F493695

General Info

Members Datasets Scaffolds Average Seq Length
1403 464 1383 142

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0550917|Ga0466960_0550917_58_477
Length 128
Sequence MERKQVSARRESLLGDEPGAFASARFVRVTPQKARRVVELVRGQAVEDALNILRFALASAVANAETTEGLDAGSLVVTKAMVDEGPTIKRWRARAQGRAARINKRTSHITLVVQPRANQDSTKKGRNA

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2739367898 Nocardioides sp. CF479 Isolate Unclassified
11 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
12 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
13 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
14 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
15 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
16 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
17 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
18 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
19 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
20 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
124 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
125 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
248 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
249 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
250 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
251 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
258 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
259 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
260 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
261 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
262 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
265 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
277 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
341 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
390 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
391 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
392 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
393 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
394 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
424 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
425 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
426 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
427 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
464 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.69
Metatranscriptomes 19.89
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 7.77
Nodule 0.07
Rhizoplane 7.27
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001376 3300000549 Bacteria 3649
2 LJQas_1009377 3300000549 Bacteria 1179
3 JGI24739J22299_10012134 3300001989 Bacteria 3164
4 JGI24739J22299_10014413 3300001989 Bacteria 2877
5 JGI24738J21930_10001633 3300002075 Bacteria 6156
6 Ga0006778J45830_1047560 3300003162 Bacteria 860
7 Ga0006759J45824_1024389 3300003163 Bacteria 1435
8 Ga0006758J48902_1015472 3300003300 Bacteria 914
9 Ga0006777J48905_1052029 3300003308 Bacteria 854
10 JGI25407J50210_10009484 3300003373 Bacteria 2467
11 Ga0006781J51513_1021454 3300003568 Bacteria 793
12 Ga0007410J51695_1013323 3300003574 Bacteria 1815
13 Ga0007416J51690_1025482 3300003577 Bacteria 955
14 Ga0006562J51391_1055045 3300003578 Bacteria 1030
15 Ga0007429J51699_1020720 3300003579 Bacteria 767
16 Ga0032354_1008083 3300003693 Bacteria 1937
17 JGI25405J52794_10045114 3300003911 Bacteria 938
18 Ga0070658_10480236 3300005327 Bacteria 1072
19 Ga0070676_11338978 3300005328 Bacteria 548
20 Ga0070683_100060577 3300005329 Bacteria 3518
21 Ga0070683_100173735 3300005329 Bacteria 2045
22 Ga0070683_100429471 3300005329 Bacteria 1260
23 Ga0070683_100553072 3300005329 Bacteria 1100
24 Ga0070683_100716249 3300005329 Bacteria 959
25 Ga0070683_101995586 3300005329 Bacteria 557
26 Ga0070670_100520023 3300005331 Bacteria 1060
27 Ga0070677_10477532 3300005333 Bacteria 672
28 Ga0068869_100441035 3300005334 Bacteria 1078
29 Ga0068869_100569559 3300005334 Bacteria 954
30 Ga0070682_100028438 3300005337 Bacteria 3362
31 Ga0070682_100114772 3300005337 Bacteria 1800
32 Ga0070682_100508901 3300005337 Bacteria 934
33 Ga0070682_101034634 3300005337 Bacteria 684
34 Ga0068868_100096107 3300005338 Bacteria 2392
35 Ga0068868_100945443 3300005338 Bacteria 786
36 Ga0068868_101154441 3300005338 Bacteria 714
37 Ga0068868_101665381 3300005338 Bacteria 600
38 Ga0068868_101952144 3300005338 Bacteria 556
39 Ga0070660_100136216 3300005339 Bacteria 1967
40 Ga0070660_100917798 3300005339 Bacteria 739
41 Ga0070689_100181515 3300005340 Bacteria 1709
42 Ga0070689_100605206 3300005340 Bacteria 949
43 Ga0070691_10169444 3300005341 Bacteria 1130
44 Ga0070687_100135823 3300005343 Bacteria 1426
45 Ga0070661_100265186 3300005344 Bacteria 1329
46 Ga0070692_10109517 3300005345 Bacteria 1525
47 Ga0070668_100884440 3300005347 Bacteria 798
48 Ga0070668_101044808 3300005347 Bacteria 735
49 Ga0070675_100218333 3300005354 Bacteria 1660
50 Ga0070675_100389616 3300005354 Bacteria 1241
51 Ga0070675_101852128 3300005354 Bacteria 557
52 Ga0070671_100289249 3300005355 Bacteria 1394
53 Ga0070674_100067586 3300005356 Bacteria 2514
54 Ga0070674_100137963 3300005356 Bacteria 1827
55 Ga0070674_100961039 3300005356 Bacteria 747
56 Ga0070674_101626818 3300005356 Bacteria 583
57 Ga0070673_100364268 3300005364 Bacteria 1286
58 Ga0070673_100768922 3300005364 Bacteria 888
59 Ga0070688_100155630 3300005365 Bacteria 1566
60 Ga0070688_101431845 3300005365 Bacteria 561
61 Ga0070659_100201752 3300005366 Bacteria 1637
62 Ga0070659_100325951 3300005366 Bacteria 1284
63 Ga0070659_100565211 3300005366 Bacteria 975
64 Ga0070659_100652320 3300005366 Bacteria 907
65 Ga0070667_101470267 3300005367 Bacteria 640
66 Ga0070667_101672116 3300005367 Bacteria 599
67 Ga0070714_100035855 3300005435 Bacteria 4158
68 Ga0070701_10001181 3300005438 Bacteria 9570
69 Ga0070701_10678506 3300005438 Bacteria 691
70 Ga0070700_100057255 3300005441 Bacteria 2446
71 Ga0070700_100074940 3300005441 Bacteria 2169
72 Ga0070700_100450102 3300005441 Bacteria 980
73 Ga0070700_100949038 3300005441 Bacteria 704
74 Ga0070663_100240209 3300005455 Bacteria 1429
75 Ga0070663_100273521 3300005455 Bacteria 1344
76 Ga0070663_100547854 3300005455 Bacteria 966
77 Ga0070663_100732829 3300005455 Bacteria 843
78 Ga0070678_100132971 3300005456 Bacteria 1979
79 Ga0070678_100592950 3300005456 Bacteria 988
80 Ga0070678_101599401 3300005456 Bacteria 612
81 Ga0070678_101748240 3300005456 Bacteria 586
82 Ga0070662_100541549 3300005457 Bacteria 975
83 Ga0068867_100201481 3300005459 Bacteria 1593
84 Ga0068867_100239173 3300005459 Bacteria 1472
85 Ga0068867_100546679 3300005459 Bacteria 1002
86 Ga0070685_10031017 3300005466 Bacteria 2983
87 Ga0070685_10344036 3300005466 Bacteria 1018
88 Ga0070698_100055313 3300005471 Bacteria 4025
89 Ga0070698_100392494 3300005471 Bacteria 1321
90 Ga0070679_100047460 3300005530 Bacteria 4280
91 Ga0070679_100800880 3300005530 Bacteria 885
92 Ga0070679_101123339 3300005530 Bacteria 731
93 Ga0070679_101640550 3300005530 Bacteria 591
94 Ga0070684_100233236 3300005535 Bacteria 1680
95 Ga0070684_100488128 3300005535 Bacteria 1140
96 Ga0070684_101232972 3300005535 Bacteria 704
97 Ga0068853_100074811 3300005539 Bacteria 2955
98 Ga0068853_100238565 3300005539 Bacteria 1666
99 Ga0068853_100589051 3300005539 Bacteria 1056
100 Ga0070672_100002167 3300005543 Bacteria 12376
101 Ga0070672_100113206 3300005543 Bacteria 2214
102 Ga0070672_100443394 3300005543 Bacteria 1117
103 Ga0070672_101066108 3300005543 Bacteria 717
104 Ga0070686_100090626 3300005544 Bacteria 2044
105 Ga0070695_100379051 3300005545 Bacteria 1067
106 Ga0070693_100526403 3300005547 Bacteria 842
107 Ga0070693_100595312 3300005547 Bacteria 797
108 Ga0070693_100889347 3300005547 Bacteria 667
109 Ga0070665_100204381 3300005548 Bacteria 1976
110 Ga0070664_100029753 3300005564 Bacteria 4554
111 Ga0070664_100533979 3300005564 Bacteria 1084
112 Ga0070664_101093786 3300005564 Bacteria 751
113 Ga0068857_100101060 3300005577 Bacteria 2587
114 Ga0068857_100556843 3300005577 Bacteria 1081
115 Ga0068857_101230025 3300005577 Bacteria 726
116 Ga0068854_100056171 3300005578 Bacteria 2837
117 Ga0068856_100151811 3300005614 Bacteria 2325
118 Ga0068856_100881930 3300005614 Bacteria 914
119 Ga0070702_100073205 3300005615 Bacteria 2029
120 Ga0070702_100174101 3300005615 Bacteria 1402
121 Ga0070702_100180569 3300005615 Bacteria 1380
122 Ga0068852_100002721 3300005616 Bacteria 12219
123 Ga0068852_100390224 3300005616 Bacteria 1367
124 Ga0068852_100789024 3300005616 Bacteria 963
125 Ga0068852_102375298 3300005616 Bacteria 551
126 Ga0068859_100200595 3300005617 Bacteria 2080
127 Ga0068864_102156781 3300005618 Bacteria 564
128 Ga0068866_10262124 3300005718 Bacteria 1063
129 Ga0068866_10876234 3300005718 Bacteria 630
130 Ga0068861_100010271 3300005719 Bacteria 6499
131 Ga0068861_100263512 3300005719 Bacteria 1476
132 Ga0068861_100722917 3300005719 Bacteria 927
133 Ga0068851_10281691 3300005834 Bacteria 951
134 Ga0068851_10373843 3300005834 Bacteria 834
135 Ga0068870_10000658 3300005840 Bacteria 13168
136 Ga0068870_10133942 3300005840 Bacteria 1442
137 Ga0068870_10311956 3300005840 Bacteria 996
138 Ga0068870_10444300 3300005840 Bacteria 853
139 Ga0068858_100764730 3300005842 Bacteria 942
140 Ga0068858_101461228 3300005842 Bacteria 674
141 Ga0068860_100021208 3300005843 Bacteria 6294
142 Ga0068860_100751614 3300005843 Bacteria 987
143 Ga0081455_10000409 3300005937 Bacteria 56312
144 Ga0081455_10009428 3300005937 Bacteria 10043
145 Ga0081455_10104192 3300005937 Bacteria 2270
146 Ga0081538_10000088 3300005981 Bacteria 88922
147 Ga0081538_10038576 3300005981 Bacteria 3079
148 Ga0075365_10010269 3300006038 Bacteria 5441
149 Ga0075365_10055583 3300006038 Bacteria 2628
150 Ga0075365_10092299 3300006038 Bacteria 2064
151 Ga0075365_10146997 3300006038 Bacteria 1638
152 Ga0075365_10179443 3300006038 Bacteria 1480
153 Ga0075365_10181107 3300006038 Bacteria 1473
154 Ga0075365_10211303 3300006038 Bacteria 1360
155 Ga0075365_10367365 3300006038 Bacteria 1014
156 Ga0075365_10531700 3300006038 Bacteria 831
157 Ga0075365_10565233 3300006038 Bacteria 804
158 Ga0075365_10583801 3300006038 Bacteria 790
159 Ga0075365_10633990 3300006038 Bacteria 755
160 Ga0075365_10766065 3300006038 Bacteria 681
161 Ga0075365_11057997 3300006038 Bacteria 571
162 Ga0075368_10001331 3300006042 Bacteria 7845
163 Ga0075368_10057698 3300006042 Bacteria 1550
164 Ga0075368_10102200 3300006042 Bacteria 1178
165 Ga0075368_10135573 3300006042 Bacteria 1025
166 Ga0075368_10208070 3300006042 Bacteria 829
167 Ga0075363_100035386 3300006048 Bacteria 2613
168 Ga0075363_100041533 3300006048 Bacteria 2426
169 Ga0075363_100109106 3300006048 Bacteria 1537
170 Ga0075363_100124271 3300006048 Bacteria 1443
171 Ga0075363_100237441 3300006048 Bacteria 1047
172 Ga0075363_100398529 3300006048 Bacteria 809
173 Ga0075363_100671169 3300006048 Bacteria 624
174 Ga0075364_10046975 3300006051 Bacteria 2811
175 Ga0075364_10171268 3300006051 Bacteria 1468
176 Ga0075364_10191422 3300006051 Bacteria 1385
177 Ga0075364_10261514 3300006051 Bacteria 1176
178 Ga0075364_10644615 3300006051 Bacteria 723
179 Ga0075364_10661179 3300006051 Bacteria 713
180 Ga0075362_10026928 3300006177 Bacteria 2459
181 Ga0075367_10025786 3300006178 Bacteria 3327
182 Ga0075367_10029487 3300006178 Bacteria 3139
183 Ga0075367_10041821 3300006178 Bacteria 2680
184 Ga0075367_10210578 3300006178 Bacteria 1215
185 Ga0075367_10412588 3300006178 Bacteria 854
186 Ga0075367_10504682 3300006178 Bacteria 767
187 Ga0075367_10567774 3300006178 Bacteria 721
188 Ga0075369_10048911 3300006186 Bacteria 1826
189 Ga0097621_101652236 3300006237 Bacteria 609
190 Ga0075370_10064412 3300006353 Bacteria 2090
191 Ga0075370_10171740 3300006353 Bacteria 1274
192 Ga0075370_10189229 3300006353 Bacteria 1212
193 Ga0075370_10217143 3300006353 Bacteria 1130
194 Ga0075370_10236513 3300006353 Bacteria 1081
195 Ga0075370_10489840 3300006353 Bacteria 741
196 Ga0075370_10585152 3300006353 Bacteria 676
197 Ga0075370_10592138 3300006353 Bacteria 672
198 Ga0068871_100785931 3300006358 Bacteria 877
199 Ga0075428_100002072 3300006844 Bacteria 21635
200 Ga0075428_101361031 3300006844 Bacteria 746
201 Ga0075430_100005226 3300006846 Bacteria 10945
202 Ga0075430_100080440 3300006846 Bacteria 2730
203 Ga0075431_100001734 3300006847 Bacteria 20513
204 Ga0075431_100004313 3300006847 Bacteria 13937
205 Ga0075431_100038721 3300006847 Bacteria 4911
206 Ga0075433_10641029 3300006852 Bacteria 932
207 Ga0075434_101862647 3300006871 Bacteria 608
208 Ga0075429_100006773 3300006880 Bacteria 9938
209 Ga0075429_100017134 3300006880 Bacteria 6265
210 Ga0075429_100528534 3300006880 Bacteria 1034
211 Ga0068865_100006802 3300006881 Bacteria 7000
212 Ga0068865_100246657 3300006881 Bacteria 1408
213 Ga0075436_100652178 3300006914 Bacteria 778
214 Ga0097620_100200581 3300006931 Bacteria 2080
215 Ga0075435_101429881 3300007076 Bacteria 606
216 Ga0105240_11894518 3300009093 Bacteria 620
217 Ga0111539_10041331 3300009094 Bacteria 5544
218 Ga0111539_10358791 3300009094 Bacteria 1696
219 Ga0111539_10587947 3300009094 Bacteria 1296
220 Ga0111539_10831785 3300009094 Bacteria 1074
221 Ga0111539_11278138 3300009094 Bacteria 852
222 Ga0111539_11541607 3300009094 Bacteria 771
223 Ga0111539_11716575 3300009094 Bacteria 728
224 Ga0105245_10533897 3300009098 Bacteria 1193
225 Ga0105245_10714775 3300009098 Bacteria 1036
226 Ga0105245_11140965 3300009098 Bacteria 826
227 Ga0105245_11371206 3300009098 Bacteria 757
228 Ga0105245_11444485 3300009098 Bacteria 738
229 Ga0105245_13039075 3300009098 Bacteria 520
230 Ga0105247_10303636 3300009101 Bacteria 1108
231 Ga0105247_10551419 3300009101 Bacteria 848
232 Ga0105247_10928075 3300009101 Bacteria 674
233 Ga0114129_10000234 3300009147 Bacteria 61922
234 Ga0114129_10006606 3300009147 Bacteria 16463
235 Ga0105243_10002648 3300009148 Bacteria 14867
236 Ga0105243_10126788 3300009148 Bacteria 2161
237 Ga0105243_10581361 3300009148 Bacteria 1075
238 Ga0105243_10635011 3300009148 Bacteria 1033
239 Ga0105243_10747924 3300009148 Bacteria 958
240 Ga0105243_10889462 3300009148 Bacteria 885
241 Ga0105243_11016600 3300009148 Bacteria 832
242 Ga0105243_11055573 3300009148 Bacteria 818
243 Ga0105242_10336584 3300009176 Bacteria 1389
244 Ga0105242_10338520 3300009176 Bacteria 1386
245 Ga0105248_10173273 3300009177 Bacteria 2432
246 Ga0105237_10852644 3300009545 Bacteria 918
247 Ga0105238_10608358 3300009551 Bacteria 1101
248 Ga0105238_10755879 3300009551 Bacteria 986
249 Ga0105238_10757932 3300009551 Bacteria 985
250 Ga0105238_11413781 3300009551 Bacteria 723
251 Ga0105249_10033506 3300009553 Bacteria 4650
252 Ga0105249_10106364 3300009553 Bacteria 2647
253 Ga0105249_10640569 3300009553 Bacteria 1120
254 Ga0105249_11426410 3300009553 Bacteria 764
255 Ga0105239_10024787 3300010375 Bacteria 6608
256 Ga0105239_11514235 3300010375 Bacteria 775
257 Ga0105239_11517279 3300010375 Bacteria 774
258 Ga0105246_10206720 3300011119 Bacteria 1530
259 Ga0105246_10375976 3300011119 Bacteria 1172
260 Ga0105246_10595867 3300011119 Bacteria 954
261 Ga0105246_10693010 3300011119 Bacteria 892
262 Ga0105246_11057755 3300011119 Bacteria 738
263 Ga0157322_1015937 3300012490 Bacteria 675
264 Ga0157341_1009388 3300012494 Bacteria 814
265 Ga0157339_1017013 3300012505 Bacteria 734
266 Ga0157371_10354275 3300013102 Bacteria 1069
267 Ga0157371_10449972 3300013102 Bacteria 947
268 Ga0157371_11320876 3300013102 Bacteria 558
269 Ga0157370_10414908 3300013104 Bacteria 1239
270 Ga0157370_10476036 3300013104 Bacteria 1147
271 Ga0157370_10677002 3300013104 Bacteria 942
272 Ga0157370_10813114 3300013104 Bacteria 850
273 Ga0157369_10488777 3300013105 Bacteria 1274
274 Ga0157369_10575182 3300013105 Bacteria 1164
275 Ga0157369_10748908 3300013105 Bacteria 1005
276 Ga0157369_10922309 3300013105 Bacteria 895
277 Ga0157369_11007682 3300013105 Bacteria 853
278 Ga0157369_11794246 3300013105 Bacteria 623
279 Ga0157374_10693022 3300013296 Bacteria 1031
280 Ga0157374_11254421 3300013296 Bacteria 763
281 Ga0157378_10729055 3300013297 Bacteria 1012
282 Ga0163162_10389264 3300013306 Bacteria 1527
283 Ga0163162_10545019 3300013306 Bacteria 1288
284 Ga0163162_10687283 3300013306 Bacteria 1145
285 Ga0163162_11601871 3300013306 Bacteria 743
286 Ga0163162_12638110 3300013306 Bacteria 578
287 Ga0157372_10067801 3300013307 Bacteria 4010
288 Ga0157372_10233202 3300013307 Bacteria 2134
289 Ga0157372_10356926 3300013307 Bacteria 1703
290 Ga0157372_10886991 3300013307 Bacteria 1035
291 Ga0157372_11198389 3300013307 Bacteria 877
292 Ga0157372_11750100 3300013307 Bacteria 715
293 Ga0157375_10467033 3300013308 Bacteria 1427
294 Ga0157375_10529730 3300013308 Bacteria 1341
295 Ga0157375_10956945 3300013308 Bacteria 998
296 Ga0157375_11020196 3300013308 Bacteria 966
297 Ga0157375_11269252 3300013308 Bacteria 865
298 Ga0157375_12831267 3300013308 Bacteria 580
299 Ga0163163_10224420 3300014325 Bacteria 1928
300 Ga0163163_10273182 3300014325 Bacteria 1741
301 Ga0163163_10615159 3300014325 Bacteria 1150
302 Ga0163163_11712571 3300014325 Bacteria 689
303 Ga0163163_12094559 3300014325 Bacteria 625
304 Ga0157380_10037515 3300014326 Bacteria 3755
305 Ga0157380_10312725 3300014326 Bacteria 1452
306 Ga0157380_10712475 3300014326 Bacteria 1010
307 Ga0157380_10798099 3300014326 Bacteria 961
308 Ga0157380_12082369 3300014326 Bacteria 630
309 Ga0182008_10098142 3300014497 Bacteria 1446
310 Ga0182008_10421450 3300014497 Bacteria 721
311 Ga0157377_10073460 3300014745 Bacteria 1982
312 Ga0157377_10683054 3300014745 Bacteria 743
313 Ga0157376_10385576 3300014969 Bacteria 1351
314 Ga0157376_11234222 3300014969 Bacteria 776
315 Ga0163161_10026654 3300017792 Bacteria 4094
316 Ga0163161_10345769 3300017792 Bacteria 1181
317 Ga0163161_10470460 3300017792 Bacteria 1019
318 Ga0163161_11031377 3300017792 Bacteria 704
319 Ga0197907_10124435 3300020069 Bacteria 531
320 Ga0206356_10119586 3300020070 Bacteria 1319
321 Ga0206356_10663620 3300020070 Bacteria 1641
322 Ga0206356_11221972 3300020070 Bacteria 704
323 Ga0206355_1430339 3300020076 Bacteria 667
324 Ga0206351_10141909 3300020077 Bacteria 1188
325 Ga0206352_10244107 3300020078 Bacteria 872
326 Ga0206350_10669679 3300020080 Bacteria 711
327 Ga0206350_11500533 3300020080 Bacteria 770
328 Ga0206350_11585932 3300020080 Bacteria 738
329 Ga0206354_10452849 3300020081 Bacteria 616
330 Ga0206354_10501550 3300020081 Bacteria 689
331 Ga0206354_10570029 3300020081 Bacteria 651
332 Ga0206354_10829853 3300020081 Bacteria 760
333 Ga0206353_10143802 3300020082 Bacteria 566
334 Ga0206353_10839177 3300020082 Bacteria 643
335 Ga0206353_11410002 3300020082 Bacteria 922
336 Ga0206353_11489688 3300020082 Bacteria 850
337 Ga0206353_11872656 3300020082 Bacteria 680
338 Ga0206353_12040929 3300020082 Bacteria 1374
339 Ga0224712_10003451 3300022467 Bacteria 4109
340 Ga0224712_10084624 3300022467 Bacteria 1316
341 Ga0224712_10244483 3300022467 Bacteria 827
342 Ga0207656_10094901 3300025321 Bacteria 1359
343 Ga0207656_10267857 3300025321 Bacteria 840
344 Ga0207682_10045174 3300025893 Bacteria 1807
345 Ga0207642_10016301 3300025899 Bacteria 2795
346 Ga0207642_10282712 3300025899 Bacteria 955
347 Ga0207710_10155554 3300025900 Bacteria 1111
348 Ga0207688_10048546 3300025901 Bacteria 2372
349 Ga0207688_10098689 3300025901 Bacteria 1684
350 Ga0207688_10244651 3300025901 Bacteria 1085
351 Ga0207688_10343947 3300025901 Bacteria 918
352 Ga0207688_10392964 3300025901 Bacteria 859
353 Ga0207680_10824931 3300025903 Bacteria 665
354 Ga0207647_10141073 3300025904 Bacteria 1412
355 Ga0207647_10167202 3300025904 Bacteria 1281
