |
| 1044 | 3300028380 | Ga0268265_10098371 | Ga0268265_100983711 | 440 |
| 1045 | 3300028381 | Ga0268264_10053802 | Ga0268264_100538023 | 440 |
| 1046 | 3300028381 | Ga0268264_10161717 | Ga0268264_101617171 | 440 |
| 1047 | 3300031852 | Ga0307410_10027439 | Ga0307410_100274393 | 440 |
| 1048 | 3300031901 | Ga0307406_10021641 | Ga0307406_100216412 | 440 |
| 1049 | 3300031903 | Ga0307407_10016459 | Ga0307407_100164592 | 440 |
| 1050 | 3300031911 | Ga0307412_10056432 | Ga0307412_100564321 | 440 |
| 1051 | 3300032002 | Ga0307416_100020419 | Ga0307416_1000204195 | 440 |
| 1052 | 3300032126 | Ga0307415_100038108 | Ga0307415_1000381082 | 440 |
| 1053 | 3300037418 | Ga0395900_0019483 | Ga0395900_0019483_2790_4118 | 440 |
| 1054 | 3300037418 | Ga0395900_0040659 | Ga0395900_0040659_497_1825 | 440 |
| 1055 | 3300038443 | Ga0395901_0020801 | Ga0395901_0020801_105_1433 | 440 |
| 1056 | 3300038443 | Ga0395901_0031362 | Ga0395901_0031362_2750_4078 | 440 |
| 1057 | 3300048904 | Ga0496101_0015675 | Ga0496101_0015675_130_1467 | 440 |
| 1058 | 3300048905 | Ga0496102_0028747 | Ga0496102_0028747_663_2000 | 440 |
| 1059 | 3300048909 | Ga0496106_0000759 | Ga0496106_0000759_15472_16809 | 440 |
| 1060 | 3300048910 | Ga0496107_0000490 | Ga0496107_0000490_17392_18729 | 440 |
| 1061 | 3300048912 | Ga0496109_0103881 | Ga0496109_0103881_1095_2423 | 440 |
| 1062 | 3300048915 | Ga0496112_0003779 | Ga0496112_0003779_2065_3402 | 440 |
| 1063 | 3300048915 | Ga0496112_0015983 | Ga0496112_0015983_329_1678 | 440 |
| 1064 | 3300048922 | Ga0496119_0039372 | Ga0496119_0039372_1057_2385 | 440 |
| 1065 | 3300048923 | Ga0496120_0001687 | Ga0496120_0001687_22445_23773 | 440 |
| 1066 | 3300048923 | Ga0496120_0069628 | Ga0496120_0069628_558_1895 | 440 |
| 1067 | 3300048924 | Ga0496121_0123526 | Ga0496121_0123526_54_1391 | 440 |
| 1068 | 3300048925 | Ga0496122_0001710 | Ga0496122_0001710_1356_2690 | 440 |
| 1069 | 3300048927 | Ga0496124_0144699 | Ga0496124_0144699_306_1634 | 440 |
| 1070 | 3300049571 | Ga0501034_0000475 | Ga0501034_0000475_47341_48669 | 440 |
| 1071 | 3300050490 | nmdc:mga03n38_29553_c1 | nmdc:mga03n38_29553_c1_690_2075 | 440 |
| 1072 | 3300050492 | nmdc:mga0yw44_22796_c1 | nmdc:mga0yw44_22796_c1_61_1446 | 440 |
| 1073 | 3300050492 | nmdc:mga0yw44_38866_c1 | nmdc:mga0yw44_38866_c1_1113_2441 | 440 |
| 1074 | iso_pu_bacteria | 2509276022 | 2509395343 | 440 |
| 1075 | iso_pu_bacteria | 2597489875 | 2597811219 | 440 |
| 1076 | iso_pu_bacteria | 2888343758 | 2888346261 | 440 |
| 1077 | iso_pu_bacteria | 2977971508 | 2977975413 | 440 |
| 1078 | iso_pu_bacteria | 8004395343 | 8004399009 | 440 |
| 1079 | 3300003756 | Ga0055533_1000947 | Ga0055533_10009474 | 441 |
| 1080 | 3300003758 | Ga0055532_1000220 | Ga0055532_100022022 | 441 |
| 1081 | 3300003760 | Ga0055527_1000173 | Ga0055527_100017323 | 441 |
| 1082 | 3300003761 | Ga0055535_1000360 | Ga0055535_100036023 | 441 |
| 1083 | 3300003762 | Ga0055542_1001730 | Ga0055542_10017301 | 441 |
| 1084 | 3300003763 | Ga0055529_1001879 | Ga0055529_10018793 | 441 |
| 1085 | 3300005329 | Ga0070683_100014390 | Ga0070683_1000143903 | 441 |
| 1086 | 3300005336 | Ga0070680_100181603 | Ga0070680_1001816032 | 441 |
| 1087 | 3300005344 | Ga0070661_100000805 | Ga0070661_10000080520 | 441 |
| 1088 | 3300005366 | Ga0070659_100001492 | Ga0070659_1000014928 | 441 |
| 1089 | 3300005435 | Ga0070714_100007403 | Ga0070714_1000074035 | 441 |
| 1090 | 3300005436 | Ga0070713_100033297 | Ga0070713_1000332974 | 441 |
| 1091 | 3300005535 | Ga0070684_100026823 | Ga0070684_1000268233 | 441 |
