F493788

General Info

Members Datasets Scaffolds Average Seq Length
1416 715 796 440

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100002388|Ga0070661_1000023885
Length 478
Sequence MPPDRIRKQGLPLSRDRHRGETLVLIAGSGCYPALMPAYTPLSNVALTGLARDLAKRADDNKPIRIGVIGSGEMGTDLVTQCMLMRGVEVAAIATRRPHTALEATAIAYGDTSHAIEADTLGKVSAAIGSKKLAITSADTLVRTPEIDVVIDATGKPGVAADFDLLAMEHGKHLVMMNVEADVTIGRYLKHEADRLGVVYSVGAGDEPSSCMELIEFATALGYRIVAAGKGKNNAFNRDAVPDDYREEATRRNMNPRMLVEFVDGSKTMVEMACIANATGLVPDVPGMHGPAADRDQMVKVLIPKADGGILDKKGVVDFTVGKGVAPGVFVIVEAEHPRIIERMDDLHIGHGPYYSFFRPYHLTSLEVPLTAARIMLTGKPDMVPLAHPVAEVCAVAKRDLAVGEKFDAIGETCYRSFTLTAADARNRNAVPVGLLEGGRVIAPVKKGELLTTANSAPDQTTRLYALRQRQDQMGSES

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
13 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
17 2534681786 Brucella suis 92/29 Isolate Unclassified
18 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
19 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
20 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
21 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
22 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
23 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
24 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
25 2643221591 Devosia sp. Root685 Isolate Unclassified
26 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
27 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
28 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
29 2643221629 Devosia sp. Root105 Isolate Unclassified
30 2643221662 Devosia sp. Root413D1 Isolate Unclassified
31 2643221674 Devosia sp. Root436 Isolate Unclassified
32 2643221734 Bosea sp. Root670 Isolate Unclassified
33 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
34 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
35 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
36 2718217927 Rhizobium sp. N324 Isolate Nodule
37 2718218423 Rhizobium sp. N941 Isolate Nodule
38 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
39 2721755809 Rhizobium sp. N541 Isolate Nodule
40 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
41 2738543024 Aminobacter sp. AP02 Isolate Unclassified
42 2751185800 Brucella pituitosa AA2 Isolate Unclassified
43 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
44 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
45 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
46 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
47 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
48 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
49 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
50 2791355256 Rhizobium sp. M10 Isolate Nodule
51 2791355261 Rhizobium sp. J15 Isolate Nodule
52 2791355262 Rhizobium sp. M1 Isolate Nodule
53 2791355263 Rhizobium chutanense C5 Isolate Nodule
54 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
55 2838061910 Rhizobium phaseoli L15 Isolate Nodule
56 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
57 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
58 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
59 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
60 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
61 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
62 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
63 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
64 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
65 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
66 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
67 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
68 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
69 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
70 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
71 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
72 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
73 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
74 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
75 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
76 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
77 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
78 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
79 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
80 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
81 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
82 2854911287 Brucella lupini LUP21 Isolate Unclassified
83 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
84 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
85 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
86 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
87 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
88 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
89 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
90 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
91 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
92 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
93 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
94 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
95 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
96 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
97 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
98 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
99 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
100 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
101 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
102 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
103 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
104 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
105 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
106 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
107 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
108 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
109 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
110 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
111 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
112 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
113 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
114 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
115 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
116 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
117 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
118 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
119 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
120 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
121 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
122 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
123 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
124 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
125 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
126 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
127 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
128 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
129 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
130 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
131 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
132 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
133 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
134 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
135 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
136 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
137 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
138 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
139 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
140 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
141 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
142 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
143 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
144 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
145 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
146 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
147 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
148 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
149 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
150 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
151 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
152 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
153 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
154 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
155 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
156 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
157 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
158 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
159 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
160 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
161 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
162 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
163 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
164 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
165 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
166 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
167 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
168 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
169 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
170 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
171 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
172 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
173 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
174 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
175 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
176 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
177 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
178 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
179 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
180 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
181 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
182 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
183 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
184 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
185 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
186 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
187 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
188 2909042592 Labrys sp. LIt4 Isolate Nodule
189 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
190 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
191 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
192 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
193 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
194 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
195 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
196 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
197 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
198 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
199 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
200 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
201 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
202 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
203 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
204 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
205 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
206 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
207 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
208 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
209 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
210 2932401849 Devosia sp. 2618 Isolate Rhizosphere
211 2936381700 Rhizobium chutanense C16 Isolate Unclassified
212 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
213 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
214 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
215 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
216 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
217 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
218 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
219 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
220 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
221 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
222 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
223 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
224 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
225 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
226 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
227 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
228 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
229 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
230 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
231 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
232 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
233 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
234 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
235 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
236 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
237 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
238 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
239 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
241 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
242 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
243 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
244 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
245 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
246 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
247 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
248 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
249 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
250 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
251 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
252 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
253 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
254 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
255 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
256 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
257 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
258 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
259 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
260 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
261 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
262 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
263 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
264 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
265 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
266 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
267 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
268 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
269 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
270 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
271 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
272 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
273 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
274 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
275 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
276 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
277 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
278 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
279 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
280 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
281 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
282 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
283 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
284 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
285 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
286 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
287 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
288 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
289 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
290 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
291 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
292 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
293 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
294 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
295 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
296 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
297 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
298 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
299 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
300 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
301 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
302 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
303 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
304 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
305 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
306 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
307 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
308 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
309 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
310 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
311 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
312 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
313 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
314 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
315 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
316 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
317 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
318 3004167301 Mesorhizobium loti 582 Isolate Unclassified
319 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
320 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
321 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
322 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
323 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
324 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
325 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
326 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
327 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
328 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
329 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
330 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
331 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
332 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
333 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
334 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
335 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
336 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
337 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
338 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
339 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
340 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
341 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
342 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
343 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
344 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
345 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
346 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
347 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
348 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
349 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
350 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
351 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
352 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
353 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
354 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
355 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
356 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
357 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
358 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
359 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
360 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
361 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
362 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
363 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
364 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
365 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
366 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
367 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
368 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
369 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
370 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
371 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
372 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
373 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
374 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
375 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
376 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
377 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
378 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
379 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
380 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
381 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
382 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
383 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
384 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
385 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
386 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
387 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
388 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
389 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
390 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
391 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
392 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
393 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
394 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
395 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
396 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
397 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
398 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
399 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
400 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
401 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
402 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
403 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
404 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
405 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
406 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
407 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
408 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
409 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
410 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
411 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
412 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
413 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
414 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
415 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
416 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
417 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
418 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
419 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
420 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
421 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
422 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
423 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
424 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
425 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
426 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
427 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
428 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
429 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
430 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
431 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
432 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
433 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
434 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
435 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
436 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
437 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
438 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
439 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
440 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
441 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
442 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
443 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
444 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
445 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
446 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
447 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
448 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
449 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
450 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
452 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
453 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
454 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
455 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
457 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
458 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
460 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
462 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
463 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
465 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
466 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
514 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
515 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
516 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
522 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
523 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
527 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
528 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
529 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
530 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
531 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
532 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
533 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
534 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
535 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
536 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
537 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
538 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
539 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
540 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
541 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
542 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
543 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
544 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
545 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
546 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
547 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
548 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
549 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
550 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
551 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
553 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
554 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
555 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
556 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
557 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
558 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
559 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
560 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
561 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
562 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
563 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
564 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
565 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
566 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
567 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
568 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
569 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
570 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
571 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
572 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
573 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
574 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
575 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
576 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
577 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
578 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
579 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
580 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
581 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
582 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
583 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
584 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
585 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
586 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
587 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
588 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
589 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
590 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
591 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
592 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
593 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
594 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
595 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
596 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
597 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
598 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
599 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
600 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
601 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
602 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
603 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
604 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
605 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
606 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
611 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
612 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
613 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
614 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
615 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
616 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
617 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
618 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
619 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
620 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
621 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
622 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
623 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
624 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
625 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
626 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
627 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
628 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
629 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
634 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
635 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
636 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
637 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
640 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
641 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
642 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
643 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
644 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
645 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
646 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
647 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
648 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
649 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
650 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
651 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
652 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
653 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
654 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
655 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
656 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
657 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
659 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
660 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
661 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
662 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
663 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
664 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
665 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
666 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
667 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
668 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
669 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
670 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
671 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
672 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
673 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
674 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
675 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
676 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
677 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
678 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
679 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
680 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
681 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
684 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
685 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
686 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
687 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
688 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
689 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
690 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
691 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
692 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
693 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
694 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
695 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
696 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
697 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
698 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
699 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
700 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
701 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
702 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
703 8005275841 Rhizobium sp. N4311 Isolate Nodule
704 8005382845 Rhizobium sp. R634 Isolate Nodule
705 8005395548 Rhizobium sp. R339 Isolate Nodule
706 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
707 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
708 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
709 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
710 8018176218 Rhizobium sp. N122 Isolate Nodule
711 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
712 8024501048 Rhizobium sp. H4 Isolate Nodule
713 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
714 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
715 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.14
Metatranscriptomes 0.07
Isolates 43.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 35.95
Rhizoplane 1.62
Rhizosphere 46.19
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004893 3300002705 Bacteria 3980
2 JGI25157J39369_1000725 3300002741 Bacteria 17573
3 JGI25406J46586_10006582 3300003203 Bacteria 5341
4 JGI25165J46597_1000219 3300003214 Bacteria 79946
5 JGI25165J46597_1004311 3300003214 Bacteria 3104
6 JGI25153J46596_10000062 3300003215 Bacteria 129749
7 JGI25153J46596_10000095 3300003215 Bacteria 102154
8 Ga0055533_1000947 3300003756 Bacteria 8562
9 Ga0055532_1000220 3300003758 Bacteria 43379
10 Ga0055527_1000173 3300003760 Bacteria 44198
11 Ga0055535_1000360 3300003761 Bacteria 43957
12 Ga0055542_1000391 3300003762 Bacteria 44080
13 Ga0055542_1000549 3300003762 Bacteria 33335
14 Ga0055542_1001448 3300003762 Bacteria 11795