356 Ga0207647_10215247 3300025904 Bacteria 1108
357 Ga0207643_10131737 3300025908 Bacteria 1488
358 Ga0207643_10213357 3300025908 Bacteria 1179
359 Ga0207643_10308427 3300025908 Bacteria 986
360 Ga0207643_10318706 3300025908 Bacteria 970
361 Ga0207705_10709473 3300025909 Bacteria 782
362 Ga0207705_10838842 3300025909 Bacteria 713
363 Ga0207654_10464760 3300025911 Bacteria 889
364 Ga0207695_11577192 3300025913 Bacteria 537
365 Ga0207662_10097436 3300025918 Bacteria 1818
366 Ga0207662_10098352 3300025918 Bacteria 1810
367 Ga0207662_10232937 3300025918 Bacteria 1203
368 Ga0207662_10240929 3300025918 Bacteria 1184
369 Ga0207657_10095519 3300025919 Bacteria 2473
370 Ga0207657_10318016 3300025919 Bacteria 1231
371 Ga0207649_10497819 3300025920 Bacteria 926
372 Ga0207652_10877523 3300025921 Bacteria 793
373 Ga0207681_10545666 3300025923 Bacteria 954
374 Ga0207694_10501976 3300025924 Bacteria 1016
375 Ga0207650_10697896 3300025925 Bacteria 857
376 Ga0207659_10116199 3300025926 Bacteria 2042
377 Ga0207659_10218769 3300025926 Bacteria 1530
378 Ga0207687_10116619 3300025927 Bacteria 1991
379 Ga0207687_10334599 3300025927 Bacteria 1229
380 Ga0207687_10546324 3300025927 Bacteria 972
381 Ga0207687_10578659 3300025927 Bacteria 944
382 Ga0207664_10030840 3300025929 Bacteria 4098
383 Ga0207644_10816936 3300025931 Bacteria 780
384 Ga0207690_10105178 3300025932 Bacteria 2023
385 Ga0207690_10957684 3300025932 Bacteria 711
386 Ga0207706_10447768 3300025933 Bacteria 1117
387 Ga0207706_11226672 3300025933 Bacteria 622
388 Ga0207686_10424045 3300025934 Bacteria 1018
389 Ga0207686_10871285 3300025934 Bacteria 725
390 Ga0207709_10005029 3300025935 Bacteria 7555
391 Ga0207709_10273292 3300025935 Bacteria 1245
392 Ga0207709_10276395 3300025935 Bacteria 1239
393 Ga0207709_10479453 3300025935 Bacteria 967
394 Ga0207670_10022974 3300025936 Bacteria 3874
395 Ga0207669_10006873 3300025937 Bacteria 5232
396 Ga0207669_10390659 3300025937 Bacteria 1087
397 Ga0207669_11034872 3300025937 Bacteria 691
398 Ga0207665_10632995 3300025939 Bacteria 837
399 Ga0207691_10003431 3300025940 Bacteria 15416
400 Ga0207691_10087896 3300025940 Bacteria 2788
401 Ga0207691_10552198 3300025940 Bacteria 976
402 Ga0207711_10062361 3300025941 Bacteria 3216
403 Ga0207689_10271934 3300025942 Bacteria 1403
404 Ga0207689_10395221 3300025942 Bacteria 1152
405 Ga0207689_10496674 3300025942 Bacteria 1022
406 Ga0207661_10142467 3300025944 Bacteria 2064
407 Ga0207661_10238858 3300025944 Bacteria 1611
408 Ga0207661_10329831 3300025944 Bacteria 1373
409 Ga0207661_10371281 3300025944 Bacteria 1293
410 Ga0207661_10433304 3300025944 Bacteria 1195
411 Ga0207661_10480809 3300025944 Bacteria 1134
412 Ga0207679_10033027 3300025945 Bacteria 3639
413 Ga0207679_10232445 3300025945 Bacteria 1558
414 Ga0207679_10480510 3300025945 Bacteria 1106
415 Ga0207679_11626759 3300025945 Bacteria 592
416 Ga0207651_10840360 3300025960 Bacteria 815
417 Ga0207712_10093301 3300025961 Bacteria 2221
418 Ga0207712_10295094 3300025961 Bacteria 1328
419 Ga0207712_10345426 3300025961 Bacteria 1235
420 Ga0207668_10963808 3300025972 Bacteria 761
421 Ga0207640_10194835 3300025981 Bacteria 1530
422 Ga0207677_10132683 3300026023 Bacteria 1894
423 Ga0207677_10260195 3300026023 Bacteria 1414
424 Ga0207677_10897782 3300026023 Bacteria 799
425 Ga0207677_11093085 3300026023 Bacteria 727
426 Ga0207703_10858139 3300026035 Bacteria 868
427 Ga0207639_10351044 3300026041 Bacteria 1317
428 Ga0207639_10547924 3300026041 Bacteria 1062
429 Ga0207678_10236385 3300026067 Bacteria 1565
430 Ga0207678_10402602 3300026067 Bacteria 1185
431 Ga0207678_10482575 3300026067 Bacteria 1079
432 Ga0207678_10673240 3300026067 Bacteria 910
433 Ga0207678_11277653 3300026067 Bacteria 649
434 Ga0207678_11349890 3300026067 Bacteria 630
435 Ga0207708_10002425 3300026075 Bacteria 13693
436 Ga0207708_10071771 3300026075 Bacteria 2653
437 Ga0207708_10092514 3300026075 Bacteria 2333
438 Ga0207708_10305175 3300026075 Bacteria 1295
439 Ga0207708_10683706 3300026075 Bacteria 876
440 Ga0207702_10341668 3300026078 Bacteria 1430
441 Ga0207648_10007281 3300026089 Bacteria 10910
442 Ga0207648_10491238 3300026089 Bacteria 1122
443 Ga0207648_10593324 3300026089 Bacteria 1020
444 Ga0207676_10370140 3300026095 Bacteria 1331
445 Ga0207676_12104808 3300026095 Bacteria 563
446 Ga0207674_10013764 3300026116 Bacteria 8952
447 Ga0207674_10234946 3300026116 Bacteria 1781
448 Ga0207674_10730133 3300026116 Bacteria 956
449 Ga0207674_10902352 3300026116 Bacteria 852
450 Ga0207675_100003879 3300026118 Bacteria 14536
451 Ga0207675_100292959 3300026118 Bacteria 1583
452 Ga0207675_100436195 3300026118 Bacteria 1296
453 Ga0207675_100485601 3300026118 Bacteria 1228
454 Ga0207675_100532514 3300026118 Bacteria 1172
455 Ga0207675_100926237 3300026118 Bacteria 888
456 Ga0207675_101069607 3300026118 Bacteria 826
457 Ga0207683_10118248 3300026121 Bacteria 2378
458 Ga0207683_10268970 3300026121 Bacteria 1557
459 Ga0207683_11127210 3300026121 Bacteria 727
460 Ga0207683_11486503 3300026121 Bacteria 626
461 Ga0207698_10007471 3300026142 Bacteria 6847
462 Ga0207698_10277773 3300026142 Bacteria 1548
463 Ga0207698_10386897 3300026142 Bacteria 1332
464 Ga0207698_10412271 3300026142 Bacteria 1294
465 Ga0207698_11242847 3300026142 Bacteria 759
466 Ga0207698_11777425 3300026142 Bacteria 632
467 Ga0209970_1010625 3300027614 Bacteria 1507
468 Ga0209971_1017984 3300027682 Bacteria 1677
469 Ga0209813_10056987 3300027866 Bacteria 1238
470 Ga0209813_10422413 3300027866 Bacteria 541
471 Ga0207428_10010526 3300027907 Bacteria 8256
472 Ga0207428_10051104 3300027907 Bacteria 3305
473 Ga0268265_11172850 3300028380 Bacteria 765
474 Ga0268264_10000792 3300028381 Bacteria 34282
475 Ga0311001_1071007 3300029277 Bacteria 1146
476 Ga0307512_10033331 3300030522 Bacteria 4430
477 Ga0316176_1081384 3300030732 Bacteria 889
478 Ga0316176_1093836 3300030732 Bacteria 1183
479 Ga0314311_1063086 3300030733 Bacteria 2200
480 Ga0314311_1091600 3300030733 Bacteria 1564
481 Ga0314311_1110141 3300030733 Bacteria 1347
482 Ga0316183_1044482 3300030742 Bacteria 1730
483 Ga0316181_1044632 3300030744 Bacteria 2032
484 Ga0316181_1229775 3300030744 Bacteria 1347
485 Ga0316182_1249978 3300030745 Bacteria 801
486 Ga0307516_10792272 3300031730 Bacteria 609
487 Ga0307405_10264638 3300031731 Bacteria 1286
488 Ga0307405_10440607 3300031731 Bacteria 1030
489 Ga0307405_10621457 3300031731 Bacteria 884
490 Ga0307413_10069421 3300031824 Bacteria 2211
491 Ga0307413_10129430 3300031824 Bacteria 1725
492 Ga0307413_10179289 3300031824 Bacteria 1508
493 Ga0307413_10723827 3300031824 Bacteria 829
494 Ga0307413_10930263 3300031824 Bacteria 740
495 Ga0307413_11243746 3300031824 Bacteria 649
496 Ga0307410_10006052 3300031852 Bacteria 6484
497 Ga0307410_10097613 3300031852 Bacteria 2099
498 Ga0307410_10131183 3300031852 Bacteria 1841
499 Ga0307410_10528526 3300031852 Bacteria 974
500 Ga0307410_10717267 3300031852 Bacteria 844
501 Ga0307410_10814649 3300031852 Bacteria 795
502 Ga0307410_11011611 3300031852 Bacteria 717
503 Ga0307406_10152957 3300031901 Bacteria 1648
504 Ga0307406_10368336 3300031901 Bacteria 1129
505 Ga0307406_10373430 3300031901 Bacteria 1122
506 Ga0307406_10391940 3300031901 Bacteria 1098
507 Ga0307406_11270995 3300031901 Bacteria 641
508 Ga0307407_10013128 3300031903 Bacteria 4008
509 Ga0307407_10163621 3300031903 Bacteria 1458
510 Ga0307407_10451135 3300031903 Bacteria 933
511 Ga0307412_10235247 3300031911 Bacteria 1413
512 Ga0307412_11004704 3300031911 Bacteria 737
513 Ga0307412_11836423 3300031911 Bacteria 558
514 Ga0307412_11905643 3300031911 Bacteria 548
515 Ga0307409_100004499 3300031995 Bacteria 7849
516 Ga0307409_100306256 3300031995 Bacteria 1480
517 Ga0307409_100314031 3300031995 Bacteria 1464
518 Ga0307409_100328891 3300031995 Bacteria 1433
519 Ga0307409_100386549 3300031995 Bacteria 1332
520 Ga0307409_100467801 3300031995 Bacteria 1220
521 Ga0307409_100493559 3300031995 Bacteria 1191
522 Ga0307409_100626279 3300031995 Bacteria 1066
523 Ga0307409_100875547 3300031995 Bacteria 910
524 Ga0307409_101333037 3300031995 Bacteria 743
525 Ga0307416_100024263 3300032002 Bacteria 4421
526 Ga0307416_100127884 3300032002 Bacteria 2279
527 Ga0307416_100365132 3300032002 Bacteria 1467
528 Ga0307416_100688812 3300032002 Bacteria 1110
529 Ga0307416_100850266 3300032002 Bacteria 1010
530 Ga0307416_100884849 3300032002 Bacteria 992
531 Ga0307416_101061441 3300032002 Bacteria 914
532 Ga0307416_101473045 3300032002 Bacteria 786
533 Ga0307416_102375033 3300032002 Bacteria 630
534 Ga0307414_10077373 3300032004 Bacteria 2421
535 Ga0307414_10400359 3300032004 Bacteria 1192
536 Ga0307414_10655907 3300032004 Bacteria 946
537 Ga0307414_11118243 3300032004 Bacteria 728
538 Ga0307411_10034009 3300032005 Bacteria 3167
539 Ga0307411_10134877 3300032005 Bacteria 1810
540 Ga0307411_10198643 3300032005 Bacteria 1538
541 Ga0307411_10625737 3300032005 Bacteria 929
542 Ga0307415_100030696 3300032126 Bacteria 3453
543 Ga0307415_100113612 3300032126 Bacteria 2014
544 Ga0307415_100199168 3300032126 Bacteria 1587
545 Ga0307415_100897958 3300032126 Bacteria 816
546 Ga0307415_101751185 3300032126 Bacteria 600
547 Ga0316583_10020342 3300032133 Bacteria 2379
548 Ga0316593_10029364 3300032168 Bacteria 1778
549 Ga0316596_1091234 3300033541 Bacteria 821
550 Ga0373959_0041280 3300034820 Bacteria 969
551 Ga0373929_0041862 3300035085 Bacteria 1020
552 Ga0373944_0123308 3300035089 Bacteria 895
553 Ga0373952_0029220 3300035092 Bacteria 1214
554 Ga0373932_0356548 3300035112 Bacteria 557
555 Ga0373960_0098428 3300035121 Bacteria 945
556 Ga0373962_0073070 3300035242 Bacteria 1028
557 Ga0373962_0127058 3300035242 Bacteria 818
558 Ga0373931_0097053 3300035691 Bacteria 1652
559 Ga0395899_0220065 3300037312 Bacteria 1315
560 Ga0395899_0495866 3300037312 Bacteria 793
561 Ga0395900_0042235 3300037418 Bacteria 4697
562 Ga0395900_0080337 3300037418 Bacteria 3351
563 Ga0395900_0169253 3300037418 Bacteria 2225
564 Ga0395900_0906545 3300037418 Bacteria 805
565 Ga0395898_0032908 3300037466 Bacteria 5175
566 Ga0395898_0090098 3300037466 Bacteria 2952
567 Ga0395898_0117522 3300037466 Bacteria 2548
568 Ga0395898_0463154 3300037466 Bacteria 1207
569 Ga0395898_0523938 3300037466 Bacteria 1127
570 Ga0395905_0660609 3300037471 Bacteria 947
571 Ga0395905_1408803 3300037471 Bacteria 601
572 Ga0436364_0626737 3300037853 Bacteria 2527
573 Ga0436364_0711707 3300037853 Bacteria 1019
574 Ga0395901_0002011 3300038443 Bacteria 20930
575 Ga0395901_0038023 3300038443 Bacteria 4978
576 Ga0395901_0044740 3300038443 Bacteria 4591
577 Ga0395901_0149529 3300038443 Bacteria 2454
578 Ga0395901_0880952 3300038443 Bacteria 878
579 Ga0439438_017324 3300041405 Bacteria 2077
580 Ga0439439_0034120 3300041406 Bacteria 1305
581 Ga0439447_022943 3300041407 Bacteria 1630
582 Ga0439461_0081393 3300041410 Bacteria 764
583 Ga0439466_0080675 3300041411 Bacteria 1026
584 Ga0451789_0337217 3300041443 Bacteria 503
585 Ga0451789_1155910 3300041443 Bacteria 1330
586 Ga0451789_1213167 3300041443 Bacteria 620
587 Ga0451790_03312 3300041444 Bacteria 513
588 Ga0451792_01584 3300041445 Bacteria 600
589 Ga0451793_0939683 3300041452 Bacteria 562
590 Ga0451797_0843885 3300041453 Bacteria 510
591 Ga0451797_0868523 3300041453 Bacteria 672
592 Ga0451798_0514919 3300041458 Bacteria 523
593 Ga0451800_1688016 3300041459 Bacteria 638
594 Ga0451802_0804525 3300041460 Bacteria 628
595 Ga0451807_2362550 3300041486 Bacteria 509
596 Ga0451835_0543034 3300041492 Bacteria 579
597 Ga0451835_0604248 3300041492 Bacteria 681
598 Ga0451837_1843479 3300041494 Bacteria 591
599 Ga0451839_0171162 3300041496 Bacteria 795
600 Ga0451841_0318149 3300041498 Bacteria 689
601 Ga0451841_0744881 3300041498 Bacteria 570
602 Ga0451849_0357388 3300041505 Bacteria 827
603 Ga0451851_0981888 3300041507 Bacteria 653
604 Ga0451843_0076660 3300041509 Bacteria 992
605 Ga0451855_0560015 3300041511 Bacteria 614
606 Ga0451855_1287871 3300041511 Bacteria 524
607 Ga0451853_2312243 3300041512 Bacteria 1384
608 Ga0439431_0008571 3300041997 Bacteria 2301
609 Ga0439442_066080 3300042002 Bacteria 768
610 Ga0439445_0013830 3300042004 Bacteria 1957
611 Ga0439449_0077931 3300042007 Bacteria 1222
612 Ga0439457_033137 3300042014 Bacteria 1147
613 Ga0439462_0084425 3300042015 Bacteria 869
614 Ga0450920_014777 3300042122 Bacteria 1481
615 Ga0450907_011557 3300042146 Bacteria 1466
616 Ga0439446_0164790 3300042156 Bacteria 734
617 Ga0439434_0000725 3300042435 Bacteria 9435
618 Ga0450901_027965 3300042533 Bacteria 618
619 Ga0466969_0042846 3300044656 Bacteria 2257
620 Ga0466969_0150416 3300044656 Bacteria 1073
621 Ga0466972_0007943 3300044658 Bacteria 5318
622 Ga0466972_0089180 3300044658 Bacteria 1463
623 Ga0466972_0201794 3300044658 Bacteria 931
624 Ga0466972_0340407 3300044658 Bacteria 701
625 Ga0466965_0010425 3300044683 Bacteria 4335
626 Ga0466965_0021029 3300044683 Bacteria 3139
627 Ga0466965_0066512 3300044683 Bacteria 1807
628 Ga0466965_0118162 3300044683 Bacteria 1367
629 Ga0466965_0180193 3300044683 Bacteria 1114
630 Ga0466965_0213732 3300044683 Bacteria 1026
631 Ga0466965_0216655 3300044683 Bacteria 1019
632 Ga0466965_0339951 3300044683 Bacteria 820
633 Ga0466965_0514916 3300044683 Bacteria 672
634 Ga0466965_0644282 3300044683 Bacteria 605
635 Ga0466965_0902143 3300044683 Bacteria 515
636 Ga0466966_0060595 3300044684 Bacteria 2388
637 Ga0466966_0066805 3300044684 Bacteria 2259
638 Ga0466966_0539043 3300044684 Bacteria 702
639 Ga0466966_0799946 3300044684 Bacteria 568
640 Ga0466961_0014059 3300044693 Bacteria 5133
641 Ga0466961_0089772 3300044693 Bacteria 1940
642 Ga0466961_0211677 3300044693 Bacteria 1196
643 Ga0466961_0478448 3300044693 Bacteria 753
644 Ga0466961_0503309 3300044693 Bacteria 731
645 Ga0466963_0002887 3300044694 Bacteria 9706
646 Ga0466963_0047188 3300044694 Bacteria 2842
647 Ga0466963_0075177 3300044694 Bacteria 2279
648 Ga0466963_0235872 3300044694 Bacteria 1282
649 Ga0466963_0301232 3300044694 Bacteria 1127
650 Ga0466963_0677370 3300044694 Bacteria 728
651 Ga0466964_0054135 3300044706 Bacteria 1653
652 Ga0466964_0065515 3300044706 Bacteria 1522
653 Ga0466964_0171153 3300044706 Bacteria 1023
654 Ga0466964_0493307 3300044706 Bacteria 656
655 Ga0466964_0692021 3300044706 Bacteria 567
656 Ga0466964_0713652 3300044706 Bacteria 560
657 Ga0466971_0020611 3300044719 Bacteria 2931
658 Ga0466971_0049834 3300044719 Bacteria 1884
659 Ga0466971_0128689 3300044719 Bacteria 1174
660 Ga0466971_0134028 3300044719 Bacteria 1151
661 Ga0466971_0305243 3300044719 Bacteria 765
662 Ga0466968_0026632 3300044735 Bacteria 2375
663 Ga0466968_0141573 3300044735 Bacteria 1100
664 Ga0466968_0159201 3300044735 Bacteria 1041
665 Ga0466970_0007149 3300044765 Bacteria 5589
666 Ga0466970_0021669 3300044765 Bacteria 3348
667 Ga0466970_0025660 3300044765 Bacteria 3086
668 Ga0466970_0249866 3300044765 Bacteria 993
669 Ga0466970_0298319 3300044765 Bacteria 908
670 Ga0466970_0340870 3300044765 Bacteria 849
671 Ga0466970_0393891 3300044765 Bacteria 790
672 Ga0466970_0417828 3300044765 Bacteria 766
673 Ga0466970_0515876 3300044765 Bacteria 689
674 Ga0466970_0542329 3300044765 Bacteria 672
675 Ga0466970_0589172 3300044765 Bacteria 644
676 Ga0466970_0686165 3300044765 Bacteria 597
677 Ga0466957_0041531 3300044842 Bacteria 2781
678 Ga0466957_0127653 3300044842 Bacteria 1626
679 Ga0466957_0171478 3300044842 Bacteria 1413
680 Ga0466957_0176113 3300044842 Bacteria 1395
681 Ga0466957_0308782 3300044842 Bacteria 1064
682 Ga0466957_0492980 3300044842 Bacteria 848
683 Ga0466957_0556831 3300044842 Bacteria 799
684 Ga0466960_0002126 3300044901 Bacteria 7386
685 Ga0466960_0009725 3300044901 Bacteria 3975
686 Ga0466960_0039714 3300044901 Bacteria 2221
687 Ga0466960_0153551 3300044901 Bacteria 1232
688 Ga0466960_0194225 3300044901 Bacteria 1106
689 Ga0466960_0270494 3300044901 Bacteria 949
690 Ga0466960_0505297 3300044901 Bacteria 709
691 Ga0466960_0550917 3300044901 Bacteria 680
692 Ga0466960_0744016 3300044901 Bacteria 590
693 Ga0466959_0044069 3300045049 Bacteria 3287
694 Ga0466959_0940213 3300045049 Bacteria 576
695 Ga0466958_0066032 3300045836 Bacteria 2208
696 Ga0466958_0250198 3300045836 Bacteria 1133
697 Ga0466958_0945592 3300045836 Bacteria 562
698 Ga0466967_0013542 3300045976 Bacteria 6308
699 Ga0466967_0048014 3300045976 Bacteria 3725
700 Ga0466967_0057496 3300045976 Bacteria 3434
701 Ga0466967_0311524 3300045976 Bacteria 1516
702 Ga0466967_0442002 3300045976 Bacteria 1270
703 Ga0466967_0549075 3300045976 Bacteria 1137
704 Ga0466967_0729642 3300045976 Bacteria 982
705 Ga0466967_1694736 3300045976 Bacteria 629
706 Ga0495590_0075600 3300046457 Bacteria 1185
707 Ga0495629_0096372 3300046459 Bacteria 2064
708 Ga0495629_0456676 3300046459 Bacteria 865
709 Ga0495629_0500075 3300046459 Bacteria 820
710 Ga0495641_0337918 3300046461 Bacteria 680
711 Ga0495651_0481029 3300046462 Bacteria 798
712 Ga0495653_0057884 3300046463 Bacteria 2948
713 Ga0495582_0164038 3300046473 Bacteria 1264
714 Ga0495639_0278480 3300046475 Bacteria 831
715 Ga0495664_0075173 3300046477 Bacteria 2021
716 Ga0495596_0340571 3300046500 Bacteria 584
717 Ga0495608_0139951 3300046511 Bacteria 1545
718 Ga0495620_0049001 3300046515 Bacteria 1810
719 Ga0495630_0381578 3300046517 Bacteria 1080
720 Ga0495631_0161727 3300046518 Bacteria 961
721 Ga0495631_0245870 3300046518 Bacteria 763
722 Ga0495586_0231445 3300046535 Bacteria 1052
723 Ga0495609_0321260 3300046538 Bacteria 628
724 Ga0495667_0776521 3300046559 Bacteria 591
725 Ga0495656_0649857 3300046615 Bacteria 566
726 Ga0495634_0250224 3300046642 Bacteria 1084
727 Ga0495599_0234217 3300046678 Bacteria 1121
728 Ga0495647_0108849 3300046681 Bacteria 1155
729 Ga0495658_0077248 3300046683 Bacteria 1947
730 Ga0495658_0378484 3300046683 Bacteria 901
731 Ga0495613_0586162 3300046689 Bacteria 743
732 Ga0495674_0493845 3300047319 Bacteria 980
733 Ga0495674_1000037 3300047319 Bacteria 641
734 Ga0495676_0197442 3300047321 Bacteria 1400
735 Ga0495676_0284682 3300047321 Bacteria 1118
736 Ga0495680_0278739 3300047322 Bacteria 1179
737 Ga0496100_0029403 3300048903 Bacteria 3398
738 Ga0496100_0135127 3300048903 Bacteria 1741
739 Ga0496100_0357801 3300048903 Bacteria 1104
740 Ga0496100_0476446 3300048903 Bacteria 959
741 Ga0496100_0547411 3300048903 Bacteria 895
742 Ga0496101_0025837 3300048904 Bacteria 4077
743 Ga0496101_0085853 3300048904 Bacteria 2333
744 Ga0496101_0312267 3300048904 Bacteria 1232
745 Ga0496101_0561052 3300048904 Bacteria 903
746 Ga0496101_0588301 3300048904 Bacteria 880
747 Ga0496101_0907791 3300048904 Bacteria 693
748 Ga0496101_1111537 3300048904 Bacteria 620
749 Ga0496102_0004268 3300048905 Bacteria 12085
750 Ga0496102_0298706 3300048905 Bacteria 1518
751 Ga0496102_0420064 3300048905 Bacteria 1256
752 Ga0496102_0674086 3300048905 Bacteria 957
753 Ga0496102_0778201 3300048905 Bacteria 879
754 Ga0496102_1821992 3300048905 Bacteria 526
755 Ga0496103_0002413 3300048906 Bacteria 11762
756 Ga0496103_0170212 3300048906 Bacteria 1399
757 Ga0496103_0203919 3300048906 Bacteria 1272
758 Ga0496103_0333986 3300048906 Bacteria 975
759 Ga0496103_0376991 3300048906 Bacteria 911
760 Ga0496104_0021580 3300048907 Bacteria 5913
761 Ga0496104_0042002 3300048907 Bacteria 4289
762 Ga0496104_0152888 3300048907 Bacteria 2215
763 Ga0496104_0313410 3300048907 Bacteria 1482
764 Ga0496104_0441400 3300048907 Bacteria 1213
765 Ga0496104_0926519 3300048907 Bacteria 776
766 Ga0496105_0004859 3300048908 Bacteria 10146
767 Ga0496105_0065779 3300048908 Bacteria 2992
768 Ga0496105_0191069 3300048908 Bacteria 1674
769 Ga0496105_0367810 3300048908 Bacteria 1146