| 1092 | 3300005539 | Ga0068853_100048415 | Ga0068853_1000484152 | 441 |
| 1093 | 3300005563 | Ga0068855_100001384 | Ga0068855_10000138413 | 441 |
| 1094 | 3300005564 | Ga0070664_100000463 | Ga0070664_1000004633 | 441 |
| 1095 | 3300005577 | Ga0068857_100001049 | Ga0068857_10000104910 | 441 |
| 1096 | 3300005578 | Ga0068854_100007622 | Ga0068854_1000076225 | 441 |
| 1097 | 3300005614 | Ga0068856_100001465 | Ga0068856_10000146521 | 441 |
| 1098 | 3300005616 | Ga0068852_100000730 | Ga0068852_1000007306 | 441 |
| 1099 | 3300005834 | Ga0068851_10019646 | Ga0068851_100196462 | 441 |
| 1100 | 3300009093 | Ga0105240_10003226 | Ga0105240_100032268 | 441 |
| 1101 | 3300009551 | Ga0105238_10001144 | Ga0105238_1000114412 | 441 |
| 1102 | 3300013100 | Ga0157373_10114254 | Ga0157373_101142542 | 441 |
| 1103 | 3300013104 | Ga0157370_10033003 | Ga0157370_100330034 | 441 |
| 1104 | 3300013105 | Ga0157369_10012421 | Ga0157369_100124213 | 441 |
| 1105 | 3300013296 | Ga0157374_10005410 | Ga0157374_100054102 | 441 |
| 1106 | 3300013296 | Ga0157374_10163668 | Ga0157374_101636682 | 441 |
| 1107 | 3300013307 | Ga0157372_10001544 | Ga0157372_1000154411 | 441 |
| 1108 | 3300025226 | Ga0209674_100130 | Ga0209674_10013084 | 441 |
| 1109 | 3300025228 | Ga0209672_100225 | Ga0209672_10022523 | 441 |
| 1110 | 3300025229 | Ga0209147_100283 | Ga0209147_10028323 | 441 |
| 1111 | 3300025242 | Ga0209258_100467 | Ga0209258_10046723 | 441 |
| 1112 | 3300025254 | Ga0209148_1000460 | Ga0209148_100046023 | 441 |
| 1113 | 3300025272 | Ga0209455_1000365 | Ga0209455_100036523 | 441 |
| 1114 | 3300025912 | Ga0207707_10035378 | Ga0207707_100353783 | 441 |
| 1115 | 3300025917 | Ga0207660_10145513 | Ga0207660_101455132 | 441 |
| 1116 | 3300025919 | Ga0207657_10010187 | Ga0207657_100101877 | 441 |
| 1117 | 3300025920 | Ga0207649_10006979 | Ga0207649_100069796 | 441 |
| 1118 | 3300025921 | Ga0207652_10190883 | Ga0207652_101908832 | 441 |
| 1119 | 3300025924 | Ga0207694_10007102 | Ga0207694_100071024 | 441 |
| 1120 | 3300025928 | Ga0207700_10161393 | Ga0207700_101613932 | 441 |
| 1121 | 3300025929 | Ga0207664_10066458 | Ga0207664_100664583 | 441 |
| 1122 | 3300025932 | Ga0207690_10173577 | Ga0207690_101735771 | 441 |
| 1123 | 3300025944 | Ga0207661_10075423 | Ga0207661_100754232 | 441 |
| 1124 | 3300025945 | Ga0207679_10005872 | Ga0207679_100058727 | 441 |
| 1125 | 3300025949 | Ga0207667_10045520 | Ga0207667_100455203 | 441 |
| 1126 | 3300026078 | Ga0207702_10006174 | Ga0207702_100061743 | 441 |
| 1127 | 3300026116 | Ga0207674_10002105 | Ga0207674_100021058 | 441 |
| 1128 | 3300026142 | Ga0207698_10001255 | Ga0207698_100012556 | 441 |
| 1129 | 3300035170 | Ga0373943_0058448 | Ga0373943_0058448_88_1431 | 441 |
| 1130 | 3300039437 | Ga0436365_0344984 | Ga0436365_0344984_6570_8129 | 441 |
| 1131 | 3300044765 | Ga0466970_0001042 | Ga0466970_0001042_7583_8953 | 441 |
| 1132 | 3300046543 | Ga0495645_0065986 | Ga0495645_0065986_180_1523 | 441 |
| 1133 | 3300046678 | Ga0495599_0054732 | Ga0495599_0054732_950_2293 | 441 |
| 1134 | 3300048910 | Ga0496107_0101813 | Ga0496107_0101813_728_2071 | 441 |
| 1135 | 3300048913 | Ga0496110_0038670 | Ga0496110_0038670_1859_3202 | 441 |
| 1136 | iso_pu_bacteria | 2977864932 | 2977865348 | 441 |
| 1137 | iso_pu_bacteria | 2996310559 | 2996312868 | 441 |
| 1138 | 3300003203 | JGI25406J46586_10006582 | JGI25406J46586_100065823 | 442 |
| 1139 | 3300003771 | Ga0055526_1000065 | Ga0055526_100006580 | 442 |
| 1140 | 3300003775 | Ga0055524_1000058 | Ga0055524_100005812 | 442 |