15 Ga0055542_1001730 3300003762 Bacteria 9386
16 Ga0055529_1001879 3300003763 Bacteria 4878
17 Ga0055529_1002315 3300003763 Bacteria 3800
18 Ga0055526_1000065 3300003771 Bacteria 102410
19 Ga0055524_1000058 3300003775 Bacteria 139138
20 Ga0055531_10029522 3300003794 Bacteria 1866
21 Ga0065165_1000384 3300005262 Bacteria 71731
22 Ga0070658_10014984 3300005327 Bacteria 6206
23 Ga0070676_10073131 3300005328 Bacteria 2062
24 Ga0070676_10096805 3300005328 Bacteria 1817
25 Ga0070683_100014390 3300005329 Bacteria 6920
26 Ga0070683_100047346 3300005329 Bacteria 3972
27 Ga0070690_100019376 3300005330 Bacteria 4128
28 Ga0070670_100000668 3300005331 Bacteria 26607
29 Ga0070670_100002946 3300005331 Bacteria 14099
30 Ga0070670_100020520 3300005331 Bacteria 5681
31 Ga0070670_100053262 3300005331 Bacteria 3475
32 Ga0068869_100006892 3300005334 Bacteria 7229
33 Ga0068869_100018208 3300005334 Bacteria 4777
34 Ga0068869_100053101 3300005334 Bacteria 2945
35 Ga0068869_100116859 3300005334 Bacteria 2035
36 Ga0070666_10007302 3300005335 Bacteria 6808
37 Ga0070666_10014351 3300005335 Bacteria 5043
38 Ga0070680_100181603 3300005336 Bacteria 1772
39 Ga0068868_100016709 3300005338 Bacteria 5457
40 Ga0068868_100024514 3300005338 Bacteria 4579
41 Ga0068868_100063418 3300005338 Bacteria 2931
42 Ga0070660_100004532 3300005339 Bacteria 9600
43 Ga0070660_100005052 3300005339 Bacteria 9115
44 Ga0070660_100110075 3300005339 Bacteria 2190
45 Ga0070689_100035473 3300005340 Bacteria 3811
46 Ga0070689_100146032 3300005340 Bacteria 1905
47 Ga0070661_100000805 3300005344 Bacteria 22549
48 Ga0070661_100002388 3300005344 Bacteria 12873
49 Ga0070661_100013058 3300005344 Bacteria 5825
50 Ga0070661_100019583 3300005344 Bacteria 4823
51 Ga0070661_100062246 3300005344 Bacteria 2740
52 Ga0070661_100099493 3300005344 Bacteria 2161
53 Ga0070668_100002303 3300005347 Bacteria 14077
54 Ga0070668_100003690 3300005347 Bacteria 11310
55 Ga0070668_100032042 3300005347 Bacteria 3999
56 Ga0070668_100114564 3300005347 Bacteria 2148
57 Ga0070668_100187207 3300005347 Bacteria 1694
58 Ga0070668_100212067 3300005347 Bacteria 1593
59 Ga0070669_100035899 3300005353 Bacteria 3591
60 Ga0070675_100003065 3300005354 Bacteria 12622
61 Ga0070675_100006887 3300005354 Bacteria 8726
62 Ga0070671_100003942 3300005355 Bacteria 11678
63 Ga0070671_100010180 3300005355 Bacteria 7546
64 Ga0070671_100015873 3300005355 Bacteria 6084
65 Ga0070673_100003212 3300005364 Bacteria 10130
66 Ga0070673_100003475 3300005364 Bacteria 9811
67 Ga0070673_100006227 3300005364 Bacteria 7743
68 Ga0070673_100027283 3300005364 Bacteria 4232
69 Ga0070673_100095403 3300005364 Bacteria 2440
70 Ga0070688_100009915 3300005365 Bacteria 5234
71 Ga0070659_100000244 3300005366 Bacteria 42804
72 Ga0070659_100001492 3300005366 Bacteria 16851
73 Ga0070659_100018306 3300005366 Bacteria 5286
74 Ga0070659_100068038 3300005366 Bacteria 2824
75 Ga0070667_100005826 3300005367 Bacteria 10278
76 Ga0070667_100022980 3300005367 Bacteria 5171
77 Ga0070667_100031165 3300005367 Bacteria 4445
78 Ga0070667_100085354 3300005367 Bacteria 2707
79 Ga0070667_100263775 3300005367 Bacteria 1543
80 Ga0070709_10011270 3300005434 Bacteria 4976
81 Ga0070714_100007403 3300005435 Bacteria 8540
82 Ga0070714_100062106 3300005435 Bacteria 3210
83 Ga0070713_100002027 3300005436 Bacteria 13093
84 Ga0070713_100033297 3300005436 Bacteria 4126
85 Ga0070711_100000713 3300005439 Bacteria 17378
86 Ga0070705_100020514 3300005440 Bacteria 3500
87 Ga0070694_100021211 3300005444 Bacteria 4147
88 Ga0070663_100011344 3300005455 Bacteria 5590
89 Ga0070663_100080278 3300005455 Bacteria 2395
90 Ga0070678_100010805 3300005456 Bacteria 5596
91 Ga0070678_100059065 3300005456 Bacteria 2817
92 Ga0070662_100000091 3300005457 Bacteria 49732
93 Ga0070662_100015098 3300005457 Bacteria 5167
94 Ga0070681_10001647 3300005458 Bacteria 19943
95 Ga0068867_100157928 3300005459 Bacteria 1786
96 Ga0068867_100210218 3300005459 Bacteria 1562
97 Ga0070685_10013266 3300005466 Bacteria 4344
98 Ga0070685_10089620 3300005466 Bacteria 1860
99 Ga0070706_100047499 3300005467 Bacteria 3961
100 Ga0070707_100022437 3300005468 Bacteria 5967
101 Ga0070699_100054158 3300005518 Bacteria 3473
102 Ga0070699_100055004 3300005518 Bacteria 3447
103 Ga0070679_100015230 3300005530 Bacteria 7387
104 Ga0070679_100044151 3300005530 Bacteria 4441
105 Ga0070684_100026823 3300005535 Bacteria 4857
106 Ga0068853_100000517 3300005539 Bacteria 26170
107 Ga0068853_100001848 3300005539 Bacteria 15550
108 Ga0068853_100002399 3300005539 Bacteria 14011
109 Ga0068853_100007892 3300005539 Bacteria 8537
110 Ga0068853_100009275 3300005539 Bacteria 7935
111 Ga0068853_100031540 3300005539 Bacteria 4482
112 Ga0068853_100048415 3300005539 Bacteria 3651
113 Ga0068853_100088048 3300005539 Bacteria 2725
114 Ga0070672_100001196 3300005543 Bacteria 15877
115 Ga0070672_100107121 3300005543 Bacteria 2274
116 Ga0070672_100178448 3300005543 Bacteria 1769
117 Ga0070686_100003766 3300005544 Bacteria 8335
118 Ga0070693_100002360 3300005547 Bacteria 8681
119 Ga0070665_100001730 3300005548 Bacteria 24965
120 Ga0070665_100130147 3300005548 Bacteria 2519
121 Ga0070665_100196582 3300005548 Bacteria 2018
122 Ga0070704_100039503 3300005549 Bacteria 3240
123 Ga0068855_100000310 3300005563 Bacteria 60449
124 Ga0068855_100001384 3300005563 Bacteria 30026
125 Ga0068855_100207408 3300005563 Bacteria 2204
126 Ga0070664_100000116 3300005564 Bacteria 52626
127 Ga0070664_100000463 3300005564 Bacteria 30826
128 Ga0070664_100037059 3300005564 Bacteria 4098
129 Ga0070664_100166104 3300005564 Bacteria 1955
130 Ga0068857_100001049 3300005577 Bacteria 21409
131 Ga0068857_100003640 3300005577 Bacteria 12921
132 Ga0068854_100007622 3300005578 Bacteria 6923
133 Ga0068854_100009688 3300005578 Bacteria 6225
134 Ga0068854_100076819 3300005578 Bacteria 2456
135 Ga0068856_100001465 3300005614 Bacteria 24722
136 Ga0068856_100077695 3300005614 Bacteria 3290
137 Ga0068856_100081953 3300005614 Bacteria 3201
138 Ga0068856_100089267 3300005614 Bacteria 3065
139 Ga0068856_100101391 3300005614 Bacteria 2871
140 Ga0070702_100009038 3300005615 Bacteria 4857
141 Ga0070702_100017853 3300005615 Bacteria 3668
142 Ga0068852_100000730 3300005616 Bacteria 21553
143 Ga0068852_100003680 3300005616 Bacteria 10744
144 Ga0068852_100013701 3300005616 Bacteria 6213
145 Ga0068859_100001046 3300005617 Bacteria 28371
146 Ga0068859_100008936 3300005617 Bacteria 10121
147 Ga0068859_100198345 3300005617 Bacteria 2091
148 Ga0068864_100003022 3300005618 Bacteria 13902
149 Ga0068864_100005142 3300005618 Bacteria 10716
150 Ga0068864_100018179 3300005618 Bacteria 5868
151 Ga0068866_10049999 3300005718 Bacteria 2121
152 Ga0068861_100002478 3300005719 Bacteria 12028
153 Ga0068861_100024828 3300005719 Bacteria 4339
154 Ga0068851_10001016 3300005834 Bacteria 12178
155 Ga0068851_10019646 3300005834 Bacteria 3266
156 Ga0068851_10068128 3300005834 Bacteria 1836
157 Ga0068870_10008506 3300005840 Bacteria 4621
158 Ga0068863_100002482 3300005841 Bacteria 18334
159 Ga0068863_100039528 3300005841 Bacteria 4487
160 Ga0068863_100060273 3300005841 Bacteria 3589
161 Ga0068858_100001816 3300005842 Bacteria 21723
162 Ga0068858_100007123 3300005842 Bacteria 10860
163 Ga0068860_100018543 3300005843 Bacteria 6769
164 Ga0068860_100022845 3300005843 Bacteria 6048
165 Ga0068860_100023458 3300005843 Bacteria 5962
166 Ga0068860_100025648 3300005843 Bacteria 5685
167 Ga0068860_100038314 3300005843 Bacteria 4585
168 Ga0068860_100108737 3300005843 Bacteria 2650
169 Ga0068862_100019100 3300005844 Bacteria 5714
170 Ga0068862_100117821 3300005844 Bacteria 2337
171 Ga0081455_10070723 3300005937 Bacteria 2896
172 Ga0081540_1011720 3300005983 Bacteria 5835
173 Ga0081539_10000646 3300005985 Bacteria 70179
174 Ga0081539_10060736 3300005985 Bacteria 2074
175 Ga0075365_10003273 3300006038 Bacteria 8304
176 Ga0075365_10016399 3300006038 Bacteria 4506
177 Ga0075365_10078577 3300006038 Bacteria 2231
178 Ga0075363_100001186 3300006048 Bacteria 9612
179 Ga0075363_100066087 3300006048 Bacteria 1956
180 Ga0075364_10007855 3300006051 Bacteria 6349
181 Ga0070712_100001191 3300006175 Bacteria 15718
182 Ga0070712_100066548 3300006175 Bacteria 2561
183 Ga0075362_10020779 3300006177 Bacteria 2747
184 Ga0075367_10000725 3300006178 Bacteria 12789
185 Ga0075367_10148074 3300006178 Bacteria 1456
186 Ga0075366_10080786 3300006195 Bacteria 1941
187 Ga0097621_100021138 3300006237 Bacteria 5026
188 Ga0075370_10016387 3300006353 Bacteria 3988
189 Ga0075370_10050746 3300006353 Bacteria 2353
190 Ga0068871_100015024 3300006358 Bacteria 5789
191 Ga0068871_100100015 3300006358 Bacteria 2428
192 Ga0068865_100020658 3300006881 Bacteria 4272
193 Ga0097620_100001046 3300006931 Bacteria 28371
194 Ga0097620_100008936 3300006931 Bacteria 10121
195 Ga0097620_100198336 3300006931 Bacteria 2091
196 Ga0105240_10003226 3300009093 Bacteria 25530
197 Ga0105240_10016842 3300009093 Bacteria 9878
198 Ga0105240_10116984 3300009093 Bacteria 3215
199 Ga0105240_10143184 3300009093 Bacteria 2856
200 Ga0105245_10024593 3300009098 Bacteria 5290
201 Ga0105245_10069375 3300009098 Bacteria 3196
202 Ga0105245_10201186 3300009098 Bacteria 1913
203 Ga0105247_10029551 3300009101 Bacteria 3322
204 Ga0114129_10360722 3300009147 Bacteria 1923
205 Ga0105242_10021962 3300009176 Bacteria 5016
206 Ga0105242_10074880 3300009176 Bacteria 2817
207 Ga0105248_10006667 3300009177 Bacteria 12669
208 Ga0105248_10016381 3300009177 Bacteria 8157
209 Ga0105248_10052380 3300009177 Bacteria 4580
210 Ga0105248_10081104 3300009177 Bacteria 3647
211 Ga0105237_10000203 3300009545 Bacteria 84732
212 Ga0105237_10011201 3300009545 Bacteria 9505
213 Ga0105237_10014190 3300009545 Bacteria 8342
214 Ga0105237_10043543 3300009545 Bacteria 4521
215 Ga0105237_10161251 3300009545 Bacteria 2241
216 Ga0105238_10001144 3300009551 Bacteria 26753
217 Ga0105238_10004964 3300009551 Bacteria 13155
218 Ga0105238_10008979 3300009551 Bacteria 10005
219 Ga0105238_10045842 3300009551 Bacteria 4416
220 Ga0105238_10199345 3300009551 Bacteria 1977
221 Ga0105249_10085726 3300009553 Bacteria 2936
222 Ga0105249_10103831 3300009553 Bacteria 2678
223 Ga0105147_101143 3300009982 Bacteria 2124
224 Ga0105239_10008429 3300010375 Bacteria 11735
225 Ga0105239_10010565 3300010375 Bacteria 10322
226 Ga0105239_10012345 3300010375 Bacteria 9514
227 Ga0105239_10050525 3300010375 Bacteria 4560
228 Ga0105246_10025696 3300011119 Bacteria 3840
229 Ga0105246_10032896 3300011119 Bacteria 3442
230 Ga0157373_10000693 3300013100 Bacteria 26417
231 Ga0157373_10059802 3300013100 Bacteria 2700
232 Ga0157373_10114254 3300013100 Bacteria 1898
233 Ga0157371_10001323 3300013102 Bacteria 26014
234 Ga0157371_10012188 3300013102 Bacteria 6582
235 Ga0157371_10018740 3300013102 Bacteria 5114
236 Ga0157371_10024324 3300013102 Bacteria 4424
237 Ga0157370_10033003 3300013104 Bacteria 5049
238 Ga0157370_10053070 3300013104 Bacteria 3867
239 Ga0157370_10075236 3300013104 Bacteria 3184
240 Ga0157370_10077232 3300013104 Bacteria 3137
241 Ga0157369_10000383 3300013105 Bacteria 58625
242 Ga0157369_10012421 3300013105 Bacteria 9667
243 Ga0157374_10005410 3300013296 Bacteria 10726
244 Ga0157374_10028264 3300013296 Bacteria 5066
245 Ga0157374_10163668 3300013296 Bacteria 2168
246 Ga0157378_10048083 3300013297 Bacteria 3793
247 Ga0163162_10030510 3300013306 Bacteria 5341
248 Ga0163162_10040685 3300013306 Bacteria 4649
249 Ga0163162_10084688 3300013306 Bacteria 3246
250 Ga0163162_10115796 3300013306 Bacteria 2781
251 Ga0157372_10001544 3300013307 Bacteria 25070
252 Ga0157372_10001853 3300013307 Bacteria 22920
253 Ga0157372_10017769 3300013307 Bacteria 7635
254 Ga0157372_10222960 3300013307 Bacteria 2185
255 Ga0157372_10265638 3300013307 Bacteria 1993
256 Ga0157375_10010879 3300013308 Bacteria 8020
257 Ga0157375_10013535 3300013308 Bacteria 7263
258 Ga0157375_10071698 3300013308 Bacteria 3478
259 Ga0163163_10005125 3300014325 Bacteria 11296
260 Ga0163163_10051110 3300014325 Bacteria 4074
261 Ga0163163_10097029 3300014325 Bacteria 2968
262 Ga0157380_10070934 3300014326 Bacteria 2817
263 Ga0157379_10002363 3300014968 Bacteria 15761
264 Ga0157379_10015544 3300014968 Bacteria 6682
265 Ga0157376_10023919 3300014969 Bacteria 4790
266 Ga0157376_10028070 3300014969 Bacteria 4469
267 Ga0157376_10175185 3300014969 Bacteria 1956
268 Ga0182006_1020041 3300015261 Bacteria 2806
269 Ga0163161_10075274 3300017792 Bacteria 2477
270 Ga0213876_10000567 3300021384 Bacteria 27564
271 Ga0213876_10001071 3300021384 Bacteria 17602
272 Ga0213875_10004301 3300021388 Bacteria 7840
273 Ga0213875_10014734 3300021388 Bacteria 3812
274 Ga0209674_100130 3300025226 Bacteria 119638
275 Ga0209672_100225 3300025228 Bacteria 43500
276 Ga0209672_100330 3300025228 Bacteria 30805
277 Ga0209147_100283 3300025229 Bacteria 43500
278 Ga0209258_100467 3300025242 Bacteria 43500
279 Ga0209026_1000002 3300025250 Bacteria 1136158
280 Ga0209026_1000116 3300025250 Bacteria 133228
281 Ga0209148_1000165 3300025254 Bacteria 136396
282 Ga0209148_1000256 3300025254 Bacteria 83479
283 Ga0209148_1000460 3300025254 Bacteria 44026
284 Ga0209759_1000153 3300025256 Bacteria 119494
285 Ga0209759_1000156 3300025256 Bacteria 117222
286 Ga0209233_1000047 3300025261 Bacteria 459614
287 Ga0209233_1000258 3300025261 Bacteria 80118
288 Ga0209455_1000143 3300025272 Bacteria 137976
289 Ga0209455_1000314 3300025272 Bacteria 48752
290 Ga0209455_1000365 3300025272 Bacteria 41954
291 Ga0209130_1000393 3300025284 Bacteria 47764
292 Ga0209675_1001542 3300025291 Bacteria 13112
293 Ga0209564_1000197 3300025295 Bacteria 139914
294 Ga0209758_1000029 3300025297 Bacteria 520787
295 Ga0209758_1006672 3300025297 Bacteria 8153
296 Ga0209050_1003786 3300025298 Bacteria 10810
297 Ga0209256_1000159 3300025299 Bacteria 139961
298 Ga0207426_1016931 3300025302 Bacteria 2602
299 Ga0209257_1002768 3300025304 Bacteria 16581
300 Ga0207656_10000583 3300025321 Bacteria 12069
301 Ga0207642_10002916 3300025899 Bacteria 5352
302 Ga0207680_10003490 3300025903 Bacteria 7405
303 Ga0207680_10023934 3300025903 Bacteria 3343
304 Ga0207699_10027727 3300025906 Bacteria 3140
305 Ga0207645_10020503 3300025907 Bacteria 4327
306 Ga0207705_10106962 3300025909 Bacteria 2063
307 Ga0207707_10035378 3300025912 Bacteria 4368
308 Ga0207707_10081742 3300025912 Bacteria 2820
309 Ga0207695_10042224 3300025913 Bacteria 4874
310 Ga0207695_10084812 3300025913 Bacteria 3197
311 Ga0207695_10088252 3300025913 Bacteria 3122
312 Ga0207695_10103333 3300025913 Bacteria 2841
313 Ga0207695_10117359 3300025913 Bacteria 2634
314 Ga0207695_10143562 3300025913 Bacteria 2333
315 Ga0207671_10002706 3300025914 Bacteria 18584
316 Ga0207693_10000459 3300025915 Bacteria 37224
317 Ga0207693_10042011 3300025915 Bacteria 3599
318 Ga0207663_10001764 3300025916 Bacteria 10202
319 Ga0207660_10145513 3300025917 Bacteria 1816
320 Ga0207662_10008462 3300025918 Bacteria 5633
321 Ga0207657_10000522 3300025919 Bacteria 40660
322 Ga0207657_10002338 3300025919 Bacteria 20555
323 Ga0207657_10002480 3300025919 Bacteria 19962
324 Ga0207657_10010187 3300025919 Bacteria 9390
325 Ga0207657_10045049 3300025919 Bacteria 3875
326 Ga0207657_10069011 3300025919 Bacteria 3001
327 Ga0207649_10001900 3300025920 Bacteria 11926
328 Ga0207649_10004443 3300025920 Bacteria 7610
329 Ga0207649_10006979 3300025920 Bacteria 6135
330 Ga0207649_10046621 3300025920 Bacteria 2664
331 Ga0207649_10057662 3300025920 Bacteria 2429
332 Ga0207649_10069616 3300025920 Bacteria 2241
333 Ga0207649_10131094 3300025920 Bacteria 1703
334 Ga0207652_10028379 3300025921 Bacteria 4669
335 Ga0207652_10055282 3300025921 Bacteria 3413
336 Ga0207652_10190883 3300025921 Bacteria 1843
337 Ga0207646_10010499 3300025922 Bacteria 9042
338 Ga0207646_10034835 3300025922 Bacteria 4551
339 Ga0207681_10172332 3300025923 Bacteria 1641
340 Ga0207681_10175646 3300025923 Bacteria 1627
341 Ga0207694_10007102 3300025924 Bacteria 8510
342 Ga0207694_10067138 3300025924 Bacteria 2799
343 Ga0207694_10068887 3300025924 Bacteria 2764
344 Ga0207650_10013390 3300025925 Bacteria 5679
345 Ga0207650_10050335 3300025925 Bacteria 3080
346 Ga0207650_10059558 3300025925 Bacteria 2847
347 Ga0207659_10002597 3300025926 Bacteria 10759
348 Ga0207659_10145740 3300025926 Bacteria 1843
349 Ga0207687_10003000 3300025927 Bacteria 11445
350 Ga0207687_10015981 3300025927 Bacteria 4924
351 Ga0207700_10004901 3300025928 Bacteria 7952
352 Ga0207700_10044413 3300025928 Bacteria 3271
353 Ga0207700_10161393 3300025928 Bacteria 1862
354 Ga0207664_10000761 3300025929 Bacteria 21889
355 Ga0207664_10066458 3300025929 Bacteria 2890
356 Ga0207644_10011666 3300025931 Bacteria 5820
357 Ga0207644_10069433 3300025931 Bacteria 2573
358 Ga0207690_10000719 3300025932 Bacteria 21322
359 Ga0207690_10173577 3300025932 Bacteria 1617
360 Ga0207706_10000093 3300025933 Bacteria 93173
361 Ga0207706_10016532 3300025933 Bacteria 6660
362 Ga0207706_10071786 3300025933 Bacteria 3045
363 Ga0207686_10002984 3300025934 Bacteria 9121
364 Ga0207686_10027885 3300025934 Bacteria 3312
365 Ga0207686_10150833 3300025934 Bacteria 1618
366 Ga0207670_10018933 3300025936 Bacteria 4196
367 Ga0207670_10060853 3300025936 Bacteria 2574
368 Ga0207704_10110404 3300025938 Bacteria 1858
369 Ga0207665_10056974 3300025939 Bacteria 2639
370 Ga0207691_10000646 3300025940 Bacteria 34475
371 Ga0207691_10152380 3300025940 Bacteria 2032
372 Ga0207711_10000626 3300025941 Bacteria 35493
373 Ga0207711_10004393 3300025941 Bacteria 12023
374 Ga0207711_10009353 3300025941 Bacteria 8183
375 Ga0207711_10037332 3300025941 Bacteria 4126
376 Ga0207711_10140254 3300025941 Bacteria 2174
377 Ga0207689_10002893 3300025942 Bacteria 15839
378 Ga0207689_10003783 3300025942 Bacteria 13789
379 Ga0207661_10075423 3300025944 Bacteria 2767
380 Ga0207679_10000841 3300025945 Bacteria 19766
381 Ga0207679_10005872 3300025945 Bacteria 7713
382 Ga0207679_10028039 3300025945 Bacteria 3902
383 Ga0207667_10001461 3300025949 Bacteria 29643
384 Ga0207667_10010611 3300025949 Bacteria 10757
385 Ga0207667_10018838 3300025949 Bacteria 7729
386 Ga0207667_10045520 3300025949 Bacteria 4647
387 Ga0207651_10000481 3300025960 Bacteria 16781
388 Ga0207651_10030620 3300025960 Bacteria 3429
389 Ga0207651_10034483 3300025960 Bacteria 3278
390 Ga0207651_10071061 3300025960 Bacteria 2465
391 Ga0207668_10001564 3300025972 Bacteria 13399
392 Ga0207668_10022902 3300025972 Bacteria 4005
393 Ga0207668_10068254 3300025972 Bacteria 2527
394 Ga0207668_10152002 3300025972 Bacteria 1793
395 Ga0207668_10171059 3300025972 Bacteria 1704
396 Ga0207640_10144072 3300025981 Bacteria 1741
397 Ga0207658_10008591 3300025986 Bacteria 6950
398 Ga0207658_10021254 3300025986 Bacteria 4502
399 Ga0207658_10085436 3300025986 Bacteria 2430
400 Ga0207677_10000359 3300026023 Bacteria 31912
401 Ga0207677_10006888 3300026023 Bacteria 6246
402 Ga0207677_10045142 3300026023 Bacteria 2941
403 Ga0207677_10080268 3300026023 Bacteria 2337
404 Ga0207703_10000552 3300026035 Bacteria 38477
405 Ga0207703_10000739 3300026035 Bacteria 32194
406 Ga0207639_10000537 3300026041 Bacteria 26056
407 Ga0207639_10011614 3300026041 Bacteria 6119
408 Ga0207639_10016779 3300026041 Bacteria 5187
409 Ga0207639_10023642 3300026041 Bacteria 4439
410 Ga0207639_10028163 3300026041 Bacteria 4100
411 Ga0207639_10062122 3300026041 Bacteria 2887
412 Ga0207639_10239364 3300026041 Bacteria 1577
413 Ga0207678_10013615 3300026067 Bacteria 7145
414 Ga0207678_10024835 3300026067 Bacteria 5232
415 Ga0207678_10028324 3300026067 Bacteria 4891
416 Ga0207678_10035621 3300026067 Bacteria 4333
417 Ga0207678_10203829 3300026067 Bacteria 1692
418 Ga0207708_10119516 3300026075 Bacteria 2053
419 Ga0207702_10006174 3300026078 Bacteria 10363
420 Ga0207702_10065797 3300026078 Bacteria 3105
421 Ga0207702_10213384 3300026078 Bacteria 1795
422 Ga0207641_10014253 3300026088 Bacteria 6514
423 Ga0207641_10101909 3300026088 Bacteria 2531
424 Ga0207648_10006217 3300026089 Bacteria 11901
425 Ga0207648_10210092 3300026089 Bacteria 1727
426 Ga0207676_10001145 3300026095 Bacteria 19988
427 Ga0207676_10005255 3300026095 Bacteria 9163
428 Ga0207676_10006255 3300026095 Bacteria 8403
429 Ga0207676_10053410 3300026095 Bacteria 3163
430 Ga0207676_10066982 3300026095 Bacteria 2867
431 Ga0207674_10002105 3300026116 Bacteria 25194
432 Ga0207674_10002729 3300026116 Bacteria 22016
433 Ga0207674_10021953 3300026116 Bacteria 6865
434 Ga0207674_10030401 3300026116 Bacteria 5679
435 Ga0207675_100002730 3300026118 Bacteria 17376
436 Ga0207675_100025292 3300026118 Bacteria 5525
437 Ga0207683_10002860 3300026121 Bacteria 15061
438 Ga0207683_10135517 3300026121 Bacteria 2217
439 Ga0207698_10001255 3300026142 Bacteria 14824
440 Ga0207698_10025428 3300026142 Bacteria 4171
441 Ga0207698_10126249 3300026142 Bacteria 2176
442 Ga0209971_1005290 3300027682 Bacteria 3069
443 Ga0209974_10006933 3300027876 Bacteria 3925
444 Ga0268266_10000343 3300028379 Bacteria 72589
445 Ga0268266_10065643 3300028379 Bacteria 3137
446 Ga0268266_10067880 3300028379 Bacteria 3087
447 Ga0268265_10016646 3300028380 Bacteria 5057
448 Ga0268265_10098371 3300028380 Bacteria 2356
449 Ga0268264_10002815 3300028381 Bacteria 15191
450 Ga0268264_10022582 3300028381 Bacteria 5135
451 Ga0268264_10053802 3300028381 Bacteria 3359
452 Ga0268264_10161717 3300028381 Bacteria 2018
453 Ga0265322_10005386 3300028654 Unclassified 3787
454 Ga0307515_10000600 3300028794 Bacteria 83981
455 Ga0307515_10003037 3300028794 Bacteria 35563
456 Ga0307515_10009737 3300028794 Bacteria 18519
457 Ga0265338_10026374 3300028800 Bacteria 5863
458 Ga0265330_10001752 3300031235 Bacteria 12192
459 Ga0265330_10007518 3300031235 Bacteria 5304
460 Ga0265325_10003409 3300031241 Bacteria 10390
461 Ga0265329_10000755 3300031242 Bacteria 16455
462 Ga0265329_10011891 3300031242 Bacteria 3152
463 Ga0265339_10000370 3300031249 Bacteria 35343
464 Ga0265331_10011736 3300031250 Bacteria 4787
465 Ga0265327_10018629 3300031251 Bacteria 4295
466 Ga0265327_10032158 3300031251 Bacteria 2939
467 Ga0265316_10012488 3300031344 Bacteria 7614
468 Ga0265316_10029152 3300031344 Bacteria 4542
469 Ga0307513_10001801 3300031456 Bacteria 30442
470 Ga0307513_10016761 3300031456 Bacteria 8816
471 Ga0307408_100156674 3300031548 Bacteria 1804
472 Ga0265313_10000070 3300031595 Bacteria 99384
473 Ga0307508_10124520 3300031616 Bacteria 2180
474 Ga0265314_10017190 3300031711 Bacteria 5684
475 Ga0265342_10000868 3300031712 Bacteria 30196
476 Ga0307516_10019483 3300031730 Bacteria 7029
477 Ga0307516_10087485 3300031730 Bacteria 2950
478 Ga0307410_10006982 3300031852 Bacteria 6146
479 Ga0307410_10027439 3300031852 Bacteria 3599
480 Ga0307406_10021641 3300031901 Bacteria 3806
481 Ga0307406_10022479 3300031901 Bacteria 3742
482 Ga0307407_10016459 3300031903 Bacteria 3682
483 Ga0307412_10042132 3300031911 Bacteria 2964
484 Ga0307412_10045455 3300031911 Bacteria 2871
485 Ga0307412_10056432 3300031911 Bacteria 2617
486 Ga0307412_10056954 3300031911 Bacteria 2607
487 Ga0307416_100020419 3300032002 Bacteria 4726
488 Ga0307416_100040290 3300032002 Bacteria 3627
489 Ga0307414_10058099 3300032004 Bacteria 2724
490 Ga0307411_10023546 3300032005 Bacteria 3650
491 Ga0307415_100012352 3300032126 Bacteria 4936
492 Ga0307415_100038108 3300032126 Bacteria 3165
493 Ga0316593_10014798 3300032168 Bacteria 2336
494 Ga0307510_10130942 3300033180 Bacteria 2182
495 Ga0373934_0014977 3300035086 Bacteria 2940
496 Ga0373923_0009060 3300035111 Bacteria 3577
497 Ga0373954_0008292 3300035118 Bacteria 4558
498 Ga0373956_0018083 3300035119 Bacteria 2980
499 Ga0373943_0058448 3300035170 Bacteria 1919
500 Ga0373946_0010335 3300035171 Bacteria 3452
501 Ga0373935_0057841 3300035692 Bacteria 2474
502 Ga0373927_0116804 3300035695 Bacteria 1740
503 Ga0373927_0121836 3300035695 Bacteria 1702
504 Ga0373933_0002724 3300035724 Bacteria 9880
505 Ga0373947_0008837 3300035725 Bacteria 5794
506 Ga0373937_0010034 3300036401 Bacteria 8258
507 Ga0373925_0028153 3300037068 Bacteria 4116
508 Ga0373925_0031977 3300037068 Bacteria 3871
509 Ga0373925_0140635 3300037068 Bacteria 1889
510 Ga0395899_0000036 3300037312 Bacteria 289502
511 Ga0395899_0000217 3300037312 Bacteria 80044
512 Ga0395899_0037973 3300037312 Bacteria 3610
513 Ga0395899_0065027 3300037312 Bacteria 2680
514 Ga0395899_0197203 3300037312 Bacteria 1406
515 Ga0395900_0000270 3300037418 Bacteria 80046
516 Ga0395900_0000872 3300037418 Bacteria 39599
517 Ga0395900_0005117 3300037418 Bacteria 13768
518 Ga0395900_0019483 3300037418 Bacteria 6917
519 Ga0395900_0040659 3300037418 Bacteria 4792
520 Ga0395900_0094090 3300037418 Bacteria 3078
521 Ga0395900_0266153 3300037418 Bacteria 1710
522 Ga0395898_0000254 3300037466 Bacteria 131247
523 Ga0395898_0000470 3300037466 Bacteria 80783
524 Ga0395898_0000626 3300037466 Bacteria 64794
525 Ga0395898_0192406 3300037466 Bacteria 1949
526 Ga0395905_0000253 3300037471 Bacteria 80046
527 Ga0395905_0012419 3300037471 Bacteria 8198
528 Ga0395905_0047736 3300037471 Bacteria 4011
529 Ga0436364_0667648 3300037853 Bacteria 9219
530 Ga0395901_0000095 3300038443 Bacteria 119290
531 Ga0395901_0000285 3300038443 Bacteria 62844
532 Ga0395901_0016751 3300038443 Bacteria 7468
533 Ga0395901_0020801 3300038443 Bacteria 6717
534 Ga0395901_0026852 3300038443 Bacteria 5911
535 Ga0395901_0031362 3300038443 Bacteria 5481
536 Ga0395901_0081590 3300038443 Bacteria 3378
537 Ga0395901_0100135 3300038443 Bacteria 3039
538 Ga0400483_093081 3300039062 Bacteria 3541
539 Ga0400483_132688 3300039062 Bacteria 6092
540 Ga0400483_257466 3300039062 Bacteria 7961
541 Ga0436365_0244982 3300039437 Bacteria 68861
542 Ga0436365_0344984 3300039437 Bacteria 19388
543 Ga0436365_0625375 3300039437 Bacteria 27116
544 Ga0436363_0002125 3300039450 Bacteria 12690
545 Ga0436363_0245198 3300039450 Bacteria 11089
546 Ga0436362_0100789 3300039453 Bacteria 5877
547 Ga0436362_0505409 3300039453 Bacteria 3143
548 Ga0436362_1174928 3300039453 Bacteria 1712
549 Ga0439465_0004781 3300041413 Bacteria 4359
550 Ga0466969_0001253 3300044656 Bacteria 13700
551 Ga0466969_0013222 3300044656 Bacteria 4347
552 Ga0466972_0012437 3300044658 Bacteria 4278
553 Ga0466965_0000665 3300044683 Bacteria 12612
554 Ga0466966_0000107 3300044684 Bacteria 51017
555 Ga0466966_0000309 3300044684 Bacteria 31554
556 Ga0466966_0003129 3300044684 Bacteria 10886
557 Ga0466961_0000068 3300044693 Bacteria 62703
558 Ga0466961_0001012 3300044693 Bacteria 17356
559 Ga0466961_0051677 3300044693 Bacteria 2624
560 Ga0466963_0003296 3300044694 Bacteria 9206
561 Ga0466963_0015643 3300044694 Bacteria 4705
562 Ga0466964_0019698 3300044706 Bacteria 2595
563 Ga0466971_0001111 3300044719 Bacteria 11172
564 Ga0466971_0034091 3300044719 Bacteria 2281
565 Ga0466970_0001042 3300044765 Bacteria 13405
566 Ga0466970_0001083 3300044765 Bacteria 13193
567 Ga0466957_0001559 3300044842 Bacteria 12067
568 Ga0466957_0009634 3300044842 Bacteria 5517
569 Ga0466957_0072670 3300044842 Bacteria 2130
570 Ga0466957_0084073 3300044842 Bacteria 1986
571 Ga0466960_0007399 3300044901 Bacteria 4460
572 Ga0466959_0001053 3300045049 Bacteria 16528
573 Ga0451576_0110114 3300045051 Bacteria 2866
574 Ga0466958_0000689 3300045836 Bacteria 14702
575 Ga0495629_0008811 3300046459 Bacteria 7418
576 Ga0495639_0001280 3300046475 Bacteria 11299
577 Ga0495662_0043851 3300046476 Bacteria 2159
578 Ga0495594_0015858 3300046499 Bacteria 3964
579 Ga0495666_0028710 3300046526 Bacteria 2737
580 Ga0495645_0065986 3300046543 Bacteria 2617
581 Ga0495667_0024865 3300046559 Bacteria 4034
582 Ga0495625_0023432 3300046660 Bacteria 4715
583 Ga0495635_0006358 3300046663 Bacteria 8232
584 Ga0495599_0054732 3300046678 Bacteria 2500
585 Ga0495623_0006009 3300046679 Bacteria 7899
586 Ga0495647_0001465 3300046681 Bacteria 7320
587 Ga0495613_0008295 3300046689 Bacteria 7713
588 Ga0495649_0095898 3300046694 Bacteria 1579
589 Ga0495581_0017609 3300047315 Bacteria 4149
590 Ga0495686_0023847 3300047472 Bacteria 4026
591 Ga0495686_0062520 3300047472 Bacteria 2309
592 Ga0495686_0090188 3300047472 Bacteria 1862
593 Ga0495593_0014536 3300047673 Bacteria 4474
594 Ga0496101_0015675 3300048904 Bacteria 5114
595 Ga0496102_0012989 3300048905 Bacteria 7212
596 Ga0496102_0024334 3300048905 Bacteria 5383
597 Ga0496102_0028747 3300048905 Bacteria 4969
598 Ga0496103_0097966 3300048906 Bacteria 1854
599 Ga0496105_0014812 3300048908 Bacteria 6208
600 Ga0496106_0000060 3300048909 Bacteria 87287
601 Ga0496106_0000759 3300048909 Bacteria 23295
602 Ga0496107_0000490 3300048910 Bacteria 21809
603 Ga0496107_0101813 3300048910 Bacteria 2106
604 Ga0496108_0155938 3300048911 Bacteria 1972
605 Ga0496108_0171572 3300048911 Bacteria 1877
606 Ga0496109_0053655 3300048912 Bacteria 3677
607 Ga0496109_0103881 3300048912 Bacteria 2638
608 Ga0496110_0038670 3300048913 Bacteria 4153
609 Ga0496112_0003779 3300048915 Bacteria 12642
610 Ga0496112_0015983 3300048915 Bacteria 7017
611 Ga0496112_0020791 3300048915 Bacteria 6229
612 Ga0496112_0295672 3300048915 Bacteria 1565
613 Ga0496115_0062801 3300048918 Bacteria 2997
614 Ga0496116_0024425 3300048919 Bacteria 4471
615 Ga0496117_0017509 3300048920 Bacteria 5982
616 Ga0496118_0020548 3300048921 Bacteria 5851
617 Ga0496118_0023118 3300048921 Bacteria 5411
618 Ga0496119_0001526 3300048922 Bacteria 27676
619 Ga0496119_0008324 3300048922 Bacteria 9141
620 Ga0496119_0030431 3300048922 Bacteria 3639
621 Ga0496119_0039372 3300048922 Bacteria 3039
622 Ga0496120_0000832 3300048923 Bacteria 44048
623 Ga0496120_0001687 3300048923 Bacteria 25349
624 Ga0496120_0069628 3300048923 Bacteria 1937
625 Ga0496121_0000102 3300048924 Bacteria 195341
626 Ga0496121_0123526 3300048924 Bacteria 1951
627 Ga0496122_0001710 3300048925 Bacteria 34034
628 Ga0496122_0005877 3300048925 Bacteria 14371
629 Ga0496122_0011460 3300048925 Bacteria 8974
630 Ga0496122_0030297 3300048925 Bacteria 4538
631 Ga0496123_0003513 3300048926 Bacteria 17460
632 Ga0496123_0018083 3300048926 Bacteria 5634
633 Ga0496123_0032777 3300048926 Bacteria 3752
634 Ga0496124_0031050 3300048927 Bacteria 4733
635 Ga0496124_0144699 3300048927 Bacteria 1872
636 Ga0496125_0001362 3300048928 Bacteria 35992
637 Ga0496125_0032187 3300048928 Bacteria 4661
638 Ga0496125_0038629 3300048928 Bacteria 4127
639 Ga0496125_0070130 3300048928 Bacteria 2745
640 Ga0496125_0107130 3300048928 Bacteria 2037
641 Ga0496126_0000400 3300048929 Bacteria 88670
642 Ga0496126_0140254 3300048929 Bacteria 2081
643 Ga0501031_0014510 3300049568 Bacteria 5122
644 Ga0501031_0075906 3300049568 Bacteria 2188
645 Ga0501031_0086033 3300049568 Bacteria 2049
646 Ga0501032_0000234 3300049569 Bacteria 46284
647 Ga0501032_0006640 3300049569 Bacteria 8492
648 Ga0501032_0008069 3300049569 Bacteria 7673
649 Ga0501032_0044497 3300049569 Bacteria 3004
650 Ga0501032_0098083 3300049569 Bacteria 1942
651 Ga0501033_0000076 3300049570 Bacteria 93921
652 Ga0501033_0000334 3300049570 Bacteria 44929
653 Ga0501033_0009070 3300049570 Bacteria 7673
654 Ga0501033_0085604 3300049570 Bacteria 2309
655 Ga0501033_0107461 3300049570 Bacteria 2032
656 Ga0501034_0000408 3300049571 Bacteria 72244
657 Ga0501034_0000475 3300049571 Bacteria 66162
658 Ga0501034_0000873 3300049571 Bacteria 44385
659 Ga0501034_0018012 3300049571 Bacteria 7247
660 Ga0501034_0019824 3300049571 Bacteria 6873
661 Ga0501034_0025999 3300049571 Bacteria 5963
662 Ga0501034_0068252 3300049571 Bacteria 3566
663 Ga0501034_0126952 3300049571 Bacteria 2535
664 Ga0501034_0161781 3300049571 Bacteria 2209
665 Ga0501034_0197976 3300049571 Bacteria 1968
666 Ga0501034_0234211 3300049571 Bacteria 1784
667 Ga0501034_0253866 3300049571 Bacteria 1702
668 Ga0501036_0000159 3300049572 Bacteria 44385
669 Ga0501036_0001942 3300049572 Bacteria 16039
670 Ga0501037_0000035 3300049573 Bacteria 125589
671 Ga0501037_0000533 3300049573 Bacteria 30360
672 Ga0501037_0018609 3300049573 Bacteria 5118
673 Ga0501037_0035735 3300049573 Bacteria 3662
674 Ga0501038_0000241 3300049574 Bacteria 46177
675 Ga0501038_0000262 3300049574 Bacteria 44385
676 Ga0501038_0043054 3300049574 Bacteria 3928
677 Ga0501038_0052644 3300049574 Bacteria 3508
678 Ga0501038_0113349 3300049574 Bacteria 2244
679 Ga0501039_0008835 3300049575 Bacteria 7673
680 Ga0501039_0086332 3300049575 Bacteria 2443
681 Ga0501040_0015223 3300049576 Bacteria 5082
682 Ga0501041_0059528 3300049577 Bacteria 2338
683 Ga0501043_0000031 3300049579 Bacteria 140707
684 Ga0501043_0000043 3300049579 Bacteria 115410
685 Ga0501043_0025732 3300049579 Bacteria 4616
686 Ga0501043_0032472 3300049579 Bacteria 4104
687 Ga0501043_0041697 3300049579 Bacteria 3606
688 Ga0501043_0045434 3300049579 Bacteria 3455
689 Ga0501046_0015199 3300049580 Bacteria 6473
690 Ga0501046_0082989 3300049580 Bacteria 2475
691 Ga0501047_0004343 3300049581 Bacteria 13343
692 Ga0501047_0010435 3300049581 Bacteria 8790
693 Ga0501047_0080823 3300049581 Bacteria 3124
694 Ga0501047_0092225 3300049581 Bacteria 2907
695 Ga0501047_0128590 3300049581 Bacteria 2413
696 Ga0501067_0008599 3300049583 Bacteria 5659
697 Ga0501068_0003453 3300049584 Bacteria 8509
698 Ga0501068_0065393 3300049584 Bacteria 2213
699 Ga0501069_0000056 3300049585 Bacteria 65784
700 Ga0501069_0012324 3300049585 Bacteria 4542
701 Ga0501070_0000141 3300049586 Bacteria 65875
702 Ga0501070_0000299 3300049586 Bacteria 46014
703 Ga0501070_0001617 3300049586 Bacteria 19979
704 Ga0501070_0037296 3300049586 Bacteria 4058
705 Ga0501070_0056901 3300049586 Bacteria 3242
706 Ga0501070_0097706 3300049586 Bacteria 2429
707 Ga0501070_0141751 3300049586 Bacteria 1984
708 Ga0501070_0204135 3300049586 Bacteria 1623
709 Ga0501071_0128426 3300049587 Bacteria 1882
710 Ga0501072_0024457 3300049588 Bacteria 4698
711 Ga0501072_0073549 3300049588 Bacteria 2702
712 Ga0501073_0003703 3300049589 Bacteria 11485
713 Ga0501073_0023174 3300049589 Bacteria 4462
714 Ga0501073_0039218 3300049589 Bacteria 3356
715 Ga0501073_0040875 3300049589 Bacteria 3278
716 Ga0501073_0253121 3300049589 Bacteria 1216
717 Ga0501074_0000223 3300049590 Bacteria 31404
718 Ga0501074_0018196 3300049590 Bacteria 5104
719 Ga0501074_0032102 3300049590 Bacteria 3806
720 Ga0501074_0034107 3300049590 Bacteria 3690
721 Ga0501075_0001104 3300049591 Bacteria 17384
722 Ga0501076_0004052 3300049592 Bacteria 10359
723 Ga0501077_0020854 3300049593 Bacteria 4149
724 Ga0501079_0003253 3300049741 Bacteria 11904
725 Ga0501079_0171986 3300049741 Bacteria 1689
726 Ga0501080_0001620 3300049742 Bacteria 19137
727 Ga0501080_0007967 3300049742 Bacteria 9600
728 Ga0501080_0013039 3300049742 Bacteria 7632
729 Ga0501080_0016746 3300049742 Bacteria 6769
730 Ga0501081_0001170 3300049743 Bacteria 15892
731 Ga0501083_0000098 3300049744 Bacteria 59246
732 Ga0501083_0043013 3300049744 Bacteria 3061
733 Ga0501083_0124110 3300049744 Bacteria 1693
734 Ga0501035_0000036 3300049822 Bacteria 165008
735 Ga0501035_0000449 3300049822 Bacteria 46083
736 Ga0501035_0002751 3300049822 Bacteria 17045
737 Ga0501035_0004065 3300049822 Bacteria 13918
738 Ga0501035_0013126 3300049822 Bacteria 7645
739 Ga0501035_0019154 3300049822 Bacteria 6300
740 Ga0501035_0031137 3300049822 Bacteria 4859
741 Ga0501035_0031401 3300049822 Bacteria 4837
742 Ga0501035_0056671 3300049822 Bacteria 3495
743 Ga0501035_0171446 3300049822 Bacteria 1874
744 Ga0501035_0260778 3300049822 Bacteria 1469
745 Ga0501035_0263574 3300049822 Bacteria 1460
746 Ga0501044_0000011 3300049823 Bacteria 257385
747 Ga0501044_0001088 3300049823 Bacteria 32411
748 Ga0501044_0001093 3300049823 Bacteria 32295
749 Ga0501044_0003690 3300049823 Bacteria 17210
750 Ga0501044_0010367 3300049823 Bacteria 10114
751 Ga0501044_0031017 3300049823 Bacteria 5628
752 Ga0501044_0052703 3300049823 Bacteria 4190
753 Ga0501044_0070373 3300049823 Bacteria 3558
754 nmdc:mga03683_19466_c1 3300050489 Bacteria 2591
755 nmdc:mga03683_3365_c1 3300050489 Bacteria 5146
756 nmdc:mga03n38_108851_c1 3300050490 Bacteria 1347
757 nmdc:mga03n38_29553_c1 3300050490 Bacteria 2295
758 nmdc:mga03n38_6325_c1 3300050490 Bacteria 4106
759 nmdc:mga00v17_135289_c1 3300050491 Bacteria 1577
760 nmdc:mga00v17_6957_c1 3300050491 Bacteria 6018
761 nmdc:mga00v17_99966_c1 3300050491 Bacteria 1830
762 nmdc:mga0yw44_22796_c1 3300050492 Bacteria 3517
763 nmdc:mga0yw44_38866_c1 3300050492 Bacteria 2818
764 nmdc:mga0yw44_467_c1 3300050492 Bacteria 14356
765 nmdc:mga0k408_113916_c1 3300050493 Bacteria 1599
766 nmdc:mga0k408_21121_c1 3300050493 Bacteria 3654
767 nmdc:mga06z11_16687_c1 3300050494 Bacteria 3314
768 nmdc:mga0sz30_1241_c3 3300050516 Bacteria 6851
769 Ga0500610_0026504 3300053079 Bacteria 2900
770 Ga0500610_0029999 3300053079 Bacteria 2752
771 Ga0495655_0002042 3300053083 Bacteria 3158
772 Ga0500641_0003709 3300053096 Bacteria 5394
773 Ga0500555_001043 3300053103 Bacteria 9345
774 Ga0500556_0000220 3300053104 Bacteria 46311
775 Ga0500594_0021662 3300053118 Bacteria 1614
776 Ga0500595_000738 3300053119 Bacteria 19430
777 Ga0500642_0000868 3300053130 Bacteria 8788
778 Ga0500652_052720 3300053131 Bacteria 1663
779 Ga0500658_0070660 3300053134 Bacteria 1472
780 Ga0500568_0000019 3300053139 Bacteria 195696
781 Ga0500568_0000489 3300053139 Bacteria 29208
782 Ga0500568_0018969 3300053139 Bacteria 3001
783 Ga0500568_0032134 3300053139 Bacteria 2159
784 Ga0500604_0012950 3300053151 Bacteria 2257
785 Ga0500604_0018203 3300053151 Bacteria 1955
786 Ga0500616_0005076 3300053153 Bacteria 9085
787 Ga0500616_0008291 3300053153 Bacteria 6472
788 Ga0500620_000055 3300053155 Bacteria 20744
789 Ga0500620_000167 3300053155 Bacteria 13238
790 Ga0500627_0004191 3300053158 Bacteria 4589
791 Ga0500634_0000017 3300053161 Bacteria 111983
792 Ga0501084_0019517 3300054114 Bacteria 5647
793 Ga0501082_0004262 3300060353 Bacteria 12496
794 Ga0501082_0008450 3300060353 Bacteria 8879
795 Ga0466962_0001601 3300061719 Bacteria 10603
796 Ga0466962_0001884 3300061719 Bacteria 9882