770 Ga0496105_0666180 3300048908 Bacteria 802
771 Ga0496106_0005923 3300048909 Bacteria 9038
772 Ga0496106_0232430 3300048909 Bacteria 1472
773 Ga0496106_0566117 3300048909 Bacteria 911
774 Ga0496107_0172477 3300048910 Bacteria 1605
775 Ga0496107_0340140 3300048910 Bacteria 1116
776 Ga0496107_0465519 3300048910 Bacteria 938
777 Ga0496107_0555287 3300048910 Bacteria 850
778 Ga0496108_0026274 3300048911 Bacteria 4801
779 Ga0496108_0177302 3300048911 Bacteria 1845
780 Ga0496108_0214879 3300048911 Bacteria 1670
781 Ga0496108_0225093 3300048911 Bacteria 1630
782 Ga0496108_0245746 3300048911 Bacteria 1557
783 Ga0496108_0303696 3300048911 Bacteria 1390
784 Ga0496108_0336636 3300048911 Bacteria 1316
785 Ga0496108_0422087 3300048911 Bacteria 1165
786 Ga0496109_0025845 3300048912 Bacteria 5233
787 Ga0496109_0029564 3300048912 Bacteria 4908
788 Ga0496109_0029975 3300048912 Bacteria 4875
789 Ga0496109_0381469 3300048912 Bacteria 1331
790 Ga0496109_0426755 3300048912 Bacteria 1252
791 Ga0496109_0584548 3300048912 Bacteria 1052
792 Ga0496109_0682021 3300048912 Bacteria 965
793 Ga0496109_0709204 3300048912 Bacteria 944
794 Ga0496109_0844733 3300048912 Bacteria 853
795 Ga0496109_1575207 3300048912 Bacteria 591
796 Ga0496110_0003020 3300048913 Bacteria 12767
797 Ga0496110_0280148 3300048913 Bacteria 1518
798 Ga0496110_0280749 3300048913 Bacteria 1516
799 Ga0496110_0310146 3300048913 Bacteria 1437
800 Ga0496110_0489336 3300048913 Bacteria 1120
801 Ga0496110_0607993 3300048913 Bacteria 991
802 Ga0496110_1733917 3300048913 Bacteria 535
803 Ga0496111_0021913 3300048914 Bacteria 4466
804 Ga0496111_0069011 3300048914 Bacteria 2570
805 Ga0496111_0276250 3300048914 Bacteria 1246
806 Ga0496111_0309142 3300048914 Bacteria 1171
807 Ga0496111_0620844 3300048914 Bacteria 790
808 Ga0496111_0792646 3300048914 Bacteria 686
809 Ga0496111_0870876 3300048914 Bacteria 650
810 Ga0496111_0881956 3300048914 Bacteria 645
811 Ga0496112_0012650 3300048915 Bacteria 7758
812 Ga0496112_1131876 3300048915 Bacteria 700
813 Ga0496112_1147788 3300048915 Bacteria 694
814 Ga0496113_0299038 3300048916 Bacteria 1288
815 Ga0496114_0066334 3300048917 Bacteria 3025
816 Ga0496114_0190045 3300048917 Bacteria 1796
817 Ga0496114_0233484 3300048917 Bacteria 1616
818 Ga0496114_0244125 3300048917 Bacteria 1579
819 Ga0496114_0297163 3300048917 Bacteria 1425
820 Ga0496114_0300732 3300048917 Bacteria 1416
821 Ga0496114_0570531 3300048917 Bacteria 999
822 Ga0496114_0782312 3300048917 Bacteria 832
823 Ga0496114_1068777 3300048917 Bacteria 691
824 Ga0496114_1106458 3300048917 Bacteria 677
825 Ga0496115_0123607 3300048918 Bacteria 2130
826 Ga0496115_0666949 3300048918 Bacteria 820
827 Ga0496124_0186718 3300048927 Bacteria 1590
828 Ga0496124_0596134 3300048927 Bacteria 720
829 Ga0501306_004752 3300049127 Bacteria 1534
830 Ga0501306_008227 3300049127 Bacteria 1268
831 Ga0501306_009279 3300049127 Bacteria 1218
832 Ga0501306_011666 3300049127 Bacteria 1124
833 Ga0501306_018050 3300049127 Bacteria 962
834 Ga0501306_024872 3300049127 Bacteria 858
835 Ga0501306_032117 3300049127 Bacteria 785
836 Ga0501306_043066 3300049127 Bacteria 705
837 Ga0501306_049266 3300049127 Bacteria 672
838 Ga0501306_081467 3300049127 Bacteria 559
839 Ga0501308_004488 3300049128 Bacteria 1347
840 Ga0501308_007774 3300049128 Bacteria 1131
841 Ga0501308_011000 3300049128 Bacteria 1014
842 Ga0501308_015225 3300049128 Bacteria 909
843 Ga0501308_021454 3300049128 Bacteria 811
844 Ga0501308_023913 3300049128 Bacteria 783
845 Ga0501308_028631 3300049128 Bacteria 737
846 Ga0501308_053802 3300049128 Bacteria 595
847 Ga0501308_066625 3300049128 Bacteria 553
848 Ga0501308_078160 3300049128 Bacteria 523
849 Ga0501309_000178 3300049129 Bacteria 4209
850 Ga0501309_004651 3300049129 Bacteria 1606
851 Ga0501309_031341 3300049129 Bacteria 786
852 Ga0501309_035097 3300049129 Bacteria 751
853 Ga0501309_066995 3300049129 Bacteria 585
854 Ga0501309_070980 3300049129 Bacteria 572
855 Ga0501310_000215 3300049130 Bacteria 5482
856 Ga0501310_000840 3300049130 Bacteria 2737
857 Ga0501310_004536 3300049130 Bacteria 1398
858 Ga0501310_014670 3300049130 Bacteria 922
859 Ga0501310_037052 3300049130 Bacteria 667
860 Ga0501310_039053 3300049130 Bacteria 655
861 Ga0501310_052760 3300049130 Bacteria 591
862 Ga0501310_056296 3300049130 Bacteria 578
863 Ga0501310_060938 3300049130 Bacteria 562
864 Ga0501310_081428 3300049130 Bacteria 509
865 Ga0501341_17736 3300049131 Bacteria 512
866 Ga0501304_002507 3300049160 Bacteria 1282
867 Ga0501304_007286 3300049160 Bacteria 910
868 Ga0501304_011121 3300049160 Bacteria 796
869 Ga0501304_014118 3300049160 Bacteria 737
870 Ga0501304_031867 3300049160 Bacteria 564
871 Ga0501304_041367 3300049160 Bacteria 516
872 Ga0501305_011790 3300049161 Bacteria 1186
873 Ga0501305_021222 3300049161 Bacteria 959
874 Ga0501305_044157 3300049161 Bacteria 732
875 Ga0501305_046041 3300049161 Bacteria 721
876 Ga0501305_047739 3300049161 Bacteria 712
877 Ga0501305_052611 3300049161 Bacteria 686
878 Ga0501305_092746 3300049161 Bacteria 555
879 Ga0501305_108648 3300049161 Bacteria 523
880 Ga0501307_001493 3300049162 Bacteria 1987
881 Ga0501307_005860 3300049162 Bacteria 1308
882 Ga0501307_018749 3300049162 Bacteria 882
883 Ga0501307_024224 3300049162 Bacteria 808
884 Ga0501307_027832 3300049162 Bacteria 770
885 Ga0501307_035776 3300049162 Bacteria 706
886 Ga0501307_052431 3300049162 Bacteria 616
887 Ga0501307_067857 3300049162 Bacteria 564
888 Ga0501307_074435 3300049162 Bacteria 546
889 Ga0501307_088798 3300049162 Bacteria 513
890 Ga0501291_011421 3300049514 Bacteria 1280
891 Ga0501291_033669 3300049514 Bacteria 875
892 Ga0501311_000103 3300049527 Bacteria 4135
893 Ga0501311_000190 3300049527 Bacteria 3584
894 Ga0501311_014637 3300049527 Bacteria 1003
895 Ga0501311_017349 3300049527 Bacteria 946
896 Ga0501311_019991 3300049527 Bacteria 902
897 Ga0501311_020635 3300049527 Bacteria 893
898 Ga0501311_056571 3300049527 Bacteria 625
899 Ga0501311_057329 3300049527 Bacteria 622
900 Ga0501311_063885 3300049527 Bacteria 600
901 Ga0501311_066930 3300049527 Bacteria 590
902 Ga0501311_069162 3300049527 Bacteria 583
903 Ga0501311_074993 3300049527 Bacteria 567
904 Ga0501311_082937 3300049527 Bacteria 548
905 Ga0501312_006477 3300049528 Bacteria 1462
906 Ga0501312_012450 3300049528 Bacteria 1170
907 Ga0501312_014599 3300049528 Bacteria 1105
908 Ga0501312_016524 3300049528 Bacteria 1057
909 Ga0501312_017160 3300049528 Bacteria 1043
910 Ga0501312_033623 3300049528 Bacteria 814
911 Ga0501312_078339 3300049528 Bacteria 595
912 Ga0501312_079182 3300049528 Bacteria 593
913 Ga0501312_124075 3300049528 Bacteria 502
914 Ga0501313_005383 3300049529 Bacteria 1350
915 Ga0501313_006104 3300049529 Bacteria 1294
916 Ga0501313_023498 3300049529 Bacteria 773
917 Ga0501313_047063 3300049529 Bacteria 590
918 Ga0501314_006582 3300049530 Bacteria 1015
919 Ga0501314_014546 3300049530 Bacteria 772
920 Ga0501315_000132 3300049531 Bacteria 4114
921 Ga0501315_003871 3300049531 Bacteria 1528
922 Ga0501315_005704 3300049531 Bacteria 1359
923 Ga0501315_012278 3300049531 Bacteria 1057
924 Ga0501315_012729 3300049531 Bacteria 1045
925 Ga0501315_043330 3300049531 Bacteria 687
926 Ga0501315_066990 3300049531 Bacteria 590
927 Ga0501316_002526 3300049532 Bacteria 1697
928 Ga0501316_005123 3300049532 Bacteria 1347
929 Ga0501316_006023 3300049532 Bacteria 1278
930 Ga0501316_008263 3300049532 Bacteria 1147
931 Ga0501316_009854 3300049532 Bacteria 1079
932 Ga0501316_031851 3300049532 Bacteria 708
933 Ga0501316_049227 3300049532 Bacteria 604
934 Ga0501316_050391 3300049532 Bacteria 598
935 Ga0501316_067268 3300049532 Bacteria 538
936 Ga0501316_076175 3300049532 Bacteria 514
937 Ga0501317_000171 3300049533 Bacteria 3756
938 Ga0501317_002626 3300049533 Bacteria 1718
939 Ga0501317_015051 3300049533 Bacteria 988
940 Ga0501317_016411 3300049533 Bacteria 960
941 Ga0501317_017566 3300049533 Bacteria 939
942 Ga0501317_017641 3300049533 Bacteria 938
943 Ga0501317_018365 3300049533 Bacteria 925
944 Ga0501317_019027 3300049533 Bacteria 914
945 Ga0501317_022777 3300049533 Bacteria 860
946 Ga0501317_034773 3300049533 Bacteria 747
947 Ga0501317_059862 3300049533 Bacteria 623
948 Ga0501317_076224 3300049533 Bacteria 573
949 Ga0501317_080033 3300049533 Bacteria 564
950 Ga0501317_104612 3300049533 Bacteria 514
951 Ga0501317_112878 3300049533 Bacteria 501
952 Ga0501318_000714 3300049534 Bacteria 2276
953 Ga0501318_009636 3300049534 Bacteria 1057
954 Ga0501318_009977 3300049534 Bacteria 1045
955 Ga0501318_011256 3300049534 Bacteria 1008
956 Ga0501318_014331 3300049534 Bacteria 934
957 Ga0501318_015961 3300049534 Bacteria 902
958 Ga0501318_017620 3300049534 Bacteria 874
959 Ga0501318_019840 3300049534 Bacteria 842
960 Ga0501318_026542 3300049534 Bacteria 765
961 Ga0501318_028928 3300049534 Bacteria 744
962 Ga0501318_039089 3300049534 Bacteria 672
963 Ga0501318_055256 3300049534 Bacteria 599
964 Ga0501318_059911 3300049534 Bacteria 582
965 Ga0501318_060076 3300049534 Bacteria 582
966 Ga0501318_076638 3300049534 Bacteria 536
967 Ga0501318_083205 3300049534 Bacteria 521
968 Ga0501318_086630 3300049534 Bacteria 514
969 Ga0501319_001563 3300049535 Bacteria 1345
970 Ga0501319_004999 3300049535 Bacteria 939
971 Ga0501319_032265 3300049535 Bacteria 508
972 Ga0501320_000195 3300049536 Bacteria 3108
973 Ga0501320_012544 3300049536 Bacteria 893
974 Ga0501320_020819 3300049536 Bacteria 758
975 Ga0501320_026475 3300049536 Bacteria 701
976 Ga0501320_053954 3300049536 Bacteria 553
977 Ga0501320_060886 3300049536 Bacteria 531
978 Ga0501321_000036 3300049537 Bacteria 6130
979 Ga0501321_000377 3300049537 Bacteria 2770
980 Ga0501321_000884 3300049537 Bacteria 2168
981 Ga0501321_001182 3300049537 Bacteria 2003
982 Ga0501321_004843 3300049537 Bacteria 1305
983 Ga0501321_006614 3300049537 Bacteria 1184
984 Ga0501321_017738 3300049537 Bacteria 858
985 Ga0501321_050996 3300049537 Bacteria 605
986 Ga0501321_056278 3300049537 Bacteria 585
987 Ga0501321_057389 3300049537 Bacteria 581
988 Ga0501321_058781 3300049537 Bacteria 577
989 Ga0501321_066729 3300049537 Bacteria 553
990 Ga0501321_087213 3300049537 Bacteria 505
991 Ga0501322_001402 3300049538 Bacteria 1349
992 Ga0501322_003259 3300049538 Bacteria 1045
993 Ga0501322_003301 3300049538 Bacteria 1041
994 Ga0501322_009483 3300049538 Bacteria 738
995 Ga0501322_020039 3300049538 Bacteria 582
996 Ga0501322_029904 3300049538 Bacteria 511
997 Ga0501323_000118 3300049539 Bacteria 4392
998 Ga0501323_003789 3300049539 Bacteria 1566
999 Ga0501323_007363 3300049539 Bacteria 1255
1000 Ga0501323_028255 3300049539 Bacteria 776
1001 Ga0501323_041980 3300049539 Bacteria 673
1002 Ga0501323_045329 3300049539 Bacteria 655
1003 Ga0501323_051700 3300049539 Bacteria 625
1004 Ga0501323_056786 3300049539 Bacteria 604
1005 Ga0501323_061508 3300049539 Bacteria 587
1006 Ga0501323_074484 3300049539 Bacteria 547
1007 Ga0501323_090304 3300049539 Bacteria 510
1008 Ga0501324_000012 3300049540 Bacteria 6616
1009 Ga0501324_004285 3300049540 Bacteria 1131
1010 Ga0501324_007536 3300049540 Bacteria 942
1011 Ga0501324_009947 3300049540 Bacteria 859
1012 Ga0501324_011807 3300049540 Bacteria 811
1013 Ga0501324_024618 3300049540 Bacteria 632
1014 Ga0501324_037264 3300049540 Bacteria 548
1015 Ga0501324_042141 3300049540 Bacteria 524
1016 Ga0501324_045939 3300049540 Bacteria 508
1017 Ga0501324_047245 3300049540 Bacteria 503
1018 Ga0501325_000185 3300049541 Bacteria 2457
1019 Ga0501325_001935 3300049541 Bacteria 1354
1020 Ga0501325_005144 3300049541 Bacteria 1030
1021 Ga0501327_02154 3300049543 Bacteria 1006
1022 Ga0501328_01590 3300049544 Bacteria 923
1023 Ga0501330_020540 3300049546 Bacteria 529
1024 Ga0501331_13252 3300049547 Bacteria 533
1025 Ga0501333_004428 3300049549 Bacteria 885
1026 Ga0501335_023778 3300049551 Bacteria 666
1027 Ga0501337_021275 3300049553 Bacteria 529
1028 Ga0501340_006300 3300049556 Bacteria 794
1029 Ga0501340_022921 3300049556 Bacteria 533
1030 Ga0501031_0015297 3300049568 Bacteria 4984
1031 Ga0501031_0019900 3300049568 Bacteria 4375
1032 Ga0501031_0036192 3300049568 Bacteria 3220
1033 Ga0501031_0120709 3300049568 Bacteria 1712
1034 Ga0501031_0311507 3300049568 Bacteria 1020
1035 Ga0501031_0335783 3300049568 Bacteria 978
1036 Ga0501031_0633992 3300049568 Bacteria 687
1037 Ga0501032_0027010 3300049569 Bacteria 3946
1038 Ga0501032_0163681 3300049569 Bacteria 1460
1039 Ga0501032_0163970 3300049569 Bacteria 1459
1040 Ga0501032_0545219 3300049569 Bacteria 740
1041 Ga0501032_0792926 3300049569 Bacteria 598
1042 Ga0501033_0061150 3300049570 Bacteria 2776
1043 Ga0501033_0545457 3300049570 Bacteria 799
1044 Ga0501033_1086889 3300049570 Bacteria 532
1045 Ga0501033_1121739 3300049570 Bacteria 523
1046 Ga0501034_0069200 3300049571 Bacteria 3540
1047 Ga0501034_0224517 3300049571 Bacteria 1830
1048 Ga0501034_0352454 3300049571 Bacteria 1400
1049 Ga0501034_0385484 3300049571 Bacteria 1326
1050 Ga0501034_1298238 3300049571 Bacteria 605
1051 Ga0501036_0093295 3300049572 Bacteria 2543
1052 Ga0501036_0149769 3300049572 Bacteria 1968
1053 Ga0501036_0151978 3300049572 Bacteria 1952
1054 Ga0501036_0582051 3300049572 Bacteria 929
1055 Ga0501036_0749634 3300049572 Bacteria 805
1056 Ga0501036_0944105 3300049572 Bacteria 707
1057 Ga0501036_0958206 3300049572 Bacteria 701
1058 Ga0501036_1354913 3300049572 Bacteria 578
1059 Ga0501037_0028700 3300049573 Bacteria 4110
1060 Ga0501037_0054932 3300049573 Bacteria 2912
1061 Ga0501037_0160089 3300049573 Bacteria 1605
1062 Ga0501037_0216570 3300049573 Bacteria 1349
1063 Ga0501037_0254772 3300049573 Bacteria 1227
1064 Ga0501037_0311649 3300049573 Bacteria 1091
1065 Ga0501037_0676042 3300049573 Bacteria 688
1066 Ga0501038_0040267 3300049574 Bacteria 4083
1067 Ga0501038_0111224 3300049574 Bacteria 2269
1068 Ga0501038_0187963 3300049574 Bacteria 1663
1069 Ga0501038_0234621 3300049574 Bacteria 1458
1070 Ga0501038_0647973 3300049574 Bacteria 795
1071 Ga0501039_0032214 3300049575 Bacteria 4040
1072 Ga0501039_0034588 3300049575 Bacteria 3899
1073 Ga0501039_0055448 3300049575 Bacteria 3069
1074 Ga0501039_0151078 3300049575 Bacteria 1824
1075 Ga0501039_0154443 3300049575 Bacteria 1803
1076 Ga0501039_0335062 3300049575 Bacteria 1189
1077 Ga0501039_0521992 3300049575 Bacteria 932
1078 Ga0501039_0551151 3300049575 Bacteria 905
1079 Ga0501039_0828661 3300049575 Bacteria 721
1080 Ga0501040_0019721 3300049576 Bacteria 4487
1081 Ga0501040_0190605 3300049576 Bacteria 1454
1082 Ga0501040_0372261 3300049576 Bacteria 1024
1083 Ga0501040_0632195 3300049576 Bacteria 773
1084 Ga0501040_0693455 3300049576 Bacteria 736
1085 Ga0501041_0006740 3300049577 Bacteria 6731
1086 Ga0501041_0117192 3300049577 Bacteria 1654
1087 Ga0501041_0126746 3300049577 Bacteria 1589
1088 Ga0501041_0432802 3300049577 Bacteria 835
1089 Ga0501042_0021479 3300049578 Bacteria 4499
1090 Ga0501042_0175282 3300049578 Bacteria 1547
1091 Ga0501042_0327248 3300049578 Bacteria 1107
1092 Ga0501042_0379379 3300049578 Bacteria 1023
1093 Ga0501042_0494290 3300049578 Bacteria 888
1094 Ga0501042_0541720 3300049578 Bacteria 846
1095 Ga0501042_0607176 3300049578 Bacteria 795
1096 Ga0501042_0722915 3300049578 Bacteria 724
1097 Ga0501042_0744455 3300049578 Bacteria 713
1098 Ga0501042_0858000 3300049578 Bacteria 661
1099 Ga0501043_0158139 3300049579 Bacteria 1771
1100 Ga0501043_0189571 3300049579 Bacteria 1599
1101 Ga0501043_0387140 3300049579 Bacteria 1058
1102 Ga0501043_0821173 3300049579 Bacteria 671
1103 Ga0501046_0071881 3300049580 Bacteria 2686
1104 Ga0501046_0244733 3300049580 Bacteria 1322
1105 Ga0501046_0306352 3300049580 Bacteria 1159
1106 Ga0501046_0447426 3300049580 Bacteria 929
1107 Ga0501046_0604422 3300049580 Bacteria 778
1108 Ga0501047_0023921 3300049581 Bacteria 5865
1109 Ga0501047_0033441 3300049581 Bacteria 4963
1110 Ga0501048_0015873 3300049582 Bacteria 5557
1111 Ga0501048_0038252 3300049582 Bacteria 3443
1112 Ga0501048_0208955 3300049582 Bacteria 1384
1113 Ga0501048_0281957 3300049582 Bacteria 1181
1114 Ga0501048_0362904 3300049582 Bacteria 1033
1115 Ga0501048_0507911 3300049582 Bacteria 864
1116 Ga0501067_0053577 3300049583 Bacteria 2235
1117 Ga0501067_0103653 3300049583 Bacteria 1581
1118 Ga0501067_0126611 3300049583 Bacteria 1421
1119 Ga0501067_0142954 3300049583 Bacteria 1333
1120 Ga0501067_0148213 3300049583 Bacteria 1307
1121 Ga0501067_0213221 3300049583 Bacteria 1075
1122 Ga0501067_0258598 3300049583 Bacteria 969
1123 Ga0501067_0283496 3300049583 Bacteria 922
1124 Ga0501067_0325791 3300049583 Bacteria 855
1125 Ga0501068_0044498 3300049584 Bacteria 2673
1126 Ga0501068_0047352 3300049584 Bacteria 2594
1127 Ga0501068_0058339 3300049584 Bacteria 2342
1128 Ga0501068_0155931 3300049584 Bacteria 1437
1129 Ga0501068_0261968 3300049584 Bacteria 1103
1130 Ga0501068_0269761 3300049584 Bacteria 1086
1131 Ga0501069_0043121 3300049585 Bacteria 2496
1132 Ga0501069_0099451 3300049585 Bacteria 1651
1133 Ga0501069_0139303 3300049585 Bacteria 1391
1134 Ga0501069_0150761 3300049585 Bacteria 1336
1135 Ga0501069_0252417 3300049585 Bacteria 1029
1136 Ga0501069_0299656 3300049585 Bacteria 943
1137 Ga0501069_0302659 3300049585 Bacteria 938
1138 Ga0501069_0321693 3300049585 Bacteria 909
1139 Ga0501069_0406557 3300049585 Bacteria 806
1140 Ga0501069_0424210 3300049585 Bacteria 789
1141 Ga0501070_0004983 3300049586 Bacteria 11332
1142 Ga0501070_0225481 3300049586 Bacteria 1536
1143 Ga0501070_0368123 3300049586 Bacteria 1165
1144 Ga0501070_0828120 3300049586 Bacteria 725
1145 Ga0501070_0947726 3300049586 Bacteria 669
1146 Ga0501070_1111858 3300049586 Bacteria 609
1147 Ga0501070_1547483 3300049586 Bacteria 501
1148 Ga0501071_0003704 3300049587 Bacteria 9594
1149 Ga0501071_0005948 3300049587 Bacteria 7895
1150 Ga0501071_0308535 3300049587 Bacteria 1200
1151 Ga0501071_0389469 3300049587 Bacteria 1063
1152 Ga0501071_0430651 3300049587 Bacteria 1009
1153 Ga0501071_1323468 3300049587 Bacteria 556
1154 Ga0501072_0018905 3300049588 Bacteria 5316
1155 Ga0501072_0054085 3300049588 Bacteria 3162
1156 Ga0501072_0230228 3300049588 Bacteria 1476
1157 Ga0501072_0330311 3300049588 Bacteria 1211
1158 Ga0501072_0449580 3300049588 Bacteria 1020
1159 Ga0501072_0504454 3300049588 Bacteria 957
1160 Ga0501072_0576215 3300049588 Bacteria 888
1161 Ga0501072_0900001 3300049588 Bacteria 691
1162 Ga0501073_0093221 3300049589 Bacteria 2092
1163 Ga0501073_0477798 3300049589 Bacteria 862
1164 Ga0501073_0644269 3300049589 Bacteria 731
1165 Ga0501073_0931276 3300049589 Bacteria 598
1166 Ga0501074_0014346 3300049590 Bacteria 5765
1167 Ga0501074_0133573 3300049590 Bacteria 1775
1168 Ga0501074_0375209 3300049590 Bacteria 1009
1169 Ga0501074_0460916 3300049590 Bacteria 901
1170 Ga0501074_0751905 3300049590 Bacteria 687
1171 Ga0501074_0814990 3300049590 Bacteria 658
1172 Ga0501074_0867194 3300049590 Bacteria 636
1173 Ga0501075_0017703 3300049591 Bacteria 5146
1174 Ga0501075_0057160 3300049591 Bacteria 2937
1175 Ga0501075_0150308 3300049591 Bacteria 1775
1176 Ga0501075_0475760 3300049591 Bacteria 953
1177 Ga0501075_0558691 3300049591 Bacteria 873
1178 Ga0501075_0667128 3300049591 Bacteria 792
1179 Ga0501075_0699833 3300049591 Bacteria 772
1180 Ga0501076_0007352 3300049592 Bacteria 8014
1181 Ga0501076_0086238 3300049592 Bacteria 2523
1182 Ga0501076_0196834 3300049592 Bacteria 1645
1183 Ga0501076_0299996 3300049592 Bacteria 1317
1184 Ga0501076_0435768 3300049592 Bacteria 1079
1185 Ga0501076_0474133 3300049592 Bacteria 1031
1186 Ga0501076_0630404 3300049592 Bacteria 884
1187 Ga0501076_0777705 3300049592 Bacteria 790
1188 Ga0501076_1135905 3300049592 Bacteria 643
1189 Ga0501077_0003693 3300049593 Bacteria 9204
1190 Ga0501077_0394824 3300049593 Bacteria 884
1191 Ga0501077_0549433 3300049593 Bacteria 741
1192 Ga0501077_0752048 3300049593 Bacteria 627
1193 Ga0501216_031581 3300049660 Bacteria 980
1194 Ga0501227_195147 3300049665 Bacteria 572
1195 Ga0501246_015266 3300049676 Bacteria 747
1196 Ga0501253_116410 3300049683 Bacteria 643
1197 Ga0501221_106772 3300049704 Bacteria 701
1198 Ga0501079_0022088 3300049741 Bacteria 4875
1199 Ga0501079_0027696 3300049741 Bacteria 4347
1200 Ga0501079_0305150 3300049741 Bacteria 1245
1201 Ga0501079_0443421 3300049741 Bacteria 1019
1202 Ga0501079_0518588 3300049741 Bacteria 937
1203 Ga0501079_0537448 3300049741 Bacteria 919
1204 Ga0501080_0141216 3300049742 Bacteria 2226
1205 Ga0501080_0216610 3300049742 Bacteria 1753
1206 Ga0501080_0379218 3300049742 Bacteria 1274
1207 Ga0501080_0731352 3300049742 Bacteria 871
1208 Ga0501080_1336902 3300049742 Bacteria 613
1209 Ga0501081_0212485 3300049743 Bacteria 1405
1210 Ga0501083_0105387 3300049744 Bacteria 1857
1211 Ga0501083_0134682 3300049744 Bacteria 1619
1212 Ga0501083_0746392 3300049744 Bacteria 637
1213 Ga0501035_0097705 3300049822 Bacteria 2578
1214 Ga0501035_0334257 3300049822 Bacteria 1270
1215 Ga0501035_0439763 3300049822 Bacteria 1080
1216 Ga0501035_0660930 3300049822 Bacteria 846
1217 Ga0501035_0889635 3300049822 Bacteria 706
1218 Ga0501044_0004036 3300049823 Bacteria 16463
1219 Ga0501044_0101925 3300049823 Bacteria 2887
1220 Ga0501044_0282550 3300049823 Bacteria 1593
1221 Ga0501044_0777629 3300049823 Bacteria 838
1222 Ga0501044_1297966 3300049823 Bacteria 594
1223 Ga0501045_0006942 3300049824 Bacteria 7848
1224 Ga0501045_0168860 3300049824 Bacteria 1629
1225 Ga0501045_0171369 3300049824 Bacteria 1616
1226 Ga0501045_0378299 3300049824 Bacteria 1054
1227 Ga0501045_0785148 3300049824 Bacteria 701
1228 nmdc:mga03683_2815_c1 3300050489 Bacteria 5478
1229 nmdc:mga03683_48175_c1 3300050489 Bacteria 1771
1230 nmdc:mga03n38_174315_c1 3300050490 Bacteria 1098
1231 nmdc:mga03n38_27461_c1 3300050490 Bacteria 2362
1232 nmdc:mga03n38_46422_c1 3300050490 Bacteria 1918
1233 nmdc:mga03n38_6080_c1 3300050490 Bacteria 4168
1234 nmdc:mga03n38_6390_c1 3300050490 Bacteria 4090
1235 nmdc:mga03n38_978246_c1 3300050490 Bacteria 501
1236 nmdc:mga00v17_180570_c1 3300050491 Bacteria 1362
1237 nmdc:mga00v17_188155_c1 3300050491 Bacteria 1333
1238 nmdc:mga00v17_21651_c2 3300050491 Bacteria 2083
1239 nmdc:mga00v17_33777_c1 3300050491 Bacteria 3034
1240 nmdc:mga00v17_396942_c1 3300050491 Bacteria 896
1241 nmdc:mga00v17_47670_c1 3300050491 Bacteria 2596
1242 nmdc:mga00v17_72501_c1 3300050491 Bacteria 2137
1243 nmdc:mga00v17_78476_c1 3300050491 Bacteria 2058
1244 nmdc:mga00v17_80515_c1 3300050491 Bacteria 2033
1245 nmdc:mga00v17_90693_c2 3300050491 Bacteria 1411
1246 nmdc:mga0yw44_1197_c1 3300050492 Bacteria 10147
1247 nmdc:mga0yw44_12755_c1 3300050492 Bacteria 4395
1248 nmdc:mga0yw44_128443_c1 3300050492 Bacteria 1639
1249 nmdc:mga0yw44_256929_c1 3300050492 Bacteria 1164
1250 nmdc:mga0yw44_265539_c1 3300050492 Bacteria 1145
1251 nmdc:mga0yw44_276350_c1 3300050492 Bacteria 803
1252 nmdc:mga0yw44_341012_c1 3300050492 Bacteria 1008
1253 nmdc:mga0yw44_353326_c1 3300050492 Bacteria 990
1254 nmdc:mga0yw44_405602_c1 3300050492 Bacteria 922
1255 nmdc:mga0yw44_56680_c1 3300050492 Bacteria 2389
1256 nmdc:mga0yw44_666703_c1 3300050492 Bacteria 707
1257 nmdc:mga0yw44_890186_c1 3300050492 Bacteria 604
1258 nmdc:mga0yw44_99006_c1 3300050492 Bacteria 1855
1259 nmdc:mga0k408_305129_c1 3300050493 Bacteria 950
1260 nmdc:mga06z11_1560_c1 3300050494 Bacteria 8521
1261 nmdc:mga06z11_21653_c2 3300050494 Bacteria 2752
1262 nmdc:mga06z11_320333_c1 3300050494 Bacteria 925
1263 nmdc:mga06z11_336706_c1 3300050494 Bacteria 902
1264 nmdc:mga06z11_63927_c1 3300050494 Bacteria 1927
1265 nmdc:mga04h51_137678_c1 3300050495 Bacteria 923
1266 nmdc:mga04h51_24216_c1 3300050495 Bacteria 1857
1267 nmdc:mga04h51_458096_c1 3300050495 Bacteria 540
1268 nmdc:mga04h51_79287_c1 3300050495 Bacteria 1162
1269 nmdc:mga07m45_1335_c1 3300050496 Bacteria 11242
1270 nmdc:mga07m45_201372_c1 3300050496 Bacteria 1158
1271 nmdc:mga07m45_205642_c1 3300050496 Bacteria 1145
1272 nmdc:mga07m45_210168_c1 3300050496 Bacteria 1132
1273 nmdc:mga07m45_227068_c1 3300050496 Bacteria 1086
1274 nmdc:mga07m45_2326_c1 3300050496 Bacteria 6935
1275 nmdc:mga07m45_431698_c1 3300050496 Bacteria 764
1276 nmdc:mga07m45_4612_c1 3300050496 Bacteria 6756
1277 nmdc:mga07m45_488432_c1 3300050496 Bacteria 713
1278 nmdc:mga05p37_10660_c1 3300050507 Bacteria 10905
1279 nmdc:mga05p37_2785_c1 3300050507 Bacteria 20326
1280 nmdc:mga09592_1799_c1 3300050508 Bacteria 17199
1281 nmdc:mga09592_182190_c1 3300050508 Bacteria 1817
1282 nmdc:mga09592_2299_c1 3300050508 Bacteria 15408
1283 nmdc:mga0qj67_10084_c1 3300050509 Bacteria 7050
1284 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
1285 nmdc:mga06r32_4895_c1 3300050510 Bacteria 12063
1286 nmdc:mga08y16_1113887_c1 3300050511 Bacteria 764
1287 nmdc:mga08y16_277154_c1 3300050511 Bacteria 1730
1288 nmdc:mga08y16_3501_c1 3300050511 Bacteria 16300
1289 nmdc:mga08y16_39303_c1 3300050511 Bacteria 4965
1290 nmdc:mga08y16_738529_c1 3300050511 Bacteria 981
1291 nmdc:mga0n895_1156086_c1 3300050512 Bacteria 749
1292 nmdc:mga0rr50_1181386_c1 3300050513 Bacteria 650
1293 nmdc:mga0a205_497050_c1 3300050515 Bacteria 1077
1294 Ga0495601_0008187 3300053077 Bacteria 6166
1295 Ga0495655_0014460 3300053083 Bacteria 1655
1296 Ga0495655_0075530 3300053083 Bacteria 952
1297 Ga0495655_0092904 3300053083 Bacteria 882
1298 Ga0495619_0021438 3300053085 Bacteria 4125
1299 Ga0495619_0231221 3300053085 Bacteria 1281
1300 Ga0495619_0319711 3300053085 Bacteria 1074
1301 Ga0495619_0547018 3300053085 Bacteria 794
1302 Ga0500644_0000427 3300053088 Bacteria 19686
1303 Ga0500641_0050012 3300053096 Bacteria 1716
1304 Ga0500554_027137 3300053102 Bacteria 1653
1305 Ga0500556_0002190 3300053104 Bacteria 6566
1306 Ga0500593_000062 3300053117 Bacteria 39716
1307 Ga0500628_015990 3300053129 Bacteria 1443
1308 Ga0500628_024032 3300053129 Bacteria 1262
1309 Ga0500573_0044627 3300053140 Bacteria 2556
1310 Ga0501084_0007241 3300054114 Bacteria 9145
1311 Ga0501084_0170123 3300054114 Bacteria 1839
1312 Ga0501084_0242239 3300054114 Bacteria 1522
1313 Ga0501084_1191241 3300054114 Bacteria 639
1314 Ga0501084_1304495 3300054114 Bacteria 608
1315 Ga0501084_1871648 3300054114 Bacteria 501
1316 Ga0590071_009977 3300059421 Bacteria 2226
1317 Ga0590077_031331 3300059426 Bacteria 1162
1318 Ga0590077_061893 3300059426 Bacteria 849
1319 Ga0587066_049092 3300059490 Bacteria 824
1320 Ga0587070_018406 3300059491 Bacteria 1144
1321 Ga0587077_028452 3300059493 Bacteria 1047
1322 Ga0587077_151657 3300059493 Bacteria 606
1323 Ga0587080_025676 3300059503 Bacteria 996
1324 Ga0587083_0036413 3300059505 Bacteria 1008
1325 Ga0587083_0114850 3300059505 Bacteria 688
1326 Ga0587088_070391 3300059508 Bacteria 728
1327 Ga0587090_010894 3300059510 Bacteria 1269
1328 Ga0587090_069525 3300059510 Bacteria 685
1329 Ga0587092_028331 3300059512 Bacteria 912
1330 Ga0587098_007696 3300059604 Bacteria 1128
1331 Ga0587098_042730 3300059604 Bacteria 665
1332 Ga0587106_018837 3300059605 Bacteria 1001
1333 Ga0587106_066057 3300059605 Bacteria 675
1334 Ga0587106_092358 3300059605 Bacteria 606
1335 Ga0587125_057559 3300059607 Bacteria 562
1336 Ga0587101_006481 3300059623 Bacteria 1345
1337 Ga0587109_034388 3300059624 Bacteria 978
1338 Ga0587115_094737 3300059626 Bacteria 546
1339 Ga0587128_013515 3300059630 Bacteria 1153
1340 Ga0587062_005533 3300059639 Bacteria 1400
1341 Ga0587062_088749 3300059639 Bacteria 586
1342 Ga0587067_035930 3300059640 Bacteria 940
1343 Ga0587068_070769 3300059641 Bacteria 688
1344 Ga0587069_012972 3300059642 Bacteria 1138
1345 Ga0587072_017844 3300059643 Bacteria 1228
1346 Ga0587076_006906 3300059645 Bacteria 1531
1347 Ga0587079_041961 3300059647 Bacteria 928
1348 Ga0587100_000563 3300059648 Bacteria 1834
1349 Ga0587105_005902 3300059651 Bacteria 827
1350 Ga0587107_003751 3300059652 Bacteria 1498
1351 Ga0587107_004096 3300059652 Bacteria 1459
1352 Ga0587107_010905 3300059652 Bacteria 1103
1353 Ga0587107_068833 3300059652 Bacteria 641
1354 Ga0587107_087927 3300059652 Bacteria 595
1355 Ga0587110_013166 3300059654 Bacteria 861
1356 Ga0587114_036800 3300059655 Bacteria 775
1357 Ga0587119_037384 3300059658 Bacteria 685
1358 Ga0587071_181229 3300060344 Bacteria 541
1359 Ga0587111_0011255 3300060346 Bacteria 1555
1360 Ga0587111_0245603 3300060346 Bacteria 527
1361 Ga0501082_0220776 3300060353 Bacteria 1649
1362 Ga0501082_0333267 3300060353 Bacteria 1322
1363 Ga0501082_0429944 3300060353 Bacteria 1153
1364 Ga0501082_0836020 3300060353 Bacteria 805
1365 Ga0501082_0880258 3300060353 Bacteria 783
1366 Ga0501082_1134437 3300060353 Bacteria 683
1367 Ga0501082_1564667 3300060353 Bacteria 576
1368 Ga0466962_0029470 3300061719 Bacteria 2628
1369 Ga0466962_0037334 3300061719 Bacteria 2326
1370 Ga0466962_0067962 3300061719 Bacteria 1701
1371 Ga0466962_0105375 3300061719 Bacteria 1355
1372 Ga0466962_0140561 3300061719 Bacteria 1169
1373 Ga0466962_0205770 3300061719 Bacteria 962
1374 Ga0530510_0007003 3300061734 Bacteria 7854
1375 Ga0530510_0070526 3300061734 Bacteria 2537
1376 Ga0530510_0081750 3300061734 Bacteria 2352
1377 Ga0530510_0296722 3300061734 Bacteria 1209
1378 Ga0530510_0317011 3300061734 Bacteria 1168
1379 Ga0530510_0409932 3300061734 Bacteria 1022
1380 Ga0530510_0434177 3300061734 Bacteria 992
1381 Ga0530510_0470702 3300061734 Bacteria 951
1382 Ga0530510_0627415 3300061734 Bacteria 818
1383 Ga0530510_1316569 3300061734 Bacteria 554

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020070 Ga0206356_11221972 Ga0206356_112219722 124
2 3300044901 Ga0466960_0550917 Ga0466960_0550917_58_477 124
3 3300049127 Ga0501306_009279 Ga0501306_009279_422_811 124
4 3300049128 Ga0501308_007774 Ga0501308_007774_75_464 124
5 3300049129 Ga0501309_000178 Ga0501309_000178_3769_4158 124
6 3300049130 Ga0501310_052760 Ga0501310_052760_51_440 124
7 3300049131 Ga0501341_17736 Ga0501341_17736_47_436 124
8 3300049160 Ga0501304_002507 Ga0501304_002507_39_428 124
9 3300049161 Ga0501305_044157 Ga0501305_044157_257_646 124
10 3300049162 Ga0501307_024224 Ga0501307_024224_51_440 124
11 3300049527 Ga0501311_000103 Ga0501311_000103_3700_4089 124
12 3300049528 Ga0501312_014599 Ga0501312_014599_665_1054 124
13 3300049529 Ga0501313_006104 Ga0501313_006104_858_1247 124
14 3300049531 Ga0501315_000132 Ga0501315_000132_35_421 124
15 3300049531 Ga0501315_012278 Ga0501315_012278_48_437 124
16 3300049532 Ga0501316_031851 Ga0501316_031851_75_464 124
17 3300049533 Ga0501317_002626 Ga0501317_002626_635_1024 124
18 3300049534 Ga0501318_009636 Ga0501318_009636_393_782 124
19 3300049535 Ga0501319_032265 Ga0501319_032265_69_458 124
20 3300049536 Ga0501320_000195 Ga0501320_000195_2668_3057 124
21 3300049537 Ga0501321_000036 Ga0501321_000036_5214_5603 124
22 3300049538 Ga0501322_003259 Ga0501322_003259_605_994 124
23 3300049539 Ga0501323_003789 Ga0501323_003789_292_681 124
24 3300049540 Ga0501324_007536 Ga0501324_007536_505_894 124
25 3300049541 Ga0501325_000185 Ga0501325_000185_80_469 124
26 3300049543 Ga0501327_02154 Ga0501327_02154_571_960 124
27 3300049544 Ga0501328_01590 Ga0501328_01590_490_879 124
28 3300049546 Ga0501330_020540 Ga0501330_020540_49_438 124
29 3300049547 Ga0501331_13252 Ga0501331_13252_99_488 124
30 3300049553 Ga0501337_021275 Ga0501337_021275_41_430 124
31 3300048914 Ga0496111_0309142 Ga0496111_0309142_502_1095 127
32 3300009094 Ga0111539_10831785 Ga0111539_108317852 128
33 3300009148 Ga0105243_10635011 Ga0105243_106350112 128
34 3300049127 Ga0501306_004752 Ga0501306_004752_47_448 128
35 3300049528 Ga0501312_079182 Ga0501312_079182_114_515 128
36 3300049532 Ga0501316_008263 Ga0501316_008263_54_455 128
37 3300049533 Ga0501317_015051 Ga0501317_015051_478_879 128
38 3300049534 Ga0501318_028928 Ga0501318_028928_82_483 128
39 3300049537 Ga0501321_066729 Ga0501321_066729_38_439 128
40 3300049540 Ga0501324_047245 Ga0501324_047245_51_452 128
41 3300049578 Ga0501042_0379379 Ga0501042_0379379_20_421 128
42 3300049593 Ga0501077_0394824 Ga0501077_0394824_411_818 128
43 3300050511 nmdc:mga08y16_1113887_c1 nmdc:mga08y16_1113887_c1_86_532 128
44 3300053083 Ga0495655_0014460 Ga0495655_0014460_149_583 128
45 3300037853 Ga0436364_0711707 Ga0436364_0711707_341_823 129
46 3300049527 Ga0501311_074993 Ga0501311_074993_147_554 130
47 3300049590 Ga0501074_0867194 Ga0501074_0867194_223_618 130
48 3300006038 Ga0075365_10181107 Ga0075365_101811073 131
49 3300006051 Ga0075364_10261514 Ga0075364_102615141 131
50 3300006186 Ga0075369_10048911 Ga0075369_100489113 131
51 3300031995 Ga0307409_100875547 Ga0307409_1008755472 131
52 3300044683 Ga0466965_0902143 Ga0466965_0902143_103_504 131
53 3300049130 Ga0501310_037052 Ga0501310_037052_97_579 131
54 3300049161 Ga0501305_052611 Ga0501305_052611_32_514 131
55 3300049527 Ga0501311_019991 Ga0501311_019991_361_843 131
56 3300049528 Ga0501312_017160 Ga0501312_017160_167_649 131
57 3300049537 Ga0501321_004843 Ga0501321_004843_779_1261 131
58 3300050491 nmdc:mga00v17_72501_c1 nmdc:mga00v17_72501_c1_712_1263 131
59 3300050492 nmdc:mga0yw44_666703_c1 nmdc:mga0yw44_666703_c1_28_579 131
60 3300003911 JGI25405J52794_10045114 JGI25405J52794_100451142 132
61 3300005459 Ga0068867_100201481 Ga0068867_1002014812 132
62 3300005937 Ga0081455_10009428 Ga0081455_100094288 132
63 3300006042 Ga0075368_10102200 Ga0075368_101022002 132
64 3300006844 Ga0075428_100002072 Ga0075428_10000207219 132
65 3300006846 Ga0075430_100080440 Ga0075430_1000804404 132
66 3300006847 Ga0075431_100004313 Ga0075431_10000431310 132
67 3300006847 Ga0075431_100038721 Ga0075431_1000387213 132
68 3300006852 Ga0075433_10641029 Ga0075433_106410291 132
69 3300006871 Ga0075434_101862647 Ga0075434_1018626472 132
70 3300006880 Ga0075429_100006773 Ga0075429_10000677312 132
71 3300009094 Ga0111539_10041331 Ga0111539_100413313 132
72 3300009147 Ga0114129_10006606 Ga0114129_1000660624 132
73 3300011119 Ga0105246_10375976 Ga0105246_103759762 132
74 3300013104 Ga0157370_10813114 Ga0157370_108131141 132
75 3300013306 Ga0163162_11601871 Ga0163162_116018712 132
76 3300013307 Ga0157372_11198389 Ga0157372_111983892 132
77 3300014326 Ga0157380_10712475 Ga0157380_107124752 132
78 3300020078 Ga0206352_10244107 Ga0206352_102441072 132
79 3300027682 Ga0209971_1017984 Ga0209971_10179843 132
80 3300032002 Ga0307416_100850266 Ga0307416_1008502662 132
81 3300032004 Ga0307414_11118243 Ga0307414_111182432 132
82 3300032126 Ga0307415_100897958 Ga0307415_1008979582 132
83 3300035089 Ga0373944_0123308 Ga0373944_0123308_97_531 132
84 3300048903 Ga0496100_0135127 Ga0496100_0135127_189_623 132
85 3300048903 Ga0496100_0476446 Ga0496100_0476446_229_663 132
86 3300048904 Ga0496101_0312267 Ga0496101_0312267_232_666 132
87 3300048905 Ga0496102_0778201 Ga0496102_0778201_189_623 132
88 3300048906 Ga0496103_0376991 Ga0496103_0376991_342_776 132
89 3300048907 Ga0496104_0021580 Ga0496104_0021580_1419_1853 132
90 3300048908 Ga0496105_0004859 Ga0496105_0004859_5909_6343 132
91 3300048909 Ga0496106_0566117 Ga0496106_0566117_374_808 132
92 3300048910 Ga0496107_0340140 Ga0496107_0340140_257_691 132
93 3300048910 Ga0496107_0465519 Ga0496107_0465519_257_691 132
94 3300048911 Ga0496108_0245746 Ga0496108_0245746_929_1363 132
95 3300048912 Ga0496109_0029564 Ga0496109_0029564_1440_1874 132
96 3300048913 Ga0496110_0280749 Ga0496110_0280749_611_1045 132
97 3300048914 Ga0496111_0276250 Ga0496111_0276250_608_1042 132
98 3300048915 Ga0496112_1147788 Ga0496112_1147788_62_496 132
99 3300048917 Ga0496114_0066334 Ga0496114_0066334_501_935 132
100 3300048918 Ga0496115_0123607 Ga0496115_0123607_257_691 132
101 3300049527 Ga0501311_017349 Ga0501311_017349_526_927 132
102 3300049534 Ga0501318_076638 Ga0501318_076638_91_492 132
103 3300050492 nmdc:mga0yw44_99006_c1 nmdc:mga0yw44_99006_c1_496_1074 132
104 3300050495 nmdc:mga04h51_79287_c1 nmdc:mga04h51_79287_c1_197_775 132
105 3300050507 nmdc:mga05p37_10660_c1 nmdc:mga05p37_10660_c1_6851_7255 132
106 3300050508 nmdc:mga09592_2299_c1 nmdc:mga09592_2299_c1_3274_3678 132
107 3300050509 nmdc:mga0qj67_10084_c1 nmdc:mga0qj67_10084_c1_2622_3026 132
108 3300050510 nmdc:mga06r32_130_c1 nmdc:mga06r32_130_c1_48993_49397 132
109 3300050511 nmdc:mga08y16_3501_c1 nmdc:mga08y16_3501_c1_13053_13457 132
110 3300050515 nmdc:mga0a205_497050_c1 nmdc:mga0a205_497050_c1_104_508 132
111 3300003162 Ga0006778J45830_1047560 Ga0006778J45830_10475602 133
112 3300005329 Ga0070683_100060577 Ga0070683_1000605773 133
113 3300005344 Ga0070661_100265186 Ga0070661_1002651862 133
114 3300005366 Ga0070659_100652320 Ga0070659_1006523202 133
115 3300005455 Ga0070663_100273521 Ga0070663_1002735213 133
116 3300005564 Ga0070664_100029753 Ga0070664_1000297536 133
117 3300005577 Ga0068857_101230025 Ga0068857_1012300252 133
118 3300005843 Ga0068860_100751614 Ga0068860_1007516141 133
119 3300009093 Ga0105240_11894518 Ga0105240_118945182 133
120 3300011119 Ga0105246_10693010 Ga0105246_106930102 133
121 3300013105 Ga0157369_11794246 Ga0157369_117942462 133
122 3300013308 Ga0157375_10529730 Ga0157375_105297303 133
123 3300025899 Ga0207642_10282712 Ga0207642_102827121 133
124 3300025913 Ga0207695_11577192 Ga0207695_115771921 133
125 3300025920 Ga0207649_10497819 Ga0207649_104978192 133
126 3300025933 Ga0207706_11226672 Ga0207706_112266722 133
127 3300025944 Ga0207661_10142467 Ga0207661_101424673 133
128 3300025945 Ga0207679_10033027 Ga0207679_100330276 133
129 3300026067 Ga0207678_11277653 Ga0207678_112776532 133
130 3300032005 Ga0307411_10625737 Ga0307411_106257372 133
131 3300032133 Ga0316583_10020342 Ga0316583_100203426 133
132 3300033541 Ga0316596_1091234 Ga0316596_10912342 133
133 3300037471 Ga0395905_1408803 Ga0395905_1408803_159_560 133
134 3300044658 Ga0466972_0089180 Ga0466972_0089180_830_1231 133
135 3300044765 Ga0466970_0393891 Ga0466970_0393891_47_448 133
136 3300046518 Ga0495631_0161727 Ga0495631_0161727_490_897 133
137 3300048904 Ga0496101_0561052 Ga0496101_0561052_104_706 133
138 3300048917 Ga0496114_0233484 Ga0496114_0233484_1016_1453 133
139 3300049127 Ga0501306_018050 Ga0501306_018050_520_933 133
140 3300049128 Ga0501308_028631 Ga0501308_028631_181_582 133
141 3300049162 Ga0501307_052431 Ga0501307_052431_82_495 133
142 3300049532 Ga0501316_049227 Ga0501316_049227_126_557 133
143 3300049533 Ga0501317_019027 Ga0501317_019027_319_732 133
144 3300049533 Ga0501317_034773 Ga0501317_034773_98_499 133
145 3300049533 Ga0501317_112878 Ga0501317_112878_24_437 133
146 3300049534 Ga0501318_039089 Ga0501318_039089_209_631 133
147 3300049569 Ga0501032_0163970 Ga0501032_0163970_531_953 133
148 3300049569 Ga0501032_0545219 Ga0501032_0545219_308_724 133
149 3300049570 Ga0501033_1121739 Ga0501033_1121739_39_461 133
150 3300049573 Ga0501037_0216570 Ga0501037_0216570_754_1176 133
151 3300049575 Ga0501039_0521992 Ga0501039_0521992_495_917 133
152 3300049579 Ga0501043_0387140 Ga0501043_0387140_580_996 133
153 3300049582 Ga0501048_0208955 Ga0501048_0208955_423_845 133
154 3300049586 Ga0501070_1547483 Ga0501070_1547483_58_480 133
155 3300049588 Ga0501072_0449580 Ga0501072_0449580_60_482 133
156 3300049588 Ga0501072_0900001 Ga0501072_0900001_225_641 133
157 3300049589 Ga0501073_0931276 Ga0501073_0931276_123_545 133
158 3300049590 Ga0501074_0751905 Ga0501074_0751905_84_506 133
159 3300049591 Ga0501075_0699833 Ga0501075_0699833_14_436 133
160 3300049743 Ga0501081_0212485 Ga0501081_0212485_545_961 133
161 3300049744 Ga0501083_0746392 Ga0501083_0746392_71_487 133
162 3300049824 Ga0501045_0785148 Ga0501045_0785148_174_596 133
163 3300054114 Ga0501084_1304495 Ga0501084_1304495_54_476 133
164 3300059493 Ga0587077_028452 Ga0587077_028452_600_1001 133
165 3300059505 Ga0587083_0036413 Ga0587083_0036413_517_918 133
166 3300059640 Ga0587067_035930 Ga0587067_035930_453_854 133
167 3300061734 Ga0530510_0434177 Ga0530510_0434177_445_867 133
168 iso_pu_bacteria 2643221617 2644099741 133
169 iso_pu_bacteria 2643221620 2644116627 133
170 iso_pu_bacteria 2738541305 2738870338 133
171 iso_pu_bacteria 2811994874 2812331445 133
172 3300005329 Ga0070683_100716249 Ga0070683_1007162492 134
173 3300005337 Ga0070682_101034634 Ga0070682_1010346341 134
174 3300005345 Ga0070692_10109517 Ga0070692_101095172 134
175 3300005354 Ga0070675_100389616 Ga0070675_1003896163 134
176 3300005355 Ga0070671_100289249 Ga0070671_1002892492 134
177 3300005356 Ga0070674_100067586 Ga0070674_1000675865 134
178 3300005441 Ga0070700_100949038 Ga0070700_1009490382 134
179 3300005456 Ga0070678_100592950 Ga0070678_1005929502 134
180 3300005459 Ga0068867_100546679 Ga0068867_1005466792 134
181 3300005466 Ga0070685_10344036 Ga0070685_103440362 134
182 3300005471 Ga0070698_100392494 Ga0070698_1003924942 134
183 3300005539 Ga0068853_100074811 Ga0068853_1000748115 134
184 3300005539 Ga0068853_100589051 Ga0068853_1005890512 134
185 3300005543 Ga0070672_100113206 Ga0070672_1001132062 134
186 3300005547 Ga0070693_100595312 Ga0070693_1005953122 134
187 3300005548 Ga0070665_100204381 Ga0070665_1002043814 134
188 3300005577 Ga0068857_100101060 Ga0068857_1001010602 134
189 3300005614 Ga0068856_100881930 Ga0068856_1008819301 134
190 3300005615 Ga0070702_100073205 Ga0070702_1000732053 134
191 3300005616 Ga0068852_100789024 Ga0068852_1007890242 134
192 3300005840 Ga0068870_10444300 Ga0068870_104443002 134
193 3300005842 Ga0068858_100764730 Ga0068858_1007647302 134
194 3300005937 Ga0081455_10104192 Ga0081455_101041923 134
195 3300006038 Ga0075365_10565233 Ga0075365_105652332 134
196 3300006048 Ga0075363_100035386 Ga0075363_1000353863 134
197 3300006178 Ga0075367_10041821 Ga0075367_100418215 134
198 3300006881 Ga0068865_100246657 Ga0068865_1002466573 134
199 3300009098 Ga0105245_10533897 Ga0105245_105338972 134
200 3300009098 Ga0105245_11444485 Ga0105245_114444851 134
201 3300009148 Ga0105243_10126788 Ga0105243_101267882 134
202 3300009148 Ga0105243_10581361 Ga0105243_105813613 134
203 3300009176 Ga0105242_10336584 Ga0105242_103365842 134
204 3300009551 Ga0105238_10608358 Ga0105238_106083581 134
205 3300009553 Ga0105249_10033506 Ga0105249_100335065 134
206 3300009553 Ga0105249_10640569 Ga0105249_106405693 134
207 3300013102 Ga0157371_10354275 Ga0157371_103542752 134
208 3300013102 Ga0157371_11320876 Ga0157371_113208761 134
209 3300013105 Ga0157369_10922309 Ga0157369_109223092 134
210 3300013296 Ga0157374_10693022 Ga0157374_106930223 134
211 3300013306 Ga0163162_10389264 Ga0163162_103892642 134
212 3300013308 Ga0157375_10467033 Ga0157375_104670332 134
213 3300014325 Ga0163163_10224420 Ga0163163_102244202 134
214 3300014497 Ga0182008_10421450 Ga0182008_104214502 134
215 3300014745 Ga0157377_10683054 Ga0157377_106830542 134
216 3300017792 Ga0163161_10026654 Ga0163161_100266543 134
217 3300020070 Ga0206356_10663620 Ga0206356_106636202 134
218 3300020081 Ga0206354_10829853 Ga0206354_108298532 134
219 3300020082 Ga0206353_12040929 Ga0206353_120409292 134
220 3300025893 Ga0207682_10045174 Ga0207682_100451743 134
221 3300025901 Ga0207688_10343947 Ga0207688_103439472 134
222 3300025904 Ga0207647_10167202 Ga0207647_101672022 134
223 3300025908 Ga0207643_10318706 Ga0207643_103187062 134
224 3300025911 Ga0207654_10464760 Ga0207654_104647602 134
225 3300025918 Ga0207662_10240929 Ga0207662_102409292 134
226 3300025924 Ga0207694_10501976 Ga0207694_105019763 134
227 3300025926 Ga0207659_10116199 Ga0207659_101161992 134
228 3300025927 Ga0207687_10334599 Ga0207687_103345992 134
229 3300025935 Ga0207709_10276395 Ga0207709_102763953 134
230 3300025940 Ga0207691_10087896 Ga0207691_100878962 134
231 3300025961 Ga0207712_10093301 Ga0207712_100933014 134
232 3300026023 Ga0207677_11093085 Ga0207677_110930852 134
233 3300026041 Ga0207639_10351044 Ga0207639_103510441 134
234 3300026067 Ga0207678_10673240 Ga0207678_106732402 134
235 3300026075 Ga0207708_10683706 Ga0207708_106837062 134
236 3300026089 Ga0207648_10593324 Ga0207648_105933242 134
237 3300026116 Ga0207674_10013764 Ga0207674_100137646 134
238 3300026118 Ga0207675_100292959 Ga0207675_1002929592 134
239 3300026121 Ga0207683_10268970 Ga0207683_102689703 134
240 3300028380 Ga0268265_11172850 Ga0268265_111728502 134
241 3300030522 Ga0307512_10033331 Ga0307512_100333317 134
242 3300037466 Ga0395898_0090098 Ga0395898_0090098_1814_2380 134
243 3300037853 Ga0436364_0626737 Ga0436364_0626737_718_1224 134
244 3300041443 Ga0451789_0337217 Ga0451789_0337217_54_482 134
245 3300044658 Ga0466972_0007943 Ga0466972_0007943_4278_4682 134
246 3300044683 Ga0466965_0010425 Ga0466965_0010425_262_666 134
247 3300044693 Ga0466961_0014059 Ga0466961_0014059_441_845 134
248 3300044694 Ga0466963_0075177 Ga0466963_0075177_1597_2001 134
249 3300044706 Ga0466964_0065515 Ga0466964_0065515_636_1040 134
250 3300044719 Ga0466971_0020611 Ga0466971_0020611_251_655 134
251 3300044735 Ga0466968_0159201 Ga0466968_0159201_134_538 134
252 3300044765 Ga0466970_0025660 Ga0466970_0025660_2009_2413 134
253 3300044765 Ga0466970_0417828 Ga0466970_0417828_48_452 134
254 3300044842 Ga0466957_0041531 Ga0466957_0041531_1861_2265 134
255 3300044842 Ga0466957_0127653 Ga0466957_0127653_573_1052 134
256 3300044901 Ga0466960_0270494 Ga0466960_0270494_346_750 134
257 3300045836 Ga0466958_0066032 Ga0466958_0066032_1127_1531 134
258 3300045976 Ga0466967_0013542 Ga0466967_0013542_4353_4757 134
259 3300046518 Ga0495631_0245870 Ga0495631_0245870_272_730 134
260 3300046535 Ga0495586_0231445 Ga0495586_0231445_493_897 134
261 3300048907 Ga0496104_0926519 Ga0496104_0926519_55_657 134
262 3300048912 Ga0496109_0709204 Ga0496109_0709204_183_641 134
263 3300048913 Ga0496110_0310146 Ga0496110_0310146_471_929 134
264 3300048914 Ga0496111_0792646 Ga0496111_0792646_37_495 134
265 3300049127 Ga0501306_049266 Ga0501306_049266_135_551 134
266 3300049127 Ga0501306_081467 Ga0501306_081467_120_536 134
267 3300049128 Ga0501308_015225 Ga0501308_015225_52_468 134
268 3300049530 Ga0501314_006582 Ga0501314_006582_27_443 134
269 3300049531 Ga0501315_066990 Ga0501315_066990_123_539 134
270 3300049533 Ga0501317_017566 Ga0501317_017566_499_915 134
271 3300049533 Ga0501317_104612 Ga0501317_104612_87_503 134
272 3300049536 Ga0501320_012544 Ga0501320_012544_430_846 134
273 3300049570 Ga0501033_0061150 Ga0501033_0061150_1410_1823 134
274 3300049571 Ga0501034_0385484 Ga0501034_0385484_496_900 134
275 3300049572 Ga0501036_1354913 Ga0501036_1354913_112_516 134
276 3300049579 Ga0501043_0158139 Ga0501043_0158139_240_653 134
277 3300049583 Ga0501067_0103653 Ga0501067_0103653_878_1291 134
278 3300049585 Ga0501069_0299656 Ga0501069_0299656_465_869 134
279 3300049586 Ga0501070_0828120 Ga0501070_0828120_83_487 134
280 3300049592 Ga0501076_0474133 Ga0501076_0474133_109_525 134
281 3300050494 nmdc:mga06z11_21653_c2 nmdc:mga06z11_21653_c2_2072_2650 134
282 3300053083 Ga0495655_0092904 Ga0495655_0092904_235_693 134
283 3300059490 Ga0587066_049092 Ga0587066_049092_187_591 134
284 3300059491 Ga0587070_018406 Ga0587070_018406_653_1057 134
285 3300059503 Ga0587080_025676 Ga0587080_025676_408_812 134
286 3300059510 Ga0587090_010894 Ga0587090_010894_605_1009 134
287 3300059512 Ga0587092_028331 Ga0587092_028331_120_524 134
288 3300059604 Ga0587098_007696 Ga0587098_007696_426_830 134
289 3300059605 Ga0587106_066057 Ga0587106_066057_144_548 134
290 3300059607 Ga0587125_057559 Ga0587125_057559_79_483 134
291 3300059623 Ga0587101_006481 Ga0587101_006481_229_633 134
292 3300059624 Ga0587109_034388 Ga0587109_034388_203_607 134
293 3300059626 Ga0587115_094737 Ga0587115_094737_92_496 134
294 3300059639 Ga0587062_005533 Ga0587062_005533_463_867 134
295 3300059642 Ga0587069_012972 Ga0587069_012972_439_843 134
296 3300059643 Ga0587072_017844 Ga0587072_017844_264_668 134
297 3300059645 Ga0587076_006906 Ga0587076_006906_683_1087 134
298 3300059647 Ga0587079_041961 Ga0587079_041961_354_758 134
299 3300059648 Ga0587100_000563 Ga0587100_000563_1332_1736 134
300 3300059651 Ga0587105_005902 Ga0587105_005902_377_781 134
301 3300059654 Ga0587110_013166 Ga0587110_013166_313_717 134
302 3300059655 Ga0587114_036800 Ga0587114_036800_79_483 134
303 3300059658 Ga0587119_037384 Ga0587119_037384_87_491 134
304 3300060346 Ga0587111_0011255 Ga0587111_0011255_506_910 134
305 3300061719 Ga0466962_0067962 Ga0466962_0067962_171_575 134
306 iso_pu_bacteria 2643221604 2644033687 134
307 3300003373 JGI25407J50210_10009484 JGI25407J50210_100094843 135
308 3300005937 Ga0081455_10000409 Ga0081455_100004096 135
309 3300005981 Ga0081538_10000088 Ga0081538_1000008861 135
310 3300005981 Ga0081538_10038576 Ga0081538_100385765 135
311 3300006051 Ga0075364_10171268 Ga0075364_101712682 135
312 3300006177 Ga0075362_10026928 Ga0075362_100269286 135
313 3300006353 Ga0075370_10585152 Ga0075370_105851522 135
314 3300009147 Ga0114129_10000234 Ga0114129_100002349 135
315 3300013306 Ga0163162_10545019 Ga0163162_105450193 135
316 3300013307 Ga0157372_10067801 Ga0157372_100678018 135
317 3300025919 Ga0207657_10318016 Ga0207657_103180161 135
318 3300026118 Ga0207675_100926237 Ga0207675_1009262372 135
319 3300027907 Ga0207428_10010526 Ga0207428_1001052616 135
320 3300032002 Ga0307416_101061441 Ga0307416_1010614412 135
321 3300041505 Ga0451849_0357388 Ga0451849_0357388_37_495 135
322 3300044706 Ga0466964_0713652 Ga0466964_0713652_62_526 135
323 3300044901 Ga0466960_0153551 Ga0466960_0153551_790_1215 135
324 3300045976 Ga0466967_0549075 Ga0466967_0549075_230_664 135
325 3300046500 Ga0495596_0340571 Ga0495596_0340571_101_532 135
326 3300046683 Ga0495658_0077248 Ga0495658_0077248_660_1241 135
327 3300048904 Ga0496101_1111537 Ga0496101_1111537_63_497 135
328 3300049128 Ga0501308_023913 Ga0501308_023913_293_700 135
329 3300049130 Ga0501310_014670 Ga0501310_014670_453_872 135
330 3300049162 Ga0501307_074435 Ga0501307_074435_71_499 135
331 3300049527 Ga0501311_066930 Ga0501311_066930_117_539 135
332 3300049533 Ga0501317_018365 Ga0501317_018365_381_803 135
333 3300049534 Ga0501318_019840 Ga0501318_019840_303_725 135
334 3300049539 Ga0501323_061508 Ga0501323_061508_115_537 135
335 3300049568 Ga0501031_0015297 Ga0501031_0015297_3651_4070 135
336 3300049568 Ga0501031_0120709 Ga0501031_0120709_204_629 135
337 3300049569 Ga0501032_0163681 Ga0501032_0163681_834_1253 135
338 3300049571 Ga0501034_0224517 Ga0501034_0224517_1174_1593 135
339 3300049572 Ga0501036_0749634 Ga0501036_0749634_364_783 135
340 3300049573 Ga0501037_0254772 Ga0501037_0254772_267_686 135
341 3300049574 Ga0501038_0040267 Ga0501038_0040267_31_450 135
342 3300049575 Ga0501039_0034588 Ga0501039_0034588_2694_3113 135
343 3300049575 Ga0501039_0828661 Ga0501039_0828661_42_467 135
344 3300049576 Ga0501040_0190605 Ga0501040_0190605_694_1113 135
345 3300049576 Ga0501040_0372261 Ga0501040_0372261_544_969 135
346 3300049576 Ga0501040_0632195 Ga0501040_0632195_238_663 135
347 3300049577 Ga0501041_0006740 Ga0501041_0006740_106_525 135
348 3300049578 Ga0501042_0722915 Ga0501042_0722915_267_689 135
349 3300049582 Ga0501048_0281957 Ga0501048_0281957_29_448 135
350 3300049584 Ga0501068_0044498 Ga0501068_0044498_1453_1872 135
351 3300049585 Ga0501069_0150761 Ga0501069_0150761_560_979 135
352 3300049586 Ga0501070_1111858 Ga0501070_1111858_31_450 135
353 3300049587 Ga0501071_0003704 Ga0501071_0003704_1831_2250 135
354 3300049588 Ga0501072_0018905 Ga0501072_0018905_2374_2793 135
355 3300049591 Ga0501075_0057160 Ga0501075_0057160_604_1023 135
356 3300049593 Ga0501077_0003693 Ga0501077_0003693_6099_6518 135
357 3300049741 Ga0501079_0022088 Ga0501079_0022088_3587_4006 135
358 3300049741 Ga0501079_0443421 Ga0501079_0443421_152_577 135
359 3300049824 Ga0501045_0171369 Ga0501045_0171369_967_1386 135
360 3300050489 nmdc:mga03683_48175_c1 nmdc:mga03683_48175_c1_13_435 135
361 3300050491 nmdc:mga00v17_90693_c2 nmdc:mga00v17_90693_c2_630_1052 135
362 3300050496 nmdc:mga07m45_205642_c1 nmdc:mga07m45_205642_c1_475_897 135
363 3300050507 nmdc:mga05p37_2785_c1 nmdc:mga05p37_2785_c1_8392_9027 135
364 3300050508 nmdc:mga09592_1799_c1 nmdc:mga09592_1799_c1_10937_11572 135
365 3300050510 nmdc:mga06r32_4895_c1 nmdc:mga06r32_4895_c1_11065_11700 135
366 3300054114 Ga0501084_0007241 Ga0501084_0007241_480_899 135
367 3300054114 Ga0501084_1871648 Ga0501084_1871648_62_484 135
368 3300059493 Ga0587077_151657 Ga0587077_151657_115_528 135
369 3300059508 Ga0587088_070391 Ga0587088_070391_260_673 135
370 3300059510 Ga0587090_069525 Ga0587090_069525_84_497 135
371 3300059604 Ga0587098_042730 Ga0587098_042730_39_446 135
372 3300059605 Ga0587106_018837 Ga0587106_018837_314_913 135
373 3300059652 Ga0587107_003751 Ga0587107_003751_219_818 135
374 3300059652 Ga0587107_068833 Ga0587107_068833_65_478 135
375 3300060344 Ga0587071_181229 Ga0587071_181229_84_497 135
376 3300060353 Ga0501082_1564667 Ga0501082_1564667_24_446 135
377 3300061734 Ga0530510_0081750 Ga0530510_0081750_1259_1678 135
378 iso_pu_bacteria 2773857762 2774396394 135
379 iso_pu_bacteria 2808606439 2809198050 135
380 iso_pu_bacteria 2811994878 2812353259 135
381 iso_pu_bacteria 2891968417 2891969113 135
382 3300005356 Ga0070674_101626818 Ga0070674_1016268181 136
383 3300005441 Ga0070700_100057255 Ga0070700_1000572552 136
384 3300025935 Ga0207709_10273292 Ga0207709_102732922 136
385 3300025937 Ga0207669_11034872 Ga0207669_110348722 136
386 3300026023 Ga0207677_10132683 Ga0207677_101326832 136
387 3300026075 Ga0207708_10071771 Ga0207708_100717716 136
388 3300031824 Ga0307413_10129430 Ga0307413_101294302 136
389 3300031901 Ga0307406_11270995 Ga0307406_112709951 136
390 3300031911 Ga0307412_11836423 Ga0307412_118364232 136
391 3300032168 Ga0316593_10029364 Ga0316593_100293642 136
392 3300041511 Ga0451855_1287871 Ga0451855_1287871_15_485 136
393 3300044683 Ga0466965_0021029 Ga0466965_0021029_2575_2988 136
394 3300044706 Ga0466964_0171153 Ga0466964_0171153_445_879 136
395 3300044706 Ga0466964_0692021 Ga0466964_0692021_48_461 136
396 3300044719 Ga0466971_0305243 Ga0466971_0305243_289_702 136
397 3300044765 Ga0466970_0021669 Ga0466970_0021669_369_782 136
398 3300044842 Ga0466957_0176113 Ga0466957_0176113_879_1292 136
399 3300044901 Ga0466960_0039714 Ga0466960_0039714_1093_1506 136
400 3300045976 Ga0466967_0442002 Ga0466967_0442002_561_974 136
401 3300046457 Ga0495590_0075600 Ga0495590_0075600_21_566 136
402 3300046459 Ga0495629_0456676 Ga0495629_0456676_279_707 136
403 3300046462 Ga0495651_0481029 Ga0495651_0481029_361_771 136
404 3300046477 Ga0495664_0075173 Ga0495664_0075173_581_1012 136
405 3300046642 Ga0495634_0250224 Ga0495634_0250224_141_572 136
406 3300048911 Ga0496108_0214879 Ga0496108_0214879_558_1001 136
407 3300048917 Ga0496114_1068777 Ga0496114_1068777_115_576 136
408 3300049528 Ga0501312_033623 Ga0501312_033623_353_775 136
409 3300049539 Ga0501323_045329 Ga0501323_045329_159_581 136
410 3300049540 Ga0501324_045939 Ga0501324_045939_82_492 136
411 3300049572 Ga0501036_0582051 Ga0501036_0582051_301_726 136
412 3300049577 Ga0501041_0117192 Ga0501041_0117192_979_1404 136
413 3300049578 Ga0501042_0494290 Ga0501042_0494290_220_645 136
414 3300049583 Ga0501067_0053577 Ga0501067_0053577_136_573 136
415 3300049583 Ga0501067_0283496 Ga0501067_0283496_231_722 136
416 3300049585 Ga0501069_0139303 Ga0501069_0139303_571_1008 136
417 3300049588 Ga0501072_0054085 Ga0501072_0054085_573_998 136
418 3300049592 Ga0501076_0299996 Ga0501076_0299996_231_656 136
419 3300049592 Ga0501076_0435768 Ga0501076_0435768_467_892 136
420 3300049741 Ga0501079_0518588 Ga0501079_0518588_102_704 136
421 3300049742 Ga0501080_0379218 Ga0501080_0379218_670_1095 136
422 3300049822 Ga0501035_0439763 Ga0501035_0439763_97_522 136
423 3300049823 Ga0501044_0282550 Ga0501044_0282550_711_1136 136
424 3300049824 Ga0501045_0168860 Ga0501045_0168860_645_1070 136
425 3300053077 Ga0495601_0008187 Ga0495601_0008187_3252_3683 136
426 3300054114 Ga0501084_0170123 Ga0501084_0170123_447_872 136
427 3300059426 Ga0590077_061893 Ga0590077_061893_296_727 136
428 3300060353 Ga0501082_0333267 Ga0501082_0333267_882_1307 136
429 3300060353 Ga0501082_0429944 Ga0501082_0429944_633_1064 136
430 3300060353 Ga0501082_0836020 Ga0501082_0836020_95_520 136
431 3300061719 Ga0466962_0029470 Ga0466962_0029470_1700_2113 136
432 3300061734 Ga0530510_0470702 Ga0530510_0470702_198_635 136
433 iso_pu_bacteria 2984576629 2984579582 136
434 iso_pu_bacteria 2990256926 2990257189 136
435 3300001989 JGI24739J22299_10014413 JGI24739J22299_100144132 137
436 3300003578 Ga0006562J51391_1055045 Ga0006562J51391_10550452 137
437 3300005329 Ga0070683_100429471 Ga0070683_1004294712 137
438 3300005367 Ga0070667_101470267 Ga0070667_1014702671 137
439 3300009148 Ga0105243_10747924 Ga0105243_107479243 137
440 3300020082 Ga0206353_10143802 Ga0206353_101438021 137
441 3300025944 Ga0207661_10329831 Ga0207661_103298312 137
442 3300031731 Ga0307405_10440607 Ga0307405_104406072 137
443 3300031901 Ga0307406_10368336 Ga0307406_103683362 137
444 3300031901 Ga0307406_10391940 Ga0307406_103919403 137
445 3300032002 Ga0307416_100688812 Ga0307416_1006888122 137
446 3300032126 Ga0307415_101751185 Ga0307415_1017511851 137
447 3300037418 Ga0395900_0042235 Ga0395900_0042235_2576_2995 137
448 3300037466 Ga0395898_0523938 Ga0395898_0523938_348_767 137
449 3300037471 Ga0395905_0660609 Ga0395905_0660609_460_879 137
450 3300038443 Ga0395901_0149529 Ga0395901_0149529_655_1074 137
451 3300044683 Ga0466965_0066512 Ga0466965_0066512_534_953 137
452 3300044765 Ga0466970_0686165 Ga0466970_0686165_130_549 137
453 3300048903 Ga0496100_0547411 Ga0496100_0547411_415_834 137
454 3300048905 Ga0496102_0298706 Ga0496102_0298706_354_773 137
455 3300048905 Ga0496102_0674086 Ga0496102_0674086_267_728 137
456 3300048907 Ga0496104_0441400 Ga0496104_0441400_365_784 137
457 3300048908 Ga0496105_0666180 Ga0496105_0666180_262_681 137
458 3300048917 Ga0496114_0570531 Ga0496114_0570531_363_782 137
459 3300049127 Ga0501306_043066 Ga0501306_043066_99_518 137
460 3300049130 Ga0501310_039053 Ga0501310_039053_146_565 137
461 3300049130 Ga0501310_056296 Ga0501310_056296_63_488 137
462 3300049160 Ga0501304_041367 Ga0501304_041367_43_465 137
463 3300049162 Ga0501307_005860 Ga0501307_005860_368_787 137
464 3300049162 Ga0501307_027832 Ga0501307_027832_286_720 137
465 3300049527 Ga0501311_082937 Ga0501311_082937_73_501 137
466 3300049532 Ga0501316_050391 Ga0501316_050391_121_552 137
467 3300049533 Ga0501317_076224 Ga0501317_076224_104_523 137
468 3300049533 Ga0501317_080033 Ga0501317_080033_20_442 137
469 3300049536 Ga0501320_026475 Ga0501320_026475_141_560 137
470 3300049539 Ga0501323_041980 Ga0501323_041980_193_612 137
471 3300049539 Ga0501323_056786 Ga0501323_056786_91_516 137
472 3300049540 Ga0501324_042141 Ga0501324_042141_12_431 137
473 3300049551 Ga0501335_023778 Ga0501335_023778_186_614 137
474 3300049570 Ga0501033_1086889 Ga0501033_1086889_56_484 137
475 3300049573 Ga0501037_0311649 Ga0501037_0311649_368_934 137
476 3300049575 Ga0501039_0335062 Ga0501039_0335062_207_773 137
477 3300049584 Ga0501068_0058339 Ga0501068_0058339_1604_2155 137
478 3300049590 Ga0501074_0133573 Ga0501074_0133573_1000_1566 137
479 3300049591 Ga0501075_0558691 Ga0501075_0558691_84_650 137
480 3300049822 Ga0501035_0889635 Ga0501035_0889635_137_565 137
481 3300059652 Ga0587107_004096 Ga0587107_004096_643_1056 137
482 3300059652 Ga0587107_010905 Ga0587107_010905_334_753 137
483 iso_pu_bacteria 2643221576 2643890021 137
484 iso_pu_bacteria 2643221590 2643959077 137
485 iso_pu_bacteria 2643221615 2644091092 137
486 iso_pu_bacteria 2643221641 2644229142 137
487 iso_pu_bacteria 2643221657 2644320895 137
488 iso_pu_bacteria 2739367898 2740168056 137
489 iso_pu_bacteria 2855386786 2855389961 137
490 iso_pu_bacteria 8054609563 8054613743 137
491 3300005337 Ga0070682_100508901 Ga0070682_1005089012 138
492 3300005338 Ga0068868_101665381 Ga0068868_1016653811 138
493 3300005455 Ga0070663_100732829 Ga0070663_1007328292 138
494 3300005456 Ga0070678_101599401 Ga0070678_1015994011 138
495 3300005535 Ga0070684_101232972 Ga0070684_1012329721 138
496 3300005843 Ga0068860_100021208 Ga0068860_1000212087 138
497 3300006038 Ga0075365_10179443 Ga0075365_101794432 138
498 3300006038 Ga0075365_10633990 Ga0075365_106339902 138
499 3300006048 Ga0075363_100041533 Ga0075363_1000415333 138
500 3300006051 Ga0075364_10644615 Ga0075364_106446152 138
501 3300006353 Ga0075370_10189229 Ga0075370_101892292 138
502 3300006846 Ga0075430_100005226 Ga0075430_1000052262 138
503 3300006847 Ga0075431_100001734 Ga0075431_10000173413 138
504 3300006880 Ga0075429_100017134 Ga0075429_10001713412 138
505 3300009094 Ga0111539_11541607 Ga0111539_115416072 138
506 3300009098 Ga0105245_11371206 Ga0105245_113712062 138
507 3300009101 Ga0105247_10551419 Ga0105247_105514192 138
508 3300009148 Ga0105243_10889462 Ga0105243_108894622 138
509 3300009551 Ga0105238_10757932 Ga0105238_107579322 138
510 3300010375 Ga0105239_11517279 Ga0105239_115172792 138
511 3300011119 Ga0105246_10206720 Ga0105246_102067202 138
512 3300012505 Ga0157339_1017013 Ga0157339_10170131 138
513 3300013105 Ga0157369_10488777 Ga0157369_104887772 138
514 3300013105 Ga0157369_10575182 Ga0157369_105751823 138
515 3300013307 Ga0157372_11750100 Ga0157372_117501001 138
516 3300013308 Ga0157375_11269252 Ga0157375_112692522 138
517 3300014325 Ga0163163_12094559 Ga0163163_120945591 138
518 3300014326 Ga0157380_12082369 Ga0157380_120823691 138
519 3300014497 Ga0182008_10098142 Ga0182008_100981422 138
520 3300017792 Ga0163161_11031377 Ga0163161_110313772 138
521 3300020076 Ga0206355_1430339 Ga0206355_14303392 138
522 3300025927 Ga0207687_10578659 Ga0207687_105786592 138
523 3300025937 Ga0207669_10390659 Ga0207669_103906592 138
524 3300025944 Ga0207661_10480809 Ga0207661_104808092 138
525 3300026067 Ga0207678_10482575 Ga0207678_104825752 138
526 3300026121 Ga0207683_11127210 Ga0207683_111272102 138
527 3300026142 Ga0207698_10412271 Ga0207698_104122713 138
528 3300028381 Ga0268264_10000792 Ga0268264_1000079224 138
529 3300035085 Ga0373929_0041862 Ga0373929_0041862_85_525 138
530 3300035112 Ga0373932_0356548 Ga0373932_0356548_16_456 138
531 3300035121 Ga0373960_0098428 Ga0373960_0098428_477_929 138
532 3300035242 Ga0373962_0127058 Ga0373962_0127058_250_693 138
533 3300037312 Ga0395899_0495866 Ga0395899_0495866_207_647 138
534 3300037418 Ga0395900_0080337 Ga0395900_0080337_673_1113 138
535 3300037466 Ga0395898_0117522 Ga0395898_0117522_669_1109 138
536 3300038443 Ga0395901_0044740 Ga0395901_0044740_1928_2368 138
537 3300038443 Ga0395901_0880952 Ga0395901_0880952_329_748 138
538 3300041444 Ga0451790_03312 Ga0451790_03312_23_484 138
539 3300041511 Ga0451855_0560015 Ga0451855_0560015_32_457 138
540 3300044683 Ga0466965_0644282 Ga0466965_0644282_94_537 138
541 3300044694 Ga0466963_0301232 Ga0466963_0301232_458_919 138
542 3300044735 Ga0466968_0026632 Ga0466968_0026632_1116_1538 138
543 3300044901 Ga0466960_0009725 Ga0466960_0009725_912_1355 138
544 3300045976 Ga0466967_0057496 Ga0466967_0057496_2740_3201 138
545 3300046475 Ga0495639_0278480 Ga0495639_0278480_100_546 138
546 3300046538 Ga0495609_0321260 Ga0495609_0321260_101_541 138
547 3300046559 Ga0495667_0776521 Ga0495667_0776521_64_510 138
548 3300046681 Ga0495647_0108849 Ga0495647_0108849_399_845 138
549 3300046683 Ga0495658_0378484 Ga0495658_0378484_239_688 138
550 3300046689 Ga0495613_0586162 Ga0495613_0586162_246_692 138
551 3300047322 Ga0495680_0278739 Ga0495680_0278739_251_697 138
552 3300048903 Ga0496100_0029403 Ga0496100_0029403_559_999 138
553 3300048904 Ga0496101_0025837 Ga0496101_0025837_1227_1667 138
554 3300048904 Ga0496101_0907791 Ga0496101_0907791_239_673 138
555 3300048905 Ga0496102_0004268 Ga0496102_0004268_6571_7011 138
556 3300048906 Ga0496103_0002413 Ga0496103_0002413_5370_5810 138
557 3300048906 Ga0496103_0203919 Ga0496103_0203919_558_977 138
558 3300048907 Ga0496104_0042002 Ga0496104_0042002_3711_4151 138
559 3300048907 Ga0496104_0152888 Ga0496104_0152888_173_634 138
560 3300048908 Ga0496105_0065779 Ga0496105_0065779_1378_1818 138
561 3300048908 Ga0496105_0191069 Ga0496105_0191069_674_1135 138
562 3300048909 Ga0496106_0005923 Ga0496106_0005923_2080_2520 138
563 3300048911 Ga0496108_0026274 Ga0496108_0026274_1599_2039 138
564 3300048911 Ga0496108_0303696 Ga0496108_0303696_323_781 138
565 3300048912 Ga0496109_0029975 Ga0496109_0029975_623_1063 138
566 3300048912 Ga0496109_0381469 Ga0496109_0381469_834_1268 138
567 3300048912 Ga0496109_0584548 Ga0496109_0584548_190_648 138
568 3300048912 Ga0496109_0682021 Ga0496109_0682021_11_436 138
569 3300048912 Ga0496109_0844733 Ga0496109_0844733_330_764 138
570 3300048913 Ga0496110_0003020 Ga0496110_0003020_6383_6823 138
571 3300048913 Ga0496110_0489336 Ga0496110_0489336_269_727 138
572 3300048914 Ga0496111_0021913 Ga0496111_0021913_3563_4003 138
573 3300048915 Ga0496112_0012650 Ga0496112_0012650_5837_6277 138
574 3300048916 Ga0496113_0299038 Ga0496113_0299038_706_1146 138
575 3300048917 Ga0496114_0244125 Ga0496114_0244125_540_980 138
576 3300048917 Ga0496114_0300732 Ga0496114_0300732_553_987 138
577 3300048918 Ga0496115_0666949 Ga0496115_0666949_67_501 138
578 3300049127 Ga0501306_008227 Ga0501306_008227_569_1012 138
579 3300049128 Ga0501308_078160 Ga0501308_078160_58_477 138
580 3300049129 Ga0501309_004651 Ga0501309_004651_576_1019 138
581 3300049130 Ga0501310_000215 Ga0501310_000215_475_918 138
582 3300049161 Ga0501305_011790 Ga0501305_011790_122_565 138
583 3300049161 Ga0501305_046041 Ga0501305_046041_126_587 138
584 3300049161 Ga0501305_092746 Ga0501305_092746_85_504 138
585 3300049162 Ga0501307_001493 Ga0501307_001493_518_961 138
586 3300049162 Ga0501307_088798 Ga0501307_088798_44_463 138
587 3300049514 Ga0501291_011421 Ga0501291_011421_390_833 138
588 3300049527 Ga0501311_000190 Ga0501311_000190_696_1139 138
589 3300049527 Ga0501311_069162 Ga0501311_069162_40_459 138
590 3300049528 Ga0501312_006477 Ga0501312_006477_607_1050 138
591 3300049528 Ga0501312_016524 Ga0501312_016524_87_506 138
592 3300049529 Ga0501313_005383 Ga0501313_005383_530_973 138
593 3300049531 Ga0501315_012729 Ga0501315_012729_125_568 138
594 3300049532 Ga0501316_009854 Ga0501316_009854_550_993 138
595 3300049533 Ga0501317_000171 Ga0501317_000171_1250_1693 138
596 3300049533 Ga0501317_059862 Ga0501317_059862_87_524 138
597 3300049534 Ga0501318_000714 Ga0501318_000714_486_929 138
598 3300049534 Ga0501318_014331 Ga0501318_014331_383_817 138
599 3300049534 Ga0501318_059911 Ga0501318_059911_124_543 138
600 3300049535 Ga0501319_001563 Ga0501319_001563_552_995 138
601 3300049536 Ga0501320_060886 Ga0501320_060886_61_480 138
602 3300049537 Ga0501321_000377 Ga0501321_000377_27_464 138
603 3300049537 Ga0501321_001182 Ga0501321_001182_1479_1922 138
604 3300049537 Ga0501321_050996 Ga0501321_050996_105_524 138
605 3300049538 Ga0501322_003301 Ga0501322_003301_151_594 138
606 3300049539 Ga0501323_000118 Ga0501323_000118_2578_3021 138
607 3300049539 Ga0501323_051700 Ga0501323_051700_14_454 138
608 3300049540 Ga0501324_000012 Ga0501324_000012_5618_6061 138
609 3300049541 Ga0501325_001935 Ga0501325_001935_343_786 138
610 3300049556 Ga0501340_006300 Ga0501340_006300_134_577 138
611 3300049568 Ga0501031_0019900 Ga0501031_0019900_1634_2062 138
612 3300049568 Ga0501031_0311507 Ga0501031_0311507_252_698 138
613 3300049569 Ga0501032_0027010 Ga0501032_0027010_1247_1675 138
614 3300049571 Ga0501034_1298238 Ga0501034_1298238_38_460 138
615 3300049572 Ga0501036_0958206 Ga0501036_0958206_152_571 138
616 3300049573 Ga0501037_0054932 Ga0501037_0054932_34_462 138
617 3300049574 Ga0501038_0234621 Ga0501038_0234621_44_472 138
618 3300049575 Ga0501039_0055448 Ga0501039_0055448_1279_1707 138
619 3300049577 Ga0501041_0432802 Ga0501041_0432802_254_673 138
620 3300049578 Ga0501042_0327248 Ga0501042_0327248_103_531 138
621 3300049578 Ga0501042_0541720 Ga0501042_0541720_297_743 138
622 3300049578 Ga0501042_0744455 Ga0501042_0744455_232_651 138
623 3300049579 Ga0501043_0189571 Ga0501043_0189571_488_916 138
624 3300049580 Ga0501046_0071881 Ga0501046_0071881_1248_1676 138
625 3300049580 Ga0501046_0604422 Ga0501046_0604422_323_742 138
626 3300049581 Ga0501047_0033441 Ga0501047_0033441_4240_4668 138
627 3300049582 Ga0501048_0015873 Ga0501048_0015873_5034_5462 138
628 3300049582 Ga0501048_0507911 Ga0501048_0507911_385_804 138
629 3300049584 Ga0501068_0155931 Ga0501068_0155931_654_1094 138
630 3300049584 Ga0501068_0261968 Ga0501068_0261968_512_940 138
631 3300049585 Ga0501069_0043121 Ga0501069_0043121_96_536 138
632 3300049585 Ga0501069_0302659 Ga0501069_0302659_254_682 138
633 3300049586 Ga0501070_0004983 Ga0501070_0004983_3034_3453 138
634 3300049587 Ga0501071_0308535 Ga0501071_0308535_120_560 138
635 3300049587 Ga0501071_0430651 Ga0501071_0430651_319_738 138
636 3300049588 Ga0501072_0504454 Ga0501072_0504454_458_877 138
637 3300049589 Ga0501073_0644269 Ga0501073_0644269_90_518 138
638 3300049590 Ga0501074_0814990 Ga0501074_0814990_78_506 138
639 3300049660 Ga0501216_031581 Ga0501216_031581_496_939 138
640 3300049676 Ga0501246_015266 Ga0501246_015266_92_535 138
641 3300049683 Ga0501253_116410 Ga0501253_116410_163_606 138
642 3300049742 Ga0501080_0141216 Ga0501080_0141216_1081_1509 138
643 3300049822 Ga0501035_0097705 Ga0501035_0097705_1937_2365 138
644 3300049823 Ga0501044_0004036 Ga0501044_0004036_4574_5002 138
645 3300050490 nmdc:mga03n38_6080_c1 nmdc:mga03n38_6080_c1_565_1125 138
646 3300050492 nmdc:mga0yw44_405602_c1 nmdc:mga0yw44_405602_c1_86_646 138
647 3300050496 nmdc:mga07m45_4612_c1 nmdc:mga07m45_4612_c1_1445_2005 138
648 3300050511 nmdc:mga08y16_738529_c1 nmdc:mga08y16_738529_c1_462_902 138
649 3300050512 nmdc:mga0n895_1156086_c1 nmdc:mga0n895_1156086_c1_78_518 138
650 3300050513 nmdc:mga0rr50_1181386_c1 nmdc:mga0rr50_1181386_c1_79_519 138
651 3300053085 Ga0495619_0231221 Ga0495619_0231221_554_1006 138
652 3300053085 Ga0495619_0319711 Ga0495619_0319711_553_999 138
653 3300059605 Ga0587106_092358 Ga0587106_092358_144_563 138
654 3300059639 Ga0587062_088749 Ga0587062_088749_47_466 138
655 3300059641 Ga0587068_070769 Ga0587068_070769_238_657 138
656 3300060353 Ga0501082_0880258 Ga0501082_0880258_104_667 138
657 3300061734 Ga0530510_0070526 Ga0530510_0070526_625_1065 138
658 3300061734 Ga0530510_0409932 Ga0530510_0409932_54_617 138
659 iso_pu_bacteria 2857481737 2857485187 138
660 3300005354 Ga0070675_101852128 Ga0070675_1018521281 139
661 3300005366 Ga0070659_100565211 Ga0070659_1005652112 139
662 3300005457 Ga0070662_100541549 Ga0070662_1005415493 139
663 3300005471 Ga0070698_100055313 Ga0070698_1000553135 139
664 3300005530 Ga0070679_101123339 Ga0070679_1011233391 139
665 3300005543 Ga0070672_101066108 Ga0070672_1010661082 139
666 3300005547 Ga0070693_100889347 Ga0070693_1008893472 139
667 3300005577 Ga0068857_100556843 Ga0068857_1005568432 139
668 3300006038 Ga0075365_10146997 Ga0075365_101469972 139
669 3300006048 Ga0075363_100124271 Ga0075363_1001242712 139
670 3300006237 Ga0097621_101652236 Ga0097621_1016522361 139
671 3300006353 Ga0075370_10236513 Ga0075370_102365133 139
672 3300009553 Ga0105249_11426410 Ga0105249_114264102 139
673 3300012490 Ga0157322_1015937 Ga0157322_10159372 139
674 3300012494 Ga0157341_1009388 Ga0157341_10093882 139
675 3300013102 Ga0157371_10449972 Ga0157371_104499722 139
676 3300013297 Ga0157378_10729055 Ga0157378_107290552 139
677 3300013306 Ga0163162_12638110 Ga0163162_126381101 139
678 3300014326 Ga0157380_10798099 Ga0157380_107980992 139
679 3300020069 Ga0197907_10124435 Ga0197907_101244351 139
680 3300025921 Ga0207652_10877523 Ga0207652_108775232 139
681 3300025931 Ga0207644_10816936 Ga0207644_108169362 139
682 3300025942 Ga0207689_10395221 Ga0207689_103952212 139
683 3300025945 Ga0207679_10480510 Ga0207679_104805102 139
684 3300027866 Ga0209813_10422413 Ga0209813_104224132 139
685 3300030732 Ga0316176_1093836 Ga0316176_10938363 139
686 3300030733 Ga0314311_1063086 Ga0314311_10630863 139
687 3300030744 Ga0316181_1044632 Ga0316181_10446323 139
688 3300030745 Ga0316182_1249978 Ga0316182_12499782 139
689 3300031730 Ga0307516_10792272 Ga0307516_107922721 139
690 3300031824 Ga0307413_10179289 Ga0307413_101792892 139
691 3300031852 Ga0307410_10131183 Ga0307410_101311833 139
692 3300031995 Ga0307409_100328891 Ga0307409_1003288912 139
693 3300032004 Ga0307414_10400359 Ga0307414_104003592 139
694 3300037312 Ga0395899_0220065 Ga0395899_0220065_213_635 139
695 3300037418 Ga0395900_0169253 Ga0395900_0169253_840_1262 139
696 3300037418 Ga0395900_0906545 Ga0395900_0906545_354_773 139
697 3300037466 Ga0395898_0032908 Ga0395898_0032908_4321_4743 139
698 3300038443 Ga0395901_0002011 Ga0395901_0002011_15075_15497 139
699 3300041405 Ga0439438_017324 Ga0439438_017324_1173_1595 139
700 3300041407 Ga0439447_022943 Ga0439447_022943_824_1246 139
701 3300041997 Ga0439431_0008571 Ga0439431_0008571_1862_2284 139
702 3300042004 Ga0439445_0013830 Ga0439445_0013830_126_548 139
703 3300042156 Ga0439446_0164790 Ga0439446_0164790_145_567 139
704 3300042435 Ga0439434_0000725 Ga0439434_0000725_3304_3726 139
705 3300044658 Ga0466972_0201794 Ga0466972_0201794_80_505 139
706 3300044683 Ga0466965_0216655 Ga0466965_0216655_228_647 139
707 3300044684 Ga0466966_0539043 Ga0466966_0539043_106_543 139
708 3300044693 Ga0466961_0503309 Ga0466961_0503309_251_670 139
709 3300044694 Ga0466963_0002887 Ga0466963_0002887_7495_7917 139
710 3300044719 Ga0466971_0134028 Ga0466971_0134028_404_826 139
711 3300044765 Ga0466970_0007149 Ga0466970_0007149_4263_4682 139
712 3300044765 Ga0466970_0515876 Ga0466970_0515876_22_441 139
713 3300044765 Ga0466970_0542329 Ga0466970_0542329_211_633 139
714 3300044842 Ga0466957_0308782 Ga0466957_0308782_221_640 139
715 3300045049 Ga0466959_0044069 Ga0466959_0044069_1471_1893 139
716 3300045836 Ga0466958_0250198 Ga0466958_0250198_567_989 139
717 3300045976 Ga0466967_0311524 Ga0466967_0311524_647_1069 139
718 3300046459 Ga0495629_0500075 Ga0495629_0500075_185_610 139
719 3300046463 Ga0495653_0057884 Ga0495653_0057884_1736_2161 139
720 3300046511 Ga0495608_0139951 Ga0495608_0139951_253_678 139
721 3300046678 Ga0495599_0234217 Ga0495599_0234217_194_619 139
722 3300047319 Ga0495674_1000037 Ga0495674_1000037_112_537 139
723 3300047321 Ga0495676_0197442 Ga0495676_0197442_444_869 139
724 3300049128 Ga0501308_021454 Ga0501308_021454_237_656 139
725 3300049129 Ga0501309_066995 Ga0501309_066995_105_545 139
726 3300049130 Ga0501310_004536 Ga0501310_004536_335_757 139
727 3300049130 Ga0501310_060938 Ga0501310_060938_93_512 139
728 3300049130 Ga0501310_081428 Ga0501310_081428_12_431 139
729 3300049161 Ga0501305_021222 Ga0501305_021222_94_513 139
730 3300049528 Ga0501312_078339 Ga0501312_078339_51_470 139
731 3300049528 Ga0501312_124075 Ga0501312_124075_47_466 139
732 3300049529 Ga0501313_023498 Ga0501313_023498_303_722 139
733 3300049530 Ga0501314_014546 Ga0501314_014546_223_651 139
734 3300049532 Ga0501316_076175 Ga0501316_076175_48_467 139
735 3300049534 Ga0501318_055256 Ga0501318_055256_134_553 139
736 3300049534 Ga0501318_086630 Ga0501318_086630_44_463 139
737 3300049536 Ga0501320_020819 Ga0501320_020819_34_453 139
738 3300049537 Ga0501321_056278 Ga0501321_056278_126_545 139
739 3300049537 Ga0501321_058781 Ga0501321_058781_124_543 139
740 3300049538 Ga0501322_009483 Ga0501322_009483_88_507 139
741 3300049539 Ga0501323_074484 Ga0501323_074484_80_499 139
742 3300049540 Ga0501324_037264 Ga0501324_037264_28_462 139
743 3300049571 Ga0501034_0069200 Ga0501034_0069200_2173_2598 139
744 3300049573 Ga0501037_0028700 Ga0501037_0028700_2632_3057 139
745 3300049574 Ga0501038_0187963 Ga0501038_0187963_296_721 139
746 3300049581 Ga0501047_0023921 Ga0501047_0023921_5225_5650 139
747 3300049583 Ga0501067_0142954 Ga0501067_0142954_178_756 139
748 3300049583 Ga0501067_0148213 Ga0501067_0148213_336_767 139
749 3300049583 Ga0501067_0258598 Ga0501067_0258598_254_688 139
750 3300049585 Ga0501069_0099451 Ga0501069_0099451_1058_1492 139
751 3300049585 Ga0501069_0252417 Ga0501069_0252417_579_1004 139
752 3300049586 Ga0501070_0225481 Ga0501070_0225481_107_529 139
753 3300049589 Ga0501073_0093221 Ga0501073_0093221_1084_1506 139
754 3300049591 Ga0501075_0475760 Ga0501075_0475760_256_693 139
755 3300049665 Ga0501227_195147 Ga0501227_195147_134_553 139
756 3300049741 Ga0501079_0027696 Ga0501079_0027696_3433_3855 139
757 3300049742 Ga0501080_0216610 Ga0501080_0216610_546_968 139
758 3300049822 Ga0501035_0334257 Ga0501035_0334257_214_639 139
759 3300049823 Ga0501044_0101925 Ga0501044_0101925_93_518 139
760 3300049823 Ga0501044_0777629 Ga0501044_0777629_320_742 139
761 3300049824 Ga0501045_0378299 Ga0501045_0378299_488_913 139
762 3300050491 nmdc:mga00v17_396942_c1 nmdc:mga00v17_396942_c1_329_748 139
763 3300050495 nmdc:mga04h51_458096_c1 nmdc:mga04h51_458096_c1_29_448 139
764 3300050496 nmdc:mga07m45_431698_c1 nmdc:mga07m45_431698_c1_291_710 139
765 3300053085 Ga0495619_0547018 Ga0495619_0547018_130_555 139
766 3300059421 Ga0590071_009977 Ga0590071_009977_623_1054 139
767 3300059426 Ga0590077_031331 Ga0590077_031331_322_753 139
768 3300061719 Ga0466962_0037334 Ga0466962_0037334_1376_1798 139
769 3300005333 Ga0070677_10477532 Ga0070677_104775321 140
770 3300005338 Ga0068868_101952144 Ga0068868_1019521441 140
771 3300005339 Ga0070660_100136216 Ga0070660_1001362162 140
772 3300005530 Ga0070679_100800880 Ga0070679_1008008802 140
773 3300005547 Ga0070693_100526403 Ga0070693_1005264032 140
774 3300005718 Ga0068866_10262124 Ga0068866_102621242 140
775 3300006038 Ga0075365_10211303 Ga0075365_102113032 140
776 3300006042 Ga0075368_10001331 Ga0075368_100013312 140
777 3300006042 Ga0075368_10057698 Ga0075368_100576983 140
778 3300006048 Ga0075363_100237441 Ga0075363_1002374413 140
779 3300006051 Ga0075364_10046975 Ga0075364_100469754 140
780 3300006178 Ga0075367_10029487 Ga0075367_100294872 140
781 3300006178 Ga0075367_10412588 Ga0075367_104125882 140
782 3300006353 Ga0075370_10171740 Ga0075370_101717403 140
783 3300006353 Ga0075370_10217143 Ga0075370_102171432 140
784 3300009148 Ga0105243_11016600 Ga0105243_110166002 140
785 3300009545 Ga0105237_10852644 Ga0105237_108526442 140
786 3300010375 Ga0105239_10024787 Ga0105239_100247873 140
787 3300013105 Ga0157369_11007682 Ga0157369_110076821 140
788 3300013296 Ga0157374_11254421 Ga0157374_112544212 140
789 3300013307 Ga0157372_10356926 Ga0157372_103569263 140
790 3300013308 Ga0157375_12831267 Ga0157375_128312671 140
791 3300020082 Ga0206353_11410002 Ga0206353_114100022 140
792 3300025901 Ga0207688_10244651 Ga0207688_102446512 140
793 3300025904 Ga0207647_10141073 Ga0207647_101410732 140
794 3300025919 Ga0207657_10095519 Ga0207657_100955191 140
795 3300025935 Ga0207709_10479453 Ga0207709_104794532 140
796 3300025939 Ga0207665_10632995 Ga0207665_106329952 140
797 3300025940 Ga0207691_10552198 Ga0207691_105521982 140
798 3300025945 Ga0207679_11626759 Ga0207679_116267591 140
799 3300025961 Ga0207712_10345426 Ga0207712_103454263 140
800 3300026095 Ga0207676_12104808 Ga0207676_121048082 140
801 3300026116 Ga0207674_10902352 Ga0207674_109023522 140
802 3300026118 Ga0207675_100436195 Ga0207675_1004361952 140
803 3300026118 Ga0207675_100532514 Ga0207675_1005325143 140
804 3300026142 Ga0207698_11777425 Ga0207698_117774251 140
805 3300027614 Ga0209970_1010625 Ga0209970_10106253 140
806 3300030733 Ga0314311_1091600 Ga0314311_10916002 140
807 3300030733 Ga0314311_1110141 Ga0314311_11101413 140
808 3300030744 Ga0316181_1229775 Ga0316181_12297752 140
809 3300031852 Ga0307410_10717267 Ga0307410_107172672 140
810 3300031852 Ga0307410_10814649 Ga0307410_108146492 140
811 3300031995 Ga0307409_100306256 Ga0307409_1003062563 140
812 3300032002 Ga0307416_100884849 Ga0307416_1008848491 140
813 3300032002 Ga0307416_102375033 Ga0307416_1023750332 140
814 3300032005 Ga0307411_10198643 Ga0307411_101986433 140
815 3300034820 Ga0373959_0041280 Ga0373959_0041280_375_800 140
816 3300035092 Ga0373952_0029220 Ga0373952_0029220_591_1016 140
817 3300038443 Ga0395901_0038023 Ga0395901_0038023_126_557 140
818 3300041411 Ga0439466_0080675 Ga0439466_0080675_370_795 140
819 3300041459 Ga0451800_1688016 Ga0451800_1688016_126_569 140
820 3300041512 Ga0451853_2312243 Ga0451853_2312243_736_1179 140
821 3300042002 Ga0439442_066080 Ga0439442_066080_328_753 140
822 3300044656 Ga0466969_0042846 Ga0466969_0042846_897_1328 140
823 3300044683 Ga0466965_0180193 Ga0466965_0180193_96_533 140
824 3300044683 Ga0466965_0213732 Ga0466965_0213732_456_896 140
825 3300044683 Ga0466965_0339951 Ga0466965_0339951_375_806 140
826 3300044683 Ga0466965_0514916 Ga0466965_0514916_232_657 140
827 3300044684 Ga0466966_0066805 Ga0466966_0066805_157_588 140
828 3300044693 Ga0466961_0211677 Ga0466961_0211677_633_1064 140
829 3300044693 Ga0466961_0478448 Ga0466961_0478448_78_518 140
830 3300044694 Ga0466963_0235872 Ga0466963_0235872_184_612 140
831 3300044694 Ga0466963_0677370 Ga0466963_0677370_159_590 140
832 3300044706 Ga0466964_0493307 Ga0466964_0493307_16_447 140
833 3300044719 Ga0466971_0049834 Ga0466971_0049834_323_754 140
834 3300044765 Ga0466970_0298319 Ga0466970_0298319_345_776 140
835 3300044842 Ga0466957_0492980 Ga0466957_0492980_284_715 140
836 3300044842 Ga0466957_0556831 Ga0466957_0556831_190_618 140
837 3300045836 Ga0466958_0945592 Ga0466958_0945592_29_460 140
838 3300045976 Ga0466967_0729642 Ga0466967_0729642_311_739 140
839 3300045976 Ga0466967_1694736 Ga0466967_1694736_30_461 140
840 3300046459 Ga0495629_0096372 Ga0495629_0096372_348_818 140
841 3300046461 Ga0495641_0337918 Ga0495641_0337918_177_647 140
842 3300046473 Ga0495582_0164038 Ga0495582_0164038_330_800 140
843 3300046517 Ga0495630_0381578 Ga0495630_0381578_97_558 140
844 3300046615 Ga0495656_0649857 Ga0495656_0649857_17_442 140
845 3300047319 Ga0495674_0493845 Ga0495674_0493845_98_559 140
846 3300047321 Ga0495676_0284682 Ga0495676_0284682_312_782 140
847 3300048903 Ga0496100_0357801 Ga0496100_0357801_541_1008 140
848 3300048905 Ga0496102_0420064 Ga0496102_0420064_656_1123 140
849 3300048905 Ga0496102_1821992 Ga0496102_1821992_38_481 140
850 3300048906 Ga0496103_0333986 Ga0496103_0333986_18_443 140
851 3300048907 Ga0496104_0313410 Ga0496104_0313410_338_760 140
852 3300048909 Ga0496106_0232430 Ga0496106_0232430_448_873 140
853 3300048910 Ga0496107_0172477 Ga0496107_0172477_427_894 140
854 3300048911 Ga0496108_0336636 Ga0496108_0336636_249_716 140
855 3300048911 Ga0496108_0422087 Ga0496108_0422087_118_561 140
856 3300048912 Ga0496109_1575207 Ga0496109_1575207_83_505 140
857 3300048914 Ga0496111_0069011 Ga0496111_0069011_977_1420 140
858 3300048915 Ga0496112_1131876 Ga0496112_1131876_30_497 140
859 3300048917 Ga0496114_0190045 Ga0496114_0190045_1183_1650 140
860 3300049127 Ga0501306_011666 Ga0501306_011666_662_1087 140
861 3300049128 Ga0501308_066625 Ga0501308_066625_92_517 140
862 3300049160 Ga0501304_007286 Ga0501304_007286_449_874 140
863 3300049161 Ga0501305_108648 Ga0501305_108648_51_476 140
864 3300049532 Ga0501316_067268 Ga0501316_067268_13_438 140
865 3300049534 Ga0501318_083205 Ga0501318_083205_49_474 140
866 3300049568 Ga0501031_0335783 Ga0501031_0335783_162_587 140
867 3300049569 Ga0501032_0792926 Ga0501032_0792926_123_548 140
868 3300049571 Ga0501034_0352454 Ga0501034_0352454_402_827 140
869 3300049572 Ga0501036_0944105 Ga0501036_0944105_228_653 140
870 3300049573 Ga0501037_0676042 Ga0501037_0676042_229_654 140
871 3300049575 Ga0501039_0151078 Ga0501039_0151078_1287_1712 140
872 3300049578 Ga0501042_0858000 Ga0501042_0858000_226_651 140
873 3300049585 Ga0501069_0321693 Ga0501069_0321693_251_847 140
874 3300049587 Ga0501071_0389469 Ga0501071_0389469_533_958 140
875 3300049588 Ga0501072_0330311 Ga0501072_0330311_473_898 140
876 3300049590 Ga0501074_0375209 Ga0501074_0375209_341_766 140
877 3300049591 Ga0501075_0667128 Ga0501075_0667128_151_576 140
878 3300049592 Ga0501076_0777705 Ga0501076_0777705_301_726 140
879 3300049741 Ga0501079_0537448 Ga0501079_0537448_253_678 140
880 3300049742 Ga0501080_0731352 Ga0501080_0731352_311_736 140
881 3300049744 Ga0501083_0105387 Ga0501083_0105387_200_625 140
882 3300049822 Ga0501035_0660930 Ga0501035_0660930_237_662 140
883 3300050489 nmdc:mga03683_2815_c1 nmdc:mga03683_2815_c1_4520_4960 140
884 3300050490 nmdc:mga03n38_6390_c1 nmdc:mga03n38_6390_c1_1729_2169 140
885 3300050490 nmdc:mga03n38_978246_c1 nmdc:mga03n38_978246_c1_59_481 140
886 3300050491 nmdc:mga00v17_21651_c2 nmdc:mga00v17_21651_c2_1125_1691 140
887 3300050491 nmdc:mga00v17_33777_c1 nmdc:mga00v17_33777_c1_1991_2524 140
888 3300050491 nmdc:mga00v17_80515_c1 nmdc:mga00v17_80515_c1_953_1393 140
889 3300050492 nmdc:mga0yw44_12755_c1 nmdc:mga0yw44_12755_c1_1936_2469 140
890 3300050492 nmdc:mga0yw44_276350_c1 nmdc:mga0yw44_276350_c1_67_621 140
891 3300050492 nmdc:mga0yw44_56680_c1 nmdc:mga0yw44_56680_c1_1044_1484 140
892 3300050494 nmdc:mga06z11_320333_c1 nmdc:mga06z11_320333_c1_107_529 140
893 3300050496 nmdc:mga07m45_1335_c1 nmdc:mga07m45_1335_c1_612_1052 140
894 3300050496 nmdc:mga07m45_210168_c1 nmdc:mga07m45_210168_c1_214_639 140
895 3300050496 nmdc:mga07m45_488432_c1 nmdc:mga07m45_488432_c1_139_564 140
896 3300053085 Ga0495619_0021438 Ga0495619_0021438_193_657 140
897 3300053088 Ga0500644_0000427 Ga0500644_0000427_722_1165 140
898 3300053140 Ga0500573_0044627 Ga0500573_0044627_242_667 140
899 3300054114 Ga0501084_1191241 Ga0501084_1191241_190_615 140
900 3300059630 Ga0587128_013515 Ga0587128_013515_80_502 140
901 3300060353 Ga0501082_1134437 Ga0501082_1134437_63_488 140
902 3300061719 Ga0466962_0140561 Ga0466962_0140561_275_706 140
903 3300061719 Ga0466962_0205770 Ga0466962_0205770_361_801 140
904 3300061734 Ga0530510_0627415 Ga0530510_0627415_180_734 140
905 3300061734 Ga0530510_1316569 Ga0530510_1316569_76_501 140
906 3300000549 LJQas_1009377 LJQas_10093773 141
907 3300001989 JGI24739J22299_10012134 JGI24739J22299_100121342 141
908 3300002075 JGI24738J21930_10001633 JGI24738J21930_100016339 141
909 3300003163 Ga0006759J45824_1024389 Ga0006759J45824_10243892 141
910 3300003300 Ga0006758J48902_1015472 Ga0006758J48902_10154722 141
911 3300003308 Ga0006777J48905_1052029 Ga0006777J48905_10520292 141
912 3300003568 Ga0006781J51513_1021454 Ga0006781J51513_10214542 141
913 3300003574 Ga0007410J51695_1013323 Ga0007410J51695_10133233 141
914 3300003577 Ga0007416J51690_1025482 Ga0007416J51690_10254822 141
915 3300003579 Ga0007429J51699_1020720 Ga0007429J51699_10207202 141
916 3300003693 Ga0032354_1008083 Ga0032354_10080833 141
917 3300005327 Ga0070658_10480236 Ga0070658_104802362 141
918 3300005328 Ga0070676_11338978 Ga0070676_113389781 141
919 3300005329 Ga0070683_100173735 Ga0070683_1001737353 141
920 3300005329 Ga0070683_100553072 Ga0070683_1005530722 141
921 3300005329 Ga0070683_101995586 Ga0070683_1019955861 141
922 3300005331 Ga0070670_100520023 Ga0070670_1005200233 141
923 3300005334 Ga0068869_100441035 Ga0068869_1004410351 141
924 3300005334 Ga0068869_100569559 Ga0068869_1005695593 141
925 3300005337 Ga0070682_100028438 Ga0070682_1000284383 141
926 3300005337 Ga0070682_100114772 Ga0070682_1001147722 141
927 3300005338 Ga0068868_100096107 Ga0068868_1000961075 141
928 3300005338 Ga0068868_100945443 Ga0068868_1009454432 141
929 3300005338 Ga0068868_101154441 Ga0068868_1011544412 141
930 3300005339 Ga0070660_100917798 Ga0070660_1009177982 141
931 3300005340 Ga0070689_100181515 Ga0070689_1001815153 141
932 3300005340 Ga0070689_100605206 Ga0070689_1006052061 141
933 3300005341 Ga0070691_10169444 Ga0070691_101694443 141
934 3300005343 Ga0070687_100135823 Ga0070687_1001358233 141
935 3300005347 Ga0070668_100884440 Ga0070668_1008844402 141
936 3300005347 Ga0070668_101044808 Ga0070668_1010448081 141
937 3300005354 Ga0070675_100218333 Ga0070675_1002183333 141
938 3300005356 Ga0070674_100137963 Ga0070674_1001379632 141
939 3300005356 Ga0070674_100961039 Ga0070674_1009610392 141
940 3300005364 Ga0070673_100364268 Ga0070673_1003642683 141
941 3300005364 Ga0070673_100768922 Ga0070673_1007689222 141
942 3300005365 Ga0070688_100155630 Ga0070688_1001556303 141
943 3300005365 Ga0070688_101431845 Ga0070688_1014318451 141
944 3300005366 Ga0070659_100325951 Ga0070659_1003259512 141
945 3300005367 Ga0070667_101672116 Ga0070667_1016721161 141
946 3300005438 Ga0070701_10001181 Ga0070701_1000118112 141
947 3300005438 Ga0070701_10678506 Ga0070701_106785061 141
948 3300005441 Ga0070700_100074940 Ga0070700_1000749403 141
949 3300005441 Ga0070700_100450102 Ga0070700_1004501022 141
950 3300005455 Ga0070663_100240209 Ga0070663_1002402093 141
951 3300005455 Ga0070663_100547854 Ga0070663_1005478542 141
952 3300005456 Ga0070678_100132971 Ga0070678_1001329713 141
953 3300005456 Ga0070678_101748240 Ga0070678_1017482401 141
954 3300005459 Ga0068867_100239173 Ga0068867_1002391732 141
955 3300005466 Ga0070685_10031017 Ga0070685_100310175 141
956 3300005535 Ga0070684_100233236 Ga0070684_1002332363 141
957 3300005535 Ga0070684_100488128 Ga0070684_1004881281 141
958 3300005539 Ga0068853_100238565 Ga0068853_1002385651 141
959 3300005543 Ga0070672_100002167 Ga0070672_10000216714 141
960 3300005543 Ga0070672_100443394 Ga0070672_1004433942 141
961 3300005544 Ga0070686_100090626 Ga0070686_1000906263 141
962 3300005545 Ga0070695_100379051 Ga0070695_1003790513 141
963 3300005564 Ga0070664_100533979 Ga0070664_1005339792 141
964 3300005564 Ga0070664_101093786 Ga0070664_1010937862 141
965 3300005578 Ga0068854_100056171 Ga0068854_1000561716 141
966 3300005614 Ga0068856_100151811 Ga0068856_1001518113 141
967 3300005615 Ga0070702_100174101 Ga0070702_1001741012 141
968 3300005615 Ga0070702_100180569 Ga0070702_1001805693 141
969 3300005616 Ga0068852_100002721 Ga0068852_1000027218 141
970 3300005616 Ga0068852_100390224 Ga0068852_1003902243 141
971 3300005616 Ga0068852_102375298 Ga0068852_1023752981 141
972 3300005617 Ga0068859_100200595 Ga0068859_1002005953 141
973 3300005618 Ga0068864_102156781 Ga0068864_1021567811 141
974 3300005718 Ga0068866_10876234 Ga0068866_108762341 141
975 3300005719 Ga0068861_100010271 Ga0068861_1000102713 141
976 3300005719 Ga0068861_100263512 Ga0068861_1002635122 141
977 3300005719 Ga0068861_100722917 Ga0068861_1007229172 141
978 3300005834 Ga0068851_10281691 Ga0068851_102816912 141
979 3300005834 Ga0068851_10373843 Ga0068851_103738432 141
980 3300005840 Ga0068870_10000658 Ga0068870_100006582 141
981 3300005840 Ga0068870_10133942 Ga0068870_101339422 141
982 3300005840 Ga0068870_10311956 Ga0068870_103119562 141
983 3300005842 Ga0068858_101461228 Ga0068858_1014612282 141
984 3300006038 Ga0075365_10010269 Ga0075365_100102692 141
985 3300006038 Ga0075365_10055583 Ga0075365_100555833 141
986 3300006038 Ga0075365_10092299 Ga0075365_100922992 141
987 3300006038 Ga0075365_10367365 Ga0075365_103673652 141
988 3300006038 Ga0075365_10531700 Ga0075365_105317002 141
989 3300006038 Ga0075365_10583801 Ga0075365_105838012 141
990 3300006038 Ga0075365_10766065 Ga0075365_107660651 141
991 3300006038 Ga0075365_11057997 Ga0075365_110579971 141
992 3300006042 Ga0075368_10135573 Ga0075368_101355732 141
993 3300006042 Ga0075368_10208070 Ga0075368_102080702 141
994 3300006048 Ga0075363_100109106 Ga0075363_1001091063 141
995 3300006048 Ga0075363_100398529 Ga0075363_1003985292 141
996 3300006048 Ga0075363_100671169 Ga0075363_1006711691 141
997 3300006051 Ga0075364_10191422 Ga0075364_101914222 141
998 3300006051 Ga0075364_10661179 Ga0075364_106611792 141
999 3300006178 Ga0075367_10025786 Ga0075367_100257863 141
1000 3300006178 Ga0075367_10210578 Ga0075367_102105782 141
1001 3300006178 Ga0075367_10504682 Ga0075367_105046822 141
1002 3300006178 Ga0075367_10567774 Ga0075367_105677741 141
1003 3300006353 Ga0075370_10064412 Ga0075370_100644123 141
1004 3300006353 Ga0075370_10489840 Ga0075370_104898402 141
1005 3300006353 Ga0075370_10592138 Ga0075370_105921381 141
1006 3300006358 Ga0068871_100785931 Ga0068871_1007859312 141
1007 3300006844 Ga0075428_101361031 Ga0075428_1013610312 141
1008 3300006880 Ga0075429_100528534 Ga0075429_1005285343 141
1009 3300006881 Ga0068865_100006802 Ga0068865_1000068022 141
1010 3300006914 Ga0075436_100652178 Ga0075436_1006521782 141
1011 3300006931 Ga0097620_100200581 Ga0097620_1002005813 141
1012 3300007076 Ga0075435_101429881 Ga0075435_1014298812 141
1013 3300009094 Ga0111539_10358791 Ga0111539_103587913 141
1014 3300009094 Ga0111539_10587947 Ga0111539_105879472 141
1015 3300009094 Ga0111539_11278138 Ga0111539_112781382 141
1016 3300009094 Ga0111539_11716575 Ga0111539_117165752 141
1017 3300009098 Ga0105245_10714775 Ga0105245_107147752 141
1018 3300009098 Ga0105245_11140965 Ga0105245_111409652 141
1019 3300009098 Ga0105245_13039075 Ga0105245_130390751 141
1020 3300009101 Ga0105247_10303636 Ga0105247_103036362 141
1021 3300009101 Ga0105247_10928075 Ga0105247_109280752 141
1022 3300009148 Ga0105243_10002648 Ga0105243_1000264813 141
1023 3300009148 Ga0105243_11055573 Ga0105243_110555732 141
1024 3300009176 Ga0105242_10338520 Ga0105242_103385202 141
1025 3300009177 Ga0105248_10173273 Ga0105248_101732734 141
1026 3300009551 Ga0105238_10755879 Ga0105238_107558792 141
1027 3300009551 Ga0105238_11413781 Ga0105238_114137812 141
1028 3300009553 Ga0105249_10106364 Ga0105249_101063642 141
1029 3300010375 Ga0105239_11514235 Ga0105239_115142351 141
1030 3300011119 Ga0105246_10595867 Ga0105246_105958672 141
1031 3300011119 Ga0105246_11057755 Ga0105246_110577552 141
1032 3300013104 Ga0157370_10414908 Ga0157370_104149081 141
1033 3300013104 Ga0157370_10476036 Ga0157370_104760363 141
1034 3300013104 Ga0157370_10677002 Ga0157370_106770022 141
1035 3300013105 Ga0157369_10748908 Ga0157369_107489082 141
1036 3300013306 Ga0163162_10687283 Ga0163162_106872833 141
1037 3300013307 Ga0157372_10233202 Ga0157372_102332023 141
1038 3300013307 Ga0157372_10886991 Ga0157372_108869912 141
1039 3300013308 Ga0157375_10956945 Ga0157375_109569452 141
1040 3300013308 Ga0157375_11020196 Ga0157375_110201962 141
1041 3300014325 Ga0163163_10273182 Ga0163163_102731822 141
1042 3300014325 Ga0163163_10615159 Ga0163163_106151593 141
1043 3300014325 Ga0163163_11712571 Ga0163163_117125711 141
1044 3300014326 Ga0157380_10037515 Ga0157380_100375155 141
1045 3300014326 Ga0157380_10312725 Ga0157380_103127253 141
1046 3300014745 Ga0157377_10073460 Ga0157377_100734602 141
1047 3300014969 Ga0157376_10385576 Ga0157376_103855762 141
1048 3300014969 Ga0157376_11234222 Ga0157376_112342222 141
1049 3300017792 Ga0163161_10345769 Ga0163161_103457693 141
1050 3300017792 Ga0163161_10470460 Ga0163161_104704602 141
1051 3300020080 Ga0206350_11500533 Ga0206350_115005331 141
1052 3300020080 Ga0206350_11585932 Ga0206350_115859322 141
1053 3300020081 Ga0206354_10452849 Ga0206354_104528492 141
1054 3300020081 Ga0206354_10501550 Ga0206354_105015502 141
1055 3300020081 Ga0206354_10570029 Ga0206354_105700292 141
1056 3300022467 Ga0224712_10003451 Ga0224712_100034512 141
1057 3300025321 Ga0207656_10094901 Ga0207656_100949012 141
1058 3300025321 Ga0207656_10267857 Ga0207656_102678572 141
1059 3300025899 Ga0207642_10016301 Ga0207642_100163015 141
1060 3300025900 Ga0207710_10155554 Ga0207710_101555543 141
1061 3300025901 Ga0207688_10048546 Ga0207688_100485464 141
1062 3300025901 Ga0207688_10098689 Ga0207688_100986892 141
1063 3300025901 Ga0207688_10392964 Ga0207688_103929641 141
1064 3300025903 Ga0207680_10824931 Ga0207680_108249311 141
1065 3300025904 Ga0207647_10215247 Ga0207647_102152473 141
1066 3300025908 Ga0207643_10131737 Ga0207643_101317372 141
1067 3300025908 Ga0207643_10213357 Ga0207643_102133572 141
1068 3300025908 Ga0207643_10308427 Ga0207643_103084272 141
1069 3300025909 Ga0207705_10709473 Ga0207705_107094731 141
1070 3300025909 Ga0207705_10838842 Ga0207705_108388422 141
1071 3300025918 Ga0207662_10097436 Ga0207662_100974362 141
1072 3300025918 Ga0207662_10098352 Ga0207662_100983522 141
1073 3300025918 Ga0207662_10232937 Ga0207662_102329372 141
1074 3300025923 Ga0207681_10545666 Ga0207681_105456662 141
1075 3300025925 Ga0207650_10697896 Ga0207650_106978962 141
1076 3300025926 Ga0207659_10218769 Ga0207659_102187692 141
1077 3300025927 Ga0207687_10116619 Ga0207687_101166193 141
1078 3300025927 Ga0207687_10546324 Ga0207687_105463242 141
1079 3300025932 Ga0207690_10957684 Ga0207690_109576842 141
1080 3300025933 Ga0207706_10447768 Ga0207706_104477682 141
1081 3300025934 Ga0207686_10424045 Ga0207686_104240453 141
1082 3300025934 Ga0207686_10871285 Ga0207686_108712852 141
1083 3300025935 Ga0207709_10005029 Ga0207709_100050292 141
1084 3300025936 Ga0207670_10022974 Ga0207670_100229742 141
1085 3300025937 Ga0207669_10006873 Ga0207669_100068732 141
1086 3300025940 Ga0207691_10003431 Ga0207691_1000343119 141
1087 3300025941 Ga0207711_10062361 Ga0207711_100623613 141
1088 3300025942 Ga0207689_10271934 Ga0207689_102719342 141
1089 3300025942 Ga0207689_10496674 Ga0207689_104966742 141
1090 3300025944 Ga0207661_10238858 Ga0207661_102388582 141
1091 3300025944 Ga0207661_10371281 Ga0207661_103712812 141
1092 3300025944 Ga0207661_10433304 Ga0207661_104333042 141
1093 3300025945 Ga0207679_10232445 Ga0207679_102324453 141
1094 3300025960 Ga0207651_10840360 Ga0207651_108403602 141
1095 3300025961 Ga0207712_10295094 Ga0207712_102950942 141
1096 3300025972 Ga0207668_10963808 Ga0207668_109638082 141
1097 3300025981 Ga0207640_10194835 Ga0207640_101948352 141
1098 3300026023 Ga0207677_10260195 Ga0207677_102601952 141
1099 3300026023 Ga0207677_10897782 Ga0207677_108977822 141
1100 3300026035 Ga0207703_10858139 Ga0207703_108581392 141
1101 3300026041 Ga0207639_10547924 Ga0207639_105479242 141
1102 3300026067 Ga0207678_10236385 Ga0207678_102363853 141
1103 3300026067 Ga0207678_10402602 Ga0207678_104026022 141
1104 3300026067 Ga0207678_11349890 Ga0207678_113498901 141
1105 3300026075 Ga0207708_10002425 Ga0207708_1000242521 141
1106 3300026075 Ga0207708_10092514 Ga0207708_100925144 141
1107 3300026075 Ga0207708_10305175 Ga0207708_103051753 141
1108 3300026078 Ga0207702_10341668 Ga0207702_103416683 141
1109 3300026089 Ga0207648_10007281 Ga0207648_1000728113 141
1110 3300026089 Ga0207648_10491238 Ga0207648_104912383 141
1111 3300026095 Ga0207676_10370140 Ga0207676_103701402 141
1112 3300026116 Ga0207674_10234946 Ga0207674_102349462 141
1113 3300026118 Ga0207675_100003879 Ga0207675_10000387913 141
1114 3300026118 Ga0207675_100485601 Ga0207675_1004856012 141
1115 3300026118 Ga0207675_101069607 Ga0207675_1010696071 141
1116 3300026121 Ga0207683_10118248 Ga0207683_101182483 141
1117 3300026121 Ga0207683_11486503 Ga0207683_114865031 141
1118 3300026142 Ga0207698_10007471 Ga0207698_100074713 141
1119 3300026142 Ga0207698_10277773 Ga0207698_102777732 141
1120 3300026142 Ga0207698_10386897 Ga0207698_103868973 141
1121 3300027866 Ga0209813_10056987 Ga0209813_100569873 141
1122 3300027907 Ga0207428_10051104 Ga0207428_100511043 141
1123 3300029277 Ga0311001_1071007 Ga0311001_10710072 141
1124 3300030732 Ga0316176_1081384 Ga0316176_10813843 141
1125 3300030742 Ga0316183_1044482 Ga0316183_10444823 141
1126 3300031731 Ga0307405_10264638 Ga0307405_102646383 141
1127 3300031731 Ga0307405_10621457 Ga0307405_106214572 141
1128 3300031824 Ga0307413_10069421 Ga0307413_100694213 141
1129 3300031824 Ga0307413_10723827 Ga0307413_107238272 141
1130 3300031824 Ga0307413_10930263 Ga0307413_109302632 141
1131 3300031852 Ga0307410_10006052 Ga0307410_1000605210 141
1132 3300031852 Ga0307410_10097613 Ga0307410_100976132 141
1133 3300031852 Ga0307410_11011611 Ga0307410_110116112 141
1134 3300031901 Ga0307406_10152957 Ga0307406_101529573 141
1135 3300031901 Ga0307406_10373430 Ga0307406_103734302 141
1136 3300031903 Ga0307407_10013128 Ga0307407_100131283 141
1137 3300031903 Ga0307407_10451135 Ga0307407_104511352 141
1138 3300031911 Ga0307412_10235247 Ga0307412_102352472 141
1139 3300031911 Ga0307412_11004704 Ga0307412_110047041 141
1140 3300031995 Ga0307409_100004499 Ga0307409_1000044998 141
1141 3300031995 Ga0307409_100314031 Ga0307409_1003140312 141
1142 3300031995 Ga0307409_100386549 Ga0307409_1003865492 141
1143 3300031995 Ga0307409_100467801 Ga0307409_1004678011 141
1144 3300031995 Ga0307409_100493559 Ga0307409_1004935592 141
1145 3300031995 Ga0307409_100626279 Ga0307409_1006262792 141
1146 3300031995 Ga0307409_101333037 Ga0307409_1013330372 141
1147 3300032002 Ga0307416_100024263 Ga0307416_1000242634 141
1148 3300032002 Ga0307416_101473045 Ga0307416_1014730452 141
1149 3300032004 Ga0307414_10077373 Ga0307414_100773732 141
1150 3300032004 Ga0307414_10655907 Ga0307414_106559072 141
1151 3300032005 Ga0307411_10034009 Ga0307411_100340093 141
1152 3300032126 Ga0307415_100113612 Ga0307415_1001136123 141
1153 3300035242 Ga0373962_0073070 Ga0373962_0073070_167_601 141
1154 3300035691 Ga0373931_0097053 Ga0373931_0097053_598_1032 141
1155 3300037466 Ga0395898_0463154 Ga0395898_0463154_431_997 141
1156 3300041406 Ga0439439_0034120 Ga0439439_0034120_571_1026 141
1157 3300041410 Ga0439461_0081393 Ga0439461_0081393_94_549 141
1158 3300041443 Ga0451789_1155910 Ga0451789_1155910_268_717 141
1159 3300041443 Ga0451789_1213167 Ga0451789_1213167_89_523 141
1160 3300041445 Ga0451792_01584 Ga0451792_01584_108_557 141
1161 3300041452 Ga0451793_0939683 Ga0451793_0939683_33_470 141
1162 3300041453 Ga0451797_0843885 Ga0451797_0843885_26_451 141
1163 3300041453 Ga0451797_0868523 Ga0451797_0868523_48_497 141
1164 3300041458 Ga0451798_0514919 Ga0451798_0514919_80_505 141
1165 3300041460 Ga0451802_0804525 Ga0451802_0804525_91_525 141
1166 3300041486 Ga0451807_2362550 Ga0451807_2362550_70_495 141
1167 3300041492 Ga0451835_0543034 Ga0451835_0543034_16_456 141
1168 3300041492 Ga0451835_0604248 Ga0451835_0604248_159_593 141
1169 3300041494 Ga0451837_1843479 Ga0451837_1843479_63_491 141
1170 3300041496 Ga0451839_0171162 Ga0451839_0171162_154_612 141
1171 3300041498 Ga0451841_0318149 Ga0451841_0318149_35_484 141
1172 3300041498 Ga0451841_0744881 Ga0451841_0744881_88_528 141
1173 3300041507 Ga0451851_0981888 Ga0451851_0981888_162_611 141
1174 3300041509 Ga0451843_0076660 Ga0451843_0076660_89_538 141
1175 3300042007 Ga0439449_0077931 Ga0439449_0077931_237_662 141
1176 3300042014 Ga0439457_033137 Ga0439457_033137_478_933 141
1177 3300042015 Ga0439462_0084425 Ga0439462_0084425_31_465 141
1178 3300042122 Ga0450920_014777 Ga0450920_014777_956_1387 141
1179 3300042146 Ga0450907_011557 Ga0450907_011557_1010_1450 141
1180 3300042533 Ga0450901_027965 Ga0450901_027965_153_602 141
1181 3300044765 Ga0466970_0340870 Ga0466970_0340870_255_755 141
1182 3300044901 Ga0466960_0194225 Ga0466960_0194225_155_655 141
1183 3300044901 Ga0466960_0505297 Ga0466960_0505297_127_570 141
1184 3300046515 Ga0495620_0049001 Ga0495620_0049001_753_1178 141
1185 3300048904 Ga0496101_0085853 Ga0496101_0085853_19_453 141
1186 3300048904 Ga0496101_0588301 Ga0496101_0588301_238_678 141
1187 3300048906 Ga0496103_0170212 Ga0496103_0170212_884_1318 141
1188 3300048908 Ga0496105_0367810 Ga0496105_0367810_473_907 141
1189 3300048911 Ga0496108_0177302 Ga0496108_0177302_485_919 141
1190 3300048911 Ga0496108_0225093 Ga0496108_0225093_233_667 141
1191 3300048912 Ga0496109_0025845 Ga0496109_0025845_4718_5152 141
1192 3300048912 Ga0496109_0426755 Ga0496109_0426755_732_1166 141
1193 3300048913 Ga0496110_0607993 Ga0496110_0607993_111_545 141
1194 3300048913 Ga0496110_1733917 Ga0496110_1733917_52_495 141
1195 3300048914 Ga0496111_0620844 Ga0496111_0620844_200_634 141
1196 3300048914 Ga0496111_0870876 Ga0496111_0870876_186_617 141
1197 3300048914 Ga0496111_0881956 Ga0496111_0881956_30_464 141
1198 3300048917 Ga0496114_0297163 Ga0496114_0297163_775_1209 141
1199 3300048917 Ga0496114_0782312 Ga0496114_0782312_246_680 141
1200 3300048917 Ga0496114_1106458 Ga0496114_1106458_62_502 141
1201 3300048927 Ga0496124_0186718 Ga0496124_0186718_587_1162 141
1202 3300048927 Ga0496124_0596134 Ga0496124_0596134_18_443 141
1203 3300049127 Ga0501306_032117 Ga0501306_032117_236_682 141
1204 3300049128 Ga0501308_011000 Ga0501308_011000_534_983 141
1205 3300049128 Ga0501308_053802 Ga0501308_053802_124_549 141
1206 3300049129 Ga0501309_035097 Ga0501309_035097_43_468 141
1207 3300049160 Ga0501304_011121 Ga0501304_011121_27_452 141
1208 3300049161 Ga0501305_047739 Ga0501305_047739_10_435 141
1209 3300049162 Ga0501307_018749 Ga0501307_018749_385_831 141
1210 3300049162 Ga0501307_035776 Ga0501307_035776_94_543 141
1211 3300049514 Ga0501291_033669 Ga0501291_033669_438_863 141
1212 3300049527 Ga0501311_020635 Ga0501311_020635_420_845 141
1213 3300049527 Ga0501311_057329 Ga0501311_057329_27_488 141
1214 3300049527 Ga0501311_063885 Ga0501311_063885_78_524 141
1215 3300049528 Ga0501312_012450 Ga0501312_012450_636_1091 141
1216 3300049531 Ga0501315_003871 Ga0501315_003871_31_468 141
1217 3300049531 Ga0501315_043330 Ga0501315_043330_13_459 141
1218 3300049532 Ga0501316_005123 Ga0501316_005123_501_926 141
1219 3300049532 Ga0501316_006023 Ga0501316_006023_726_1181 141
1220 3300049533 Ga0501317_016411 Ga0501317_016411_310_771 141
1221 3300049533 Ga0501317_022777 Ga0501317_022777_94_519 141
1222 3300049534 Ga0501318_009977 Ga0501318_009977_87_530 141
1223 3300049534 Ga0501318_011256 Ga0501318_011256_217_642 141
1224 3300049534 Ga0501318_015961 Ga0501318_015961_241_696 141
1225 3300049534 Ga0501318_017620 Ga0501318_017620_329_790 141
1226 3300049534 Ga0501318_026542 Ga0501318_026542_79_525 141
1227 3300049535 Ga0501319_004999 Ga0501319_004999_52_501 141
1228 3300049537 Ga0501321_017738 Ga0501321_017738_318_779 141
1229 3300049537 Ga0501321_057389 Ga0501321_057389_14_451 141
1230 3300049537 Ga0501321_087213 Ga0501321_087213_55_480 141
1231 3300049538 Ga0501322_020039 Ga0501322_020039_84_509 141
1232 3300049539 Ga0501323_007363 Ga0501323_007363_759_1214 141
1233 3300049539 Ga0501323_090304 Ga0501323_090304_41_466 141
1234 3300049540 Ga0501324_004285 Ga0501324_004285_651_1100 141
1235 3300049540 Ga0501324_009947 Ga0501324_009947_12_437 141
1236 3300049568 Ga0501031_0633992 Ga0501031_0633992_211_657 141
1237 3300049572 Ga0501036_0093295 Ga0501036_0093295_480_923 141
1238 3300049572 Ga0501036_0149769 Ga0501036_0149769_561_989 141
1239 3300049574 Ga0501038_0647973 Ga0501038_0647973_103_531 141
1240 3300049575 Ga0501039_0154443 Ga0501039_0154443_996_1424 141
1241 3300049575 Ga0501039_0551151 Ga0501039_0551151_339_785 141
1242 3300049576 Ga0501040_0693455 Ga0501040_0693455_136_564 141
1243 3300049578 Ga0501042_0175282 Ga0501042_0175282_185_613 141
1244 3300049578 Ga0501042_0607176 Ga0501042_0607176_227_673 141
1245 3300049579 Ga0501043_0821173 Ga0501043_0821173_106_540 141
1246 3300049580 Ga0501046_0306352 Ga0501046_0306352_396_824 141
1247 3300049580 Ga0501046_0447426 Ga0501046_0447426_169_594 141
1248 3300049582 Ga0501048_0362904 Ga0501048_0362904_443_886 141
1249 3300049583 Ga0501067_0126611 Ga0501067_0126611_304_738 141
1250 3300049583 Ga0501067_0213221 Ga0501067_0213221_20_445 141
1251 3300049583 Ga0501067_0325791 Ga0501067_0325791_222_653 141
1252 3300049584 Ga0501068_0269761 Ga0501068_0269761_198_632 141
1253 3300049585 Ga0501069_0406557 Ga0501069_0406557_147_572 141
1254 3300049585 Ga0501069_0424210 Ga0501069_0424210_157_585 141
1255 3300049586 Ga0501070_0368123 Ga0501070_0368123_80_514 141
1256 3300049586 Ga0501070_0947726 Ga0501070_0947726_118_561 141
1257 3300049587 Ga0501071_1323468 Ga0501071_1323468_11_439 141
1258 3300049588 Ga0501072_0576215 Ga0501072_0576215_384_812 141
1259 3300049589 Ga0501073_0477798 Ga0501073_0477798_263_688 141
1260 3300049590 Ga0501074_0460916 Ga0501074_0460916_153_581 141
1261 3300049591 Ga0501075_0150308 Ga0501075_0150308_419_853 141
1262 3300049592 Ga0501076_0086238 Ga0501076_0086238_1464_1907 141
1263 3300049592 Ga0501076_0196834 Ga0501076_0196834_640_1242 141
1264 3300049592 Ga0501076_0630404 Ga0501076_0630404_354_782 141
1265 3300049592 Ga0501076_1135905 Ga0501076_1135905_18_464 141
1266 3300049593 Ga0501077_0549433 Ga0501077_0549433_186_614 141
1267 3300049593 Ga0501077_0752048 Ga0501077_0752048_144_578 141
1268 3300049704 Ga0501221_106772 Ga0501221_106772_88_537 141
1269 3300049742 Ga0501080_1336902 Ga0501080_1336902_113_559 141
1270 3300049823 Ga0501044_1297966 Ga0501044_1297966_79_507 141
1271 3300050490 nmdc:mga03n38_174315_c1 nmdc:mga03n38_174315_c1_59_493 141
1272 3300050490 nmdc:mga03n38_27461_c1 nmdc:mga03n38_27461_c1_964_1407 141
1273 3300050490 nmdc:mga03n38_46422_c1 nmdc:mga03n38_46422_c1_1205_1753 141
1274 3300050491 nmdc:mga00v17_180570_c1 nmdc:mga00v17_180570_c1_403_828 141
1275 3300050491 nmdc:mga00v17_188155_c1 nmdc:mga00v17_188155_c1_295_720 141
1276 3300050491 nmdc:mga00v17_47670_c1 nmdc:mga00v17_47670_c1_2065_2508 141
1277 3300050491 nmdc:mga00v17_78476_c1 nmdc:mga00v17_78476_c1_268_708 141
1278 3300050492 nmdc:mga0yw44_1197_c1 nmdc:mga0yw44_1197_c1_1389_1817 141
1279 3300050492 nmdc:mga0yw44_128443_c1 nmdc:mga0yw44_128443_c1_277_705 141
1280 3300050492 nmdc:mga0yw44_256929_c1 nmdc:mga0yw44_256929_c1_468_902 141
1281 3300050492 nmdc:mga0yw44_265539_c1 nmdc:mga0yw44_265539_c1_129_683 141
1282 3300050492 nmdc:mga0yw44_341012_c1 nmdc:mga0yw44_341012_c1_226_663 141
1283 3300050492 nmdc:mga0yw44_353326_c1 nmdc:mga0yw44_353326_c1_47_475 141
1284 3300050492 nmdc:mga0yw44_890186_c1 nmdc:mga0yw44_890186_c1_90_536 141
1285 3300050493 nmdc:mga0k408_305129_c1 nmdc:mga0k408_305129_c1_270_707 141
1286 3300050494 nmdc:mga06z11_1560_c1 nmdc:mga06z11_1560_c1_3470_4018 141
1287 3300050494 nmdc:mga06z11_336706_c1 nmdc:mga06z11_336706_c1_343_771 141
1288 3300050494 nmdc:mga06z11_63927_c1 nmdc:mga06z11_63927_c1_1328_1756 141
1289 3300050495 nmdc:mga04h51_137678_c1 nmdc:mga04h51_137678_c1_356_790 141
1290 3300050495 nmdc:mga04h51_24216_c1 nmdc:mga04h51_24216_c1_1290_1724 141
1291 3300050496 nmdc:mga07m45_201372_c1 nmdc:mga07m45_201372_c1_360_794 141
1292 3300050496 nmdc:mga07m45_227068_c1 nmdc:mga07m45_227068_c1_134_565 141
1293 3300050496 nmdc:mga07m45_2326_c1 nmdc:mga07m45_2326_c1_2406_2849 141
1294 3300050508 nmdc:mga09592_182190_c1 nmdc:mga09592_182190_c1_894_1328 141
1295 3300050511 nmdc:mga08y16_277154_c1 nmdc:mga08y16_277154_c1_1073_1501 141
1296 3300050511 nmdc:mga08y16_39303_c1 nmdc:mga08y16_39303_c1_3482_3916 141
1297 3300053083 Ga0495655_0075530 Ga0495655_0075530_16_444 141
1298 3300053096 Ga0500641_0050012 Ga0500641_0050012_595_1173 141
1299 3300053102 Ga0500554_027137 Ga0500554_027137_219_776 141
1300 3300053104 Ga0500556_0002190 Ga0500556_0002190_5358_5798 141
1301 3300053117 Ga0500593_000062 Ga0500593_000062_16275_16715 141
1302 3300053129 Ga0500628_015990 Ga0500628_015990_708_1148 141
1303 3300053129 Ga0500628_024032 Ga0500628_024032_467_901 141
1304 3300054114 Ga0501084_0242239 Ga0501084_0242239_329_757 141
1305 3300059505 Ga0587083_0114850 Ga0587083_0114850_98_544 141
1306 3300059652 Ga0587107_087927 Ga0587107_087927_47_496 141
1307 3300060346 Ga0587111_0245603 Ga0587111_0245603_56_484 141
1308 3300060353 Ga0501082_0220776 Ga0501082_0220776_616_1059 141
1309 3300061734 Ga0530510_0296722 Ga0530510_0296722_566_997 141
1310 3300061734 Ga0530510_0317011 Ga0530510_0317011_504_938 141
1311 3300020082 Ga0206353_10839177 Ga0206353_108391772 142
1312 3300031824 Ga0307413_11243746 Ga0307413_112437462 142
1313 3300044684 Ga0466966_0799946 Ga0466966_0799946_82_519 142
1314 3300044765 Ga0466970_0249866 Ga0466970_0249866_521_958 142
1315 3300049568 Ga0501031_0036192 Ga0501031_0036192_1031_1468 142
1316 3300049570 Ga0501033_0545457 Ga0501033_0545457_261_698 142
1317 3300049572 Ga0501036_0151978 Ga0501036_0151978_730_1167 142
1318 3300049573 Ga0501037_0160089 Ga0501037_0160089_865_1302 142
1319 3300049574 Ga0501038_0111224 Ga0501038_0111224_1352_1789 142
1320 3300049575 Ga0501039_0032214 Ga0501039_0032214_223_660 142
1321 3300049576 Ga0501040_0019721 Ga0501040_0019721_1532_1969 142
1322 3300049577 Ga0501041_0126746 Ga0501041_0126746_1103_1540 142
1323 3300049578 Ga0501042_0021479 Ga0501042_0021479_3847_4284 142
1324 3300049580 Ga0501046_0244733 Ga0501046_0244733_198_635 142
1325 3300049582 Ga0501048_0038252 Ga0501048_0038252_2776_3213 142
1326 3300049584 Ga0501068_0047352 Ga0501068_0047352_478_915 142
1327 3300049587 Ga0501071_0005948 Ga0501071_0005948_5805_6242 142
1328 3300049588 Ga0501072_0230228 Ga0501072_0230228_688_1125 142
1329 3300049590 Ga0501074_0014346 Ga0501074_0014346_5112_5549 142
1330 3300049591 Ga0501075_0017703 Ga0501075_0017703_229_666 142
1331 3300049592 Ga0501076_0007352 Ga0501076_0007352_2745_3182 142
1332 3300049741 Ga0501079_0305150 Ga0501079_0305150_504_941 142
1333 3300049744 Ga0501083_0134682 Ga0501083_0134682_693_1130 142
1334 3300049824 Ga0501045_0006942 Ga0501045_0006942_7161_7598 142
1335 3300061734 Ga0530510_0007003 Ga0530510_0007003_2242_2679 142
1336 3300005366 Ga0070659_100201752 Ga0070659_1002017523 143
1337 3300005530 Ga0070679_100047460 Ga0070679_1000474602 143
1338 3300020070 Ga0206356_10119586 Ga0206356_101195862 143
1339 3300020077 Ga0206351_10141909 Ga0206351_101419092 143
1340 3300020080 Ga0206350_10669679 Ga0206350_106696792 143
1341 3300020082 Ga0206353_11489688 Ga0206353_114896882 143
1342 3300022467 Ga0224712_10244483 Ga0224712_102444832 143
1343 3300025932 Ga0207690_10105178 Ga0207690_101051782 143
1344 3300044901 Ga0466960_0002126 Ga0466960_0002126_6294_6731 143
1345 3300048910 Ga0496107_0555287 Ga0496107_0555287_305_745 143
1346 3300048913 Ga0496110_0280148 Ga0496110_0280148_841_1281 143
1347 3300049529 Ga0501313_047063 Ga0501313_047063_100_540 143
1348 3300005435 Ga0070714_100035855 Ga0070714_1000358553 144
1349 3300005530 Ga0070679_101640550 Ga0070679_1016405501 144
1350 3300020082 Ga0206353_11872656 Ga0206353_118726562 144
1351 3300022467 Ga0224712_10084624 Ga0224712_100846243 144
1352 3300025929 Ga0207664_10030840 Ga0207664_100308403 144
1353 3300026142 Ga0207698_11242847 Ga0207698_112428472 144
1354 3300044656 Ga0466969_0150416 Ga0466969_0150416_109_558 144
1355 3300044658 Ga0466972_0340407 Ga0466972_0340407_225_674 144
1356 3300044683 Ga0466965_0118162 Ga0466965_0118162_391_840 144
1357 3300044684 Ga0466966_0060595 Ga0466966_0060595_314_763 144
1358 3300044693 Ga0466961_0089772 Ga0466961_0089772_1255_1704 144
1359 3300044694 Ga0466963_0047188 Ga0466963_0047188_66_515 144
1360 3300044706 Ga0466964_0054135 Ga0466964_0054135_628_1077 144
1361 3300044719 Ga0466971_0128689 Ga0466971_0128689_660_1109 144
1362 3300044735 Ga0466968_0141573 Ga0466968_0141573_485_934 144
1363 3300044765 Ga0466970_0589172 Ga0466970_0589172_110_559 144
1364 3300044842 Ga0466957_0171478 Ga0466957_0171478_735_1184 144
1365 3300044901 Ga0466960_0744016 Ga0466960_0744016_110_559 144
1366 3300045049 Ga0466959_0940213 Ga0466959_0940213_69_518 144
1367 3300045976 Ga0466967_0048014 Ga0466967_0048014_1881_2330 144
1368 3300061719 Ga0466962_0105375 Ga0466962_0105375_564_1013 144
1369 3300000549 LJQas_1001376 LJQas_10013762 145
1370 3300026116 Ga0207674_10730133 Ga0207674_107301332 145
1371 3300031852 Ga0307410_10528526 Ga0307410_105285261 145
1372 3300031903 Ga0307407_10163621 Ga0307407_101636212 145
1373 3300031911 Ga0307412_11905643 Ga0307412_119056432 145
1374 3300032002 Ga0307416_100127884 Ga0307416_1001278842 145
1375 3300032002 Ga0307416_100365132 Ga0307416_1003651322 145
1376 3300032005 Ga0307411_10134877 Ga0307411_101348773 145
1377 3300032126 Ga0307415_100030696 Ga0307415_1000306965 145
1378 3300032126 Ga0307415_100199168 Ga0307415_1001991683 145
1379 3300049127 Ga0501306_024872 Ga0501306_024872_30_467 145
1380 3300049128 Ga0501308_004488 Ga0501308_004488_365_802 145
1381 3300049129 Ga0501309_031341 Ga0501309_031341_289_726 145
1382 3300049129 Ga0501309_070980 Ga0501309_070980_84_521 145
1383 3300049130 Ga0501310_000840 Ga0501310_000840_70_507 145
1384 3300049160 Ga0501304_014118 Ga0501304_014118_51_488 145
1385 3300049160 Ga0501304_031867 Ga0501304_031867_38_475 145
1386 3300049162 Ga0501307_067857 Ga0501307_067857_41_478 145
1387 3300049527 Ga0501311_014637 Ga0501311_014637_248_685 145
1388 3300049527 Ga0501311_056571 Ga0501311_056571_105_542 145
1389 3300049531 Ga0501315_005704 Ga0501315_005704_871_1308 145
1390 3300049532 Ga0501316_002526 Ga0501316_002526_249_686 145
1391 3300049533 Ga0501317_017641 Ga0501317_017641_46_483 145
1392 3300049534 Ga0501318_060076 Ga0501318_060076_28_465 145
1393 3300049536 Ga0501320_053954 Ga0501320_053954_66_503 145
1394 3300049537 Ga0501321_000884 Ga0501321_000884_1261_1698 145
1395 3300049537 Ga0501321_006614 Ga0501321_006614_168_605 145
1396 3300049538 Ga0501322_001402 Ga0501322_001402_566_1003 145
1397 3300049538 Ga0501322_029904 Ga0501322_029904_48_485 145
1398 3300049539 Ga0501323_028255 Ga0501323_028255_44_481 145
1399 3300049540 Ga0501324_011807 Ga0501324_011807_313_750 145
1400 3300049540 Ga0501324_024618 Ga0501324_024618_34_471 145
1401 3300049541 Ga0501325_005144 Ga0501325_005144_423_860 145
1402 3300049549 Ga0501333_004428 Ga0501333_004428_405_842 145
1403 3300049556 Ga0501340_022921 Ga0501340_022921_43_480 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

22

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9665 22 128
8c9a-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9622 23 128
8c95-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9607 22 128
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9513 23 129
8c8z-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9472 22 128
ID Description Score Start End Superfamily
af_I1K1P2_86_208_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9208 22 129 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9195 22 129 3.90.470.10
af_Q9XX18_90_260_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8968 22 129 3.90.470.10
af_A0A0P0YAA5_35_146_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8947 22 129 3.90.470.10
af_Q4DYB8_108_251_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8892 19 129 3.90.470.10
ID Description Score Start End GO Terms
AF-A0A2W2CZW6-F1-model_v4 Large ribosomal subunit protein uL22 0.9256 20 129 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A7W7SNW7-F1-model_v4 Large ribosomal subunit protein uL22 0.9252 20 129 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-B2UMT4-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.9252 22 131 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A846ZTR3-F1-model_v4 Large ribosomal subunit protein uL22 0.9252 22 129 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A6J7L4Z0-F1-model_v4 Unannotated protein 0.925 22 128 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
82.83 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map