| 1141 | 3300005262 | Ga0065165_1000384 | Ga0065165_100038438 | 442 |
| 1142 | 3300005985 | Ga0081539_10000646 | Ga0081539_1000064634 | 442 |
| 1143 | 3300009177 | Ga0105248_10016381 | Ga0105248_100163814 | 442 |
| 1144 | 3300013102 | Ga0157371_10018740 | Ga0157371_100187402 | 442 |
| 1145 | 3300013104 | Ga0157370_10077232 | Ga0157370_100772322 | 442 |
| 1146 | 3300013105 | Ga0157369_10000383 | Ga0157369_1000038334 | 442 |
| 1147 | 3300021384 | Ga0213876_10001071 | Ga0213876_100010714 | 442 |
| 1148 | 3300025284 | Ga0209130_1000393 | Ga0209130_100039351 | 442 |
| 1149 | 3300025291 | Ga0209675_1001542 | Ga0209675_10015426 | 442 |
| 1150 | 3300025295 | Ga0209564_1000197 | Ga0209564_1000197111 | 442 |
| 1151 | 3300025299 | Ga0209256_1000159 | Ga0209256_1000159111 | 442 |
| 1152 | 3300025302 | Ga0207426_1016931 | Ga0207426_10169313 | 442 |
| 1153 | 3300025941 | Ga0207711_10009353 | Ga0207711_100093534 | 442 |
| 1154 | 3300031901 | Ga0307406_10022479 | Ga0307406_100224793 | 442 |
| 1155 | 3300037418 | Ga0395900_0005117 | Ga0395900_0005117_1878_3209 | 442 |
| 1156 | 3300037418 | Ga0395900_0094090 | Ga0395900_0094090_1384_2715 | 442 |
| 1157 | 3300037466 | Ga0395898_0000254 | Ga0395898_0000254_66855_68186 | 442 |
| 1158 | 3300037853 | Ga0436364_0667648 | Ga0436364_0667648_1358_2725 | 442 |
| 1159 | 3300038443 | Ga0395901_0000095 | Ga0395901_0000095_110437_111768 | 442 |
| 1160 | 3300038443 | Ga0395901_0026852 | Ga0395901_0026852_2327_3658 | 442 |
| 1161 | 3300039062 | Ga0400483_093081 | Ga0400483_093081_630_2015 | 442 |
| 1162 | 3300039437 | Ga0436365_0625375 | Ga0436365_0625375_12508_13869 | 442 |
| 1163 | 3300039453 | Ga0436362_0505409 | Ga0436362_0505409_277_1644 | 442 |
| 1164 | 3300044656 | Ga0466969_0001253 | Ga0466969_0001253_3927_5258 | 442 |
| 1165 | 3300044656 | Ga0466969_0013222 | Ga0466969_0013222_2036_3367 | 442 |
| 1166 | 3300044658 | Ga0466972_0012437 | Ga0466972_0012437_2696_4027 | 442 |
| 1167 | 3300044683 | Ga0466965_0000665 | Ga0466965_0000665_8292_9623 | 442 |
| 1168 | 3300044684 | Ga0466966_0000107 | Ga0466966_0000107_15178_16509 | 442 |
| 1169 | 3300044684 | Ga0466966_0000309 | Ga0466966_0000309_10839_12170 | 442 |
| 1170 | 3300044684 | Ga0466966_0003129 | Ga0466966_0003129_5618_6949 | 442 |
| 1171 | 3300044693 | Ga0466961_0000068 | Ga0466961_0000068_14326_15657 | 442 |
| 1172 | 3300044693 | Ga0466961_0001012 | Ga0466961_0001012_8511_9842 | 442 |
| 1173 | 3300044693 | Ga0466961_0051677 | Ga0466961_0051677_191_1522 | 442 |
| 1174 | 3300044694 | Ga0466963_0003296 | Ga0466963_0003296_803_2134 | 442 |
| 1175 | 3300044694 | Ga0466963_0015643 | Ga0466963_0015643_2951_4282 | 442 |
| 1176 | 3300044706 | Ga0466964_0019698 | Ga0466964_0019698_1017_2348 | 442 |
| 1177 | 3300044719 | Ga0466971_0001111 | Ga0466971_0001111_7492_8823 | 442 |
| 1178 | 3300044765 | Ga0466970_0001083 | Ga0466970_0001083_3445_4776 | 442 |
| 1179 | 3300044842 | Ga0466957_0001559 | Ga0466957_0001559_3870_5201 | 442 |
| 1180 | 3300044842 | Ga0466957_0009634 | Ga0466957_0009634_277_1608 | 442 |
| 1181 | 3300044842 | Ga0466957_0084073 | Ga0466957_0084073_44_1375 | 442 |
| 1182 | 3300045049 | Ga0466959_0001053 | Ga0466959_0001053_4257_5588 | 442 |
| 1183 | 3300045836 | Ga0466958_0000689 | Ga0466958_0000689_2929_4260 | 442 |
| 1184 | 3300048909 | Ga0496106_0000060 | Ga0496106_0000060_55839_57176 | 442 |
| 1185 | 3300048919 | Ga0496116_0024425 | Ga0496116_0024425_1217_2548 | 442 |
| 1186 | 3300048921 | Ga0496118_0020548 | Ga0496118_0020548_600_2012 | 442 |
| 1187 | 3300048921 | Ga0496118_0023118 | Ga0496118_0023118_3686_5017 | 442 |