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100146032 Ga0070689_1001460322 365
2 3300049589 Ga0501073_0253121 Ga0501073_0253121_35_1177 380
3 3300025939 Ga0207665_10056974 Ga0207665_100569742 387
4 iso_pu_bacteria 2970540015 2970541772 390
5 iso_pu_bacteria 2838701080 2838701089 392
6 3300049581 Ga0501047_0080823 Ga0501047_0080823_16_1206 395
7 3300048911 Ga0496108_0171572 Ga0496108_0171572_669_1862 396
8 3300048911 Ga0496108_0155938 Ga0496108_0155938_759_1955 397
9 3300050489 nmdc:mga03683_19466_c1 nmdc:mga03683_19466_c1_1379_2575 397
10 iso_pu_bacteria 2965040258 2965046072 397
11 3300045051 Ga0451576_0110114 Ga0451576_0110114_1297_2598 400
12 iso_pu_bacteria 2838061910 2838068458 403
13 iso_pu_bacteria 2838668709 2838669250 403
14 iso_pu_bacteria 2841864319 2841868407 403
15 iso_pu_bacteria 2842146304 2842146845 403
16 iso_pu_bacteria 2842250916 2842250925 403
17 iso_pu_bacteria 2842264693 2842268459 403
18 iso_pu_bacteria 2842428310 2842432431 403
19 iso_pu_bacteria 2842434925 2842438735 403
20 iso_pu_bacteria 2842441272 2842445428 403
21 iso_pu_bacteria 2842469257 2842473350 403
22 iso_pu_bacteria 2913295892 2913301224 403
23 iso_pu_bacteria 2840764183 2840768850 404
24 iso_pu_bacteria 2958041894 2958044045 404
25 3300005347 Ga0070668_100187207 Ga0070668_1001872071 405
26 3300025972 Ga0207668_10171059 Ga0207668_101710591 405
27 3300039062 Ga0400483_132688 Ga0400483_132688_4512_5735 406
28 3300039062 Ga0400483_257466 Ga0400483_257466_4154_5377 406
29 3300039450 Ga0436363_0245198 Ga0436363_0245198_845_2212 406
30 3300039453 Ga0436362_1174928 Ga0436362_1174928_121_1485 406
31 3300026041 Ga0207639_10239364 Ga0207639_102393642 407
32 3300031616 Ga0307508_10124520 Ga0307508_101245202 407
33 3300031548 Ga0307408_100156674 Ga0307408_1001566742 408
34 3300031911 Ga0307412_10056954 Ga0307412_100569541 408
35 3300032005 Ga0307411_10023546 Ga0307411_100235464 408
36 3300032126 Ga0307415_100012352 Ga0307415_1000123524 408
37 3300050490 nmdc:mga03n38_108851_c1 nmdc:mga03n38_108851_c1_11_1240 408
38 3300050492 nmdc:mga0yw44_467_c1 nmdc:mga0yw44_467_c1_5719_7041 408
39 3300050516 nmdc:mga0sz30_1241_c3 nmdc:mga0sz30_1241_c3_1349_2671 408
40 3300053131 Ga0500652_052720 Ga0500652_052720_32_1366 408
41 3300053079 Ga0500610_0026504 Ga0500610_0026504_923_2245 409
42 3300053155 Ga0500620_000167 Ga0500620_000167_4082_5404 409
43 3300028794 Ga0307515_10000600 Ga0307515_1000060017 410
44 3300031456 Ga0307513_10001801 Ga0307513_1000180117 410
45 3300039437 Ga0436365_0244982 Ga0436365_0244982_21371_22612 410
46 3300039450 Ga0436363_0002125 Ga0436363_0002125_8193_9434 410
47 3300039453 Ga0436362_0100789 Ga0436362_0100789_640_1881 410
48 3300044719 Ga0466971_0034091 Ga0466971_0034091_1000_2235 410
49 3300028379 Ga0268266_10065643 Ga0268266_100656432 411
50 3300046689 Ga0495613_0008295 Ga0495613_0008295_6452_7702 414
51 3300006051 Ga0075364_10007855 Ga0075364_100078552 416
52 3300050491 nmdc:mga00v17_99966_c1 nmdc:mga00v17_99966_c1_164_1486 416
53 3300037312 Ga0395899_0000036 Ga0395899_0000036_241928_243259 419
54 3300037418 Ga0395900_0000872 Ga0395900_0000872_9089_10420 419
55 3300037466 Ga0395898_0000626 Ga0395898_0000626_17649_18980 419
56 3300025228 Ga0209672_100330 Ga0209672_1003309 422
57 3300049571 Ga0501034_0019824 Ga0501034_0019824_4838_6157 422
58 3300049579 Ga0501043_0025732 Ga0501043_0025732_1801_3114 423
59 3300049587 Ga0501071_0128426 Ga0501071_0128426_293_1606 423
60 3300049589 Ga0501073_0023174 Ga0501073_0023174_2044_3402 423
61 3300049590 Ga0501074_0034107 Ga0501074_0034107_1634_2947 423
62 3300049591 Ga0501075_0001104 Ga0501075_0001104_9205_10518 423
63 3300049592 Ga0501076_0004052 Ga0501076_0004052_5331_6644 423
64 3300049593 Ga0501077_0020854 Ga0501077_0020854_2192_3505 423
65 3300049741 Ga0501079_0003253 Ga0501079_0003253_1504_2817 423
66 3300049743 Ga0501081_0001170 Ga0501081_0001170_2650_3963 423
67 3300054114 Ga0501084_0019517 Ga0501084_0019517_2198_3511 423
68 3300060353 Ga0501082_0004262 Ga0501082_0004262_6532_7845 423
69 3300041413 Ga0439465_0004781 Ga0439465_0004781_2358_3638 425
70 3300036401 Ga0373937_0010034 Ga0373937_0010034_883_2241 426
71 3300053104 Ga0500556_0000220 Ga0500556_0000220_14197_15531 426
72 3300009177 Ga0105248_10081104 Ga0105248_100811042 427
73 3300028654 Ga0265322_10005386 Ga0265322_100053862 427
74 3300031235 Ga0265330_10001752 Ga0265330_100017524 427
75 3300031242 Ga0265329_10000755 Ga0265329_100007555 427
76 3300031344 Ga0265316_10029152 Ga0265316_100291524 427
77 3300031712 Ga0265342_10000868 Ga0265342_1000086817 427
78 3300035695 Ga0373927_0116804 Ga0373927_0116804_180_1535 427
79 3300035725 Ga0373947_0008837 Ga0373947_0008837_2302_3657 427
80 3300037068 Ga0373925_0031977 Ga0373925_0031977_482_1837 427
81 3300025941 Ga0207711_10037332 Ga0207711_100373324 428
82 3300047472 Ga0495686_0090188 Ga0495686_0090188_161_1492 428
83 3300049569 Ga0501032_0006640 Ga0501032_0006640_4113_5435 428
84 3300049570 Ga0501033_0000334 Ga0501033_0000334_5073_6395 428
85 3300049573 Ga0501037_0000035 Ga0501037_0000035_94851_96173 428
86 3300049579 Ga0501043_0000031 Ga0501043_0000031_19885_21207 428
87 3300049585 Ga0501069_0000056 Ga0501069_0000056_28365_29687 428
88 3300049586 Ga0501070_0000141 Ga0501070_0000141_28367_29689 428
89 3300049590 Ga0501074_0000223 Ga0501074_0000223_6290_7612 428
90 3300049742 Ga0501080_0016746 Ga0501080_0016746_248_1570 428
91 3300049744 Ga0501083_0000098 Ga0501083_0000098_42289_43611 428
92 3300049822 Ga0501035_0000036 Ga0501035_0000036_134270_135592 428
93 3300049823 Ga0501044_0000011 Ga0501044_0000011_242984_244306 428
94 3300005344 Ga0070661_100099493 Ga0070661_1000994932 429
95 3300005578 Ga0068854_100076819 Ga0068854_1000768193 429
96 3300005616 Ga0068852_100013701 Ga0068852_1000137015 429
97 3300013102 Ga0157371_10012188 Ga0157371_100121885 429
98 3300013104 Ga0157370_10053070 Ga0157370_100530704 429
99 3300013307 Ga0157372_10265638 Ga0157372_102656383 429
100 3300025920 Ga0207649_10057662 Ga0207649_100576622 429
101 3300026041 Ga0207639_10016779 Ga0207639_100167795 429
102 3300026067 Ga0207678_10203829 Ga0207678_102038291 429
103 3300026142 Ga0207698_10025428 Ga0207698_100254283 429
104 3300037312 Ga0395899_0065027 Ga0395899_0065027_708_2042 429
105 3300038443 Ga0395901_0100135 Ga0395901_0100135_1004_2338 429
106 3300053118 Ga0500594_0021662 Ga0500594_0021662_284_1579 429
107 iso_pu_bacteria 2767802442 2770200461 429
108 iso_pu_bacteria 637000159 637078464 429
109 3300032002 Ga0307416_100040290 Ga0307416_1000402903 430
110 3300049569 Ga0501032_0098083 Ga0501032_0098083_23_1324 431
111 3300005985 Ga0081539_10060736 Ga0081539_100607362 432
112 3300049571 Ga0501034_0025999 Ga0501034_0025999_1400_2716 432
113 iso_pu_bacteria 2856349417 2856349597 432
114 iso_pu_bacteria 2881155292 2881158464 432
115 iso_pu_bacteria 2881853255 2881854719 432
116 iso_pu_bacteria 2885342637 2885349512 432
117 iso_pu_bacteria 2885350715 2885357677 432
118 iso_pu_bacteria 2508501123 2509116856 433
119 iso_pu_bacteria 2510065059 2510316368 433
120 iso_pu_bacteria 2513237090 2513612396 433
121 iso_pu_bacteria 2534681786 2535486913 433
122 iso_pu_bacteria 2643221550 2643772461 433
123 iso_pu_bacteria 2643221551 2643778032 433
124 iso_pu_bacteria 2643221555 2643796480 433
125 iso_pu_bacteria 2643221564 2643837887 433
126 iso_pu_bacteria 2738543024 2739307116 433
127 iso_pu_bacteria 2751185800 2753360023 433
128 iso_pu_bacteria 2758568016 2758642342 433
129 iso_pu_bacteria 2837678835 2837681274 433
130 iso_pu_bacteria 2839993093 2839997400 433
131 iso_pu_bacteria 2841734538 2841735657 433
132 iso_pu_bacteria 2844009547 2844009884 433
133 iso_pu_bacteria 2847670302 2847672649 433
134 iso_pu_bacteria 2854911287 2854912692 433
135 iso_pu_bacteria 2856314179 2856315126 433
136 iso_pu_bacteria 2856320880 2856328195 433
137 iso_pu_bacteria 2856342000 2856344833 433
138 iso_pu_bacteria 2856356410 2856358772 433
139 iso_pu_bacteria 2869162929 2869167309 433
140 iso_pu_bacteria 2869169390 2869175855 433
141 iso_pu_bacteria 2869242130 2869244400 433
142 iso_pu_bacteria 2869256925 2869259814 433
143 iso_pu_bacteria 2869278585 2869284270 433
144 iso_pu_bacteria 2871474448 2871480634 433
145 iso_pu_bacteria 2871481445 2871486483 433
146 iso_pu_bacteria 2871488783 2871490111 433
147 iso_pu_bacteria 2871495908 2871502020 433
148 iso_pu_bacteria 2874116593 2874121253 433
149 iso_pu_bacteria 2874123672 2874125284 433
150 iso_pu_bacteria 2874139085 2874139267 433
151 iso_pu_bacteria 2876386047 2876391820 433
152 iso_pu_bacteria 2876392853 2876393754 433
153 iso_pu_bacteria 2876420981 2876421499 433
154 iso_pu_bacteria 2878035449 2878042016 433
155 iso_pu_bacteria 2878730984 2878733393 433
156 iso_pu_bacteria 2878738818 2878740114 433
157 iso_pu_bacteria 2878753008 2878753204 433
158 iso_pu_bacteria 2878760144 2878765743 433
159 iso_pu_bacteria 2878767105 2878772417 433
160 iso_pu_bacteria 2878788777 2878789281 433
161 iso_pu_bacteria 2881147464 2881154705 433
162 iso_pu_bacteria 2881161766 2881164116 433
163 iso_pu_bacteria 2881845957 2881848162 433
164 iso_pu_bacteria 2881861095 2881862743 433
165 iso_pu_bacteria 2882632389 2882634339 433
166 iso_pu_bacteria 2882912400 2882915444 433
167 iso_pu_bacteria 2885318864 2885319173 433
168 iso_pu_bacteria 2888337043 2888342487 433
169 iso_pu_bacteria 2903492973 2903498032 433
170 iso_pu_bacteria 2903540706 2903546689 433
171 iso_pu_bacteria 2904659560 2904660479 433
172 iso_pu_bacteria 2906401398 2906401713 433
173 iso_pu_bacteria 2906414383 2906415123 433
174 iso_pu_bacteria 2906427513 2906432928 433
175 iso_pu_bacteria 2915650412 2915653411 433
176 iso_pu_bacteria 2919119836 2919124325 433
177 iso_pu_bacteria 2924710171 2924717362 433
178 iso_pu_bacteria 2924718760 2924723820 433
179 iso_pu_bacteria 2924741084 2924744566 433
180 iso_pu_bacteria 2924762789 2924767151 433
181 iso_pu_bacteria 2924776078 2924777713 433
182 iso_pu_bacteria 2924784321 2924791199 433
183 iso_pu_bacteria 2937836603 2937837080 433
184 iso_pu_bacteria 2937848649 2937850852 433
185 iso_pu_bacteria 2937861824 2937868449 433
186 iso_pu_bacteria 2937877337 2937883931 433
187 iso_pu_bacteria 2937972304 2937976682 433
188 iso_pu_bacteria 2937994558 2938000548 433
189 iso_pu_bacteria 2954011201 2954012315 433
190 iso_pu_bacteria 2958034702 2958038368 433
191 iso_pu_bacteria 2958041894 2958055978 433
192 iso_pu_bacteria 2958064165 2958066482 433
193 iso_pu_bacteria 2958071322 2958076490 433
194 iso_pu_bacteria 2958084443 2958091209 433
195 iso_pu_bacteria 2958092219 2958100278 433
196 iso_pu_bacteria 2958108152 2958113523 433
197 iso_pu_bacteria 2958144490 2958146768 433
198 iso_pu_bacteria 2958165035 2958170919 433
199 iso_pu_bacteria 2961114664 2961120801 433
200 iso_pu_bacteria 2961163497 2961169363 433
201 iso_pu_bacteria 2961170736 2961177028 433
202 iso_pu_bacteria 2961183825 2961187293 433
203 iso_pu_bacteria 2965018300 2965023615 433
204 iso_pu_bacteria 2967996073 2968002846 433
205 iso_pu_bacteria 2968003550 2968005243 433
206 iso_pu_bacteria 2968016561 2968021327 433
207 iso_pu_bacteria 2968110612 2968111538 433
208 iso_pu_bacteria 2968171901 2968177753 433
209 iso_pu_bacteria 2970469710 2970476432 433
210 iso_pu_bacteria 2970489779 2970493843 433
211 iso_pu_bacteria 2970503327 2970509701 433
212 iso_pu_bacteria 2970510686 2970515404 433
213 iso_pu_bacteria 2970524798 2970527763 433
214 iso_pu_bacteria 2970554993 2970560599 433
215 iso_pu_bacteria 2970593180 2970598886 433
216 iso_pu_bacteria 2970619444 2970620348 433
217 iso_pu_bacteria 2970627176 2970628747 433
218 iso_pu_bacteria 2977821940 2977822136 433
219 iso_pu_bacteria 2977828996 2977836959 433
220 iso_pu_bacteria 2977851361 2977851776 433
221 iso_pu_bacteria 2977898635 2977907029 433
222 iso_pu_bacteria 2977907340 2977914774 433
223 iso_pu_bacteria 2977922695 2977923828 433
224 iso_pu_bacteria 2979772303 2979778012 433
225 iso_pu_bacteria 2979808191 2979814488 433
226 iso_pu_bacteria 2987659509 2987665659 433
227 iso_pu_bacteria 2987666974 2987671104 433
228 iso_pu_bacteria 2996386984 2996387917 433
229 iso_pu_bacteria 3004167301 3004172330 433
230 iso_pu_bacteria 3004188549 3004194551 433
231 iso_pu_bacteria 3004211236 3004213266 433
232 iso_pu_bacteria 3004218560 3004221338 433
233 iso_pu_bacteria 3004232784 3004238593 433
234 iso_pu_bacteria 3004248173 3004251057 433
235 iso_pu_bacteria 3004268573 3004271638 433
236 iso_pu_bacteria 3004289098 3004293436 433
237 iso_pu_bacteria 3004334049 3004338331 433
238 iso_pu_bacteria 8004374579 8004374775 433
239 iso_pu_bacteria 8004633249 8004635715 433
240 iso_pu_bacteria 8004640170 8004645328 433
241 iso_pu_bacteria 8004727605 8004731414 433
242 iso_pu_bacteria 8045864390 8045867390 433
243 3300021388 Ga0213875_10004301 Ga0213875_100043013 434
244 3300025934 Ga0207686_10150833 Ga0207686_101508331 434
245 3300048922 Ga0496119_0001526 Ga0496119_0001526_23487_24821 434
246 iso_pu_bacteria 2508501127 2509145609 434
247 iso_pu_bacteria 2509276018 2509372636 434
248 iso_pu_bacteria 2511231027 2511388449 434
249 iso_pu_bacteria 2512875016 2512928765 434
250 iso_pu_bacteria 2512875024 2512963502 434
251 iso_pu_bacteria 2512875024 2512963740 434
252 iso_pu_bacteria 2513237164 2514039389 434
253 iso_pu_bacteria 2513237305 2514419622 434
254 iso_pu_bacteria 2588253730 2588514309 434
255 iso_pu_bacteria 2643221591 2643966349 434
256 iso_pu_bacteria 2643221595 2643989882 434
257 iso_pu_bacteria 2643221627 2644153534 434
258 iso_pu_bacteria 2687453392 2688597725 434
259 iso_pu_bacteria 2721755686 2723578275 434
260 iso_pu_bacteria 2751185800 2753356988 434
261 iso_pu_bacteria 2756170246 2756676378 434
262 iso_pu_bacteria 2757320392 2757572538 434
263 iso_pu_bacteria 2758568016 2758640534 434
264 iso_pu_bacteria 2775506902 2776267712 434
265 iso_pu_bacteria 2775506902 2776270538 434
266 iso_pu_bacteria 2775506904 2776281541 434
267 iso_pu_bacteria 2791355123 2792750152 434
268 iso_pu_bacteria 2842871566 2842875442 434
269 iso_pu_bacteria 2844002411 2844004323 434
270 iso_pu_bacteria 2854911287 2854916007 434
271 iso_pu_bacteria 2856328259 2856332249 434
272 iso_pu_bacteria 2856334872 2856338799 434
273 iso_pu_bacteria 2857367948 2857369527 434
274 iso_pu_bacteria 2869249662 2869250769 434
275 iso_pu_bacteria 2869264136 2869269584 434
276 iso_pu_bacteria 2869271264 2869272639 434
277 iso_pu_bacteria 2871435913 2871439175 434
278 iso_pu_bacteria 2871451962 2871458947 434
279 iso_pu_bacteria 2871459585 2871459702 434
280 iso_pu_bacteria 2871466892 2871473922 434
281 iso_pu_bacteria 2874131515 2874138422 434
282 iso_pu_bacteria 2874162495 2874167539 434
283 iso_pu_bacteria 2874168670 2874170924 434
284 iso_pu_bacteria 2876363079 2876369192 434
285 iso_pu_bacteria 2876399893 2876404423 434
286 iso_pu_bacteria 2876406927 2876410644 434
287 iso_pu_bacteria 2878774303 2878780759 434
288 iso_pu_bacteria 2885312484 2885318846 434
289 iso_pu_bacteria 2894652903 2894655868 434
290 iso_pu_bacteria 2894817345 2894817950 434
291 iso_pu_bacteria 2903448605 2903449400 434
292 iso_pu_bacteria 2903521522 2903526340 434
293 iso_pu_bacteria 2903528002 2903529627 434
294 iso_pu_bacteria 2906363423 2906365368 434
295 iso_pu_bacteria 2906370794 2906371302 434
296 iso_pu_bacteria 2906378014 2906385316 434
297 iso_pu_bacteria 2906386501 2906387450 434
298 iso_pu_bacteria 2906393657 2906394829 434
299 iso_pu_bacteria 2906408224 2906411419 434
300 iso_pu_bacteria 2909042592 2909044422 434
301 iso_pu_bacteria 2919119836 2919123245 434
302 iso_pu_bacteria 2922172374 2922175170 434
303 iso_pu_bacteria 2922178524 2922179538 434