| 1188 | 3300048924 | Ga0496121_0000102 | Ga0496121_0000102_55292_56629 | 442 |
| 1189 | 3300048925 | Ga0496122_0005877 | Ga0496122_0005877_1906_3267 | 442 |
| 1190 | 3300048926 | Ga0496123_0003513 | Ga0496123_0003513_4995_6356 | 442 |
| 1191 | 3300048929 | Ga0496126_0140254 | Ga0496126_0140254_341_1708 | 442 |
| 1192 | 3300061719 | Ga0466962_0001601 | Ga0466962_0001601_5102_6433 | 442 |
| 1193 | 3300061719 | Ga0466962_0001884 | Ga0466962_0001884_5715_7046 | 442 |
| 1194 | iso_pu_bacteria | 2599185301 | 2599940607 | 442 |
| 1195 | iso_pu_bacteria | 2693429783 | 2694629185 | 442 |
| 1196 | iso_pu_bacteria | 2693429784 | 2694636901 | 442 |
| 1197 | iso_pu_bacteria | 2847686936 | 2847691788 | 442 |
| 1198 | iso_pu_bacteria | 2856364286 | 2856365901 | 442 |
| 1199 | iso_pu_bacteria | 2857349434 | 2857353682 | 442 |
| 1200 | iso_pu_bacteria | 2869285874 | 2869286788 | 442 |
| 1201 | iso_pu_bacteria | 2871429161 | 2871434052 | 442 |
| 1202 | iso_pu_bacteria | 2871444079 | 2871445033 | 442 |
| 1203 | iso_pu_bacteria | 2874102143 | 2874104633 | 442 |
| 1204 | iso_pu_bacteria | 2874146452 | 2874147710 | 442 |
| 1205 | iso_pu_bacteria | 2874155637 | 2874156628 | 442 |
| 1206 | iso_pu_bacteria | 2876369609 | 2876374242 | 442 |
| 1207 | iso_pu_bacteria | 2876377896 | 2876384632 | 442 |
| 1208 | iso_pu_bacteria | 2876413966 | 2876414798 | 442 |
| 1209 | iso_pu_bacteria | 2878745973 | 2878746762 | 442 |
| 1210 | iso_pu_bacteria | 2885305155 | 2885308789 | 442 |
| 1211 | iso_pu_bacteria | 2885326080 | 2885333446 | 442 |
| 1212 | iso_pu_bacteria | 2885334103 | 2885335969 | 442 |
| 1213 | iso_pu_bacteria | 2889016732 | 2889021489 | 442 |
| 1214 | iso_pu_bacteria | 2903492973 | 2903498205 | 442 |
| 1215 | iso_pu_bacteria | 2906308376 | 2906309142 | 442 |
| 1216 | iso_pu_bacteria | 2906321335 | 2906326749 | 442 |
| 1217 | iso_pu_bacteria | 2906328253 | 2906328708 | 442 |
| 1218 | iso_pu_bacteria | 2906354277 | 2906359083 | 442 |
| 1219 | iso_pu_bacteria | 2922130491 | 2922134623 | 442 |
| 1220 | iso_pu_bacteria | 2922158528 | 2922160766 | 442 |
| 1221 | iso_pu_bacteria | 2922185730 | 2922192433 | 442 |
| 1222 | iso_pu_bacteria | 2924726620 | 2924728598 | 442 |
| 1223 | iso_pu_bacteria | 2937813078 | 2937813999 | 442 |
| 1224 | iso_pu_bacteria | 2937891427 | 2937893592 | 442 |
| 1225 | iso_pu_bacteria | 2938014810 | 2938018605 | 442 |
| 1226 | iso_pu_bacteria | 2958041894 | 2958049283 | 442 |
| 1227 | iso_pu_bacteria | 2958100919 | 2958101530 | 442 |
| 1228 | iso_pu_bacteria | 2958115193 | 2958121424 | 442 |
| 1229 | iso_pu_bacteria | 2958130278 | 2958131192 | 442 |
| 1230 | iso_pu_bacteria | 2958172287 | 2958172960 | 442 |
| 1231 | iso_pu_bacteria | 2958179912 | 2958180591 | 442 |
| 1232 | iso_pu_bacteria | 2961077736 | 2961078425 | 442 |
| 1233 | iso_pu_bacteria | 2965062239 | 2965063912 | 442 |
| 1234 | iso_pu_bacteria | 2968091066 | 2968095244 | 442 |
| 1235 | iso_pu_bacteria | 2968097103 | 2968101214 | 442 |
| 1236 | iso_pu_bacteria | 2968117919 | 2968120239 | 442 |
| 1237 | iso_pu_bacteria | 2968128360 | 2968128637 | 442 |
| 1238 | iso_pu_bacteria | 2977843712 | 2977845298 | 442 |
| 1239 | iso_pu_bacteria | 2977858184 | 2977862272 | 442 |
| 1240 | iso_pu_bacteria | 2977942078 | 2977949875 | 442 |
| 1241 | iso_pu_bacteria | 2977971508 | 2977978060 | 442 |
| 1242 | iso_pu_bacteria | 2979710463 | 2979717228 | 442 |
| 1243 | iso_pu_bacteria | 2979779861 | 2979780505 | 442 |
| 1244 | iso_pu_bacteria | 2987636660 | 2987642905 | 442 |
| 1245 | iso_pu_bacteria | 2987652177 | 2987658529 | 442 |
| 1246 | iso_pu_bacteria | 2996341866 | 2996348014 | 442 |
| 1247 | iso_pu_bacteria | 3004203850 | 3004210698 | 442 |
| 1248 | iso_pu_bacteria | 8004387939 | 8004388072 | 442 |
| 1249 | iso_pu_bacteria | 8004445564 | 8004446263 | 442 |
| 1250 | iso_pu_bacteria | 8004703790 | 8004713157 | 442 |
| 1251 | iso_pu_bacteria | 8004714634 | 8004715399 | 442 |
| 1252 | 3300009982 | Ga0105147_101143 | Ga0105147_1011432 | 443 |
| 1253 | 3300025261 | Ga0209233_1000047 | Ga0209233_1000047326 | 443 |
| 1254 | 3300049586 | Ga0501070_0097706 | Ga0501070_0097706_199_1545 | 443 |
| 1255 | 3300049822 | Ga0501035_0056671 | Ga0501035_0056671_1339_2685 | 443 |
| 1256 | 3300005614 | Ga0068856_100101391 | Ga0068856_1001013912 | 444 |
| 1257 | 3300009545 | Ga0105237_10161251 | Ga0105237_101612511 | 444 |
| 1258 | 3300025297 | Ga0209758_1006672 | Ga0209758_10066724 | 444 |
| 1259 | 3300037471 | Ga0395905_0012419 | Ga0395905_0012419_2084_3418 | 444 |
| 1260 | 3300048920 | Ga0496117_0017509 | Ga0496117_0017509_1552_2895 | 444 |
| 1261 | 3300048929 | Ga0496126_0000400 | Ga0496126_0000400_59933_61276 | 444 |
| 1262 | 3300002705 | JGI25156J39149_1004893 | JGI25156J39149_10048932 | 446 |
| 1263 | 3300002741 | JGI25157J39369_1000725 | JGI25157J39369_10007252 | 446 |
| 1264 | 3300005328 | Ga0070676_10073131 | Ga0070676_100731312 | 446 |
| 1265 | 3300005329 | Ga0070683_100047346 | Ga0070683_1000473462 | 446 |
| 1266 | 3300005330 | Ga0070690_100019376 | Ga0070690_1000193763 | 446 |
| 1267 | 3300005331 | Ga0070670_100002946 | Ga0070670_1000029463 | 446 |
| 1268 | 3300005334 | Ga0068869_100006892 | Ga0068869_1000068924 | 446 |
| 1269 | 3300005334 | Ga0068869_100116859 | Ga0068869_1001168592 | 446 |
| 1270 | 3300005335 | Ga0070666_10007302 | Ga0070666_100073022 | 446 |
| 1271 | 3300005335 | Ga0070666_10014351 | Ga0070666_100143513 | 446 |
| 1272 | 3300005338 | Ga0068868_100016709 | Ga0068868_1000167093 | 446 |
| 1273 | 3300005338 | Ga0068868_100024514 | Ga0068868_1000245142 | 446 |
| 1274 | 3300005338 | Ga0068868_100063418 | Ga0068868_1000634182 | 446 |
| 1275 | 3300005340 | Ga0070689_100035473 | Ga0070689_1000354733 | 446 |
| 1276 | 3300005347 | Ga0070668_100032042 | Ga0070668_1000320422 | 446 |
| 1277 | 3300005355 | Ga0070671_100015873 | Ga0070671_1000158734 | 446 |
| 1278 | 3300005364 | Ga0070673_100003212 | Ga0070673_1000032122 | 446 |
| 1279 | 3300005364 | Ga0070673_100027283 | Ga0070673_1000272833 | 446 |
| 1280 | 3300005365 | Ga0070688_100009915 | Ga0070688_1000099154 | 446 |
| 1281 | 3300005367 | Ga0070667_100005826 | Ga0070667_1000058263 | 446 |
| 1282 | 3300005367 | Ga0070667_100031165 | Ga0070667_1000311652 | 446 |
| 1283 | 3300005367 | Ga0070667_100085354 | Ga0070667_1000853542 | 446 |
| 1284 | 3300005434 | Ga0070709_10011270 | Ga0070709_100112702 | 446 |
| 1285 | 3300005435 | Ga0070714_100062106 | Ga0070714_1000621062 | 446 |
| 1286 | 3300005436 | Ga0070713_100002027 | Ga0070713_10000202712 | 446 |
| 1287 | 3300005439 | Ga0070711_100000713 | Ga0070711_1000007138 | 446 |
| 1288 | 3300005440 | Ga0070705_100020514 | Ga0070705_1000205142 | 446 |
| 1289 | 3300005444 | Ga0070694_100021211 | Ga0070694_1000212111 | 446 |
| 1290 | 3300005456 | Ga0070678_100010805 | Ga0070678_1000108054 | 446 |
| 1291 | 3300005457 | Ga0070662_100015098 | Ga0070662_1000150983 | 446 |
| 1292 | 3300005466 | Ga0070685_10013266 | Ga0070685_100132663 | 446 |
| 1293 | 3300005467 | Ga0070706_100047499 | Ga0070706_1000474992 | 446 |
| 1294 | 3300005468 | Ga0070707_100022437 | Ga0070707_1000224373 | 446 |