304 iso_pu_bacteria 2924748358 2924749159 434
305 iso_pu_bacteria 2928521798 2928526544 434
306 iso_pu_bacteria 2937822353 2937828753 434
307 iso_pu_bacteria 2958122699 2958125050 434
308 iso_pu_bacteria 2958137437 2958139364 434
309 iso_pu_bacteria 2958158011 2958160299 434
310 iso_pu_bacteria 2961136820 2961137144 434
311 iso_pu_bacteria 2963644680 2963650468 434
312 iso_pu_bacteria 2965025482 2965029056 434
313 iso_pu_bacteria 2965040258 2965047612 434
314 iso_pu_bacteria 2965047637 2965048713 434
315 iso_pu_bacteria 2965089291 2965095545 434
316 iso_pu_bacteria 2965102966 2965106883 434
317 iso_pu_bacteria 2965110997 2965115555 434
318 iso_pu_bacteria 2968083720 2968085641 434
319 iso_pu_bacteria 2970547951 2970554109 434
320 iso_pu_bacteria 2977872689 2977875802 434
321 iso_pu_bacteria 2977915119 2977917976 434
322 iso_pu_bacteria 2977935797 2977940114 434
323 iso_pu_bacteria 2977950692 2977953485 434
324 iso_pu_bacteria 2977986579 2977990013 434
325 iso_pu_bacteria 2987645492 2987649499 434
326 iso_pu_bacteria 2987673487 2987679945 434
327 iso_pu_bacteria 2996336353 2996337120 434
328 iso_pu_bacteria 3000135777 3000142406 434
329 iso_pu_bacteria 3002141150 3002144850 434
330 iso_pu_bacteria 3002141150 3002146384 434
331 iso_pu_bacteria 3004195979 3004197315 434
332 iso_pu_bacteria 3004239961 3004247142 434
333 iso_pu_bacteria 649633066 649872267 434
334 iso_pu_bacteria 8004300914 8004307295 434
335 iso_pu_bacteria 8004361976 8004362019 434
336 iso_pu_bacteria 8004695233 8004699051 434
337 iso_pu_bacteria 8055617313 8055619039 434
338 3300005937 Ga0081455_10070723 Ga0081455_100707231 435
339 3300032168 Ga0316593_10014798 Ga0316593_100147981 435
340 3300037471 Ga0395905_0047736 Ga0395905_0047736_17_1327 435
341 iso_pu_bacteria 2643221674 2644413181 435
342 iso_pu_bacteria 2721755686 2723577835 435
343 iso_pu_bacteria 2841734538 2841735206 435
344 iso_pu_bacteria 2847670302 2847672198 435
345 iso_pu_bacteria 2847686936 2847688549 435
346 iso_pu_bacteria 2856314179 2856316867 435
347 iso_pu_bacteria 2856342000 2856349347 435
348 iso_pu_bacteria 2856356410 2856362269 435
349 iso_pu_bacteria 2856356410 2856363035 435
350 iso_pu_bacteria 2871444079 2871447563 435
351 iso_pu_bacteria 2871474448 2871481410 435
352 iso_pu_bacteria 2871488783 2871489606 435
353 iso_pu_bacteria 2871488783 2871492672 435
354 iso_pu_bacteria 2871495908 2871499209 435
355 iso_pu_bacteria 2874102143 2874104265 435
356 iso_pu_bacteria 2874123672 2874126578 435
357 iso_pu_bacteria 2876369609 2876373055 435
358 iso_pu_bacteria 2878035449 2878037117 435
359 iso_pu_bacteria 2878753008 2878753990 435
360 iso_pu_bacteria 2878753008 2878758553 435
361 iso_pu_bacteria 2878760144 2878763399 435
362 iso_pu_bacteria 2878767105 2878770397 435
363 iso_pu_bacteria 2881147464 2881154166 435
364 iso_pu_bacteria 2881155292 2881157897 435
365 iso_pu_bacteria 2881161766 2881163238 435
366 iso_pu_bacteria 2881845957 2881850919 435
367 iso_pu_bacteria 2881861095 2881863750 435
368 iso_pu_bacteria 2881861095 2881866808 435
369 iso_pu_bacteria 2882632389 2882639895 435
370 iso_pu_bacteria 2882912400 2882913447 435
371 iso_pu_bacteria 2882912400 2882916919 435
372 iso_pu_bacteria 2885305155 2885312198 435
373 iso_pu_bacteria 2885312484 2885315733 435
374 iso_pu_bacteria 2885318864 2885324557 435
375 iso_pu_bacteria 2885318864 2885325735 435
376 iso_pu_bacteria 2885334103 2885336146 435
377 iso_pu_bacteria 2885342637 2885345992 435
378 iso_pu_bacteria 2885350715 2885352252 435
379 iso_pu_bacteria 2888343758 2888349222 435
380 iso_pu_bacteria 2903492973 2903494708 435
381 iso_pu_bacteria 2903492973 2903496596 435
382 iso_pu_bacteria 2903540706 2903544014 435
383 iso_pu_bacteria 2904659560 2904665550 435
384 iso_pu_bacteria 2906328253 2906331710 435
385 iso_pu_bacteria 2906414383 2906416922 435
386 iso_pu_bacteria 2922158528 2922160939 435
387 iso_pu_bacteria 2924726620 2924731327 435
388 iso_pu_bacteria 2924754689 2924760066 435
389 iso_pu_bacteria 2924762789 2924766214 435
390 iso_pu_bacteria 2924784321 2924785130 435
391 iso_pu_bacteria 2924784321 2924788935 435
392 iso_pu_bacteria 2932401849 2932405980 435
393 iso_pu_bacteria 2937836603 2937840421 435
394 iso_pu_bacteria 2937891427 2937893780 435
395 iso_pu_bacteria 2937994558 2937997860 435
396 iso_pu_bacteria 2958071322 2958075794 435
397 iso_pu_bacteria 2958115193 2958115876 435
398 iso_pu_bacteria 2958165035 2958168334 435
399 iso_pu_bacteria 2961114664 2961120550 435
400 iso_pu_bacteria 2961127735 2961132186 435
401 iso_pu_bacteria 2961163497 2961166798 435
402 iso_pu_bacteria 2961170736 2961171623 435
403 iso_pu_bacteria 2961170736 2961173252 435
404 iso_pu_bacteria 2965018300 2965021622 435
405 iso_pu_bacteria 2965062239 2965068344 435
406 iso_pu_bacteria 2967996073 2967996672 435
407 iso_pu_bacteria 2967996073 2967998423 435
408 iso_pu_bacteria 2968003550 2968006151 435
409 iso_pu_bacteria 2968003550 2968010116 435
410 iso_pu_bacteria 2968091066 2968095493 435
411 iso_pu_bacteria 2968097103 2968103291 435
412 iso_pu_bacteria 2968110612 2968117017 435
413 iso_pu_bacteria 2968128360 2968128393 435
414 iso_pu_bacteria 2968171901 2968175204 435
415 iso_pu_bacteria 2970503327 2970504219 435
416 iso_pu_bacteria 2970503327 2970505846 435
417 iso_pu_bacteria 2970524798 2970531185 435
418 iso_pu_bacteria 2970540015 2970544734 435
419 iso_pu_bacteria 2970554993 2970558242 435
420 iso_pu_bacteria 2977821940 2977823206 435
421 iso_pu_bacteria 2977821940 2977827087 435
422 iso_pu_bacteria 2977828996 2977831110 435
423 iso_pu_bacteria 2977828996 2977832713 435
424 iso_pu_bacteria 2977858184 2977863677 435
425 iso_pu_bacteria 2977864932 2977870484 435
426 iso_pu_bacteria 2979808191 2979808856 435
427 iso_pu_bacteria 2979808191 2979810567 435
428 iso_pu_bacteria 2987659509 2987662810 435
429 iso_pu_bacteria 2987666974 2987670706 435
430 iso_pu_bacteria 2996310559 2996315903 435
431 iso_pu_bacteria 2996341866 2996342679 435
432 iso_pu_bacteria 3004188549 3004191862 435
433 iso_pu_bacteria 8004374579 8004375567 435
434 iso_pu_bacteria 8004374579 8004380070 435
435 iso_pu_bacteria 8004395343 8004397031 435
436 iso_pu_bacteria 8004633249 8004637931 435
437 iso_pu_bacteria 8004703790 8004704115 435
438 iso_pu_bacteria 8018150411 8018150623 435
439 iso_pu_bacteria 8055617313 8055623644 435
440 3300005347 Ga0070668_100002303 Ga0070668_1000023033 436
441 3300005983 Ga0081540_1011720 Ga0081540_10117202 436
442 3300009093 Ga0105240_10143184 Ga0105240_101431842 436
443 3300025913 Ga0207695_10088252 Ga0207695_100882523 436
444 3300025913 Ga0207695_10103333 Ga0207695_101033333 436
445 3300025972 Ga0207668_10001564 Ga0207668_100015643 436
446 3300028794 Ga0307515_10003037 Ga0307515_1000303724 436
447 3300035695 Ga0373927_0121836 Ga0373927_0121836_16_1341 436
448 3300037312 Ga0395899_0000217 Ga0395899_0000217_2625_3941 436
449 3300037418 Ga0395900_0000270 Ga0395900_0000270_2625_3941 436
450 3300037466 Ga0395898_0000470 Ga0395898_0000470_3362_4678 436
451 3300037471 Ga0395905_0000253 Ga0395905_0000253_76106_77422 436
452 3300038443 Ga0395901_0000285 Ga0395901_0000285_58904_60220 436
453 3300044901 Ga0466960_0007399 Ga0466960_0007399_2943_4259 436
454 3300048922 Ga0496119_0008324 Ga0496119_0008324_3595_4911 436
455 3300048926 Ga0496123_0032777 Ga0496123_0032777_2191_3507 436
456 3300048928 Ga0496125_0001362 Ga0496125_0001362_21137_22450 436
457 3300048928 Ga0496125_0107130 Ga0496125_0107130_15_1331 436
458 3300049573 Ga0501037_0035735 Ga0501037_0035735_1248_2561 436
459 3300053139 Ga0500568_0000489 Ga0500568_0000489_8942_10261 436
460 iso_pu_bacteria 2512047086 2512528675 436
461 iso_pu_bacteria 2516143018 2516207677 436
462 iso_pu_bacteria 2524023207 2524453233 436
463 iso_pu_bacteria 2643221623 2644129442 436
464 iso_pu_bacteria 2718217927 2719389203 436
465 iso_pu_bacteria 2718218423 2721401970 436
466 iso_pu_bacteria 2721755809 2724035803 436
467 iso_pu_bacteria 2721755823 2724113337 436
468 iso_pu_bacteria 2791355256 2793299072 436
469 iso_pu_bacteria 2791355261 2793331919 436
470 iso_pu_bacteria 2791355262 2793336933 436
471 iso_pu_bacteria 2791355263 2793340865 436
472 iso_pu_bacteria 2838729681 2838733519 436
473 iso_pu_bacteria 2838742623 2838746189 436
474 iso_pu_bacteria 2841851746 2841858101 436
475 iso_pu_bacteria 2842229732 2842234307 436
476 iso_pu_bacteria 2842243621 2842247829 436
477 iso_pu_bacteria 2842257432 2842259424 436
478 iso_pu_bacteria 2842395702 2842402067 436
479 iso_pu_bacteria 2844454524 2844459751 436
480 iso_pu_bacteria 2891373044 2891375663 436
481 iso_pu_bacteria 2936381700 2936384354 436
482 iso_pu_bacteria 2961127735 2961136766 436
483 iso_pu_bacteria 2989776772 2989781421 436
484 iso_pu_bacteria 643692032 643823793 436
485 iso_pu_bacteria 8002285264 8002289098 436
486 iso_pu_bacteria 8005275841 8005277545 436
487 iso_pu_bacteria 8005382845 8005382883 436
488 iso_pu_bacteria 8005395548 8005398488 436
489 iso_pu_bacteria 8005430974 8005436489 436
490 iso_pu_bacteria 8005626139 8005629688 436
491 iso_pu_bacteria 8005695170 8005701056 436
492 iso_pu_bacteria 8018176218 8018179201 436
493 iso_pu_bacteria 8024501048 8024505685 436
494 3300005339 Ga0070660_100004532 Ga0070660_1000045323 437
495 3300005339 Ga0070660_100110075 Ga0070660_1001100752 437
496 3300005344 Ga0070661_100002388 Ga0070661_1000023885 437
497 3300005344 Ga0070661_100019583 Ga0070661_1000195836 437
498 3300005539 Ga0068853_100000517 Ga0068853_1000005176 437
499 3300005563 Ga0068855_100207408 Ga0068855_1002074082 437
500 3300005834 Ga0068851_10001016 Ga0068851_100010168 437
501 3300006038 Ga0075365_10078577 Ga0075365_100785772 437
502 3300006048 Ga0075363_100066087 Ga0075363_1000660872 437
503 3300006177 Ga0075362_10020779 Ga0075362_100207792 437
504 3300006353 Ga0075370_10050746 Ga0075370_100507462 437
505 3300009551 Ga0105238_10004964 Ga0105238_100049648 437
506 3300010375 Ga0105239_10010565 Ga0105239_100105659 437
507 3300025321 Ga0207656_10000583 Ga0207656_100005835 437
508 3300025909 Ga0207705_10106962 Ga0207705_101069621 437
509 3300025913 Ga0207695_10143562 Ga0207695_101435622 437
510 3300025919 Ga0207657_10000522 Ga0207657_1000052231 437
511 3300025919 Ga0207657_10069011 Ga0207657_100690112 437
512 3300025920 Ga0207649_10001900 Ga0207649_100019008 437
513 3300025924 Ga0207694_10068887 Ga0207694_100688873 437
514 3300025938 Ga0207704_10110404 Ga0207704_101104042 437
515 3300025949 Ga0207667_10018838 Ga0207667_100188381 437
516 3300026041 Ga0207639_10000537 Ga0207639_1000053719 437
517 3300026067 Ga0207678_10028324 Ga0207678_100283246 437
518 3300026116 Ga0207674_10030401 Ga0207674_100304012 437
519 3300026142 Ga0207698_10126249 Ga0207698_101262491 437
520 3300031251 Ga0265327_10032158 Ga0265327_100321582 437
521 3300031852 Ga0307410_10006982 Ga0307410_100069824 437
522 3300032004 Ga0307414_10058099 Ga0307414_100580991 437
523 3300037068 Ga0373925_0140635 Ga0373925_0140635_493_1824 437
524 3300037312 Ga0395899_0037973 Ga0395899_0037973_1518_2849 437
525 3300044842 Ga0466957_0072670 Ga0466957_0072670_498_1829 437
526 3300046660 Ga0495625_0023432 Ga0495625_0023432_1559_2872 437
527 3300046694 Ga0495649_0095898 Ga0495649_0095898_147_1460 437
528 3300048915 Ga0496112_0295672 Ga0496112_0295672_208_1521 437
529 3300048922 Ga0496119_0030431 Ga0496119_0030431_260_1579 437
530 3300048925 Ga0496122_0011460 Ga0496122_0011460_7281_8600 437
531 3300048925 Ga0496122_0030297 Ga0496122_0030297_2783_4171 437
532 3300048926 Ga0496123_0018083 Ga0496123_0018083_655_1974 437
533 3300048928 Ga0496125_0032187 Ga0496125_0032187_178_1566 437
534 3300048928 Ga0496125_0038629 Ga0496125_0038629_1180_2568 437
535 3300048928 Ga0496125_0070130 Ga0496125_0070130_1180_2499 437
536 3300049568 Ga0501031_0086033 Ga0501031_0086033_242_1561 437
537 3300049569 Ga0501032_0044497 Ga0501032_0044497_302_1633 437
538 3300049570 Ga0501033_0085604 Ga0501033_0085604_854_2173 437
539 3300049571 Ga0501034_0018012 Ga0501034_0018012_1787_3100 437
540 3300049571 Ga0501034_0068252 Ga0501034_0068252_1725_3056 437
541 3300049571 Ga0501034_0126952 Ga0501034_0126952_745_2076 437
542 3300049571 Ga0501034_0253866 Ga0501034_0253866_287_1627 437
543 3300049574 Ga0501038_0043054 Ga0501038_0043054_658_1989 437
544 3300049574 Ga0501038_0052644 Ga0501038_0052644_265_1584 437
545 3300049575 Ga0501039_0086332 Ga0501039_0086332_24_1343 437
546 3300049579 Ga0501043_0032472 Ga0501043_0032472_179_1510 437
547 3300049584 Ga0501068_0065393 Ga0501068_0065393_443_1762 437
548 3300049586 Ga0501070_0141751 Ga0501070_0141751_500_1831 437
549 3300049822 Ga0501035_0019154 Ga0501035_0019154_941_2260 437
550 3300049822 Ga0501035_0031137 Ga0501035_0031137_2043_3413 437
551 3300049822 Ga0501035_0031401 Ga0501035_0031401_2850_4169 437
552 3300049822 Ga0501035_0171446 Ga0501035_0171446_492_1823 437
553 3300049822 Ga0501035_0260778 Ga0501035_0260778_21_1370 437
554 3300049823 Ga0501044_0031017 Ga0501044_0031017_1976_3346 437
555 3300050489 nmdc:mga03683_3365_c1 nmdc:mga03683_3365_c1_2259_3584 437
556 3300050490 nmdc:mga03n38_6325_c1 nmdc:mga03n38_6325_c1_2326_3651 437
557 3300050491 nmdc:mga00v17_135289_c1 nmdc:mga00v17_135289_c1_221_1552 437
558 3300050493 nmdc:mga0k408_21121_c1 nmdc:mga0k408_21121_c1_207_1538 437
559 3300053079 Ga0500610_0029999 Ga0500610_0029999_959_2272 437
560 3300053083 Ga0495655_0002042 Ga0495655_0002042_1819_3132 437
561 3300053155 Ga0500620_000055 Ga0500620_000055_3179_4504 437
562 3300053161 Ga0500634_0000017 Ga0500634_0000017_7637_8953 437
563 iso_pu_bacteria 2503198000 2503199515 437
564 iso_pu_bacteria 2508501123 2509113530 437
565 iso_pu_bacteria 2509276022 2509394449 437
566 iso_pu_bacteria 2510065059 2510320245 437
567 iso_pu_bacteria 2512875016 2512933081 437
568 iso_pu_bacteria 2512875024 2512961127 437
569 iso_pu_bacteria 2513237090 2513611695 437
570 iso_pu_bacteria 2513237164 2514035179 437
571 iso_pu_bacteria 2513237305 2514420990 437
572 iso_pu_bacteria 2513237351 2514591405 437
573 iso_pu_bacteria 2599185301 2599937486 437
574 iso_pu_bacteria 2643221595 2643988144 437
575 iso_pu_bacteria 2643221627 2644155139 437
576 iso_pu_bacteria 2687453392 2688596776 437
577 iso_pu_bacteria 2693429783 2694633875 437
578 iso_pu_bacteria 2693429784 2694637720 437
579 iso_pu_bacteria 2721755686 2723578004 437
580 iso_pu_bacteria 2756170246 2756674210 437
581 iso_pu_bacteria 2791355123 2792750489 437
582 iso_pu_bacteria 2844002411 2844009267 437
583 iso_pu_bacteria 2844009547 2844012032 437
584 iso_pu_bacteria 2856320880 2856324137 437
585 iso_pu_bacteria 2856328259 2856329649 437
586 iso_pu_bacteria 2856334872 2856339428 437
587 iso_pu_bacteria 2856364286 2856368578 437
588 iso_pu_bacteria 2857349434 2857355451 437
589 iso_pu_bacteria 2857367948 2857374405 437
590 iso_pu_bacteria 2869169390 2869170828 437
591 iso_pu_bacteria 2869234852 2869235573 437
592 iso_pu_bacteria 2869242130 2869248542 437
593 iso_pu_bacteria 2869249662 2869256525 437
594 iso_pu_bacteria 2869256925 2869259129 437
595 iso_pu_bacteria 2869264136 2869266927 437
596 iso_pu_bacteria 2869278585 2869285571 437
597 iso_pu_bacteria 2869285874 2869292006 437
598 iso_pu_bacteria 2871429161 2871435213 437
599 iso_pu_bacteria 2871451962 2871456904 437
600 iso_pu_bacteria 2871459585 2871461701 437
601 iso_pu_bacteria 2871466892 2871470282 437
602 iso_pu_bacteria 2871481445 2871481873 437
603 iso_pu_bacteria 2874109183 2874112408 437
604 iso_pu_bacteria 2874116593 2874118141 437
605 iso_pu_bacteria 2874131515 2874138299 437
606 iso_pu_bacteria 2874139085 2874146187 437
607 iso_pu_bacteria 2874146452 2874151137 437
608 iso_pu_bacteria 2874155637 2874161164 437