| 1295 | 3300005539 | Ga0068853_100088048 | Ga0068853_1000880482 | 446 |
| 1296 | 3300005544 | Ga0070686_100003766 | Ga0070686_1000037664 | 446 |
| 1297 | 3300005547 | Ga0070693_100002360 | Ga0070693_1000023608 | 446 |
| 1298 | 3300005548 | Ga0070665_100001730 | Ga0070665_10000173014 | 446 |
| 1299 | 3300005549 | Ga0070704_100039503 | Ga0070704_1000395033 | 446 |
| 1300 | 3300005577 | Ga0068857_100003640 | Ga0068857_1000036405 | 446 |
| 1301 | 3300005578 | Ga0068854_100009688 | Ga0068854_1000096883 | 446 |
| 1302 | 3300005615 | Ga0070702_100009038 | Ga0070702_1000090381 | 446 |
| 1303 | 3300005615 | Ga0070702_100017853 | Ga0070702_1000178532 | 446 |
| 1304 | 3300005617 | Ga0068859_100001046 | Ga0068859_10000104618 | 446 |
| 1305 | 3300005617 | Ga0068859_100008936 | Ga0068859_1000089369 | 446 |
| 1306 | 3300005618 | Ga0068864_100003022 | Ga0068864_1000030224 | 446 |
| 1307 | 3300005618 | Ga0068864_100005142 | Ga0068864_1000051422 | 446 |
| 1308 | 3300005719 | Ga0068861_100024828 | Ga0068861_1000248281 | 446 |
| 1309 | 3300005834 | Ga0068851_10068128 | Ga0068851_100681282 | 446 |
| 1310 | 3300005840 | Ga0068870_10008506 | Ga0068870_100085063 | 446 |
| 1311 | 3300005842 | Ga0068858_100001816 | Ga0068858_1000018168 | 446 |
| 1312 | 3300005842 | Ga0068858_100007123 | Ga0068858_1000071237 | 446 |
| 1313 | 3300005843 | Ga0068860_100023458 | Ga0068860_1000234583 | 446 |
| 1314 | 3300005843 | Ga0068860_100025648 | Ga0068860_1000256484 | 446 |
| 1315 | 3300005843 | Ga0068860_100038314 | Ga0068860_1000383144 | 446 |
| 1316 | 3300006175 | Ga0070712_100001191 | Ga0070712_10000119113 | 446 |
| 1317 | 3300006175 | Ga0070712_100066548 | Ga0070712_1000665482 | 446 |
| 1318 | 3300006237 | Ga0097621_100021138 | Ga0097621_1000211382 | 446 |
| 1319 | 3300006358 | Ga0068871_100015024 | Ga0068871_1000150243 | 446 |
| 1320 | 3300006358 | Ga0068871_100100015 | Ga0068871_1001000151 | 446 |
| 1321 | 3300006881 | Ga0068865_100020658 | Ga0068865_1000206584 | 446 |
| 1322 | 3300006931 | Ga0097620_100001046 | Ga0097620_10000104618 | 446 |
| 1323 | 3300006931 | Ga0097620_100008936 | Ga0097620_1000089369 | 446 |
| 1324 | 3300009098 | Ga0105245_10024593 | Ga0105245_100245935 | 446 |
| 1325 | 3300009098 | Ga0105245_10069375 | Ga0105245_100693753 | 446 |
| 1326 | 3300009101 | Ga0105247_10029551 | Ga0105247_100295513 | 446 |
| 1327 | 3300009176 | Ga0105242_10074880 | Ga0105242_100748802 | 446 |
| 1328 | 3300009177 | Ga0105248_10006667 | Ga0105248_100066678 | 446 |
| 1329 | 3300009545 | Ga0105237_10011201 | Ga0105237_100112015 | 446 |
| 1330 | 3300011119 | Ga0105246_10025696 | Ga0105246_100256962 | 446 |
| 1331 | 3300011119 | Ga0105246_10032896 | Ga0105246_100328962 | 446 |
| 1332 | 3300013102 | Ga0157371_10024324 | Ga0157371_100243242 | 446 |
| 1333 | 3300013297 | Ga0157378_10048083 | Ga0157378_100480832 | 446 |
| 1334 | 3300013306 | Ga0163162_10030510 | Ga0163162_100305105 | 446 |
| 1335 | 3300014325 | Ga0163163_10005125 | Ga0163163_100051253 | 446 |
| 1336 | 3300014325 | Ga0163163_10097029 | Ga0163163_100970291 | 446 |
| 1337 | 3300014968 | Ga0157379_10002363 | Ga0157379_1000236311 | 446 |
| 1338 | 3300014968 | Ga0157379_10015544 | Ga0157379_100155443 | 446 |
| 1339 | 3300014969 | Ga0157376_10023919 | Ga0157376_100239195 | 446 |
| 1340 | 3300025250 | Ga0209026_1000116 | Ga0209026_100011685 | 446 |
| 1341 | 3300025256 | Ga0209759_1000153 | Ga0209759_100015339 | 446 |
| 1342 | 3300025899 | Ga0207642_10002916 | Ga0207642_100029162 | 446 |
| 1343 | 3300025903 | Ga0207680_10003490 | Ga0207680_100034906 | 446 |
| 1344 | 3300025903 | Ga0207680_10023934 | Ga0207680_100239343 | 446 |
| 1345 | 3300025907 | Ga0207645_10020503 | Ga0207645_100205033 | 446 |
| 1346 | 3300025915 | Ga0207693_10000459 | Ga0207693_1000045928 | 446 |
| 1347 | 3300025915 | Ga0207693_10042011 | Ga0207693_100420113 | 446 |
| 1348 | 3300025916 | Ga0207663_10001764 | Ga0207663_100017644 | 446 |
| 1349 | 3300025918 | Ga0207662_10008462 | Ga0207662_100084623 | 446 |
| 1350 | 3300025919 | Ga0207657_10002480 | Ga0207657_100024803 | 446 |
| 1351 | 3300025920 | Ga0207649_10046621 | Ga0207649_100466212 | 446 |
| 1352 | 3300025921 | Ga0207652_10028379 | Ga0207652_100283793 | 446 |
| 1353 | 3300025925 | Ga0207650_10013390 | Ga0207650_100133904 | 446 |
| 1354 | 3300025927 | Ga0207687_10003000 | Ga0207687_100030003 | 446 |
| 1355 | 3300025927 | Ga0207687_10015981 | Ga0207687_100159812 | 446 |
| 1356 | 3300025928 | Ga0207700_10004901 | Ga0207700_100049012 | 446 |
| 1357 | 3300025928 | Ga0207700_10044413 | Ga0207700_100444132 | 446 |
| 1358 | 3300025929 | Ga0207664_10000761 | Ga0207664_1000076118 | 446 |
| 1359 | 3300025933 | Ga0207706_10071786 | Ga0207706_100717862 | 446 |
| 1360 | 3300025934 | Ga0207686_10002984 | Ga0207686_100029843 | 446 |
| 1361 | 3300025934 | Ga0207686_10027885 | Ga0207686_100278853 | 446 |
| 1362 | 3300025936 | Ga0207670_10018933 | Ga0207670_100189333 | 446 |
| 1363 | 3300025936 | Ga0207670_10060853 | Ga0207670_100608532 | 446 |
| 1364 | 3300025941 | Ga0207711_10000626 | Ga0207711_1000062637 | 446 |
| 1365 | 3300025941 | Ga0207711_10004393 | Ga0207711_100043933 | 446 |
| 1366 | 3300025941 | Ga0207711_10140254 | Ga0207711_101402542 | 446 |
| 1367 | 3300025942 | Ga0207689_10002893 | Ga0207689_100028933 | 446 |
| 1368 | 3300025960 | Ga0207651_10000481 | Ga0207651_100004819 | 446 |
| 1369 | 3300025960 | Ga0207651_10030620 | Ga0207651_100306203 | 446 |
| 1370 | 3300025972 | Ga0207668_10022902 | Ga0207668_100229023 | 446 |
| 1371 | 3300025986 | Ga0207658_10008591 | Ga0207658_100085914 | 446 |
| 1372 | 3300025986 | Ga0207658_10021254 | Ga0207658_100212544 | 446 |
| 1373 | 3300025986 | Ga0207658_10085436 | Ga0207658_100854362 | 446 |
| 1374 | 3300026023 | Ga0207677_10000359 | Ga0207677_1000035910 | 446 |
| 1375 | 3300026023 | Ga0207677_10006888 | Ga0207677_100068884 | 446 |
| 1376 | 3300026023 | Ga0207677_10045142 | Ga0207677_100451422 | 446 |
| 1377 | 3300026035 | Ga0207703_10000552 | Ga0207703_1000055211 | 446 |
| 1378 | 3300026035 | Ga0207703_10000739 | Ga0207703_1000073926 | 446 |
| 1379 | 3300026089 | Ga0207648_10006217 | Ga0207648_100062178 | 446 |
| 1380 | 3300026095 | Ga0207676_10001145 | Ga0207676_1000114512 | 446 |
| 1381 | 3300026095 | Ga0207676_10006255 | Ga0207676_100062555 | 446 |
| 1382 | 3300026116 | Ga0207674_10002729 | Ga0207674_100027292 | 446 |
| 1383 | 3300026116 | Ga0207674_10021953 | Ga0207674_100219533 | 446 |
| 1384 | 3300026118 | Ga0207675_100002730 | Ga0207675_10000273012 | 446 |
| 1385 | 3300026121 | Ga0207683_10002860 | Ga0207683_1000286010 | 446 |
| 1386 | 3300028380 | Ga0268265_10016646 | Ga0268265_100166463 | 446 |
| 1387 | 3300028381 | Ga0268264_10002815 | Ga0268264_1000281510 | 446 |
| 1388 | 3300028381 | Ga0268264_10022582 | Ga0268264_100225824 | 446 |
| 1389 | 3300035086 | Ga0373934_0014977 | Ga0373934_0014977_1156_2514 | 446 |
| 1390 | 3300035111 | Ga0373923_0009060 | Ga0373923_0009060_1261_2619 | 446 |
| 1391 | 3300035118 | Ga0373954_0008292 | Ga0373954_0008292_1413_2771 | 446 |
| 1392 | 3300035119 | Ga0373956_0018083 | Ga0373956_0018083_716_2074 | 446 |