609 iso_pu_bacteria 2874162495 2874165266 437
610 iso_pu_bacteria 2874168670 2874175791 437
611 iso_pu_bacteria 2876363079 2876364672 437
612 iso_pu_bacteria 2876386047 2876389650 437
613 iso_pu_bacteria 2876399893 2876401344 437
614 iso_pu_bacteria 2876406927 2876409954 437
615 iso_pu_bacteria 2876413966 2876417157 437
616 iso_pu_bacteria 2876420981 2876421245 437
617 iso_pu_bacteria 2878730984 2878735715 437
618 iso_pu_bacteria 2878738818 2878741229 437
619 iso_pu_bacteria 2878745973 2878752348 437
620 iso_pu_bacteria 2878774303 2878775438 437
621 iso_pu_bacteria 2878781027 2878783239 437
622 iso_pu_bacteria 2888337043 2888337893 437
623 iso_pu_bacteria 2888350351 2888357060 437
624 iso_pu_bacteria 2889010040 2889012074 437
625 iso_pu_bacteria 2889016732 2889022996 437
626 iso_pu_bacteria 2889790730 2889791214 437
627 iso_pu_bacteria 2889790730 2889793894 437
628 iso_pu_bacteria 2889914905 2889916034 437
629 iso_pu_bacteria 2889914905 2889916168 437
630 iso_pu_bacteria 2900634093 2900642128 437
631 iso_pu_bacteria 2903448605 2903454802 437
632 iso_pu_bacteria 2903492973 2903505479 437
633 iso_pu_bacteria 2903513507 2903520291 437
634 iso_pu_bacteria 2903521522 2903522592 437
635 iso_pu_bacteria 2903528002 2903528971 437
636 iso_pu_bacteria 2906308376 2906314742 437
637 iso_pu_bacteria 2906321335 2906327914 437
638 iso_pu_bacteria 2906363423 2906364769 437
639 iso_pu_bacteria 2906370794 2906372932 437
640 iso_pu_bacteria 2906378014 2906382897 437
641 iso_pu_bacteria 2906386501 2906393324 437
642 iso_pu_bacteria 2906401398 2906402808 437
643 iso_pu_bacteria 2906408224 2906410936 437
644 iso_pu_bacteria 2906427513 2906433152 437
645 iso_pu_bacteria 2922130491 2922134679 437
646 iso_pu_bacteria 2922151315 2922157525 437
647 iso_pu_bacteria 2922172374 2922177996 437
648 iso_pu_bacteria 2922185730 2922193792 437
649 iso_pu_bacteria 2924710171 2924718321 437
650 iso_pu_bacteria 2924718760 2924726609 437
651 iso_pu_bacteria 2924733363 2924735699 437
652 iso_pu_bacteria 2924741084 2924748259 437
653 iso_pu_bacteria 2924748358 2924750353 437
654 iso_pu_bacteria 2924776078 2924778911 437
655 iso_pu_bacteria 2937813078 2937821069 437
656 iso_pu_bacteria 2937848649 2937855515 437
657 iso_pu_bacteria 2937861824 2937862062 437
658 iso_pu_bacteria 2937868953 2937874665 437
659 iso_pu_bacteria 2937877337 2937883430 437
660 iso_pu_bacteria 2937972304 2937973590 437
661 iso_pu_bacteria 2937980651 2937982258 437
662 iso_pu_bacteria 2938014810 2938016773 437
663 iso_pu_bacteria 2958034702 2958041275 437
664 iso_pu_bacteria 2958041894 2958057769 437
665 iso_pu_bacteria 2958064165 2958070010 437
666 iso_pu_bacteria 2958084443 2958090597 437
667 iso_pu_bacteria 2958092219 2958096561 437
668 iso_pu_bacteria 2958100919 2958107983 437
669 iso_pu_bacteria 2958108152 2958109922 437
670 iso_pu_bacteria 2958122699 2958127880 437
671 iso_pu_bacteria 2958130278 2958136406 437
672 iso_pu_bacteria 2958137437 2958137813 437
673 iso_pu_bacteria 2958144490 2958147965 437
674 iso_pu_bacteria 2958158011 2958162167 437
675 iso_pu_bacteria 2958172287 2958173302 437
676 iso_pu_bacteria 2958179912 2958185873 437
677 iso_pu_bacteria 2961077736 2961084354 437
678 iso_pu_bacteria 2961136820 2961138010 437
679 iso_pu_bacteria 2961183825 2961187010 437
680 iso_pu_bacteria 2963644680 2963646128 437
681 iso_pu_bacteria 2965025482 2965025602 437
682 iso_pu_bacteria 2965047637 2965049036 437
683 iso_pu_bacteria 2965089291 2965091311 437
684 iso_pu_bacteria 2965102966 2965106735 437
685 iso_pu_bacteria 2968016561 2968016611 437
686 iso_pu_bacteria 2968083720 2968089640 437
687 iso_pu_bacteria 2968117919 2968123751 437
688 iso_pu_bacteria 2968138860 2968143188 437
689 iso_pu_bacteria 2970469710 2970469953 437
690 iso_pu_bacteria 2970489779 2970493748 437
691 iso_pu_bacteria 2970510686 2970510812 437
692 iso_pu_bacteria 2970532167 2970537707 437
693 iso_pu_bacteria 2970547951 2970552892 437
694 iso_pu_bacteria 2970593180 2970600186 437
695 iso_pu_bacteria 2970619444 2970620575 437
696 iso_pu_bacteria 2970627176 2970629252 437
697 iso_pu_bacteria 2977843712 2977849729 437
698 iso_pu_bacteria 2977851361 2977851835 437
699 iso_pu_bacteria 2977872689 2977879909 437
700 iso_pu_bacteria 2977907340 2977908407 437
701 iso_pu_bacteria 2977915119 2977921380 437
702 iso_pu_bacteria 2977922695 2977928778 437
703 iso_pu_bacteria 2977935797 2977935942 437
704 iso_pu_bacteria 2977942078 2977948954 437
705 iso_pu_bacteria 2977950692 2977952776 437
706 iso_pu_bacteria 2977957713 2977961637 437
707 iso_pu_bacteria 2977986579 2977989168 437
708 iso_pu_bacteria 2979710463 2979714376 437
709 iso_pu_bacteria 2979764755 2979771020 437
710 iso_pu_bacteria 2979772303 2979775610 437
711 iso_pu_bacteria 2987636660 2987640584 437
712 iso_pu_bacteria 2987645492 2987647504 437
713 iso_pu_bacteria 2987652177 2987654490 437
714 iso_pu_bacteria 2987673487 2987674478 437
715 iso_pu_bacteria 2996348954 2996353116 437
716 iso_pu_bacteria 2996386984 2996390396 437
717 iso_pu_bacteria 3000135777 3000141411 437
718 iso_pu_bacteria 3004167301 3004174164 437
719 iso_pu_bacteria 3004203850 3004208782 437
720 iso_pu_bacteria 3004211236 3004211422 437
721 iso_pu_bacteria 3004218560 3004225029 437
722 iso_pu_bacteria 3004232784 3004236179 437
723 iso_pu_bacteria 3004239961 3004245026 437
724 iso_pu_bacteria 3004248173 3004248387 437
725 iso_pu_bacteria 3004268573 3004271384 437
726 iso_pu_bacteria 3004275668 3004279798 437
727 iso_pu_bacteria 3004334049 3004336286 437
728 iso_pu_bacteria 637000159 637076162 437
729 iso_pu_bacteria 649633066 649871330 437
730 iso_pu_bacteria 8004300914 8004302650 437
731 iso_pu_bacteria 8004312739 8004312960 437
732 iso_pu_bacteria 8004361976 8004364005 437
733 iso_pu_bacteria 8004387939 8004395014 437
734 iso_pu_bacteria 8004640170 8004642969 437
735 iso_pu_bacteria 8004695233 8004696123 437
736 iso_pu_bacteria 8004714634 8004721003 437
737 iso_pu_bacteria 8021120328 8021127674 437
738 3300003214 JGI25165J46597_1004311 JGI25165J46597_10043112 438
739 3300003762 Ga0055542_1000391 Ga0055542_10003918 438
740 3300003762 Ga0055542_1000549 Ga0055542_100054914 438
741 3300003763 Ga0055529_1002315 Ga0055529_10023152 438
742 3300005327 Ga0070658_10014984 Ga0070658_100149846 438
743 3300005328 Ga0070676_10096805 Ga0070676_100968052 438
744 3300005334 Ga0068869_100053101 Ga0068869_1000531012 438
745 3300005347 Ga0070668_100212067 Ga0070668_1002120671 438
746 3300005353 Ga0070669_100035899 Ga0070669_1000358992 438
747 3300005366 Ga0070659_100018306 Ga0070659_1000183064 438
748 3300005367 Ga0070667_100263775 Ga0070667_1002637751 438
749 3300005455 Ga0070663_100080278 Ga0070663_1000802782 438
750 3300005459 Ga0068867_100210218 Ga0068867_1002102181 438
751 3300005518 Ga0070699_100055004 Ga0070699_1000550043 438
752 3300005539 Ga0068853_100002399 Ga0068853_1000023997 438
753 3300005548 Ga0070665_100196582 Ga0070665_1001965822 438
754 3300005614 Ga0068856_100089267 Ga0068856_1000892672 438
755 3300005616 Ga0068852_100003680 Ga0068852_10000368011 438
756 3300006038 Ga0075365_10003273 Ga0075365_100032734 438
757 3300006048 Ga0075363_100001186 Ga0075363_1000011865 438
758 3300006178 Ga0075367_10000725 Ga0075367_100007256 438
759 3300006195 Ga0075366_10080786 Ga0075366_100807861 438
760 3300009093 Ga0105240_10116984 Ga0105240_101169843 438
761 3300009147 Ga0114129_10360722 Ga0114129_103607221 438
762 3300009545 Ga0105237_10000203 Ga0105237_1000020376 438
763 3300009545 Ga0105237_10014190 Ga0105237_100141903 438
764 3300009551 Ga0105238_10008979 Ga0105238_100089793 438
765 3300009553 Ga0105249_10085726 Ga0105249_100857261 438
766 3300010375 Ga0105239_10008429 Ga0105239_100084297 438
767 3300010375 Ga0105239_10012345 Ga0105239_100123454 438
768 3300010375 Ga0105239_10050525 Ga0105239_100505253 438
769 3300021384 Ga0213876_10000567 Ga0213876_100005677 438
770 3300021388 Ga0213875_10014734 Ga0213875_100147342 438
771 3300025254 Ga0209148_1000256 Ga0209148_100025640 438
772 3300025272 Ga0209455_1000314 Ga0209455_100031432 438
773 3300025913 Ga0207695_10042224 Ga0207695_100422245 438
774 3300025913 Ga0207695_10084812 Ga0207695_100848123 438
775 3300025914 Ga0207671_10002706 Ga0207671_100027067 438
776 3300025919 Ga0207657_10045049 Ga0207657_100450493 438
777 3300025922 Ga0207646_10034835 Ga0207646_100348351 438
778 3300025923 Ga0207681_10172332 Ga0207681_101723322 438
779 3300025924 Ga0207694_10067138 Ga0207694_100671383 438
780 3300025949 Ga0207667_10010611 Ga0207667_1001061111 438
781 3300026067 Ga0207678_10024835 Ga0207678_100248354 438
782 3300026078 Ga0207702_10213384 Ga0207702_102133842 438
783 3300028379 Ga0268266_10000343 Ga0268266_1000034348 438
784 3300028800 Ga0265338_10026374 Ga0265338_100263748 438
785 3300031235 Ga0265330_10007518 Ga0265330_100075185 438
786 3300031241 Ga0265325_10003409 Ga0265325_100034093 438
787 3300031242 Ga0265329_10011891 Ga0265329_100118912 438
788 3300031249 Ga0265339_10000370 Ga0265339_1000037027 438
789 3300031250 Ga0265331_10011736 Ga0265331_100117363 438
790 3300031344 Ga0265316_10012488 Ga0265316_100124888 438
791 3300031595 Ga0265313_10000070 Ga0265313_1000007069 438
792 3300031711 Ga0265314_10017190 Ga0265314_100171903 438
793 3300031730 Ga0307516_10019483 Ga0307516_100194836 438
794 3300031730 Ga0307516_10087485 Ga0307516_100874853 438
795 3300031911 Ga0307412_10045455 Ga0307412_100454553 438
796 3300033180 Ga0307510_10130942 Ga0307510_101309422 438
797 3300037312 Ga0395899_0197203 Ga0395899_0197203_79_1395 438
798 3300037418 Ga0395900_0266153 Ga0395900_0266153_79_1395 438
799 3300037466 Ga0395898_0192406 Ga0395898_0192406_543_1859 438
800 3300038443 Ga0395901_0081590 Ga0395901_0081590_1704_3020 438
801 3300047472 Ga0495686_0023847 Ga0495686_0023847_406_1845 438
802 3300048927 Ga0496124_0031050 Ga0496124_0031050_1825_3144 438
803 3300049568 Ga0501031_0075906 Ga0501031_0075906_359_1684 438
804 3300049569 Ga0501032_0000234 Ga0501032_0000234_2276_3601 438
805 3300049570 Ga0501033_0000076 Ga0501033_0000076_37145_38470 438
806 3300049570 Ga0501033_0107461 Ga0501033_0107461_192_1511 438
807 3300049571 Ga0501034_0000408 Ga0501034_0000408_54933_56258 438
808 3300049571 Ga0501034_0161781 Ga0501034_0161781_748_2067 438
809 3300049571 Ga0501034_0234211 Ga0501034_0234211_40_1359 438
810 3300049572 Ga0501036_0001942 Ga0501036_0001942_11889_13214 438
811 3300049573 Ga0501037_0000533 Ga0501037_0000533_11803_13128 438
812 3300049574 Ga0501038_0000241 Ga0501038_0000241_42570_43895 438
813 3300049574 Ga0501038_0113349 Ga0501038_0113349_63_1382 438
814 3300049577 Ga0501041_0059528 Ga0501041_0059528_609_1934 438
815 3300049579 Ga0501043_0000043 Ga0501043_0000043_41868_43193 438
816 3300049579 Ga0501043_0041697 Ga0501043_0041697_2096_3415 438
817 3300049579 Ga0501043_0045434 Ga0501043_0045434_1411_2730 438
818 3300049580 Ga0501046_0015199 Ga0501046_0015199_2033_3358 438
819 3300049581 Ga0501047_0010435 Ga0501047_0010435_7127_8449 438
820 3300049581 Ga0501047_0092225 Ga0501047_0092225_880_2277 438
821 3300049585 Ga0501069_0012324 Ga0501069_0012324_1472_2794 438
822 3300049586 Ga0501070_0000299 Ga0501070_0000299_9872_11269 438
823 3300049586 Ga0501070_0001617 Ga0501070_0001617_1813_3135 438
824 3300049586 Ga0501070_0037296 Ga0501070_0037296_2622_3941 438
825 3300049586 Ga0501070_0204135 Ga0501070_0204135_192_1511 438
826 3300049589 Ga0501073_0039218 Ga0501073_0039218_378_1775 438
827 3300049590 Ga0501074_0032102 Ga0501074_0032102_1526_2923 438
828 3300049742 Ga0501080_0001620 Ga0501080_0001620_8029_9426 438
829 3300049744 Ga0501083_0124110 Ga0501083_0124110_311_1630 438
830 3300049822 Ga0501035_0000449 Ga0501035_0000449_42603_43928 438
831 3300049822 Ga0501035_0002751 Ga0501035_0002751_9723_11045 438
832 3300049822 Ga0501035_0004065 Ga0501035_0004065_1000_2397 438
833 3300049823 Ga0501044_0001093 Ga0501044_0001093_8547_9944 438
834 3300049823 Ga0501044_0003690 Ga0501044_0003690_4150_5475 438
835 3300049823 Ga0501044_0010367 Ga0501044_0010367_811_2133 438
836 3300049823 Ga0501044_0052703 Ga0501044_0052703_2421_3740 438
837 3300049823 Ga0501044_0070373 Ga0501044_0070373_523_1842 438
838 3300050491 nmdc:mga00v17_6957_c1 nmdc:mga00v17_6957_c1_3714_5030 438
839 3300050493 nmdc:mga0k408_113916_c1 nmdc:mga0k408_113916_c1_77_1402 438
840 3300050494 nmdc:mga06z11_16687_c1 nmdc:mga06z11_16687_c1_344_1660 438
841 3300053103 Ga0500555_001043 Ga0500555_001043_1346_2671 438
842 3300053134 Ga0500658_0070660 Ga0500658_0070660_98_1414 438
843 3300053139 Ga0500568_0018969 Ga0500568_0018969_950_2293 438
844 3300053153 Ga0500616_0008291 Ga0500616_0008291_3106_4449 438
845 iso_pu_bacteria 2643221629 2644164789 438
846 iso_pu_bacteria 2643221662 2644345939 438
847 iso_pu_bacteria 2643221734 2644734133 438
848 iso_pu_bacteria 2919450847 2919454822 438
849 iso_pu_bacteria 8001845381 8001850291 438
850 iso_pu_bacteria 8057529695 8057533603 438
851 3300003215 JGI25153J46596_10000062 JGI25153J46596_10000062101 439
852 3300003215 JGI25153J46596_10000095 JGI25153J46596_1000009595 439
853 3300003794 Ga0055531_10029522 Ga0055531_100295221 439
854 3300005344 Ga0070661_100062246 Ga0070661_1000622462 439
855 3300005458 Ga0070681_10001647 Ga0070681_100016471 439
856 3300005518 Ga0070699_100054158 Ga0070699_1000541584 439
857 3300005530 Ga0070679_100015230 Ga0070679_1000152305 439
858 3300005539 Ga0068853_100007892 Ga0068853_10000789210 439
859 3300005539 Ga0068853_100009275 Ga0068853_1000092757 439
860 3300005543 Ga0070672_100178448 Ga0070672_1001784482 439
861 3300005841 Ga0068863_100039528 Ga0068863_1000395284 439
862 3300005843 Ga0068860_100022845 Ga0068860_1000228453 439
863 3300005844 Ga0068862_100117821 Ga0068862_1001178211 439
864 3300013100 Ga0157373_10059802 Ga0157373_100598021 439
865 3300013104 Ga0157370_10075236 Ga0157370_100752362 439
866 3300013296 Ga0157374_10028264 Ga0157374_100282645 439
867 3300013307 Ga0157372_10017769 Ga0157372_100177691 439
868 3300025297 Ga0209758_1000029 Ga0209758_1000029347 439
869 3300025298 Ga0209050_1003786 Ga0209050_10037866 439
870 3300025304 Ga0209257_1002768 Ga0209257_100276810 439
871 3300025921 Ga0207652_10055282 Ga0207652_100552823 439
872 3300025922 Ga0207646_10010499 Ga0207646_100104997 439
873 3300025972 Ga0207668_10152002 Ga0207668_101520022 439
874 3300026041 Ga0207639_10023642 Ga0207639_100236424 439
875 3300026067 Ga0207678_10013615 Ga0207678_100136155 439
876 3300027682 Ga0209971_1005290 Ga0209971_10052902 439
877 3300027876 Ga0209974_10006933 Ga0209974_100069333 439
878 3300028794 Ga0307515_10009737 Ga0307515_100097378 439
879 3300031251 Ga0265327_10018629 Ga0265327_100186294 439
880 3300031456 Ga0307513_10016761 Ga0307513_100167613 439
881 3300031911 Ga0307412_10042132 Ga0307412_100421322 439
882 3300047472 Ga0495686_0062520 Ga0495686_0062520_930_2264 439
883 3300049568 Ga0501031_0014510 Ga0501031_0014510_3451_4776 439
884 3300049569 Ga0501032_0008069 Ga0501032_0008069_3451_4776 439
885 3300049570 Ga0501033_0009070 Ga0501033_0009070_3451_4776 439
886 3300049571 Ga0501034_0000873 Ga0501034_0000873_39610_40935 439
887 3300049571 Ga0501034_0197976 Ga0501034_0197976_407_1741 439
888 3300049572 Ga0501036_0000159 Ga0501036_0000159_3451_4776 439
889 3300049573 Ga0501037_0018609 Ga0501037_0018609_3439_4764 439
890 3300049574 Ga0501038_0000262 Ga0501038_0000262_39610_40935 439
891 3300049575 Ga0501039_0008835 Ga0501039_0008835_2898_4223 439
892 3300049576 Ga0501040_0015223 Ga0501040_0015223_3294_4619 439
893 3300049580 Ga0501046_0082989 Ga0501046_0082989_599_1933 439
894 3300049581 Ga0501047_0004343 Ga0501047_0004343_5361_6695 439
895 3300049581 Ga0501047_0128590 Ga0501047_0128590_826_2160 439
896 3300049583 Ga0501067_0008599 Ga0501067_0008599_3017_4351 439
897 3300049584 Ga0501068_0003453 Ga0501068_0003453_1855_3189 439
898 3300049586 Ga0501070_0056901 Ga0501070_0056901_1855_3180 439
899 3300049588 Ga0501072_0024457 Ga0501072_0024457_711_2045 439
900 3300049588 Ga0501072_0073549 Ga0501072_0073549_446_1780 439
901 3300049589 Ga0501073_0003703 Ga0501073_0003703_3474_4808 439
902 3300049589 Ga0501073_0040875 Ga0501073_0040875_645_1979 439
903 3300049590 Ga0501074_0018196 Ga0501074_0018196_1585_2919 439
904 3300049741 Ga0501079_0171986 Ga0501079_0171986_57_1391 439
905 3300049742 Ga0501080_0007967 Ga0501080_0007967_6662_7996 439
906 3300049742 Ga0501080_0013039 Ga0501080_0013039_4229_5563 439
907 3300049744 Ga0501083_0043013 Ga0501083_0043013_1681_3015 439
908 3300049822 Ga0501035_0013126 Ga0501035_0013126_3451_4776 439
909 3300049822 Ga0501035_0263574 Ga0501035_0263574_26_1360 439
910 3300049823 Ga0501044_0001088 Ga0501044_0001088_27636_28961 439
911 3300053096 Ga0500641_0003709 Ga0500641_0003709_213_1547 439
912 3300053119 Ga0500595_000738 Ga0500595_000738_623_1957 439
913 3300053130 Ga0500642_0000868 Ga0500642_0000868_604_1938 439
914 3300053139 Ga0500568_0000019 Ga0500568_0000019_42360_43682 439
915 3300053139 Ga0500568_0032134 Ga0500568_0032134_242_1576 439
916 3300053151 Ga0500604_0012950 Ga0500604_0012950_659_1993 439
917 3300053151 Ga0500604_0018203 Ga0500604_0018203_435_1769 439
918 3300053153 Ga0500616_0005076 Ga0500616_0005076_2187_3521 439
919 3300053158 Ga0500627_0004191 Ga0500627_0004191_2983_4305 439
920 3300060353 Ga0501082_0008450 Ga0501082_0008450_97_1431 439
921 iso_pu_bacteria 2937843397 2937845228 439
922 3300003214 JGI25165J46597_1000219 JGI25165J46597_100021985 440
923 3300003762 Ga0055542_1001448 Ga0055542_10014487 440
924 3300005331 Ga0070670_100000668 Ga0070670_10000066813 440
925 3300005331 Ga0070670_100020520 Ga0070670_1000205205 440
926 3300005331 Ga0070670_100053262 Ga0070670_1000532623 440
927 3300005334 Ga0068869_100018208 Ga0068869_1000182081 440
928 3300005339 Ga0070660_100005052 Ga0070660_1000050524 440
929 3300005344 Ga0070661_100013058 Ga0070661_1000130583 440
930 3300005347 Ga0070668_100003690 Ga0070668_1000036903 440
931 3300005347 Ga0070668_100114564 Ga0070668_1001145642 440
932 3300005354 Ga0070675_100003065 Ga0070675_1000030656 440
933 3300005354 Ga0070675_100006887 Ga0070675_1000068875 440
934 3300005355 Ga0070671_100003942 Ga0070671_10000394210 440
935 3300005355 Ga0070671_100010180 Ga0070671_1000101806 440
936 3300005364 Ga0070673_100003475 Ga0070673_1000034755 440
937 3300005364 Ga0070673_100006227 Ga0070673_1000062273 440
938 3300005364 Ga0070673_100095403 Ga0070673_1000954032 440
939 3300005366 Ga0070659_100000244 Ga0070659_10000024433 440
940 3300005366 Ga0070659_100068038 Ga0070659_1000680382 440
941 3300005367 Ga0070667_100022980 Ga0070667_1000229805 440
942 3300005455 Ga0070663_100011344 Ga0070663_1000113442 440
943 3300005456 Ga0070678_100059065 Ga0070678_1000590652 440
944 3300005457 Ga0070662_100000091 Ga0070662_1000000917 440
945 3300005459 Ga0068867_100157928 Ga0068867_1001579282 440
946 3300005466 Ga0070685_10089620 Ga0070685_100896201 440
947 3300005530 Ga0070679_100044151 Ga0070679_1000441512 440
948 3300005539 Ga0068853_100001848 Ga0068853_1000018486 440
949 3300005539 Ga0068853_100031540 Ga0068853_1000315406 440
950 3300005543 Ga0070672_100001196 Ga0070672_1000011966 440
951 3300005543 Ga0070672_100107121 Ga0070672_1001071212 440
952 3300005548 Ga0070665_100130147 Ga0070665_1001301472 440
953 3300005563 Ga0068855_100000310 Ga0068855_10000031045 440
954 3300005564 Ga0070664_100000116 Ga0070664_10000011620 440
955 3300005564 Ga0070664_100037059 Ga0070664_1000370592 440
956 3300005564 Ga0070664_100166104 Ga0070664_1001661042 440
957 3300005614 Ga0068856_100077695 Ga0068856_1000776953 440
958 3300005614 Ga0068856_100081953 Ga0068856_1000819534 440
959 3300005617 Ga0068859_100198345 Ga0068859_1001983451 440
960 3300005618 Ga0068864_100018179 Ga0068864_1000181795 440
961 3300005718 Ga0068866_10049999 Ga0068866_100499992 440
962 3300005719 Ga0068861_100002478 Ga0068861_10000247810 440
963 3300005841 Ga0068863_100002482 Ga0068863_1000024827 440
964 3300005841 Ga0068863_100060273 Ga0068863_1000602733 440
965 3300005843 Ga0068860_100018543 Ga0068860_1000185437 440
966 3300005843 Ga0068860_100108737 Ga0068860_1001087373 440
967 3300005844 Ga0068862_100019100 Ga0068862_1000191001 440
968 3300006038 Ga0075365_10016399 Ga0075365_100163994 440
969 3300006178 Ga0075367_10148074 Ga0075367_101480741 440
970 3300006353 Ga0075370_10016387 Ga0075370_100163871 440
971 3300006931 Ga0097620_100198336 Ga0097620_1001983361 440
972 3300009093 Ga0105240_10016842 Ga0105240_100168426 440
973 3300009098 Ga0105245_10201186 Ga0105245_102011862 440
974 3300009176 Ga0105242_10021962 Ga0105242_100219622 440
975 3300009177 Ga0105248_10052380 Ga0105248_100523804 440
976 3300009545 Ga0105237_10043543 Ga0105237_100435433 440
977 3300009551 Ga0105238_10045842 Ga0105238_100458424 440
978 3300009551 Ga0105238_10199345 Ga0105238_101993451 440
979 3300009553 Ga0105249_10103831 Ga0105249_101038312 440
980 3300013100 Ga0157373_10000693 Ga0157373_1000069327 440
981 3300013102 Ga0157371_10001323 Ga0157371_1000132311 440
982 3300013306 Ga0163162_10040685 Ga0163162_100406854 440
983 3300013306 Ga0163162_10084688 Ga0163162_100846883 440
984 3300013306 Ga0163162_10115796 Ga0163162_101157961 440
985 3300013307 Ga0157372_10001853 Ga0157372_100018537 440
986 3300013307 Ga0157372_10222960 Ga0157372_102229602 440
987 3300013308 Ga0157375_10010879 Ga0157375_100108796 440
988 3300013308 Ga0157375_10013535 Ga0157375_100135353 440
989 3300013308 Ga0157375_10071698 Ga0157375_100716983 440
990 3300014325 Ga0163163_10051110 Ga0163163_100511102 440
991 3300014326 Ga0157380_10070934 Ga0157380_100709342 440
992 3300014969 Ga0157376_10028070 Ga0157376_100280704 440
993 3300014969 Ga0157376_10175185 Ga0157376_101751852 440
994 3300015261 Ga0182006_1020041 Ga0182006_10200412 440
995 3300017792 Ga0163161_10075274 Ga0163161_100752742 440
996 3300025250 Ga0209026_1000002 Ga0209026_1000002829 440
997 3300025254 Ga0209148_1000165 Ga0209148_1000165142 440
998 3300025256 Ga0209759_1000156 Ga0209759_100015640 440
999 3300025261 Ga0209233_1000258 Ga0209233_100025886 440
1000 3300025272 Ga0209455_1000143 Ga0209455_10001434 440
1001 3300025906 Ga0207699_10027727 Ga0207699_100277271 440
1002 3300025912 Ga0207707_10081742 Ga0207707_100817422 440
1003 3300025913 Ga0207695_10117359 Ga0207695_101173591 440
1004 3300025919 Ga0207657_10002338 Ga0207657_1000233810 440
1005 3300025920 Ga0207649_10004443 Ga0207649_100044433 440
1006 3300025920 Ga0207649_10069616 Ga0207649_100696161 440
1007 3300025920 Ga0207649_10131094 Ga0207649_101310942 440
1008 3300025923 Ga0207681_10175646 Ga0207681_101756462 440
1009 3300025925 Ga0207650_10050335 Ga0207650_100503352 440
1010 3300025925 Ga0207650_10059558 Ga0207650_100595582 440
1011 3300025926 Ga0207659_10002597 Ga0207659_100025974 440
1012 3300025926 Ga0207659_10145740 Ga0207659_101457401 440
1013 3300025931 Ga0207644_10011666 Ga0207644_100116665 440
1014 3300025931 Ga0207644_10069433 Ga0207644_100694333 440
1015 3300025932 Ga0207690_10000719 Ga0207690_100007195 440
1016 3300025933 Ga0207706_10000093 Ga0207706_1000009361 440
1017 3300025933 Ga0207706_10016532 Ga0207706_100165323 440
1018 3300025940 Ga0207691_10000646 Ga0207691_1000064622 440
1019 3300025940 Ga0207691_10152380 Ga0207691_101523801 440
1020 3300025942 Ga0207689_10003783 Ga0207689_100037834 440
1021 3300025945 Ga0207679_10000841 Ga0207679_100008415 440
1022 3300025945 Ga0207679_10028039 Ga0207679_100280393 440
1023 3300025949 Ga0207667_10001461 Ga0207667_1000146121 440
1024 3300025960 Ga0207651_10034483 Ga0207651_100344833 440
1025 3300025960 Ga0207651_10071061 Ga0207651_100710612 440
1026 3300025972 Ga0207668_10068254 Ga0207668_100682542 440
1027 3300025981 Ga0207640_10144072 Ga0207640_101440721 440
1028 3300026023 Ga0207677_10080268 Ga0207677_100802682 440
1029 3300026041 Ga0207639_10011614 Ga0207639_100116142 440
1030 3300026041 Ga0207639_10028163 Ga0207639_100281634 440
1031 3300026041 Ga0207639_10062122 Ga0207639_100621222 440
1032 3300026067 Ga0207678_10035621 Ga0207678_100356212 440
1033 3300026075 Ga0207708_10119516 Ga0207708_101195162 440
1034 3300026078 Ga0207702_10065797 Ga0207702_100657972 440
1035 3300026088 Ga0207641_10014253 Ga0207641_100142533 440
1036 3300026088 Ga0207641_10101909 Ga0207641_101019092 440
1037 3300026089 Ga0207648_10210092 Ga0207648_102100921 440
1038 3300026095 Ga0207676_10005255 Ga0207676_100052557 440
1039 3300026095 Ga0207676_10053410 Ga0207676_100534103 440
1040 3300026095 Ga0207676_10066982 Ga0207676_100669823 440
1041 3300026118 Ga0207675_100025292 Ga0207675_1000252925 440
1042 3300026121 Ga0207683_10135517 Ga0207683_101355172 440
1043 3300028379 Ga0268266_10067880 Ga0268266_100678803 440
1044 3300028380 Ga0268265_10098371 Ga0268265_100983711 440
1045 3300028381 Ga0268264_10053802 Ga0268264_100538023 440
1046 3300028381 Ga0268264_10161717 Ga0268264_101617171 440
1047 3300031852 Ga0307410_10027439 Ga0307410_100274393 440
1048 3300031901 Ga0307406_10021641 Ga0307406_100216412 440
1049 3300031903 Ga0307407_10016459 Ga0307407_100164592 440
1050 3300031911 Ga0307412_10056432 Ga0307412_100564321 440
1051 3300032002 Ga0307416_100020419 Ga0307416_1000204195 440
1052 3300032126 Ga0307415_100038108 Ga0307415_1000381082 440
1053 3300037418 Ga0395900_0019483 Ga0395900_0019483_2790_4118 440
1054 3300037418 Ga0395900_0040659 Ga0395900_0040659_497_1825 440
1055 3300038443 Ga0395901_0020801 Ga0395901_0020801_105_1433 440
1056 3300038443 Ga0395901_0031362 Ga0395901_0031362_2750_4078 440
1057 3300048904 Ga0496101_0015675 Ga0496101_0015675_130_1467 440
1058 3300048905 Ga0496102_0028747 Ga0496102_0028747_663_2000 440
1059 3300048909 Ga0496106_0000759 Ga0496106_0000759_15472_16809 440
1060 3300048910 Ga0496107_0000490 Ga0496107_0000490_17392_18729 440
1061 3300048912 Ga0496109_0103881 Ga0496109_0103881_1095_2423 440
1062 3300048915 Ga0496112_0003779 Ga0496112_0003779_2065_3402 440
1063 3300048915 Ga0496112_0015983 Ga0496112_0015983_329_1678 440
1064 3300048922 Ga0496119_0039372 Ga0496119_0039372_1057_2385 440
1065 3300048923 Ga0496120_0001687 Ga0496120_0001687_22445_23773 440
1066 3300048923 Ga0496120_0069628 Ga0496120_0069628_558_1895 440
1067 3300048924 Ga0496121_0123526 Ga0496121_0123526_54_1391 440
1068 3300048925 Ga0496122_0001710 Ga0496122_0001710_1356_2690 440
1069 3300048927 Ga0496124_0144699 Ga0496124_0144699_306_1634 440
1070 3300049571 Ga0501034_0000475 Ga0501034_0000475_47341_48669 440
1071 3300050490 nmdc:mga03n38_29553_c1 nmdc:mga03n38_29553_c1_690_2075 440
1072 3300050492 nmdc:mga0yw44_22796_c1 nmdc:mga0yw44_22796_c1_61_1446 440
1073 3300050492 nmdc:mga0yw44_38866_c1 nmdc:mga0yw44_38866_c1_1113_2441 440
1074 iso_pu_bacteria 2509276022 2509395343 440
1075 iso_pu_bacteria 2597489875 2597811219 440
1076 iso_pu_bacteria 2888343758 2888346261 440
1077 iso_pu_bacteria 2977971508 2977975413 440
1078 iso_pu_bacteria 8004395343 8004399009 440
1079 3300003756 Ga0055533_1000947 Ga0055533_10009474 441
1080 3300003758 Ga0055532_1000220 Ga0055532_100022022 441
1081 3300003760 Ga0055527_1000173 Ga0055527_100017323 441
1082 3300003761 Ga0055535_1000360 Ga0055535_100036023 441
1083 3300003762 Ga0055542_1001730 Ga0055542_10017301 441
1084 3300003763 Ga0055529_1001879 Ga0055529_10018793 441
1085 3300005329 Ga0070683_100014390 Ga0070683_1000143903 441
1086 3300005336 Ga0070680_100181603 Ga0070680_1001816032 441
1087 3300005344 Ga0070661_100000805 Ga0070661_10000080520 441
1088 3300005366 Ga0070659_100001492 Ga0070659_1000014928 441
1089 3300005435 Ga0070714_100007403 Ga0070714_1000074035 441
1090 3300005436 Ga0070713_100033297 Ga0070713_1000332974 441
1091 3300005535 Ga0070684_100026823 Ga0070684_1000268233 441
1092 3300005539 Ga0068853_100048415 Ga0068853_1000484152 441
1093 3300005563 Ga0068855_100001384 Ga0068855_10000138413 441
1094 3300005564 Ga0070664_100000463 Ga0070664_1000004633 441
1095 3300005577 Ga0068857_100001049 Ga0068857_10000104910 441
1096 3300005578 Ga0068854_100007622 Ga0068854_1000076225 441
1097 3300005614 Ga0068856_100001465 Ga0068856_10000146521 441
1098 3300005616 Ga0068852_100000730 Ga0068852_1000007306 441
1099 3300005834 Ga0068851_10019646 Ga0068851_100196462 441
1100 3300009093 Ga0105240_10003226 Ga0105240_100032268 441
1101 3300009551 Ga0105238_10001144 Ga0105238_1000114412 441
1102 3300013100 Ga0157373_10114254 Ga0157373_101142542 441
1103 3300013104 Ga0157370_10033003 Ga0157370_100330034 441
1104 3300013105 Ga0157369_10012421 Ga0157369_100124213 441
1105 3300013296 Ga0157374_10005410 Ga0157374_100054102 441
1106 3300013296 Ga0157374_10163668 Ga0157374_101636682 441
1107 3300013307 Ga0157372_10001544 Ga0157372_1000154411 441
1108 3300025226 Ga0209674_100130 Ga0209674_10013084 441
1109 3300025228 Ga0209672_100225 Ga0209672_10022523 441
1110 3300025229 Ga0209147_100283 Ga0209147_10028323 441
1111 3300025242 Ga0209258_100467 Ga0209258_10046723 441
1112 3300025254 Ga0209148_1000460 Ga0209148_100046023 441
1113 3300025272 Ga0209455_1000365 Ga0209455_100036523 441
1114 3300025912 Ga0207707_10035378 Ga0207707_100353783 441
1115 3300025917 Ga0207660_10145513 Ga0207660_101455132 441
1116 3300025919 Ga0207657_10010187 Ga0207657_100101877 441
1117 3300025920 Ga0207649_10006979 Ga0207649_100069796 441
1118 3300025921 Ga0207652_10190883 Ga0207652_101908832 441
1119 3300025924 Ga0207694_10007102 Ga0207694_100071024 441
1120 3300025928 Ga0207700_10161393 Ga0207700_101613932 441
1121 3300025929 Ga0207664_10066458 Ga0207664_100664583 441
1122 3300025932 Ga0207690_10173577 Ga0207690_101735771 441
1123 3300025944 Ga0207661_10075423 Ga0207661_100754232 441
1124 3300025945 Ga0207679_10005872 Ga0207679_100058727 441
1125 3300025949 Ga0207667_10045520 Ga0207667_100455203 441
1126 3300026078 Ga0207702_10006174 Ga0207702_100061743 441
1127 3300026116 Ga0207674_10002105 Ga0207674_100021058 441
1128 3300026142 Ga0207698_10001255 Ga0207698_100012556 441
1129 3300035170 Ga0373943_0058448 Ga0373943_0058448_88_1431 441
1130 3300039437 Ga0436365_0344984 Ga0436365_0344984_6570_8129 441
1131 3300044765 Ga0466970_0001042 Ga0466970_0001042_7583_8953 441
1132 3300046543 Ga0495645_0065986 Ga0495645_0065986_180_1523 441
1133 3300046678 Ga0495599_0054732 Ga0495599_0054732_950_2293 441
1134 3300048910 Ga0496107_0101813 Ga0496107_0101813_728_2071 441
1135 3300048913 Ga0496110_0038670 Ga0496110_0038670_1859_3202 441
1136 iso_pu_bacteria 2977864932 2977865348 441
1137 iso_pu_bacteria 2996310559 2996312868 441
1138 3300003203 JGI25406J46586_10006582 JGI25406J46586_100065823 442
1139 3300003771 Ga0055526_1000065 Ga0055526_100006580 442
1140 3300003775 Ga0055524_1000058 Ga0055524_100005812 442
1141 3300005262 Ga0065165_1000384 Ga0065165_100038438 442
1142 3300005985 Ga0081539_10000646 Ga0081539_1000064634 442
1143 3300009177 Ga0105248_10016381 Ga0105248_100163814 442
1144 3300013102 Ga0157371_10018740 Ga0157371_100187402 442
1145 3300013104 Ga0157370_10077232 Ga0157370_100772322 442
1146 3300013105 Ga0157369_10000383 Ga0157369_1000038334 442
1147 3300021384 Ga0213876_10001071 Ga0213876_100010714 442
1148 3300025284 Ga0209130_1000393 Ga0209130_100039351 442
1149 3300025291 Ga0209675_1001542 Ga0209675_10015426 442
1150 3300025295 Ga0209564_1000197 Ga0209564_1000197111 442
1151 3300025299 Ga0209256_1000159 Ga0209256_1000159111 442
1152 3300025302 Ga0207426_1016931 Ga0207426_10169313 442
1153 3300025941 Ga0207711_10009353 Ga0207711_100093534 442
1154 3300031901 Ga0307406_10022479 Ga0307406_100224793 442
1155 3300037418 Ga0395900_0005117 Ga0395900_0005117_1878_3209 442
1156 3300037418 Ga0395900_0094090 Ga0395900_0094090_1384_2715 442
1157 3300037466 Ga0395898_0000254 Ga0395898_0000254_66855_68186 442
1158 3300037853 Ga0436364_0667648 Ga0436364_0667648_1358_2725 442
1159 3300038443 Ga0395901_0000095 Ga0395901_0000095_110437_111768 442
1160 3300038443 Ga0395901_0026852 Ga0395901_0026852_2327_3658 442
1161 3300039062 Ga0400483_093081 Ga0400483_093081_630_2015 442
1162 3300039437 Ga0436365_0625375 Ga0436365_0625375_12508_13869 442
1163 3300039453 Ga0436362_0505409 Ga0436362_0505409_277_1644 442
1164 3300044656 Ga0466969_0001253 Ga0466969_0001253_3927_5258 442
1165 3300044656 Ga0466969_0013222 Ga0466969_0013222_2036_3367 442
1166 3300044658 Ga0466972_0012437 Ga0466972_0012437_2696_4027 442
1167 3300044683 Ga0466965_0000665 Ga0466965_0000665_8292_9623 442
1168 3300044684 Ga0466966_0000107 Ga0466966_0000107_15178_16509 442
1169 3300044684 Ga0466966_0000309 Ga0466966_0000309_10839_12170 442
1170 3300044684 Ga0466966_0003129 Ga0466966_0003129_5618_6949 442
1171 3300044693 Ga0466961_0000068 Ga0466961_0000068_14326_15657 442
1172 3300044693 Ga0466961_0001012 Ga0466961_0001012_8511_9842 442
1173 3300044693 Ga0466961_0051677 Ga0466961_0051677_191_1522 442
1174 3300044694 Ga0466963_0003296 Ga0466963_0003296_803_2134 442
1175 3300044694 Ga0466963_0015643 Ga0466963_0015643_2951_4282 442
1176 3300044706 Ga0466964_0019698 Ga0466964_0019698_1017_2348 442
1177 3300044719 Ga0466971_0001111 Ga0466971_0001111_7492_8823 442
1178 3300044765 Ga0466970_0001083 Ga0466970_0001083_3445_4776 442
1179 3300044842 Ga0466957_0001559 Ga0466957_0001559_3870_5201 442
1180 3300044842 Ga0466957_0009634 Ga0466957_0009634_277_1608 442
1181 3300044842 Ga0466957_0084073 Ga0466957_0084073_44_1375 442
1182 3300045049 Ga0466959_0001053 Ga0466959_0001053_4257_5588 442
1183 3300045836 Ga0466958_0000689 Ga0466958_0000689_2929_4260 442
1184 3300048909 Ga0496106_0000060 Ga0496106_0000060_55839_57176 442
1185 3300048919 Ga0496116_0024425 Ga0496116_0024425_1217_2548 442
1186 3300048921 Ga0496118_0020548 Ga0496118_0020548_600_2012 442
1187 3300048921 Ga0496118_0023118 Ga0496118_0023118_3686_5017 442
1188 3300048924 Ga0496121_0000102 Ga0496121_0000102_55292_56629 442
1189 3300048925 Ga0496122_0005877 Ga0496122_0005877_1906_3267 442
1190 3300048926 Ga0496123_0003513 Ga0496123_0003513_4995_6356 442
1191 3300048929 Ga0496126_0140254 Ga0496126_0140254_341_1708 442
1192 3300061719 Ga0466962_0001601 Ga0466962_0001601_5102_6433 442
1193 3300061719 Ga0466962_0001884 Ga0466962_0001884_5715_7046 442
1194 iso_pu_bacteria 2599185301 2599940607 442
1195 iso_pu_bacteria 2693429783 2694629185 442
1196 iso_pu_bacteria 2693429784 2694636901 442
1197 iso_pu_bacteria 2847686936 2847691788 442
1198 iso_pu_bacteria 2856364286 2856365901 442
1199 iso_pu_bacteria 2857349434 2857353682 442
1200 iso_pu_bacteria 2869285874 2869286788 442
1201 iso_pu_bacteria 2871429161 2871434052 442
1202 iso_pu_bacteria 2871444079 2871445033 442
1203 iso_pu_bacteria 2874102143 2874104633 442
1204 iso_pu_bacteria 2874146452 2874147710 442
1205 iso_pu_bacteria 2874155637 2874156628 442
1206 iso_pu_bacteria 2876369609 2876374242 442
1207 iso_pu_bacteria 2876377896 2876384632 442
1208 iso_pu_bacteria 2876413966 2876414798 442
1209 iso_pu_bacteria 2878745973 2878746762 442
1210 iso_pu_bacteria 2885305155 2885308789 442
1211 iso_pu_bacteria 2885326080 2885333446 442
1212 iso_pu_bacteria 2885334103 2885335969 442
1213 iso_pu_bacteria 2889016732 2889021489 442
1214 iso_pu_bacteria 2903492973 2903498205 442
1215 iso_pu_bacteria 2906308376 2906309142 442
1216 iso_pu_bacteria 2906321335 2906326749 442
1217 iso_pu_bacteria 2906328253 2906328708 442
1218 iso_pu_bacteria 2906354277 2906359083 442
1219 iso_pu_bacteria 2922130491 2922134623 442
1220 iso_pu_bacteria 2922158528 2922160766 442
1221 iso_pu_bacteria 2922185730 2922192433 442
1222 iso_pu_bacteria 2924726620 2924728598 442
1223 iso_pu_bacteria 2937813078 2937813999 442
1224 iso_pu_bacteria 2937891427 2937893592 442
1225 iso_pu_bacteria 2938014810 2938018605 442
1226 iso_pu_bacteria 2958041894 2958049283 442
1227 iso_pu_bacteria 2958100919 2958101530 442
1228 iso_pu_bacteria 2958115193 2958121424 442
1229 iso_pu_bacteria 2958130278 2958131192 442
1230 iso_pu_bacteria 2958172287 2958172960 442
1231 iso_pu_bacteria 2958179912 2958180591 442
1232 iso_pu_bacteria 2961077736 2961078425 442
1233 iso_pu_bacteria 2965062239 2965063912 442
1234 iso_pu_bacteria 2968091066 2968095244 442
1235 iso_pu_bacteria 2968097103 2968101214 442
1236 iso_pu_bacteria 2968117919 2968120239 442
1237 iso_pu_bacteria 2968128360 2968128637 442
1238 iso_pu_bacteria 2977843712 2977845298 442
1239 iso_pu_bacteria 2977858184 2977862272 442
1240 iso_pu_bacteria 2977942078 2977949875 442
1241 iso_pu_bacteria 2977971508 2977978060 442
1242 iso_pu_bacteria 2979710463 2979717228 442
1243 iso_pu_bacteria 2979779861 2979780505 442
1244 iso_pu_bacteria 2987636660 2987642905 442
1245 iso_pu_bacteria 2987652177 2987658529 442
1246 iso_pu_bacteria 2996341866 2996348014 442
1247 iso_pu_bacteria 3004203850 3004210698 442
1248 iso_pu_bacteria 8004387939 8004388072 442
1249 iso_pu_bacteria 8004445564 8004446263 442
1250 iso_pu_bacteria 8004703790 8004713157 442
1251 iso_pu_bacteria 8004714634 8004715399 442
1252 3300009982 Ga0105147_101143 Ga0105147_1011432 443
1253 3300025261 Ga0209233_1000047 Ga0209233_1000047326 443
1254 3300049586 Ga0501070_0097706 Ga0501070_0097706_199_1545 443
1255 3300049822 Ga0501035_0056671 Ga0501035_0056671_1339_2685 443
1256 3300005614 Ga0068856_100101391 Ga0068856_1001013912 444
1257 3300009545 Ga0105237_10161251 Ga0105237_101612511 444
1258 3300025297 Ga0209758_1006672 Ga0209758_10066724 444
1259 3300037471 Ga0395905_0012419 Ga0395905_0012419_2084_3418 444
1260 3300048920 Ga0496117_0017509 Ga0496117_0017509_1552_2895 444
1261 3300048929 Ga0496126_0000400 Ga0496126_0000400_59933_61276 444
1262 3300002705 JGI25156J39149_1004893 JGI25156J39149_10048932 446
1263 3300002741 JGI25157J39369_1000725 JGI25157J39369_10007252 446
1264 3300005328 Ga0070676_10073131 Ga0070676_100731312 446
1265 3300005329 Ga0070683_100047346 Ga0070683_1000473462 446
1266 3300005330 Ga0070690_100019376 Ga0070690_1000193763 446
1267 3300005331 Ga0070670_100002946 Ga0070670_1000029463 446
1268 3300005334 Ga0068869_100006892 Ga0068869_1000068924 446
1269 3300005334 Ga0068869_100116859 Ga0068869_1001168592 446
1270 3300005335 Ga0070666_10007302 Ga0070666_100073022 446
1271 3300005335 Ga0070666_10014351 Ga0070666_100143513 446
1272 3300005338 Ga0068868_100016709 Ga0068868_1000167093 446
1273 3300005338 Ga0068868_100024514 Ga0068868_1000245142 446
1274 3300005338 Ga0068868_100063418 Ga0068868_1000634182 446
1275 3300005340 Ga0070689_100035473 Ga0070689_1000354733 446
1276 3300005347 Ga0070668_100032042 Ga0070668_1000320422 446
1277 3300005355 Ga0070671_100015873 Ga0070671_1000158734 446
1278 3300005364 Ga0070673_100003212 Ga0070673_1000032122 446
1279 3300005364 Ga0070673_100027283 Ga0070673_1000272833 446
1280 3300005365 Ga0070688_100009915 Ga0070688_1000099154 446
1281 3300005367 Ga0070667_100005826 Ga0070667_1000058263 446
1282 3300005367 Ga0070667_100031165 Ga0070667_1000311652 446
1283 3300005367 Ga0070667_100085354 Ga0070667_1000853542 446
1284 3300005434 Ga0070709_10011270 Ga0070709_100112702 446
1285 3300005435 Ga0070714_100062106 Ga0070714_1000621062 446
1286 3300005436 Ga0070713_100002027 Ga0070713_10000202712 446
1287 3300005439 Ga0070711_100000713 Ga0070711_1000007138 446
1288 3300005440 Ga0070705_100020514 Ga0070705_1000205142 446
1289 3300005444 Ga0070694_100021211 Ga0070694_1000212111 446
1290 3300005456 Ga0070678_100010805 Ga0070678_1000108054 446
1291 3300005457 Ga0070662_100015098 Ga0070662_1000150983 446
1292 3300005466 Ga0070685_10013266 Ga0070685_100132663 446
1293 3300005467 Ga0070706_100047499 Ga0070706_1000474992 446
1294 3300005468 Ga0070707_100022437 Ga0070707_1000224373 446
1295 3300005539 Ga0068853_100088048 Ga0068853_1000880482 446
1296 3300005544 Ga0070686_100003766 Ga0070686_1000037664 446
1297 3300005547 Ga0070693_100002360 Ga0070693_1000023608 446
1298 3300005548 Ga0070665_100001730 Ga0070665_10000173014 446
1299 3300005549 Ga0070704_100039503 Ga0070704_1000395033 446
1300 3300005577 Ga0068857_100003640 Ga0068857_1000036405 446
1301 3300005578 Ga0068854_100009688 Ga0068854_1000096883 446
1302 3300005615 Ga0070702_100009038 Ga0070702_1000090381 446
1303 3300005615 Ga0070702_100017853 Ga0070702_1000178532 446
1304 3300005617 Ga0068859_100001046 Ga0068859_10000104618 446
1305 3300005617 Ga0068859_100008936 Ga0068859_1000089369 446
1306 3300005618 Ga0068864_100003022 Ga0068864_1000030224 446
1307 3300005618 Ga0068864_100005142 Ga0068864_1000051422 446
1308 3300005719 Ga0068861_100024828 Ga0068861_1000248281 446
1309 3300005834 Ga0068851_10068128 Ga0068851_100681282 446
1310 3300005840 Ga0068870_10008506 Ga0068870_100085063 446
1311 3300005842 Ga0068858_100001816 Ga0068858_1000018168 446
1312 3300005842 Ga0068858_100007123 Ga0068858_1000071237 446
1313 3300005843 Ga0068860_100023458 Ga0068860_1000234583 446
1314 3300005843 Ga0068860_100025648 Ga0068860_1000256484 446
1315 3300005843 Ga0068860_100038314 Ga0068860_1000383144 446
1316 3300006175 Ga0070712_100001191 Ga0070712_10000119113 446
1317 3300006175 Ga0070712_100066548 Ga0070712_1000665482 446
1318 3300006237 Ga0097621_100021138 Ga0097621_1000211382 446
1319 3300006358 Ga0068871_100015024 Ga0068871_1000150243 446
1320 3300006358 Ga0068871_100100015 Ga0068871_1001000151 446
1321 3300006881 Ga0068865_100020658 Ga0068865_1000206584 446
1322 3300006931 Ga0097620_100001046 Ga0097620_10000104618 446
1323 3300006931 Ga0097620_100008936 Ga0097620_1000089369 446
1324 3300009098 Ga0105245_10024593 Ga0105245_100245935 446
1325 3300009098 Ga0105245_10069375 Ga0105245_100693753 446
1326 3300009101 Ga0105247_10029551 Ga0105247_100295513 446
1327 3300009176 Ga0105242_10074880 Ga0105242_100748802 446
1328 3300009177 Ga0105248_10006667 Ga0105248_100066678 446
1329 3300009545 Ga0105237_10011201 Ga0105237_100112015 446
1330 3300011119 Ga0105246_10025696 Ga0105246_100256962 446
1331 3300011119 Ga0105246_10032896 Ga0105246_100328962 446
1332 3300013102 Ga0157371_10024324 Ga0157371_100243242 446
1333 3300013297 Ga0157378_10048083 Ga0157378_100480832 446
1334 3300013306 Ga0163162_10030510 Ga0163162_100305105 446
1335 3300014325 Ga0163163_10005125 Ga0163163_100051253 446
1336 3300014325 Ga0163163_10097029 Ga0163163_100970291 446
1337 3300014968 Ga0157379_10002363 Ga0157379_1000236311 446
1338 3300014968 Ga0157379_10015544 Ga0157379_100155443 446
1339 3300014969 Ga0157376_10023919 Ga0157376_100239195 446
1340 3300025250 Ga0209026_1000116 Ga0209026_100011685 446
1341 3300025256 Ga0209759_1000153 Ga0209759_100015339 446
1342 3300025899 Ga0207642_10002916 Ga0207642_100029162 446
1343 3300025903 Ga0207680_10003490 Ga0207680_100034906 446
1344 3300025903 Ga0207680_10023934 Ga0207680_100239343 446
1345 3300025907 Ga0207645_10020503 Ga0207645_100205033 446
1346 3300025915 Ga0207693_10000459 Ga0207693_1000045928 446
1347 3300025915 Ga0207693_10042011 Ga0207693_100420113 446
1348 3300025916 Ga0207663_10001764 Ga0207663_100017644 446
1349 3300025918 Ga0207662_10008462 Ga0207662_100084623 446
1350 3300025919 Ga0207657_10002480 Ga0207657_100024803 446
1351 3300025920 Ga0207649_10046621 Ga0207649_100466212 446
1352 3300025921 Ga0207652_10028379 Ga0207652_100283793 446
1353 3300025925 Ga0207650_10013390 Ga0207650_100133904 446
1354 3300025927 Ga0207687_10003000 Ga0207687_100030003 446
1355 3300025927 Ga0207687_10015981 Ga0207687_100159812 446
1356 3300025928 Ga0207700_10004901 Ga0207700_100049012 446
1357 3300025928 Ga0207700_10044413 Ga0207700_100444132 446
1358 3300025929 Ga0207664_10000761 Ga0207664_1000076118 446
1359 3300025933 Ga0207706_10071786 Ga0207706_100717862 446
1360 3300025934 Ga0207686_10002984 Ga0207686_100029843 446
1361 3300025934 Ga0207686_10027885 Ga0207686_100278853 446
1362 3300025936 Ga0207670_10018933 Ga0207670_100189333 446
1363 3300025936 Ga0207670_10060853 Ga0207670_100608532 446
1364 3300025941 Ga0207711_10000626 Ga0207711_1000062637 446
1365 3300025941 Ga0207711_10004393 Ga0207711_100043933 446
1366 3300025941 Ga0207711_10140254 Ga0207711_101402542 446
1367 3300025942 Ga0207689_10002893 Ga0207689_100028933 446
1368 3300025960 Ga0207651_10000481 Ga0207651_100004819 446
1369 3300025960 Ga0207651_10030620 Ga0207651_100306203 446
1370 3300025972 Ga0207668_10022902 Ga0207668_100229023 446
1371 3300025986 Ga0207658_10008591 Ga0207658_100085914 446
1372 3300025986 Ga0207658_10021254 Ga0207658_100212544 446
1373 3300025986 Ga0207658_10085436 Ga0207658_100854362 446
1374 3300026023 Ga0207677_10000359 Ga0207677_1000035910 446
1375 3300026023 Ga0207677_10006888 Ga0207677_100068884 446
1376 3300026023 Ga0207677_10045142 Ga0207677_100451422 446
1377 3300026035 Ga0207703_10000552 Ga0207703_1000055211 446
1378 3300026035 Ga0207703_10000739 Ga0207703_1000073926 446
1379 3300026089 Ga0207648_10006217 Ga0207648_100062178 446
1380 3300026095 Ga0207676_10001145 Ga0207676_1000114512 446
1381 3300026095 Ga0207676_10006255 Ga0207676_100062555 446
1382 3300026116 Ga0207674_10002729 Ga0207674_100027292 446
1383 3300026116 Ga0207674_10021953 Ga0207674_100219533 446
1384 3300026118 Ga0207675_100002730 Ga0207675_10000273012 446
1385 3300026121 Ga0207683_10002860 Ga0207683_1000286010 446
1386 3300028380 Ga0268265_10016646 Ga0268265_100166463 446
1387 3300028381 Ga0268264_10002815 Ga0268264_1000281510 446
1388 3300028381 Ga0268264_10022582 Ga0268264_100225824 446
1389 3300035086 Ga0373934_0014977 Ga0373934_0014977_1156_2514 446
1390 3300035111 Ga0373923_0009060 Ga0373923_0009060_1261_2619 446
1391 3300035118 Ga0373954_0008292 Ga0373954_0008292_1413_2771 446
1392 3300035119 Ga0373956_0018083 Ga0373956_0018083_716_2074 446
1393 3300035171 Ga0373946_0010335 Ga0373946_0010335_954_2312 446
1394 3300035692 Ga0373935_0057841 Ga0373935_0057841_900_2258 446
1395 3300035724 Ga0373933_0002724 Ga0373933_0002724_8443_9801 446
1396 3300037068 Ga0373925_0028153 Ga0373925_0028153_1325_2683 446
1397 3300038443 Ga0395901_0016751 Ga0395901_0016751_1943_3310 446
1398 3300046459 Ga0495629_0008811 Ga0495629_0008811_4865_6223 446
1399 3300046475 Ga0495639_0001280 Ga0495639_0001280_4203_5561 446
1400 3300046476 Ga0495662_0043851 Ga0495662_0043851_728_2086 446
1401 3300046499 Ga0495594_0015858 Ga0495594_0015858_1889_3247 446
1402 3300046526 Ga0495666_0028710 Ga0495666_0028710_712_2070 446
1403 3300046559 Ga0495667_0024865 Ga0495667_0024865_1928_3286 446
1404 3300046663 Ga0495635_0006358 Ga0495635_0006358_5205_6563 446
1405 3300046679 Ga0495623_0006009 Ga0495623_0006009_4970_6328 446
1406 3300046681 Ga0495647_0001465 Ga0495647_0001465_1699_3057 446
1407 3300047315 Ga0495581_0017609 Ga0495581_0017609_1023_2381 446
1408 3300047673 Ga0495593_0014536 Ga0495593_0014536_10_1368 446
1409 3300048905 Ga0496102_0012989 Ga0496102_0012989_3978_5336 446
1410 3300048905 Ga0496102_0024334 Ga0496102_0024334_161_1519 446
1411 3300048906 Ga0496103_0097966 Ga0496103_0097966_45_1403 446
1412 3300048908 Ga0496105_0014812 Ga0496105_0014812_1486_2844 446
1413 3300048912 Ga0496109_0053655 Ga0496109_0053655_1301_2659 446
1414 3300048915 Ga0496112_0020791 Ga0496112_0020791_672_2030 446
1415 3300048918 Ga0496115_0062801 Ga0496115_0062801_1548_2906 446
1416 3300048923 Ga0496120_0000832 Ga0496120_0000832_35271_36611 446

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21135

DRL_cat

Oxidoreductase DRL, catalytic domain

205

368

1

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

70

203

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3upy-assembly1.cif.gz_B crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. 0.9915 1 433
3upy-assembly1.cif.gz_B crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. 0.9825 1 433
3frn-assembly1.cif.gz_A crystal structure of flagellar protein flga from thermotoga maritima msb8 0.7761 350 417
6net-assembly3.cif.gz_B fad-dependent monooxygenase tropb from t. stipitatus substrate complex 0.7622 21 55
5lfo-assembly1.cif.gz_A crystal structure of murine n1-acetylpolyamine oxidase in complex with n1-acetylspermine 0.7593 24 53
ID Description Score Start End Superfamily
af_G5ECJ8_3_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.861 22 55 3.50.50.60
af_Q58325_34_123_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8393 96 161 3.40.50.720
af_E9AH12_65_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8277 23 159 3.40.50.720
5xgvB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8159 23 56 3.50.50.60
1vqwB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8137 24 57 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A526QFS4-F1-model_v4 Homoserine dehydrogenase 1.002 333 436
AF-A0A441WN15-F1-model_v4 Homoserine dehydrogenase 1 1 161 GO:0016491
GO:0050661
AF-A0A530GFW6-F1-model_v4 Homoserine dehydrogenase 0.9997 230 340
AF-A0A527G1W6-F1-model_v4 Homoserine dehydrogenase 0.999 255 356
AF-A0A2N7SEN7-F1-model_v4 deleted 0.9987 1 377

Feature Viewer

pLDDT pTM Quality
94.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map