| 1393 | 3300035171 | Ga0373946_0010335 | Ga0373946_0010335_954_2312 | 446 |
| 1394 | 3300035692 | Ga0373935_0057841 | Ga0373935_0057841_900_2258 | 446 |
| 1395 | 3300035724 | Ga0373933_0002724 | Ga0373933_0002724_8443_9801 | 446 |
| 1396 | 3300037068 | Ga0373925_0028153 | Ga0373925_0028153_1325_2683 | 446 |
| 1397 | 3300038443 | Ga0395901_0016751 | Ga0395901_0016751_1943_3310 | 446 |
| 1398 | 3300046459 | Ga0495629_0008811 | Ga0495629_0008811_4865_6223 | 446 |
| 1399 | 3300046475 | Ga0495639_0001280 | Ga0495639_0001280_4203_5561 | 446 |
| 1400 | 3300046476 | Ga0495662_0043851 | Ga0495662_0043851_728_2086 | 446 |
| 1401 | 3300046499 | Ga0495594_0015858 | Ga0495594_0015858_1889_3247 | 446 |
| 1402 | 3300046526 | Ga0495666_0028710 | Ga0495666_0028710_712_2070 | 446 |
| 1403 | 3300046559 | Ga0495667_0024865 | Ga0495667_0024865_1928_3286 | 446 |
| 1404 | 3300046663 | Ga0495635_0006358 | Ga0495635_0006358_5205_6563 | 446 |
| 1405 | 3300046679 | Ga0495623_0006009 | Ga0495623_0006009_4970_6328 | 446 |
| 1406 | 3300046681 | Ga0495647_0001465 | Ga0495647_0001465_1699_3057 | 446 |
| 1407 | 3300047315 | Ga0495581_0017609 | Ga0495581_0017609_1023_2381 | 446 |
| 1408 | 3300047673 | Ga0495593_0014536 | Ga0495593_0014536_10_1368 | 446 |
| 1409 | 3300048905 | Ga0496102_0012989 | Ga0496102_0012989_3978_5336 | 446 |
| 1410 | 3300048905 | Ga0496102_0024334 | Ga0496102_0024334_161_1519 | 446 |
| 1411 | 3300048906 | Ga0496103_0097966 | Ga0496103_0097966_45_1403 | 446 |
| 1412 | 3300048908 | Ga0496105_0014812 | Ga0496105_0014812_1486_2844 | 446 |
| 1413 | 3300048912 | Ga0496109_0053655 | Ga0496109_0053655_1301_2659 | 446 |
| 1414 | 3300048915 | Ga0496112_0020791 | Ga0496112_0020791_672_2030 | 446 |
| 1415 | 3300048918 | Ga0496115_0062801 | Ga0496115_0062801_1548_2906 | 446 |
| 1416 | 3300048923 | Ga0496120_0000832 | Ga0496120_0000832_35271_36611 | 446 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3upy-assembly1.cif.gz_B | crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. | 0.9915 | 1 | 433 |
| 3upy-assembly1.cif.gz_B | crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. | 0.9825 | 1 | 433 |
| 3frn-assembly1.cif.gz_A | crystal structure of flagellar protein flga from thermotoga maritima msb8 | 0.7761 | 350 | 417 |
| 6net-assembly3.cif.gz_B | fad-dependent monooxygenase tropb from t. stipitatus substrate complex | 0.7622 | 21 | 55 |
| 5lfo-assembly1.cif.gz_A | crystal structure of murine n1-acetylpolyamine oxidase in complex with n1-acetylspermine | 0.7593 | 24 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5ECJ8_3_395_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.861 | 22 | 55 | 3.50.50.60 |
| af_Q58325_34_123_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8393 | 96 | 161 | 3.40.50.720 |
| af_E9AH12_65_201_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8277 | 23 | 159 | 3.40.50.720 |
| 5xgvB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8159 | 23 | 56 | 3.50.50.60 |
| 1vqwB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8137 | 24 | 57 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526QFS4-F1-model_v4 | Homoserine dehydrogenase | 1.002 | 333 | 436 |
|
| AF-A0A441WN15-F1-model_v4 | Homoserine dehydrogenase | 1 | 1 | 161 |
GO:0016491
GO:0050661 |
| AF-A0A530GFW6-F1-model_v4 | Homoserine dehydrogenase | 0.9997 | 230 | 340 |
|
| AF-A0A527G1W6-F1-model_v4 | Homoserine dehydrogenase | 0.999 | 255 | 356 |
|
| AF-A0A2N7SEN7-F1-model_v4 | deleted | 0.9987 | 1 | 377 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar