F493695
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1403 | 464 | 1383 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0550917|Ga0466960_0550917_58_477 |
| Length | 128 |
| Sequence | MERKQVSARRESLLGDEPGAFASARFVRVTPQKARRVVELVRGQAVEDALNILRFALASAVANAETTEGLDAGSLVVTKAMVDEGPTIKRWRARAQGRAARINKRTSHITLVVQPRANQDSTKKGRNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 2 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 3 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 4 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 8 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 9 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 10 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 11 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 12 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 13 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 14 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 15 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 16 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 17 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 18 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 19 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 20 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 32 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 124 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 125 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 208 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 209 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 210 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 225 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 248 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 249 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 256 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 257 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 258 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 259 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 260 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 261 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 262 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 265 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 268 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 269 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 270 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 271 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 277 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 391 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 392 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 393 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 394 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 395 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 424 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 427 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 430 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 431 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 463 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 464 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.69 |
| Metatranscriptomes | 19.89 |
| Isolates | 1.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 7.77 |
| Nodule | 0.07 |
| Rhizoplane | 7.27 |
| Rhizosphere | 82.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001376 | 3300000549 | Bacteria | 3649 |
| 2 | LJQas_1009377 | 3300000549 | Bacteria | 1179 |
| 3 | JGI24739J22299_10012134 | 3300001989 | Bacteria | 3164 |
| 4 | JGI24739J22299_10014413 | 3300001989 | Bacteria | 2877 |
| 5 | JGI24738J21930_10001633 | 3300002075 | Bacteria | 6156 |
| 6 | Ga0006778J45830_1047560 | 3300003162 | Bacteria | 860 |
| 7 | Ga0006759J45824_1024389 | 3300003163 | Bacteria | 1435 |
| 8 | Ga0006758J48902_1015472 | 3300003300 | Bacteria | 914 |
| 9 | Ga0006777J48905_1052029 | 3300003308 | Bacteria | 854 |
| 10 | JGI25407J50210_10009484 | 3300003373 | Bacteria | 2467 |
| 11 | Ga0006781J51513_1021454 | 3300003568 | Bacteria | 793 |
| 12 | Ga0007410J51695_1013323 | 3300003574 | Bacteria | 1815 |
| 13 | Ga0007416J51690_1025482 | 3300003577 | Bacteria | 955 |
| 14 | Ga0006562J51391_1055045 | 3300003578 | Bacteria | 1030 |
| 15 | Ga0007429J51699_1020720 | 3300003579 | Bacteria | 767 |
| 16 | Ga0032354_1008083 | 3300003693 | Bacteria | 1937 |
| 17 | JGI25405J52794_10045114 | 3300003911 | Bacteria | 938 |
| 18 | Ga0070658_10480236 | 3300005327 | Bacteria | 1072 |
| 19 | Ga0070676_11338978 | 3300005328 | Bacteria | 548 |
| 20 | Ga0070683_100060577 | 3300005329 | Bacteria | 3518 |
| 21 | Ga0070683_100173735 | 3300005329 | Bacteria | 2045 |
| 22 | Ga0070683_100429471 | 3300005329 | Bacteria | 1260 |
| 23 | Ga0070683_100553072 | 3300005329 | Bacteria | 1100 |
| 24 | Ga0070683_100716249 | 3300005329 | Bacteria | 959 |
| 25 | Ga0070683_101995586 | 3300005329 | Bacteria | 557 |
| 26 | Ga0070670_100520023 | 3300005331 | Bacteria | 1060 |
| 27 | Ga0070677_10477532 | 3300005333 | Bacteria | 672 |
| 28 | Ga0068869_100441035 | 3300005334 | Bacteria | 1078 |
| 29 | Ga0068869_100569559 | 3300005334 | Bacteria | 954 |
| 30 | Ga0070682_100028438 | 3300005337 | Bacteria | 3362 |
| 31 | Ga0070682_100114772 | 3300005337 | Bacteria | 1800 |
| 32 | Ga0070682_100508901 | 3300005337 | Bacteria | 934 |
| 33 | Ga0070682_101034634 | 3300005337 | Bacteria | 684 |
| 34 | Ga0068868_100096107 | 3300005338 | Bacteria | 2392 |
| 35 | Ga0068868_100945443 | 3300005338 | Bacteria | 786 |
| 36 | Ga0068868_101154441 | 3300005338 | Bacteria | 714 |
| 37 | Ga0068868_101665381 | 3300005338 | Bacteria | 600 |
| 38 | Ga0068868_101952144 | 3300005338 | Bacteria | 556 |
| 39 | Ga0070660_100136216 | 3300005339 | Bacteria | 1967 |
| 40 | Ga0070660_100917798 | 3300005339 | Bacteria | 739 |
| 41 | Ga0070689_100181515 | 3300005340 | Bacteria | 1709 |
| 42 | Ga0070689_100605206 | 3300005340 | Bacteria | 949 |
| 43 | Ga0070691_10169444 | 3300005341 | Bacteria | 1130 |
| 44 | Ga0070687_100135823 | 3300005343 | Bacteria | 1426 |
| 45 | Ga0070661_100265186 | 3300005344 | Bacteria | 1329 |
| 46 | Ga0070692_10109517 | 3300005345 | Bacteria | 1525 |
| 47 | Ga0070668_100884440 | 3300005347 | Bacteria | 798 |
| 48 | Ga0070668_101044808 | 3300005347 | Bacteria | 735 |
| 49 | Ga0070675_100218333 | 3300005354 | Bacteria | 1660 |
| 50 | Ga0070675_100389616 | 3300005354 | Bacteria | 1241 |
| 51 | Ga0070675_101852128 | 3300005354 | Bacteria | 557 |
| 52 | Ga0070671_100289249 | 3300005355 | Bacteria | 1394 |
| 53 | Ga0070674_100067586 | 3300005356 | Bacteria | 2514 |
| 54 | Ga0070674_100137963 | 3300005356 | Bacteria | 1827 |
| 55 | Ga0070674_100961039 | 3300005356 | Bacteria | 747 |
| 56 | Ga0070674_101626818 | 3300005356 | Bacteria | 583 |
| 57 | Ga0070673_100364268 | 3300005364 | Bacteria | 1286 |
| 58 | Ga0070673_100768922 | 3300005364 | Bacteria | 888 |
| 59 | Ga0070688_100155630 | 3300005365 | Bacteria | 1566 |
| 60 | Ga0070688_101431845 | 3300005365 | Bacteria | 561 |
| 61 | Ga0070659_100201752 | 3300005366 | Bacteria | 1637 |
| 62 | Ga0070659_100325951 | 3300005366 | Bacteria | 1284 |
| 63 | Ga0070659_100565211 | 3300005366 | Bacteria | 975 |
| 64 | Ga0070659_100652320 | 3300005366 | Bacteria | 907 |
| 65 | Ga0070667_101470267 | 3300005367 | Bacteria | 640 |
| 66 | Ga0070667_101672116 | 3300005367 | Bacteria | 599 |
| 67 | Ga0070714_100035855 | 3300005435 | Bacteria | 4158 |
| 68 | Ga0070701_10001181 | 3300005438 | Bacteria | 9570 |
| 69 | Ga0070701_10678506 | 3300005438 | Bacteria | 691 |
| 70 | Ga0070700_100057255 | 3300005441 | Bacteria | 2446 |
| 71 | Ga0070700_100074940 | 3300005441 | Bacteria | 2169 |
| 72 | Ga0070700_100450102 | 3300005441 | Bacteria | 980 |
| 73 | Ga0070700_100949038 | 3300005441 | Bacteria | 704 |
| 74 | Ga0070663_100240209 | 3300005455 | Bacteria | 1429 |
| 75 | Ga0070663_100273521 | 3300005455 | Bacteria | 1344 |
| 76 | Ga0070663_100547854 | 3300005455 | Bacteria | 966 |
| 77 | Ga0070663_100732829 | 3300005455 | Bacteria | 843 |
| 78 | Ga0070678_100132971 | 3300005456 | Bacteria | 1979 |
| 79 | Ga0070678_100592950 | 3300005456 | Bacteria | 988 |
| 80 | Ga0070678_101599401 | 3300005456 | Bacteria | 612 |
| 81 | Ga0070678_101748240 | 3300005456 | Bacteria | 586 |
| 82 | Ga0070662_100541549 | 3300005457 | Bacteria | 975 |
| 83 | Ga0068867_100201481 | 3300005459 | Bacteria | 1593 |
| 84 | Ga0068867_100239173 | 3300005459 | Bacteria | 1472 |
| 85 | Ga0068867_100546679 | 3300005459 | Bacteria | 1002 |
| 86 | Ga0070685_10031017 | 3300005466 | Bacteria | 2983 |
| 87 | Ga0070685_10344036 | 3300005466 | Bacteria | 1018 |
| 88 | Ga0070698_100055313 | 3300005471 | Bacteria | 4025 |
| 89 | Ga0070698_100392494 | 3300005471 | Bacteria | 1321 |
| 90 | Ga0070679_100047460 | 3300005530 | Bacteria | 4280 |
| 91 | Ga0070679_100800880 | 3300005530 | Bacteria | 885 |
| 92 | Ga0070679_101123339 | 3300005530 | Bacteria | 731 |
| 93 | Ga0070679_101640550 | 3300005530 | Bacteria | 591 |
| 94 | Ga0070684_100233236 | 3300005535 | Bacteria | 1680 |
| 95 | Ga0070684_100488128 | 3300005535 | Bacteria | 1140 |
| 96 | Ga0070684_101232972 | 3300005535 | Bacteria | 704 |
| 97 | Ga0068853_100074811 | 3300005539 | Bacteria | 2955 |
| 98 | Ga0068853_100238565 | 3300005539 | Bacteria | 1666 |
| 99 | Ga0068853_100589051 | 3300005539 | Bacteria | 1056 |
| 100 | Ga0070672_100002167 | 3300005543 | Bacteria | 12376 |
| 101 | Ga0070672_100113206 | 3300005543 | Bacteria | 2214 |
| 102 | Ga0070672_100443394 | 3300005543 | Bacteria | 1117 |
| 103 | Ga0070672_101066108 | 3300005543 | Bacteria | 717 |
| 104 | Ga0070686_100090626 | 3300005544 | Bacteria | 2044 |
| 105 | Ga0070695_100379051 | 3300005545 | Bacteria | 1067 |
| 106 | Ga0070693_100526403 | 3300005547 | Bacteria | 842 |
| 107 | Ga0070693_100595312 | 3300005547 | Bacteria | 797 |
| 108 | Ga0070693_100889347 | 3300005547 | Bacteria | 667 |
| 109 | Ga0070665_100204381 | 3300005548 | Bacteria | 1976 |
| 110 | Ga0070664_100029753 | 3300005564 | Bacteria | 4554 |
| 111 | Ga0070664_100533979 | 3300005564 | Bacteria | 1084 |
| 112 | Ga0070664_101093786 | 3300005564 | Bacteria | 751 |
| 113 | Ga0068857_100101060 | 3300005577 | Bacteria | 2587 |
| 114 | Ga0068857_100556843 | 3300005577 | Bacteria | 1081 |
| 115 | Ga0068857_101230025 | 3300005577 | Bacteria | 726 |
| 116 | Ga0068854_100056171 | 3300005578 | Bacteria | 2837 |
| 117 | Ga0068856_100151811 | 3300005614 | Bacteria | 2325 |
| 118 | Ga0068856_100881930 | 3300005614 | Bacteria | 914 |
| 119 | Ga0070702_100073205 | 3300005615 | Bacteria | 2029 |
| 120 | Ga0070702_100174101 | 3300005615 | Bacteria | 1402 |
| 121 | Ga0070702_100180569 | 3300005615 | Bacteria | 1380 |
| 122 | Ga0068852_100002721 | 3300005616 | Bacteria | 12219 |
| 123 | Ga0068852_100390224 | 3300005616 | Bacteria | 1367 |
| 124 | Ga0068852_100789024 | 3300005616 | Bacteria | 963 |
| 125 | Ga0068852_102375298 | 3300005616 | Bacteria | 551 |
| 126 | Ga0068859_100200595 | 3300005617 | Bacteria | 2080 |
| 127 | Ga0068864_102156781 | 3300005618 | Bacteria | 564 |
| 128 | Ga0068866_10262124 | 3300005718 | Bacteria | 1063 |
| 129 | Ga0068866_10876234 | 3300005718 | Bacteria | 630 |
| 130 | Ga0068861_100010271 | 3300005719 | Bacteria | 6499 |
| 131 | Ga0068861_100263512 | 3300005719 | Bacteria | 1476 |
| 132 | Ga0068861_100722917 | 3300005719 | Bacteria | 927 |
| 133 | Ga0068851_10281691 | 3300005834 | Bacteria | 951 |
| 134 | Ga0068851_10373843 | 3300005834 | Bacteria | 834 |
| 135 | Ga0068870_10000658 | 3300005840 | Bacteria | 13168 |
| 136 | Ga0068870_10133942 | 3300005840 | Bacteria | 1442 |
| 137 | Ga0068870_10311956 | 3300005840 | Bacteria | 996 |
| 138 | Ga0068870_10444300 | 3300005840 | Bacteria | 853 |
| 139 | Ga0068858_100764730 | 3300005842 | Bacteria | 942 |
| 140 | Ga0068858_101461228 | 3300005842 | Bacteria | 674 |
| 141 | Ga0068860_100021208 | 3300005843 | Bacteria | 6294 |
| 142 | Ga0068860_100751614 | 3300005843 | Bacteria | 987 |
| 143 | Ga0081455_10000409 | 3300005937 | Bacteria | 56312 |
| 144 | Ga0081455_10009428 | 3300005937 | Bacteria | 10043 |
| 145 | Ga0081455_10104192 | 3300005937 | Bacteria | 2270 |
| 146 | Ga0081538_10000088 | 3300005981 | Bacteria | 88922 |
| 147 | Ga0081538_10038576 | 3300005981 | Bacteria | 3079 |
| 148 | Ga0075365_10010269 | 3300006038 | Bacteria | 5441 |
| 149 | Ga0075365_10055583 | 3300006038 | Bacteria | 2628 |
| 150 | Ga0075365_10092299 | 3300006038 | Bacteria | 2064 |
| 151 | Ga0075365_10146997 | 3300006038 | Bacteria | 1638 |
| 152 | Ga0075365_10179443 | 3300006038 | Bacteria | 1480 |
| 153 | Ga0075365_10181107 | 3300006038 | Bacteria | 1473 |
| 154 | Ga0075365_10211303 | 3300006038 | Bacteria | 1360 |
| 155 | Ga0075365_10367365 | 3300006038 | Bacteria | 1014 |
| 156 | Ga0075365_10531700 | 3300006038 | Bacteria | 831 |
| 157 | Ga0075365_10565233 | 3300006038 | Bacteria | 804 |
| 158 | Ga0075365_10583801 | 3300006038 | Bacteria | 790 |
| 159 | Ga0075365_10633990 | 3300006038 | Bacteria | 755 |
| 160 | Ga0075365_10766065 | 3300006038 | Bacteria | 681 |
| 161 | Ga0075365_11057997 | 3300006038 | Bacteria | 571 |
| 162 | Ga0075368_10001331 | 3300006042 | Bacteria | 7845 |
| 163 | Ga0075368_10057698 | 3300006042 | Bacteria | 1550 |
| 164 | Ga0075368_10102200 | 3300006042 | Bacteria | 1178 |
| 165 | Ga0075368_10135573 | 3300006042 | Bacteria | 1025 |
| 166 | Ga0075368_10208070 | 3300006042 | Bacteria | 829 |
| 167 | Ga0075363_100035386 | 3300006048 | Bacteria | 2613 |
| 168 | Ga0075363_100041533 | 3300006048 | Bacteria | 2426 |
| 169 | Ga0075363_100109106 | 3300006048 | Bacteria | 1537 |
| 170 | Ga0075363_100124271 | 3300006048 | Bacteria | 1443 |
| 171 | Ga0075363_100237441 | 3300006048 | Bacteria | 1047 |
| 172 | Ga0075363_100398529 | 3300006048 | Bacteria | 809 |
| 173 | Ga0075363_100671169 | 3300006048 | Bacteria | 624 |
| 174 | Ga0075364_10046975 | 3300006051 | Bacteria | 2811 |
| 175 | Ga0075364_10171268 | 3300006051 | Bacteria | 1468 |
| 176 | Ga0075364_10191422 | 3300006051 | Bacteria | 1385 |
| 177 | Ga0075364_10261514 | 3300006051 | Bacteria | 1176 |
| 178 | Ga0075364_10644615 | 3300006051 | Bacteria | 723 |
| 179 | Ga0075364_10661179 | 3300006051 | Bacteria | 713 |
| 180 | Ga0075362_10026928 | 3300006177 | Bacteria | 2459 |
| 181 | Ga0075367_10025786 | 3300006178 | Bacteria | 3327 |
| 182 | Ga0075367_10029487 | 3300006178 | Bacteria | 3139 |
| 183 | Ga0075367_10041821 | 3300006178 | Bacteria | 2680 |
| 184 | Ga0075367_10210578 | 3300006178 | Bacteria | 1215 |
| 185 | Ga0075367_10412588 | 3300006178 | Bacteria | 854 |
| 186 | Ga0075367_10504682 | 3300006178 | Bacteria | 767 |
| 187 | Ga0075367_10567774 | 3300006178 | Bacteria | 721 |
| 188 | Ga0075369_10048911 | 3300006186 | Bacteria | 1826 |
| 189 | Ga0097621_101652236 | 3300006237 | Bacteria | 609 |
| 190 | Ga0075370_10064412 | 3300006353 | Bacteria | 2090 |
| 191 | Ga0075370_10171740 | 3300006353 | Bacteria | 1274 |
| 192 | Ga0075370_10189229 | 3300006353 | Bacteria | 1212 |
| 193 | Ga0075370_10217143 | 3300006353 | Bacteria | 1130 |
| 194 | Ga0075370_10236513 | 3300006353 | Bacteria | 1081 |
| 195 | Ga0075370_10489840 | 3300006353 | Bacteria | 741 |
| 196 | Ga0075370_10585152 | 3300006353 | Bacteria | 676 |
| 197 | Ga0075370_10592138 | 3300006353 | Bacteria | 672 |
| 198 | Ga0068871_100785931 | 3300006358 | Bacteria | 877 |
| 199 | Ga0075428_100002072 | 3300006844 | Bacteria | 21635 |
| 200 | Ga0075428_101361031 | 3300006844 | Bacteria | 746 |
| 201 | Ga0075430_100005226 | 3300006846 | Bacteria | 10945 |
| 202 | Ga0075430_100080440 | 3300006846 | Bacteria | 2730 |
| 203 | Ga0075431_100001734 | 3300006847 | Bacteria | 20513 |
| 204 | Ga0075431_100004313 | 3300006847 | Bacteria | 13937 |
| 205 | Ga0075431_100038721 | 3300006847 | Bacteria | 4911 |
| 206 | Ga0075433_10641029 | 3300006852 | Bacteria | 932 |
| 207 | Ga0075434_101862647 | 3300006871 | Bacteria | 608 |
| 208 | Ga0075429_100006773 | 3300006880 | Bacteria | 9938 |
| 209 | Ga0075429_100017134 | 3300006880 | Bacteria | 6265 |
| 210 | Ga0075429_100528534 | 3300006880 | Bacteria | 1034 |
| 211 | Ga0068865_100006802 | 3300006881 | Bacteria | 7000 |
| 212 | Ga0068865_100246657 | 3300006881 | Bacteria | 1408 |
| 213 | Ga0075436_100652178 | 3300006914 | Bacteria | 778 |
| 214 | Ga0097620_100200581 | 3300006931 | Bacteria | 2080 |
| 215 | Ga0075435_101429881 | 3300007076 | Bacteria | 606 |
| 216 | Ga0105240_11894518 | 3300009093 | Bacteria | 620 |
| 217 | Ga0111539_10041331 | 3300009094 | Bacteria | 5544 |
| 218 | Ga0111539_10358791 | 3300009094 | Bacteria | 1696 |
| 219 | Ga0111539_10587947 | 3300009094 | Bacteria | 1296 |
| 220 | Ga0111539_10831785 | 3300009094 | Bacteria | 1074 |
| 221 | Ga0111539_11278138 | 3300009094 | Bacteria | 852 |
| 222 | Ga0111539_11541607 | 3300009094 | Bacteria | 771 |
| 223 | Ga0111539_11716575 | 3300009094 | Bacteria | 728 |
| 224 | Ga0105245_10533897 | 3300009098 | Bacteria | 1193 |
| 225 | Ga0105245_10714775 | 3300009098 | Bacteria | 1036 |
| 226 | Ga0105245_11140965 | 3300009098 | Bacteria | 826 |
| 227 | Ga0105245_11371206 | 3300009098 | Bacteria | 757 |
| 228 | Ga0105245_11444485 | 3300009098 | Bacteria | 738 |
| 229 | Ga0105245_13039075 | 3300009098 | Bacteria | 520 |
| 230 | Ga0105247_10303636 | 3300009101 | Bacteria | 1108 |
| 231 | Ga0105247_10551419 | 3300009101 | Bacteria | 848 |
| 232 | Ga0105247_10928075 | 3300009101 | Bacteria | 674 |
| 233 | Ga0114129_10000234 | 3300009147 | Bacteria | 61922 |
| 234 | Ga0114129_10006606 | 3300009147 | Bacteria | 16463 |
| 235 | Ga0105243_10002648 | 3300009148 | Bacteria | 14867 |
| 236 | Ga0105243_10126788 | 3300009148 | Bacteria | 2161 |
| 237 | Ga0105243_10581361 | 3300009148 | Bacteria | 1075 |
| 238 | Ga0105243_10635011 | 3300009148 | Bacteria | 1033 |
| 239 | Ga0105243_10747924 | 3300009148 | Bacteria | 958 |
| 240 | Ga0105243_10889462 | 3300009148 | Bacteria | 885 |
| 241 | Ga0105243_11016600 | 3300009148 | Bacteria | 832 |
| 242 | Ga0105243_11055573 | 3300009148 | Bacteria | 818 |
| 243 | Ga0105242_10336584 | 3300009176 | Bacteria | 1389 |
| 244 | Ga0105242_10338520 | 3300009176 | Bacteria | 1386 |
| 245 | Ga0105248_10173273 | 3300009177 | Bacteria | 2432 |
| 246 | Ga0105237_10852644 | 3300009545 | Bacteria | 918 |
| 247 | Ga0105238_10608358 | 3300009551 | Bacteria | 1101 |
| 248 | Ga0105238_10755879 | 3300009551 | Bacteria | 986 |
| 249 | Ga0105238_10757932 | 3300009551 | Bacteria | 985 |
| 250 | Ga0105238_11413781 | 3300009551 | Bacteria | 723 |
| 251 | Ga0105249_10033506 | 3300009553 | Bacteria | 4650 |
| 252 | Ga0105249_10106364 | 3300009553 | Bacteria | 2647 |
| 253 | Ga0105249_10640569 | 3300009553 | Bacteria | 1120 |
| 254 | Ga0105249_11426410 | 3300009553 | Bacteria | 764 |
| 255 | Ga0105239_10024787 | 3300010375 | Bacteria | 6608 |
| 256 | Ga0105239_11514235 | 3300010375 | Bacteria | 775 |
| 257 | Ga0105239_11517279 | 3300010375 | Bacteria | 774 |
| 258 | Ga0105246_10206720 | 3300011119 | Bacteria | 1530 |
| 259 | Ga0105246_10375976 | 3300011119 | Bacteria | 1172 |
| 260 | Ga0105246_10595867 | 3300011119 | Bacteria | 954 |
| 261 | Ga0105246_10693010 | 3300011119 | Bacteria | 892 |
| 262 | Ga0105246_11057755 | 3300011119 | Bacteria | 738 |
| 263 | Ga0157322_1015937 | 3300012490 | Bacteria | 675 |
| 264 | Ga0157341_1009388 | 3300012494 | Bacteria | 814 |
| 265 | Ga0157339_1017013 | 3300012505 | Bacteria | 734 |
| 266 | Ga0157371_10354275 | 3300013102 | Bacteria | 1069 |
| 267 | Ga0157371_10449972 | 3300013102 | Bacteria | 947 |
| 268 | Ga0157371_11320876 | 3300013102 | Bacteria | 558 |
| 269 | Ga0157370_10414908 | 3300013104 | Bacteria | 1239 |
| 270 | Ga0157370_10476036 | 3300013104 | Bacteria | 1147 |
| 271 | Ga0157370_10677002 | 3300013104 | Bacteria | 942 |
| 272 | Ga0157370_10813114 | 3300013104 | Bacteria | 850 |
| 273 | Ga0157369_10488777 | 3300013105 | Bacteria | 1274 |
| 274 | Ga0157369_10575182 | 3300013105 | Bacteria | 1164 |
| 275 | Ga0157369_10748908 | 3300013105 | Bacteria | 1005 |
| 276 | Ga0157369_10922309 | 3300013105 | Bacteria | 895 |
| 277 | Ga0157369_11007682 | 3300013105 | Bacteria | 853 |
| 278 | Ga0157369_11794246 | 3300013105 | Bacteria | 623 |
| 279 | Ga0157374_10693022 | 3300013296 | Bacteria | 1031 |
| 280 | Ga0157374_11254421 | 3300013296 | Bacteria | 763 |
| 281 | Ga0157378_10729055 | 3300013297 | Bacteria | 1012 |
| 282 | Ga0163162_10389264 | 3300013306 | Bacteria | 1527 |
| 283 | Ga0163162_10545019 | 3300013306 | Bacteria | 1288 |
| 284 | Ga0163162_10687283 | 3300013306 | Bacteria | 1145 |
| 285 | Ga0163162_11601871 | 3300013306 | Bacteria | 743 |
| 286 | Ga0163162_12638110 | 3300013306 | Bacteria | 578 |
| 287 | Ga0157372_10067801 | 3300013307 | Bacteria | 4010 |
| 288 | Ga0157372_10233202 | 3300013307 | Bacteria | 2134 |
| 289 | Ga0157372_10356926 | 3300013307 | Bacteria | 1703 |
| 290 | Ga0157372_10886991 | 3300013307 | Bacteria | 1035 |
| 291 | Ga0157372_11198389 | 3300013307 | Bacteria | 877 |
| 292 | Ga0157372_11750100 | 3300013307 | Bacteria | 715 |
| 293 | Ga0157375_10467033 | 3300013308 | Bacteria | 1427 |
| 294 | Ga0157375_10529730 | 3300013308 | Bacteria | 1341 |
| 295 | Ga0157375_10956945 | 3300013308 | Bacteria | 998 |
| 296 | Ga0157375_11020196 | 3300013308 | Bacteria | 966 |
| 297 | Ga0157375_11269252 | 3300013308 | Bacteria | 865 |
| 298 | Ga0157375_12831267 | 3300013308 | Bacteria | 580 |
| 299 | Ga0163163_10224420 | 3300014325 | Bacteria | 1928 |
| 300 | Ga0163163_10273182 | 3300014325 | Bacteria | 1741 |
| 301 | Ga0163163_10615159 | 3300014325 | Bacteria | 1150 |
| 302 | Ga0163163_11712571 | 3300014325 | Bacteria | 689 |
| 303 | Ga0163163_12094559 | 3300014325 | Bacteria | 625 |
| 304 | Ga0157380_10037515 | 3300014326 | Bacteria | 3755 |
| 305 | Ga0157380_10312725 | 3300014326 | Bacteria | 1452 |
| 306 | Ga0157380_10712475 | 3300014326 | Bacteria | 1010 |
| 307 | Ga0157380_10798099 | 3300014326 | Bacteria | 961 |
| 308 | Ga0157380_12082369 | 3300014326 | Bacteria | 630 |
| 309 | Ga0182008_10098142 | 3300014497 | Bacteria | 1446 |
| 310 | Ga0182008_10421450 | 3300014497 | Bacteria | 721 |
| 311 | Ga0157377_10073460 | 3300014745 | Bacteria | 1982 |
| 312 | Ga0157377_10683054 | 3300014745 | Bacteria | 743 |
| 313 | Ga0157376_10385576 | 3300014969 | Bacteria | 1351 |
| 314 | Ga0157376_11234222 | 3300014969 | Bacteria | 776 |
| 315 | Ga0163161_10026654 | 3300017792 | Bacteria | 4094 |
| 316 | Ga0163161_10345769 | 3300017792 | Bacteria | 1181 |
| 317 | Ga0163161_10470460 | 3300017792 | Bacteria | 1019 |
| 318 | Ga0163161_11031377 | 3300017792 | Bacteria | 704 |
| 319 | Ga0197907_10124435 | 3300020069 | Bacteria | 531 |
| 320 | Ga0206356_10119586 | 3300020070 | Bacteria | 1319 |
| 321 | Ga0206356_10663620 | 3300020070 | Bacteria | 1641 |
| 322 | Ga0206356_11221972 | 3300020070 | Bacteria | 704 |
| 323 | Ga0206355_1430339 | 3300020076 | Bacteria | 667 |
| 324 | Ga0206351_10141909 | 3300020077 | Bacteria | 1188 |
| 325 | Ga0206352_10244107 | 3300020078 | Bacteria | 872 |
| 326 | Ga0206350_10669679 | 3300020080 | Bacteria | 711 |
| 327 | Ga0206350_11500533 | 3300020080 | Bacteria | 770 |
| 328 | Ga0206350_11585932 | 3300020080 | Bacteria | 738 |
| 329 | Ga0206354_10452849 | 3300020081 | Bacteria | 616 |
| 330 | Ga0206354_10501550 | 3300020081 | Bacteria | 689 |
| 331 | Ga0206354_10570029 | 3300020081 | Bacteria | 651 |
| 332 | Ga0206354_10829853 | 3300020081 | Bacteria | 760 |
| 333 | Ga0206353_10143802 | 3300020082 | Bacteria | 566 |
| 334 | Ga0206353_10839177 | 3300020082 | Bacteria | 643 |
| 335 | Ga0206353_11410002 | 3300020082 | Bacteria | 922 |
| 336 | Ga0206353_11489688 | 3300020082 | Bacteria | 850 |
| 337 | Ga0206353_11872656 | 3300020082 | Bacteria | 680 |
| 338 | Ga0206353_12040929 | 3300020082 | Bacteria | 1374 |
| 339 | Ga0224712_10003451 | 3300022467 | Bacteria | 4109 |
| 340 | Ga0224712_10084624 | 3300022467 | Bacteria | 1316 |
| 341 | Ga0224712_10244483 | 3300022467 | Bacteria | 827 |
| 342 | Ga0207656_10094901 | 3300025321 | Bacteria | 1359 |
| 343 | Ga0207656_10267857 | 3300025321 | Bacteria | 840 |
| 344 | Ga0207682_10045174 | 3300025893 | Bacteria | 1807 |
| 345 | Ga0207642_10016301 | 3300025899 | Bacteria | 2795 |
| 346 | Ga0207642_10282712 | 3300025899 | Bacteria | 955 |
| 347 | Ga0207710_10155554 | 3300025900 | Bacteria | 1111 |
| 348 | Ga0207688_10048546 | 3300025901 | Bacteria | 2372 |
| 349 | Ga0207688_10098689 | 3300025901 | Bacteria | 1684 |
| 350 | Ga0207688_10244651 | 3300025901 | Bacteria | 1085 |
| 351 | Ga0207688_10343947 | 3300025901 | Bacteria | 918 |
| 352 | Ga0207688_10392964 | 3300025901 | Bacteria | 859 |
| 353 | Ga0207680_10824931 | 3300025903 | Bacteria | 665 |
| 354 | Ga0207647_10141073 | 3300025904 | Bacteria | 1412 |
| 355 | Ga0207647_10167202 | 3300025904 | Bacteria | 1281 |
| 356 | Ga0207647_10215247 | 3300025904 | Bacteria | 1108 |
| 357 | Ga0207643_10131737 | 3300025908 | Bacteria | 1488 |
| 358 | Ga0207643_10213357 | 3300025908 | Bacteria | 1179 |
| 359 | Ga0207643_10308427 | 3300025908 | Bacteria | 986 |
| 360 | Ga0207643_10318706 | 3300025908 | Bacteria | 970 |
| 361 | Ga0207705_10709473 | 3300025909 | Bacteria | 782 |
| 362 | Ga0207705_10838842 | 3300025909 | Bacteria | 713 |
| 363 | Ga0207654_10464760 | 3300025911 | Bacteria | 889 |
| 364 | Ga0207695_11577192 | 3300025913 | Bacteria | 537 |
| 365 | Ga0207662_10097436 | 3300025918 | Bacteria | 1818 |
| 366 | Ga0207662_10098352 | 3300025918 | Bacteria | 1810 |
| 367 | Ga0207662_10232937 | 3300025918 | Bacteria | 1203 |
| 368 | Ga0207662_10240929 | 3300025918 | Bacteria | 1184 |
| 369 | Ga0207657_10095519 | 3300025919 | Bacteria | 2473 |
| 370 | Ga0207657_10318016 | 3300025919 | Bacteria | 1231 |
| 371 | Ga0207649_10497819 | 3300025920 | Bacteria | 926 |
| 372 | Ga0207652_10877523 | 3300025921 | Bacteria | 793 |
| 373 | Ga0207681_10545666 | 3300025923 | Bacteria | 954 |
| 374 | Ga0207694_10501976 | 3300025924 | Bacteria | 1016 |
| 375 | Ga0207650_10697896 | 3300025925 | Bacteria | 857 |
| 376 | Ga0207659_10116199 | 3300025926 | Bacteria | 2042 |
| 377 | Ga0207659_10218769 | 3300025926 | Bacteria | 1530 |
| 378 | Ga0207687_10116619 | 3300025927 | Bacteria | 1991 |
| 379 | Ga0207687_10334599 | 3300025927 | Bacteria | 1229 |
| 380 | Ga0207687_10546324 | 3300025927 | Bacteria | 972 |
| 381 | Ga0207687_10578659 | 3300025927 | Bacteria | 944 |
| 382 | Ga0207664_10030840 | 3300025929 | Bacteria | 4098 |
| 383 | Ga0207644_10816936 | 3300025931 | Bacteria | 780 |
| 384 | Ga0207690_10105178 | 3300025932 | Bacteria | 2023 |
| 385 | Ga0207690_10957684 | 3300025932 | Bacteria | 711 |
| 386 | Ga0207706_10447768 | 3300025933 | Bacteria | 1117 |
| 387 | Ga0207706_11226672 | 3300025933 | Bacteria | 622 |
| 388 | Ga0207686_10424045 | 3300025934 | Bacteria | 1018 |
| 389 | Ga0207686_10871285 | 3300025934 | Bacteria | 725 |
| 390 | Ga0207709_10005029 | 3300025935 | Bacteria | 7555 |
| 391 | Ga0207709_10273292 | 3300025935 | Bacteria | 1245 |
| 392 | Ga0207709_10276395 | 3300025935 | Bacteria | 1239 |
| 393 | Ga0207709_10479453 | 3300025935 | Bacteria | 967 |
| 394 | Ga0207670_10022974 | 3300025936 | Bacteria | 3874 |
| 395 | Ga0207669_10006873 | 3300025937 | Bacteria | 5232 |
| 396 | Ga0207669_10390659 | 3300025937 | Bacteria | 1087 |
| 397 | Ga0207669_11034872 | 3300025937 | Bacteria | 691 |
| 398 | Ga0207665_10632995 | 3300025939 | Bacteria | 837 |
| 399 | Ga0207691_10003431 | 3300025940 | Bacteria | 15416 |
| 400 | Ga0207691_10087896 | 3300025940 | Bacteria | 2788 |
| 401 | Ga0207691_10552198 | 3300025940 | Bacteria | 976 |
| 402 | Ga0207711_10062361 | 3300025941 | Bacteria | 3216 |
| 403 | Ga0207689_10271934 | 3300025942 | Bacteria | 1403 |
| 404 | Ga0207689_10395221 | 3300025942 | Bacteria | 1152 |
| 405 | Ga0207689_10496674 | 3300025942 | Bacteria | 1022 |
| 406 | Ga0207661_10142467 | 3300025944 | Bacteria | 2064 |
| 407 | Ga0207661_10238858 | 3300025944 | Bacteria | 1611 |
| 408 | Ga0207661_10329831 | 3300025944 | Bacteria | 1373 |
| 409 | Ga0207661_10371281 | 3300025944 | Bacteria | 1293 |
| 410 | Ga0207661_10433304 | 3300025944 | Bacteria | 1195 |
| 411 | Ga0207661_10480809 | 3300025944 | Bacteria | 1134 |
| 412 | Ga0207679_10033027 | 3300025945 | Bacteria | 3639 |
| 413 | Ga0207679_10232445 | 3300025945 | Bacteria | 1558 |
| 414 | Ga0207679_10480510 | 3300025945 | Bacteria | 1106 |
| 415 | Ga0207679_11626759 | 3300025945 | Bacteria | 592 |
| 416 | Ga0207651_10840360 | 3300025960 | Bacteria | 815 |
| 417 | Ga0207712_10093301 | 3300025961 | Bacteria | 2221 |
| 418 | Ga0207712_10295094 | 3300025961 | Bacteria | 1328 |
| 419 | Ga0207712_10345426 | 3300025961 | Bacteria | 1235 |
| 420 | Ga0207668_10963808 | 3300025972 | Bacteria | 761 |
| 421 | Ga0207640_10194835 | 3300025981 | Bacteria | 1530 |
| 422 | Ga0207677_10132683 | 3300026023 | Bacteria | 1894 |
| 423 | Ga0207677_10260195 | 3300026023 | Bacteria | 1414 |
| 424 | Ga0207677_10897782 | 3300026023 | Bacteria | 799 |
| 425 | Ga0207677_11093085 | 3300026023 | Bacteria | 727 |
| 426 | Ga0207703_10858139 | 3300026035 | Bacteria | 868 |
| 427 | Ga0207639_10351044 | 3300026041 | Bacteria | 1317 |
| 428 | Ga0207639_10547924 | 3300026041 | Bacteria | 1062 |
| 429 | Ga0207678_10236385 | 3300026067 | Bacteria | 1565 |
| 430 | Ga0207678_10402602 | 3300026067 | Bacteria | 1185 |
| 431 | Ga0207678_10482575 | 3300026067 | Bacteria | 1079 |
| 432 | Ga0207678_10673240 | 3300026067 | Bacteria | 910 |
| 433 | Ga0207678_11277653 | 3300026067 | Bacteria | 649 |
| 434 | Ga0207678_11349890 | 3300026067 | Bacteria | 630 |
| 435 | Ga0207708_10002425 | 3300026075 | Bacteria | 13693 |
| 436 | Ga0207708_10071771 | 3300026075 | Bacteria | 2653 |
| 437 | Ga0207708_10092514 | 3300026075 | Bacteria | 2333 |
| 438 | Ga0207708_10305175 | 3300026075 | Bacteria | 1295 |
| 439 | Ga0207708_10683706 | 3300026075 | Bacteria | 876 |
| 440 | Ga0207702_10341668 | 3300026078 | Bacteria | 1430 |
| 441 | Ga0207648_10007281 | 3300026089 | Bacteria | 10910 |
| 442 | Ga0207648_10491238 | 3300026089 | Bacteria | 1122 |
| 443 | Ga0207648_10593324 | 3300026089 | Bacteria | 1020 |
| 444 | Ga0207676_10370140 | 3300026095 | Bacteria | 1331 |
| 445 | Ga0207676_12104808 | 3300026095 | Bacteria | 563 |
| 446 | Ga0207674_10013764 | 3300026116 | Bacteria | 8952 |
| 447 | Ga0207674_10234946 | 3300026116 | Bacteria | 1781 |
| 448 | Ga0207674_10730133 | 3300026116 | Bacteria | 956 |
| 449 | Ga0207674_10902352 | 3300026116 | Bacteria | 852 |
| 450 | Ga0207675_100003879 | 3300026118 | Bacteria | 14536 |
| 451 | Ga0207675_100292959 | 3300026118 | Bacteria | 1583 |
| 452 | Ga0207675_100436195 | 3300026118 | Bacteria | 1296 |
| 453 | Ga0207675_100485601 | 3300026118 | Bacteria | 1228 |
| 454 | Ga0207675_100532514 | 3300026118 | Bacteria | 1172 |
| 455 | Ga0207675_100926237 | 3300026118 | Bacteria | 888 |
| 456 | Ga0207675_101069607 | 3300026118 | Bacteria | 826 |
| 457 | Ga0207683_10118248 | 3300026121 | Bacteria | 2378 |
| 458 | Ga0207683_10268970 | 3300026121 | Bacteria | 1557 |
| 459 | Ga0207683_11127210 | 3300026121 | Bacteria | 727 |
| 460 | Ga0207683_11486503 | 3300026121 | Bacteria | 626 |
| 461 | Ga0207698_10007471 | 3300026142 | Bacteria | 6847 |
| 462 | Ga0207698_10277773 | 3300026142 | Bacteria | 1548 |
| 463 | Ga0207698_10386897 | 3300026142 | Bacteria | 1332 |
| 464 | Ga0207698_10412271 | 3300026142 | Bacteria | 1294 |
| 465 | Ga0207698_11242847 | 3300026142 | Bacteria | 759 |
| 466 | Ga0207698_11777425 | 3300026142 | Bacteria | 632 |
| 467 | Ga0209970_1010625 | 3300027614 | Bacteria | 1507 |
| 468 | Ga0209971_1017984 | 3300027682 | Bacteria | 1677 |
| 469 | Ga0209813_10056987 | 3300027866 | Bacteria | 1238 |
| 470 | Ga0209813_10422413 | 3300027866 | Bacteria | 541 |
| 471 | Ga0207428_10010526 | 3300027907 | Bacteria | 8256 |
| 472 | Ga0207428_10051104 | 3300027907 | Bacteria | 3305 |
| 473 | Ga0268265_11172850 | 3300028380 | Bacteria | 765 |
| 474 | Ga0268264_10000792 | 3300028381 | Bacteria | 34282 |
| 475 | Ga0311001_1071007 | 3300029277 | Bacteria | 1146 |
| 476 | Ga0307512_10033331 | 3300030522 | Bacteria | 4430 |
| 477 | Ga0316176_1081384 | 3300030732 | Bacteria | 889 |
| 478 | Ga0316176_1093836 | 3300030732 | Bacteria | 1183 |
| 479 | Ga0314311_1063086 | 3300030733 | Bacteria | 2200 |
| 480 | Ga0314311_1091600 | 3300030733 | Bacteria | 1564 |
| 481 | Ga0314311_1110141 | 3300030733 | Bacteria | 1347 |
| 482 | Ga0316183_1044482 | 3300030742 | Bacteria | 1730 |
| 483 | Ga0316181_1044632 | 3300030744 | Bacteria | 2032 |
| 484 | Ga0316181_1229775 | 3300030744 | Bacteria | 1347 |
| 485 | Ga0316182_1249978 | 3300030745 | Bacteria | 801 |
| 486 | Ga0307516_10792272 | 3300031730 | Bacteria | 609 |
| 487 | Ga0307405_10264638 | 3300031731 | Bacteria | 1286 |
| 488 | Ga0307405_10440607 | 3300031731 | Bacteria | 1030 |
| 489 | Ga0307405_10621457 | 3300031731 | Bacteria | 884 |
| 490 | Ga0307413_10069421 | 3300031824 | Bacteria | 2211 |
| 491 | Ga0307413_10129430 | 3300031824 | Bacteria | 1725 |
| 492 | Ga0307413_10179289 | 3300031824 | Bacteria | 1508 |
| 493 | Ga0307413_10723827 | 3300031824 | Bacteria | 829 |
| 494 | Ga0307413_10930263 | 3300031824 | Bacteria | 740 |
| 495 | Ga0307413_11243746 | 3300031824 | Bacteria | 649 |
| 496 | Ga0307410_10006052 | 3300031852 | Bacteria | 6484 |
| 497 | Ga0307410_10097613 | 3300031852 | Bacteria | 2099 |
| 498 | Ga0307410_10131183 | 3300031852 | Bacteria | 1841 |
| 499 | Ga0307410_10528526 | 3300031852 | Bacteria | 974 |
| 500 | Ga0307410_10717267 | 3300031852 | Bacteria | 844 |
| 501 | Ga0307410_10814649 | 3300031852 | Bacteria | 795 |
| 502 | Ga0307410_11011611 | 3300031852 | Bacteria | 717 |
| 503 | Ga0307406_10152957 | 3300031901 | Bacteria | 1648 |
| 504 | Ga0307406_10368336 | 3300031901 | Bacteria | 1129 |
| 505 | Ga0307406_10373430 | 3300031901 | Bacteria | 1122 |
| 506 | Ga0307406_10391940 | 3300031901 | Bacteria | 1098 |
| 507 | Ga0307406_11270995 | 3300031901 | Bacteria | 641 |
| 508 | Ga0307407_10013128 | 3300031903 | Bacteria | 4008 |
| 509 | Ga0307407_10163621 | 3300031903 | Bacteria | 1458 |
| 510 | Ga0307407_10451135 | 3300031903 | Bacteria | 933 |
| 511 | Ga0307412_10235247 | 3300031911 | Bacteria | 1413 |
| 512 | Ga0307412_11004704 | 3300031911 | Bacteria | 737 |
| 513 | Ga0307412_11836423 | 3300031911 | Bacteria | 558 |
| 514 | Ga0307412_11905643 | 3300031911 | Bacteria | 548 |
| 515 | Ga0307409_100004499 | 3300031995 | Bacteria | 7849 |
| 516 | Ga0307409_100306256 | 3300031995 | Bacteria | 1480 |
| 517 | Ga0307409_100314031 | 3300031995 | Bacteria | 1464 |
| 518 | Ga0307409_100328891 | 3300031995 | Bacteria | 1433 |
| 519 | Ga0307409_100386549 | 3300031995 | Bacteria | 1332 |
| 520 | Ga0307409_100467801 | 3300031995 | Bacteria | 1220 |
| 521 | Ga0307409_100493559 | 3300031995 | Bacteria | 1191 |
| 522 | Ga0307409_100626279 | 3300031995 | Bacteria | 1066 |
| 523 | Ga0307409_100875547 | 3300031995 | Bacteria | 910 |
| 524 | Ga0307409_101333037 | 3300031995 | Bacteria | 743 |
| 525 | Ga0307416_100024263 | 3300032002 | Bacteria | 4421 |
| 526 | Ga0307416_100127884 | 3300032002 | Bacteria | 2279 |
| 527 | Ga0307416_100365132 | 3300032002 | Bacteria | 1467 |
| 528 | Ga0307416_100688812 | 3300032002 | Bacteria | 1110 |
| 529 | Ga0307416_100850266 | 3300032002 | Bacteria | 1010 |
| 530 | Ga0307416_100884849 | 3300032002 | Bacteria | 992 |
| 531 | Ga0307416_101061441 | 3300032002 | Bacteria | 914 |
| 532 | Ga0307416_101473045 | 3300032002 | Bacteria | 786 |
| 533 | Ga0307416_102375033 | 3300032002 | Bacteria | 630 |
| 534 | Ga0307414_10077373 | 3300032004 | Bacteria | 2421 |
| 535 | Ga0307414_10400359 | 3300032004 | Bacteria | 1192 |
| 536 | Ga0307414_10655907 | 3300032004 | Bacteria | 946 |
| 537 | Ga0307414_11118243 | 3300032004 | Bacteria | 728 |
| 538 | Ga0307411_10034009 | 3300032005 | Bacteria | 3167 |
| 539 | Ga0307411_10134877 | 3300032005 | Bacteria | 1810 |
| 540 | Ga0307411_10198643 | 3300032005 | Bacteria | 1538 |
| 541 | Ga0307411_10625737 | 3300032005 | Bacteria | 929 |
| 542 | Ga0307415_100030696 | 3300032126 | Bacteria | 3453 |
| 543 | Ga0307415_100113612 | 3300032126 | Bacteria | 2014 |
| 544 | Ga0307415_100199168 | 3300032126 | Bacteria | 1587 |
| 545 | Ga0307415_100897958 | 3300032126 | Bacteria | 816 |
| 546 | Ga0307415_101751185 | 3300032126 | Bacteria | 600 |
| 547 | Ga0316583_10020342 | 3300032133 | Bacteria | 2379 |
| 548 | Ga0316593_10029364 | 3300032168 | Bacteria | 1778 |
| 549 | Ga0316596_1091234 | 3300033541 | Bacteria | 821 |
| 550 | Ga0373959_0041280 | 3300034820 | Bacteria | 969 |
| 551 | Ga0373929_0041862 | 3300035085 | Bacteria | 1020 |
| 552 | Ga0373944_0123308 | 3300035089 | Bacteria | 895 |
| 553 | Ga0373952_0029220 | 3300035092 | Bacteria | 1214 |
| 554 | Ga0373932_0356548 | 3300035112 | Bacteria | 557 |
| 555 | Ga0373960_0098428 | 3300035121 | Bacteria | 945 |
| 556 | Ga0373962_0073070 | 3300035242 | Bacteria | 1028 |
| 557 | Ga0373962_0127058 | 3300035242 | Bacteria | 818 |
| 558 | Ga0373931_0097053 | 3300035691 | Bacteria | 1652 |
| 559 | Ga0395899_0220065 | 3300037312 | Bacteria | 1315 |
| 560 | Ga0395899_0495866 | 3300037312 | Bacteria | 793 |
| 561 | Ga0395900_0042235 | 3300037418 | Bacteria | 4697 |
| 562 | Ga0395900_0080337 | 3300037418 | Bacteria | 3351 |
| 563 | Ga0395900_0169253 | 3300037418 | Bacteria | 2225 |
| 564 | Ga0395900_0906545 | 3300037418 | Bacteria | 805 |
| 565 | Ga0395898_0032908 | 3300037466 | Bacteria | 5175 |
| 566 | Ga0395898_0090098 | 3300037466 | Bacteria | 2952 |
| 567 | Ga0395898_0117522 | 3300037466 | Bacteria | 2548 |
| 568 | Ga0395898_0463154 | 3300037466 | Bacteria | 1207 |
| 569 | Ga0395898_0523938 | 3300037466 | Bacteria | 1127 |
| 570 | Ga0395905_0660609 | 3300037471 | Bacteria | 947 |
| 571 | Ga0395905_1408803 | 3300037471 | Bacteria | 601 |
| 572 | Ga0436364_0626737 | 3300037853 | Bacteria | 2527 |
| 573 | Ga0436364_0711707 | 3300037853 | Bacteria | 1019 |
| 574 | Ga0395901_0002011 | 3300038443 | Bacteria | 20930 |
| 575 | Ga0395901_0038023 | 3300038443 | Bacteria | 4978 |
| 576 | Ga0395901_0044740 | 3300038443 | Bacteria | 4591 |
| 577 | Ga0395901_0149529 | 3300038443 | Bacteria | 2454 |
| 578 | Ga0395901_0880952 | 3300038443 | Bacteria | 878 |
| 579 | Ga0439438_017324 | 3300041405 | Bacteria | 2077 |
| 580 | Ga0439439_0034120 | 3300041406 | Bacteria | 1305 |
| 581 | Ga0439447_022943 | 3300041407 | Bacteria | 1630 |
| 582 | Ga0439461_0081393 | 3300041410 | Bacteria | 764 |
| 583 | Ga0439466_0080675 | 3300041411 | Bacteria | 1026 |
| 584 | Ga0451789_0337217 | 3300041443 | Bacteria | 503 |
| 585 | Ga0451789_1155910 | 3300041443 | Bacteria | 1330 |
| 586 | Ga0451789_1213167 | 3300041443 | Bacteria | 620 |
| 587 | Ga0451790_03312 | 3300041444 | Bacteria | 513 |
| 588 | Ga0451792_01584 | 3300041445 | Bacteria | 600 |
| 589 | Ga0451793_0939683 | 3300041452 | Bacteria | 562 |
| 590 | Ga0451797_0843885 | 3300041453 | Bacteria | 510 |
| 591 | Ga0451797_0868523 | 3300041453 | Bacteria | 672 |
| 592 | Ga0451798_0514919 | 3300041458 | Bacteria | 523 |
| 593 | Ga0451800_1688016 | 3300041459 | Bacteria | 638 |
| 594 | Ga0451802_0804525 | 3300041460 | Bacteria | 628 |
| 595 | Ga0451807_2362550 | 3300041486 | Bacteria | 509 |
| 596 | Ga0451835_0543034 | 3300041492 | Bacteria | 579 |
| 597 | Ga0451835_0604248 | 3300041492 | Bacteria | 681 |
| 598 | Ga0451837_1843479 | 3300041494 | Bacteria | 591 |
| 599 | Ga0451839_0171162 | 3300041496 | Bacteria | 795 |
| 600 | Ga0451841_0318149 | 3300041498 | Bacteria | 689 |
| 601 | Ga0451841_0744881 | 3300041498 | Bacteria | 570 |
| 602 | Ga0451849_0357388 | 3300041505 | Bacteria | 827 |
| 603 | Ga0451851_0981888 | 3300041507 | Bacteria | 653 |
| 604 | Ga0451843_0076660 | 3300041509 | Bacteria | 992 |
| 605 | Ga0451855_0560015 | 3300041511 | Bacteria | 614 |
| 606 | Ga0451855_1287871 | 3300041511 | Bacteria | 524 |
| 607 | Ga0451853_2312243 | 3300041512 | Bacteria | 1384 |
| 608 | Ga0439431_0008571 | 3300041997 | Bacteria | 2301 |
| 609 | Ga0439442_066080 | 3300042002 | Bacteria | 768 |
| 610 | Ga0439445_0013830 | 3300042004 | Bacteria | 1957 |
| 611 | Ga0439449_0077931 | 3300042007 | Bacteria | 1222 |
| 612 | Ga0439457_033137 | 3300042014 | Bacteria | 1147 |
| 613 | Ga0439462_0084425 | 3300042015 | Bacteria | 869 |
| 614 | Ga0450920_014777 | 3300042122 | Bacteria | 1481 |
| 615 | Ga0450907_011557 | 3300042146 | Bacteria | 1466 |
| 616 | Ga0439446_0164790 | 3300042156 | Bacteria | 734 |
| 617 | Ga0439434_0000725 | 3300042435 | Bacteria | 9435 |
| 618 | Ga0450901_027965 | 3300042533 | Bacteria | 618 |
| 619 | Ga0466969_0042846 | 3300044656 | Bacteria | 2257 |
| 620 | Ga0466969_0150416 | 3300044656 | Bacteria | 1073 |
| 621 | Ga0466972_0007943 | 3300044658 | Bacteria | 5318 |
| 622 | Ga0466972_0089180 | 3300044658 | Bacteria | 1463 |
| 623 | Ga0466972_0201794 | 3300044658 | Bacteria | 931 |
| 624 | Ga0466972_0340407 | 3300044658 | Bacteria | 701 |
| 625 | Ga0466965_0010425 | 3300044683 | Bacteria | 4335 |
| 626 | Ga0466965_0021029 | 3300044683 | Bacteria | 3139 |
| 627 | Ga0466965_0066512 | 3300044683 | Bacteria | 1807 |
| 628 | Ga0466965_0118162 | 3300044683 | Bacteria | 1367 |
| 629 | Ga0466965_0180193 | 3300044683 | Bacteria | 1114 |
| 630 | Ga0466965_0213732 | 3300044683 | Bacteria | 1026 |
| 631 | Ga0466965_0216655 | 3300044683 | Bacteria | 1019 |
| 632 | Ga0466965_0339951 | 3300044683 | Bacteria | 820 |
| 633 | Ga0466965_0514916 | 3300044683 | Bacteria | 672 |
| 634 | Ga0466965_0644282 | 3300044683 | Bacteria | 605 |
| 635 | Ga0466965_0902143 | 3300044683 | Bacteria | 515 |
| 636 | Ga0466966_0060595 | 3300044684 | Bacteria | 2388 |
| 637 | Ga0466966_0066805 | 3300044684 | Bacteria | 2259 |
| 638 | Ga0466966_0539043 | 3300044684 | Bacteria | 702 |
| 639 | Ga0466966_0799946 | 3300044684 | Bacteria | 568 |
| 640 | Ga0466961_0014059 | 3300044693 | Bacteria | 5133 |
| 641 | Ga0466961_0089772 | 3300044693 | Bacteria | 1940 |
| 642 | Ga0466961_0211677 | 3300044693 | Bacteria | 1196 |
| 643 | Ga0466961_0478448 | 3300044693 | Bacteria | 753 |
| 644 | Ga0466961_0503309 | 3300044693 | Bacteria | 731 |
| 645 | Ga0466963_0002887 | 3300044694 | Bacteria | 9706 |
| 646 | Ga0466963_0047188 | 3300044694 | Bacteria | 2842 |
| 647 | Ga0466963_0075177 | 3300044694 | Bacteria | 2279 |
| 648 | Ga0466963_0235872 | 3300044694 | Bacteria | 1282 |
| 649 | Ga0466963_0301232 | 3300044694 | Bacteria | 1127 |
| 650 | Ga0466963_0677370 | 3300044694 | Bacteria | 728 |
| 651 | Ga0466964_0054135 | 3300044706 | Bacteria | 1653 |
| 652 | Ga0466964_0065515 | 3300044706 | Bacteria | 1522 |
| 653 | Ga0466964_0171153 | 3300044706 | Bacteria | 1023 |
| 654 | Ga0466964_0493307 | 3300044706 | Bacteria | 656 |
| 655 | Ga0466964_0692021 | 3300044706 | Bacteria | 567 |
| 656 | Ga0466964_0713652 | 3300044706 | Bacteria | 560 |
| 657 | Ga0466971_0020611 | 3300044719 | Bacteria | 2931 |
| 658 | Ga0466971_0049834 | 3300044719 | Bacteria | 1884 |
| 659 | Ga0466971_0128689 | 3300044719 | Bacteria | 1174 |
| 660 | Ga0466971_0134028 | 3300044719 | Bacteria | 1151 |
| 661 | Ga0466971_0305243 | 3300044719 | Bacteria | 765 |
| 662 | Ga0466968_0026632 | 3300044735 | Bacteria | 2375 |
| 663 | Ga0466968_0141573 | 3300044735 | Bacteria | 1100 |
| 664 | Ga0466968_0159201 | 3300044735 | Bacteria | 1041 |
| 665 | Ga0466970_0007149 | 3300044765 | Bacteria | 5589 |
| 666 | Ga0466970_0021669 | 3300044765 | Bacteria | 3348 |
| 667 | Ga0466970_0025660 | 3300044765 | Bacteria | 3086 |
| 668 | Ga0466970_0249866 | 3300044765 | Bacteria | 993 |
| 669 | Ga0466970_0298319 | 3300044765 | Bacteria | 908 |
| 670 | Ga0466970_0340870 | 3300044765 | Bacteria | 849 |
| 671 | Ga0466970_0393891 | 3300044765 | Bacteria | 790 |
| 672 | Ga0466970_0417828 | 3300044765 | Bacteria | 766 |
| 673 | Ga0466970_0515876 | 3300044765 | Bacteria | 689 |
| 674 | Ga0466970_0542329 | 3300044765 | Bacteria | 672 |
| 675 | Ga0466970_0589172 | 3300044765 | Bacteria | 644 |
| 676 | Ga0466970_0686165 | 3300044765 | Bacteria | 597 |
| 677 | Ga0466957_0041531 | 3300044842 | Bacteria | 2781 |
| 678 | Ga0466957_0127653 | 3300044842 | Bacteria | 1626 |
| 679 | Ga0466957_0171478 | 3300044842 | Bacteria | 1413 |
| 680 | Ga0466957_0176113 | 3300044842 | Bacteria | 1395 |
| 681 | Ga0466957_0308782 | 3300044842 | Bacteria | 1064 |
| 682 | Ga0466957_0492980 | 3300044842 | Bacteria | 848 |
| 683 | Ga0466957_0556831 | 3300044842 | Bacteria | 799 |
| 684 | Ga0466960_0002126 | 3300044901 | Bacteria | 7386 |
| 685 | Ga0466960_0009725 | 3300044901 | Bacteria | 3975 |
| 686 | Ga0466960_0039714 | 3300044901 | Bacteria | 2221 |
| 687 | Ga0466960_0153551 | 3300044901 | Bacteria | 1232 |
| 688 | Ga0466960_0194225 | 3300044901 | Bacteria | 1106 |
| 689 | Ga0466960_0270494 | 3300044901 | Bacteria | 949 |
| 690 | Ga0466960_0505297 | 3300044901 | Bacteria | 709 |
| 691 | Ga0466960_0550917 | 3300044901 | Bacteria | 680 |
| 692 | Ga0466960_0744016 | 3300044901 | Bacteria | 590 |
| 693 | Ga0466959_0044069 | 3300045049 | Bacteria | 3287 |
| 694 | Ga0466959_0940213 | 3300045049 | Bacteria | 576 |
| 695 | Ga0466958_0066032 | 3300045836 | Bacteria | 2208 |
| 696 | Ga0466958_0250198 | 3300045836 | Bacteria | 1133 |
| 697 | Ga0466958_0945592 | 3300045836 | Bacteria | 562 |
| 698 | Ga0466967_0013542 | 3300045976 | Bacteria | 6308 |
| 699 | Ga0466967_0048014 | 3300045976 | Bacteria | 3725 |
| 700 | Ga0466967_0057496 | 3300045976 | Bacteria | 3434 |
| 701 | Ga0466967_0311524 | 3300045976 | Bacteria | 1516 |
| 702 | Ga0466967_0442002 | 3300045976 | Bacteria | 1270 |
| 703 | Ga0466967_0549075 | 3300045976 | Bacteria | 1137 |
| 704 | Ga0466967_0729642 | 3300045976 | Bacteria | 982 |
| 705 | Ga0466967_1694736 | 3300045976 | Bacteria | 629 |
| 706 | Ga0495590_0075600 | 3300046457 | Bacteria | 1185 |
| 707 | Ga0495629_0096372 | 3300046459 | Bacteria | 2064 |
| 708 | Ga0495629_0456676 | 3300046459 | Bacteria | 865 |
| 709 | Ga0495629_0500075 | 3300046459 | Bacteria | 820 |
| 710 | Ga0495641_0337918 | 3300046461 | Bacteria | 680 |
| 711 | Ga0495651_0481029 | 3300046462 | Bacteria | 798 |
| 712 | Ga0495653_0057884 | 3300046463 | Bacteria | 2948 |
| 713 | Ga0495582_0164038 | 3300046473 | Bacteria | 1264 |
| 714 | Ga0495639_0278480 | 3300046475 | Bacteria | 831 |
| 715 | Ga0495664_0075173 | 3300046477 | Bacteria | 2021 |
| 716 | Ga0495596_0340571 | 3300046500 | Bacteria | 584 |
| 717 | Ga0495608_0139951 | 3300046511 | Bacteria | 1545 |
| 718 | Ga0495620_0049001 | 3300046515 | Bacteria | 1810 |
| 719 | Ga0495630_0381578 | 3300046517 | Bacteria | 1080 |
| 720 | Ga0495631_0161727 | 3300046518 | Bacteria | 961 |
| 721 | Ga0495631_0245870 | 3300046518 | Bacteria | 763 |
| 722 | Ga0495586_0231445 | 3300046535 | Bacteria | 1052 |
| 723 | Ga0495609_0321260 | 3300046538 | Bacteria | 628 |
| 724 | Ga0495667_0776521 | 3300046559 | Bacteria | 591 |
| 725 | Ga0495656_0649857 | 3300046615 | Bacteria | 566 |
| 726 | Ga0495634_0250224 | 3300046642 | Bacteria | 1084 |
| 727 | Ga0495599_0234217 | 3300046678 | Bacteria | 1121 |
| 728 | Ga0495647_0108849 | 3300046681 | Bacteria | 1155 |
| 729 | Ga0495658_0077248 | 3300046683 | Bacteria | 1947 |
| 730 | Ga0495658_0378484 | 3300046683 | Bacteria | 901 |
| 731 | Ga0495613_0586162 | 3300046689 | Bacteria | 743 |
| 732 | Ga0495674_0493845 | 3300047319 | Bacteria | 980 |
| 733 | Ga0495674_1000037 | 3300047319 | Bacteria | 641 |
| 734 | Ga0495676_0197442 | 3300047321 | Bacteria | 1400 |
| 735 | Ga0495676_0284682 | 3300047321 | Bacteria | 1118 |
| 736 | Ga0495680_0278739 | 3300047322 | Bacteria | 1179 |
| 737 | Ga0496100_0029403 | 3300048903 | Bacteria | 3398 |
| 738 | Ga0496100_0135127 | 3300048903 | Bacteria | 1741 |
| 739 | Ga0496100_0357801 | 3300048903 | Bacteria | 1104 |
| 740 | Ga0496100_0476446 | 3300048903 | Bacteria | 959 |
| 741 | Ga0496100_0547411 | 3300048903 | Bacteria | 895 |
| 742 | Ga0496101_0025837 | 3300048904 | Bacteria | 4077 |
| 743 | Ga0496101_0085853 | 3300048904 | Bacteria | 2333 |
| 744 | Ga0496101_0312267 | 3300048904 | Bacteria | 1232 |
| 745 | Ga0496101_0561052 | 3300048904 | Bacteria | 903 |
| 746 | Ga0496101_0588301 | 3300048904 | Bacteria | 880 |
| 747 | Ga0496101_0907791 | 3300048904 | Bacteria | 693 |
| 748 | Ga0496101_1111537 | 3300048904 | Bacteria | 620 |
| 749 | Ga0496102_0004268 | 3300048905 | Bacteria | 12085 |
| 750 | Ga0496102_0298706 | 3300048905 | Bacteria | 1518 |
| 751 | Ga0496102_0420064 | 3300048905 | Bacteria | 1256 |
| 752 | Ga0496102_0674086 | 3300048905 | Bacteria | 957 |
| 753 | Ga0496102_0778201 | 3300048905 | Bacteria | 879 |
| 754 | Ga0496102_1821992 | 3300048905 | Bacteria | 526 |
| 755 | Ga0496103_0002413 | 3300048906 | Bacteria | 11762 |
| 756 | Ga0496103_0170212 | 3300048906 | Bacteria | 1399 |
| 757 | Ga0496103_0203919 | 3300048906 | Bacteria | 1272 |
| 758 | Ga0496103_0333986 | 3300048906 | Bacteria | 975 |
| 759 | Ga0496103_0376991 | 3300048906 | Bacteria | 911 |
| 760 | Ga0496104_0021580 | 3300048907 | Bacteria | 5913 |
| 761 | Ga0496104_0042002 | 3300048907 | Bacteria | 4289 |
| 762 | Ga0496104_0152888 | 3300048907 | Bacteria | 2215 |
| 763 | Ga0496104_0313410 | 3300048907 | Bacteria | 1482 |
| 764 | Ga0496104_0441400 | 3300048907 | Bacteria | 1213 |
| 765 | Ga0496104_0926519 | 3300048907 | Bacteria | 776 |
| 766 | Ga0496105_0004859 | 3300048908 | Bacteria | 10146 |
| 767 | Ga0496105_0065779 | 3300048908 | Bacteria | 2992 |
| 768 | Ga0496105_0191069 | 3300048908 | Bacteria | 1674 |
| 769 | Ga0496105_0367810 | 3300048908 | Bacteria | 1146 |
| 770 | Ga0496105_0666180 | 3300048908 | Bacteria | 802 |
| 771 | Ga0496106_0005923 | 3300048909 | Bacteria | 9038 |
| 772 | Ga0496106_0232430 | 3300048909 | Bacteria | 1472 |
| 773 | Ga0496106_0566117 | 3300048909 | Bacteria | 911 |
| 774 | Ga0496107_0172477 | 3300048910 | Bacteria | 1605 |
| 775 | Ga0496107_0340140 | 3300048910 | Bacteria | 1116 |
| 776 | Ga0496107_0465519 | 3300048910 | Bacteria | 938 |
| 777 | Ga0496107_0555287 | 3300048910 | Bacteria | 850 |
| 778 | Ga0496108_0026274 | 3300048911 | Bacteria | 4801 |
| 779 | Ga0496108_0177302 | 3300048911 | Bacteria | 1845 |
| 780 | Ga0496108_0214879 | 3300048911 | Bacteria | 1670 |
| 781 | Ga0496108_0225093 | 3300048911 | Bacteria | 1630 |
| 782 | Ga0496108_0245746 | 3300048911 | Bacteria | 1557 |
| 783 | Ga0496108_0303696 | 3300048911 | Bacteria | 1390 |
| 784 | Ga0496108_0336636 | 3300048911 | Bacteria | 1316 |
| 785 | Ga0496108_0422087 | 3300048911 | Bacteria | 1165 |
| 786 | Ga0496109_0025845 | 3300048912 | Bacteria | 5233 |
| 787 | Ga0496109_0029564 | 3300048912 | Bacteria | 4908 |
| 788 | Ga0496109_0029975 | 3300048912 | Bacteria | 4875 |
| 789 | Ga0496109_0381469 | 3300048912 | Bacteria | 1331 |
| 790 | Ga0496109_0426755 | 3300048912 | Bacteria | 1252 |
| 791 | Ga0496109_0584548 | 3300048912 | Bacteria | 1052 |
| 792 | Ga0496109_0682021 | 3300048912 | Bacteria | 965 |
| 793 | Ga0496109_0709204 | 3300048912 | Bacteria | 944 |
| 794 | Ga0496109_0844733 | 3300048912 | Bacteria | 853 |
| 795 | Ga0496109_1575207 | 3300048912 | Bacteria | 591 |
| 796 | Ga0496110_0003020 | 3300048913 | Bacteria | 12767 |
| 797 | Ga0496110_0280148 | 3300048913 | Bacteria | 1518 |
| 798 | Ga0496110_0280749 | 3300048913 | Bacteria | 1516 |
| 799 | Ga0496110_0310146 | 3300048913 | Bacteria | 1437 |
| 800 | Ga0496110_0489336 | 3300048913 | Bacteria | 1120 |
| 801 | Ga0496110_0607993 | 3300048913 | Bacteria | 991 |
| 802 | Ga0496110_1733917 | 3300048913 | Bacteria | 535 |
| 803 | Ga0496111_0021913 | 3300048914 | Bacteria | 4466 |
| 804 | Ga0496111_0069011 | 3300048914 | Bacteria | 2570 |
| 805 | Ga0496111_0276250 | 3300048914 | Bacteria | 1246 |
| 806 | Ga0496111_0309142 | 3300048914 | Bacteria | 1171 |
| 807 | Ga0496111_0620844 | 3300048914 | Bacteria | 790 |
| 808 | Ga0496111_0792646 | 3300048914 | Bacteria | 686 |
| 809 | Ga0496111_0870876 | 3300048914 | Bacteria | 650 |
| 810 | Ga0496111_0881956 | 3300048914 | Bacteria | 645 |
| 811 | Ga0496112_0012650 | 3300048915 | Bacteria | 7758 |
| 812 | Ga0496112_1131876 | 3300048915 | Bacteria | 700 |
| 813 | Ga0496112_1147788 | 3300048915 | Bacteria | 694 |
| 814 | Ga0496113_0299038 | 3300048916 | Bacteria | 1288 |
| 815 | Ga0496114_0066334 | 3300048917 | Bacteria | 3025 |
| 816 | Ga0496114_0190045 | 3300048917 | Bacteria | 1796 |
| 817 | Ga0496114_0233484 | 3300048917 | Bacteria | 1616 |
| 818 | Ga0496114_0244125 | 3300048917 | Bacteria | 1579 |
| 819 | Ga0496114_0297163 | 3300048917 | Bacteria | 1425 |
| 820 | Ga0496114_0300732 | 3300048917 | Bacteria | 1416 |
| 821 | Ga0496114_0570531 | 3300048917 | Bacteria | 999 |
| 822 | Ga0496114_0782312 | 3300048917 | Bacteria | 832 |
| 823 | Ga0496114_1068777 | 3300048917 | Bacteria | 691 |
| 824 | Ga0496114_1106458 | 3300048917 | Bacteria | 677 |
| 825 | Ga0496115_0123607 | 3300048918 | Bacteria | 2130 |
| 826 | Ga0496115_0666949 | 3300048918 | Bacteria | 820 |
| 827 | Ga0496124_0186718 | 3300048927 | Bacteria | 1590 |
| 828 | Ga0496124_0596134 | 3300048927 | Bacteria | 720 |
| 829 | Ga0501306_004752 | 3300049127 | Bacteria | 1534 |
| 830 | Ga0501306_008227 | 3300049127 | Bacteria | 1268 |
| 831 | Ga0501306_009279 | 3300049127 | Bacteria | 1218 |
| 832 | Ga0501306_011666 | 3300049127 | Bacteria | 1124 |
| 833 | Ga0501306_018050 | 3300049127 | Bacteria | 962 |
| 834 | Ga0501306_024872 | 3300049127 | Bacteria | 858 |
| 835 | Ga0501306_032117 | 3300049127 | Bacteria | 785 |
| 836 | Ga0501306_043066 | 3300049127 | Bacteria | 705 |
| 837 | Ga0501306_049266 | 3300049127 | Bacteria | 672 |
| 838 | Ga0501306_081467 | 3300049127 | Bacteria | 559 |
| 839 | Ga0501308_004488 | 3300049128 | Bacteria | 1347 |
| 840 | Ga0501308_007774 | 3300049128 | Bacteria | 1131 |
| 841 | Ga0501308_011000 | 3300049128 | Bacteria | 1014 |
| 842 | Ga0501308_015225 | 3300049128 | Bacteria | 909 |
| 843 | Ga0501308_021454 | 3300049128 | Bacteria | 811 |
| 844 | Ga0501308_023913 | 3300049128 | Bacteria | 783 |
| 845 | Ga0501308_028631 | 3300049128 | Bacteria | 737 |
| 846 | Ga0501308_053802 | 3300049128 | Bacteria | 595 |
| 847 | Ga0501308_066625 | 3300049128 | Bacteria | 553 |
| 848 | Ga0501308_078160 | 3300049128 | Bacteria | 523 |
| 849 | Ga0501309_000178 | 3300049129 | Bacteria | 4209 |
| 850 | Ga0501309_004651 | 3300049129 | Bacteria | 1606 |
| 851 | Ga0501309_031341 | 3300049129 | Bacteria | 786 |
| 852 | Ga0501309_035097 | 3300049129 | Bacteria | 751 |
| 853 | Ga0501309_066995 | 3300049129 | Bacteria | 585 |
| 854 | Ga0501309_070980 | 3300049129 | Bacteria | 572 |
| 855 | Ga0501310_000215 | 3300049130 | Bacteria | 5482 |
| 856 | Ga0501310_000840 | 3300049130 | Bacteria | 2737 |
| 857 | Ga0501310_004536 | 3300049130 | Bacteria | 1398 |
| 858 | Ga0501310_014670 | 3300049130 | Bacteria | 922 |
| 859 | Ga0501310_037052 | 3300049130 | Bacteria | 667 |
| 860 | Ga0501310_039053 | 3300049130 | Bacteria | 655 |
| 861 | Ga0501310_052760 | 3300049130 | Bacteria | 591 |
| 862 | Ga0501310_056296 | 3300049130 | Bacteria | 578 |
| 863 | Ga0501310_060938 | 3300049130 | Bacteria | 562 |
| 864 | Ga0501310_081428 | 3300049130 | Bacteria | 509 |
| 865 | Ga0501341_17736 | 3300049131 | Bacteria | 512 |
| 866 | Ga0501304_002507 | 3300049160 | Bacteria | 1282 |
| 867 | Ga0501304_007286 | 3300049160 | Bacteria | 910 |
| 868 | Ga0501304_011121 | 3300049160 | Bacteria | 796 |
| 869 | Ga0501304_014118 | 3300049160 | Bacteria | 737 |
| 870 | Ga0501304_031867 | 3300049160 | Bacteria | 564 |
| 871 | Ga0501304_041367 | 3300049160 | Bacteria | 516 |
| 872 | Ga0501305_011790 | 3300049161 | Bacteria | 1186 |
| 873 | Ga0501305_021222 | 3300049161 | Bacteria | 959 |
| 874 | Ga0501305_044157 | 3300049161 | Bacteria | 732 |
| 875 | Ga0501305_046041 | 3300049161 | Bacteria | 721 |
| 876 | Ga0501305_047739 | 3300049161 | Bacteria | 712 |
| 877 | Ga0501305_052611 | 3300049161 | Bacteria | 686 |
| 878 | Ga0501305_092746 | 3300049161 | Bacteria | 555 |
| 879 | Ga0501305_108648 | 3300049161 | Bacteria | 523 |
| 880 | Ga0501307_001493 | 3300049162 | Bacteria | 1987 |
| 881 | Ga0501307_005860 | 3300049162 | Bacteria | 1308 |
| 882 | Ga0501307_018749 | 3300049162 | Bacteria | 882 |
| 883 | Ga0501307_024224 | 3300049162 | Bacteria | 808 |
| 884 | Ga0501307_027832 | 3300049162 | Bacteria | 770 |
| 885 | Ga0501307_035776 | 3300049162 | Bacteria | 706 |
| 886 | Ga0501307_052431 | 3300049162 | Bacteria | 616 |
| 887 | Ga0501307_067857 | 3300049162 | Bacteria | 564 |
| 888 | Ga0501307_074435 | 3300049162 | Bacteria | 546 |
| 889 | Ga0501307_088798 | 3300049162 | Bacteria | 513 |
| 890 | Ga0501291_011421 | 3300049514 | Bacteria | 1280 |
| 891 | Ga0501291_033669 | 3300049514 | Bacteria | 875 |
| 892 | Ga0501311_000103 | 3300049527 | Bacteria | 4135 |
| 893 | Ga0501311_000190 | 3300049527 | Bacteria | 3584 |
| 894 | Ga0501311_014637 | 3300049527 | Bacteria | 1003 |
| 895 | Ga0501311_017349 | 3300049527 | Bacteria | 946 |
| 896 | Ga0501311_019991 | 3300049527 | Bacteria | 902 |
| 897 | Ga0501311_020635 | 3300049527 | Bacteria | 893 |
| 898 | Ga0501311_056571 | 3300049527 | Bacteria | 625 |
| 899 | Ga0501311_057329 | 3300049527 | Bacteria | 622 |
| 900 | Ga0501311_063885 | 3300049527 | Bacteria | 600 |
| 901 | Ga0501311_066930 | 3300049527 | Bacteria | 590 |
| 902 | Ga0501311_069162 | 3300049527 | Bacteria | 583 |
| 903 | Ga0501311_074993 | 3300049527 | Bacteria | 567 |
| 904 | Ga0501311_082937 | 3300049527 | Bacteria | 548 |
| 905 | Ga0501312_006477 | 3300049528 | Bacteria | 1462 |
| 906 | Ga0501312_012450 | 3300049528 | Bacteria | 1170 |
| 907 | Ga0501312_014599 | 3300049528 | Bacteria | 1105 |
| 908 | Ga0501312_016524 | 3300049528 | Bacteria | 1057 |
| 909 | Ga0501312_017160 | 3300049528 | Bacteria | 1043 |
| 910 | Ga0501312_033623 | 3300049528 | Bacteria | 814 |
| 911 | Ga0501312_078339 | 3300049528 | Bacteria | 595 |
| 912 | Ga0501312_079182 | 3300049528 | Bacteria | 593 |
| 913 | Ga0501312_124075 | 3300049528 | Bacteria | 502 |
| 914 | Ga0501313_005383 | 3300049529 | Bacteria | 1350 |
| 915 | Ga0501313_006104 | 3300049529 | Bacteria | 1294 |
| 916 | Ga0501313_023498 | 3300049529 | Bacteria | 773 |
| 917 | Ga0501313_047063 | 3300049529 | Bacteria | 590 |
| 918 | Ga0501314_006582 | 3300049530 | Bacteria | 1015 |
| 919 | Ga0501314_014546 | 3300049530 | Bacteria | 772 |
| 920 | Ga0501315_000132 | 3300049531 | Bacteria | 4114 |
| 921 | Ga0501315_003871 | 3300049531 | Bacteria | 1528 |
| 922 | Ga0501315_005704 | 3300049531 | Bacteria | 1359 |
| 923 | Ga0501315_012278 | 3300049531 | Bacteria | 1057 |
| 924 | Ga0501315_012729 | 3300049531 | Bacteria | 1045 |
| 925 | Ga0501315_043330 | 3300049531 | Bacteria | 687 |
| 926 | Ga0501315_066990 | 3300049531 | Bacteria | 590 |
| 927 | Ga0501316_002526 | 3300049532 | Bacteria | 1697 |
| 928 | Ga0501316_005123 | 3300049532 | Bacteria | 1347 |
| 929 | Ga0501316_006023 | 3300049532 | Bacteria | 1278 |
| 930 | Ga0501316_008263 | 3300049532 | Bacteria | 1147 |
| 931 | Ga0501316_009854 | 3300049532 | Bacteria | 1079 |
| 932 | Ga0501316_031851 | 3300049532 | Bacteria | 708 |
| 933 | Ga0501316_049227 | 3300049532 | Bacteria | 604 |
| 934 | Ga0501316_050391 | 3300049532 | Bacteria | 598 |
| 935 | Ga0501316_067268 | 3300049532 | Bacteria | 538 |
| 936 | Ga0501316_076175 | 3300049532 | Bacteria | 514 |
| 937 | Ga0501317_000171 | 3300049533 | Bacteria | 3756 |
| 938 | Ga0501317_002626 | 3300049533 | Bacteria | 1718 |
| 939 | Ga0501317_015051 | 3300049533 | Bacteria | 988 |
| 940 | Ga0501317_016411 | 3300049533 | Bacteria | 960 |
| 941 | Ga0501317_017566 | 3300049533 | Bacteria | 939 |
| 942 | Ga0501317_017641 | 3300049533 | Bacteria | 938 |
| 943 | Ga0501317_018365 | 3300049533 | Bacteria | 925 |
| 944 | Ga0501317_019027 | 3300049533 | Bacteria | 914 |
| 945 | Ga0501317_022777 | 3300049533 | Bacteria | 860 |
| 946 | Ga0501317_034773 | 3300049533 | Bacteria | 747 |
| 947 | Ga0501317_059862 | 3300049533 | Bacteria | 623 |
| 948 | Ga0501317_076224 | 3300049533 | Bacteria | 573 |
| 949 | Ga0501317_080033 | 3300049533 | Bacteria | 564 |
| 950 | Ga0501317_104612 | 3300049533 | Bacteria | 514 |
| 951 | Ga0501317_112878 | 3300049533 | Bacteria | 501 |
| 952 | Ga0501318_000714 | 3300049534 | Bacteria | 2276 |
| 953 | Ga0501318_009636 | 3300049534 | Bacteria | 1057 |
| 954 | Ga0501318_009977 | 3300049534 | Bacteria | 1045 |
| 955 | Ga0501318_011256 | 3300049534 | Bacteria | 1008 |
| 956 | Ga0501318_014331 | 3300049534 | Bacteria | 934 |
| 957 | Ga0501318_015961 | 3300049534 | Bacteria | 902 |
| 958 | Ga0501318_017620 | 3300049534 | Bacteria | 874 |
| 959 | Ga0501318_019840 | 3300049534 | Bacteria | 842 |
| 960 | Ga0501318_026542 | 3300049534 | Bacteria | 765 |
| 961 | Ga0501318_028928 | 3300049534 | Bacteria | 744 |
| 962 | Ga0501318_039089 | 3300049534 | Bacteria | 672 |
| 963 | Ga0501318_055256 | 3300049534 | Bacteria | 599 |
| 964 | Ga0501318_059911 | 3300049534 | Bacteria | 582 |
| 965 | Ga0501318_060076 | 3300049534 | Bacteria | 582 |
| 966 | Ga0501318_076638 | 3300049534 | Bacteria | 536 |
| 967 | Ga0501318_083205 | 3300049534 | Bacteria | 521 |
| 968 | Ga0501318_086630 | 3300049534 | Bacteria | 514 |
| 969 | Ga0501319_001563 | 3300049535 | Bacteria | 1345 |
| 970 | Ga0501319_004999 | 3300049535 | Bacteria | 939 |
| 971 | Ga0501319_032265 | 3300049535 | Bacteria | 508 |
| 972 | Ga0501320_000195 | 3300049536 | Bacteria | 3108 |
| 973 | Ga0501320_012544 | 3300049536 | Bacteria | 893 |
| 974 | Ga0501320_020819 | 3300049536 | Bacteria | 758 |
| 975 | Ga0501320_026475 | 3300049536 | Bacteria | 701 |
| 976 | Ga0501320_053954 | 3300049536 | Bacteria | 553 |
| 977 | Ga0501320_060886 | 3300049536 | Bacteria | 531 |
| 978 | Ga0501321_000036 | 3300049537 | Bacteria | 6130 |
| 979 | Ga0501321_000377 | 3300049537 | Bacteria | 2770 |
| 980 | Ga0501321_000884 | 3300049537 | Bacteria | 2168 |
| 981 | Ga0501321_001182 | 3300049537 | Bacteria | 2003 |
| 982 | Ga0501321_004843 | 3300049537 | Bacteria | 1305 |
| 983 | Ga0501321_006614 | 3300049537 | Bacteria | 1184 |
| 984 | Ga0501321_017738 | 3300049537 | Bacteria | 858 |
| 985 | Ga0501321_050996 | 3300049537 | Bacteria | 605 |
| 986 | Ga0501321_056278 | 3300049537 | Bacteria | 585 |
| 987 | Ga0501321_057389 | 3300049537 | Bacteria | 581 |
| 988 | Ga0501321_058781 | 3300049537 | Bacteria | 577 |
| 989 | Ga0501321_066729 | 3300049537 | Bacteria | 553 |
| 990 | Ga0501321_087213 | 3300049537 | Bacteria | 505 |
| 991 | Ga0501322_001402 | 3300049538 | Bacteria | 1349 |
| 992 | Ga0501322_003259 | 3300049538 | Bacteria | 1045 |
| 993 | Ga0501322_003301 | 3300049538 | Bacteria | 1041 |
| 994 | Ga0501322_009483 | 3300049538 | Bacteria | 738 |
| 995 | Ga0501322_020039 | 3300049538 | Bacteria | 582 |
| 996 | Ga0501322_029904 | 3300049538 | Bacteria | 511 |
| 997 | Ga0501323_000118 | 3300049539 | Bacteria | 4392 |
| 998 | Ga0501323_003789 | 3300049539 | Bacteria | 1566 |
| 999 | Ga0501323_007363 | 3300049539 | Bacteria | 1255 |
| 1000 | Ga0501323_028255 | 3300049539 | Bacteria | 776 |
| 1001 | Ga0501323_041980 | 3300049539 | Bacteria | 673 |
| 1002 | Ga0501323_045329 | 3300049539 | Bacteria | 655 |
| 1003 | Ga0501323_051700 | 3300049539 | Bacteria | 625 |
| 1004 | Ga0501323_056786 | 3300049539 | Bacteria | 604 |
| 1005 | Ga0501323_061508 | 3300049539 | Bacteria | 587 |
| 1006 | Ga0501323_074484 | 3300049539 | Bacteria | 547 |
| 1007 | Ga0501323_090304 | 3300049539 | Bacteria | 510 |
| 1008 | Ga0501324_000012 | 3300049540 | Bacteria | 6616 |
| 1009 | Ga0501324_004285 | 3300049540 | Bacteria | 1131 |
| 1010 | Ga0501324_007536 | 3300049540 | Bacteria | 942 |
| 1011 | Ga0501324_009947 | 3300049540 | Bacteria | 859 |
| 1012 | Ga0501324_011807 | 3300049540 | Bacteria | 811 |
| 1013 | Ga0501324_024618 | 3300049540 | Bacteria | 632 |
| 1014 | Ga0501324_037264 | 3300049540 | Bacteria | 548 |
| 1015 | Ga0501324_042141 | 3300049540 | Bacteria | 524 |
| 1016 | Ga0501324_045939 | 3300049540 | Bacteria | 508 |
| 1017 | Ga0501324_047245 | 3300049540 | Bacteria | 503 |
| 1018 | Ga0501325_000185 | 3300049541 | Bacteria | 2457 |
| 1019 | Ga0501325_001935 | 3300049541 | Bacteria | 1354 |
| 1020 | Ga0501325_005144 | 3300049541 | Bacteria | 1030 |
| 1021 | Ga0501327_02154 | 3300049543 | Bacteria | 1006 |
| 1022 | Ga0501328_01590 | 3300049544 | Bacteria | 923 |
| 1023 | Ga0501330_020540 | 3300049546 | Bacteria | 529 |
| 1024 | Ga0501331_13252 | 3300049547 | Bacteria | 533 |
| 1025 | Ga0501333_004428 | 3300049549 | Bacteria | 885 |
| 1026 | Ga0501335_023778 | 3300049551 | Bacteria | 666 |
| 1027 | Ga0501337_021275 | 3300049553 | Bacteria | 529 |
| 1028 | Ga0501340_006300 | 3300049556 | Bacteria | 794 |
| 1029 | Ga0501340_022921 | 3300049556 | Bacteria | 533 |
| 1030 | Ga0501031_0015297 | 3300049568 | Bacteria | 4984 |
| 1031 | Ga0501031_0019900 | 3300049568 | Bacteria | 4375 |
| 1032 | Ga0501031_0036192 | 3300049568 | Bacteria | 3220 |
| 1033 | Ga0501031_0120709 | 3300049568 | Bacteria | 1712 |
| 1034 | Ga0501031_0311507 | 3300049568 | Bacteria | 1020 |
| 1035 | Ga0501031_0335783 | 3300049568 | Bacteria | 978 |
| 1036 | Ga0501031_0633992 | 3300049568 | Bacteria | 687 |
| 1037 | Ga0501032_0027010 | 3300049569 | Bacteria | 3946 |
| 1038 | Ga0501032_0163681 | 3300049569 | Bacteria | 1460 |
| 1039 | Ga0501032_0163970 | 3300049569 | Bacteria | 1459 |
| 1040 | Ga0501032_0545219 | 3300049569 | Bacteria | 740 |
| 1041 | Ga0501032_0792926 | 3300049569 | Bacteria | 598 |
| 1042 | Ga0501033_0061150 | 3300049570 | Bacteria | 2776 |
| 1043 | Ga0501033_0545457 | 3300049570 | Bacteria | 799 |
| 1044 | Ga0501033_1086889 | 3300049570 | Bacteria | 532 |
| 1045 | Ga0501033_1121739 | 3300049570 | Bacteria | 523 |
| 1046 | Ga0501034_0069200 | 3300049571 | Bacteria | 3540 |
| 1047 | Ga0501034_0224517 | 3300049571 | Bacteria | 1830 |
| 1048 | Ga0501034_0352454 | 3300049571 | Bacteria | 1400 |
| 1049 | Ga0501034_0385484 | 3300049571 | Bacteria | 1326 |
| 1050 | Ga0501034_1298238 | 3300049571 | Bacteria | 605 |
| 1051 | Ga0501036_0093295 | 3300049572 | Bacteria | 2543 |
| 1052 | Ga0501036_0149769 | 3300049572 | Bacteria | 1968 |
| 1053 | Ga0501036_0151978 | 3300049572 | Bacteria | 1952 |
| 1054 | Ga0501036_0582051 | 3300049572 | Bacteria | 929 |
| 1055 | Ga0501036_0749634 | 3300049572 | Bacteria | 805 |
| 1056 | Ga0501036_0944105 | 3300049572 | Bacteria | 707 |
| 1057 | Ga0501036_0958206 | 3300049572 | Bacteria | 701 |
| 1058 | Ga0501036_1354913 | 3300049572 | Bacteria | 578 |
| 1059 | Ga0501037_0028700 | 3300049573 | Bacteria | 4110 |
| 1060 | Ga0501037_0054932 | 3300049573 | Bacteria | 2912 |
| 1061 | Ga0501037_0160089 | 3300049573 | Bacteria | 1605 |
| 1062 | Ga0501037_0216570 | 3300049573 | Bacteria | 1349 |
| 1063 | Ga0501037_0254772 | 3300049573 | Bacteria | 1227 |
| 1064 | Ga0501037_0311649 | 3300049573 | Bacteria | 1091 |
| 1065 | Ga0501037_0676042 | 3300049573 | Bacteria | 688 |
| 1066 | Ga0501038_0040267 | 3300049574 | Bacteria | 4083 |
| 1067 | Ga0501038_0111224 | 3300049574 | Bacteria | 2269 |
| 1068 | Ga0501038_0187963 | 3300049574 | Bacteria | 1663 |
| 1069 | Ga0501038_0234621 | 3300049574 | Bacteria | 1458 |
| 1070 | Ga0501038_0647973 | 3300049574 | Bacteria | 795 |
| 1071 | Ga0501039_0032214 | 3300049575 | Bacteria | 4040 |
| 1072 | Ga0501039_0034588 | 3300049575 | Bacteria | 3899 |
| 1073 | Ga0501039_0055448 | 3300049575 | Bacteria | 3069 |
| 1074 | Ga0501039_0151078 | 3300049575 | Bacteria | 1824 |
| 1075 | Ga0501039_0154443 | 3300049575 | Bacteria | 1803 |
| 1076 | Ga0501039_0335062 | 3300049575 | Bacteria | 1189 |
| 1077 | Ga0501039_0521992 | 3300049575 | Bacteria | 932 |
| 1078 | Ga0501039_0551151 | 3300049575 | Bacteria | 905 |
| 1079 | Ga0501039_0828661 | 3300049575 | Bacteria | 721 |
| 1080 | Ga0501040_0019721 | 3300049576 | Bacteria | 4487 |
| 1081 | Ga0501040_0190605 | 3300049576 | Bacteria | 1454 |
| 1082 | Ga0501040_0372261 | 3300049576 | Bacteria | 1024 |
| 1083 | Ga0501040_0632195 | 3300049576 | Bacteria | 773 |
| 1084 | Ga0501040_0693455 | 3300049576 | Bacteria | 736 |
| 1085 | Ga0501041_0006740 | 3300049577 | Bacteria | 6731 |
| 1086 | Ga0501041_0117192 | 3300049577 | Bacteria | 1654 |
| 1087 | Ga0501041_0126746 | 3300049577 | Bacteria | 1589 |
| 1088 | Ga0501041_0432802 | 3300049577 | Bacteria | 835 |
| 1089 | Ga0501042_0021479 | 3300049578 | Bacteria | 4499 |
| 1090 | Ga0501042_0175282 | 3300049578 | Bacteria | 1547 |
| 1091 | Ga0501042_0327248 | 3300049578 | Bacteria | 1107 |
| 1092 | Ga0501042_0379379 | 3300049578 | Bacteria | 1023 |
| 1093 | Ga0501042_0494290 | 3300049578 | Bacteria | 888 |
| 1094 | Ga0501042_0541720 | 3300049578 | Bacteria | 846 |
| 1095 | Ga0501042_0607176 | 3300049578 | Bacteria | 795 |
| 1096 | Ga0501042_0722915 | 3300049578 | Bacteria | 724 |
| 1097 | Ga0501042_0744455 | 3300049578 | Bacteria | 713 |
| 1098 | Ga0501042_0858000 | 3300049578 | Bacteria | 661 |
| 1099 | Ga0501043_0158139 | 3300049579 | Bacteria | 1771 |
| 1100 | Ga0501043_0189571 | 3300049579 | Bacteria | 1599 |
| 1101 | Ga0501043_0387140 | 3300049579 | Bacteria | 1058 |
| 1102 | Ga0501043_0821173 | 3300049579 | Bacteria | 671 |
| 1103 | Ga0501046_0071881 | 3300049580 | Bacteria | 2686 |
| 1104 | Ga0501046_0244733 | 3300049580 | Bacteria | 1322 |
| 1105 | Ga0501046_0306352 | 3300049580 | Bacteria | 1159 |
| 1106 | Ga0501046_0447426 | 3300049580 | Bacteria | 929 |
| 1107 | Ga0501046_0604422 | 3300049580 | Bacteria | 778 |
| 1108 | Ga0501047_0023921 | 3300049581 | Bacteria | 5865 |
| 1109 | Ga0501047_0033441 | 3300049581 | Bacteria | 4963 |
| 1110 | Ga0501048_0015873 | 3300049582 | Bacteria | 5557 |
| 1111 | Ga0501048_0038252 | 3300049582 | Bacteria | 3443 |
| 1112 | Ga0501048_0208955 | 3300049582 | Bacteria | 1384 |
| 1113 | Ga0501048_0281957 | 3300049582 | Bacteria | 1181 |
| 1114 | Ga0501048_0362904 | 3300049582 | Bacteria | 1033 |
| 1115 | Ga0501048_0507911 | 3300049582 | Bacteria | 864 |
| 1116 | Ga0501067_0053577 | 3300049583 | Bacteria | 2235 |
| 1117 | Ga0501067_0103653 | 3300049583 | Bacteria | 1581 |
| 1118 | Ga0501067_0126611 | 3300049583 | Bacteria | 1421 |
| 1119 | Ga0501067_0142954 | 3300049583 | Bacteria | 1333 |
| 1120 | Ga0501067_0148213 | 3300049583 | Bacteria | 1307 |
| 1121 | Ga0501067_0213221 | 3300049583 | Bacteria | 1075 |
| 1122 | Ga0501067_0258598 | 3300049583 | Bacteria | 969 |
| 1123 | Ga0501067_0283496 | 3300049583 | Bacteria | 922 |
| 1124 | Ga0501067_0325791 | 3300049583 | Bacteria | 855 |
| 1125 | Ga0501068_0044498 | 3300049584 | Bacteria | 2673 |
| 1126 | Ga0501068_0047352 | 3300049584 | Bacteria | 2594 |
| 1127 | Ga0501068_0058339 | 3300049584 | Bacteria | 2342 |
| 1128 | Ga0501068_0155931 | 3300049584 | Bacteria | 1437 |
| 1129 | Ga0501068_0261968 | 3300049584 | Bacteria | 1103 |
| 1130 | Ga0501068_0269761 | 3300049584 | Bacteria | 1086 |
| 1131 | Ga0501069_0043121 | 3300049585 | Bacteria | 2496 |
| 1132 | Ga0501069_0099451 | 3300049585 | Bacteria | 1651 |
| 1133 | Ga0501069_0139303 | 3300049585 | Bacteria | 1391 |
| 1134 | Ga0501069_0150761 | 3300049585 | Bacteria | 1336 |
| 1135 | Ga0501069_0252417 | 3300049585 | Bacteria | 1029 |
| 1136 | Ga0501069_0299656 | 3300049585 | Bacteria | 943 |
| 1137 | Ga0501069_0302659 | 3300049585 | Bacteria | 938 |
| 1138 | Ga0501069_0321693 | 3300049585 | Bacteria | 909 |
| 1139 | Ga0501069_0406557 | 3300049585 | Bacteria | 806 |
| 1140 | Ga0501069_0424210 | 3300049585 | Bacteria | 789 |
| 1141 | Ga0501070_0004983 | 3300049586 | Bacteria | 11332 |
| 1142 | Ga0501070_0225481 | 3300049586 | Bacteria | 1536 |
| 1143 | Ga0501070_0368123 | 3300049586 | Bacteria | 1165 |
| 1144 | Ga0501070_0828120 | 3300049586 | Bacteria | 725 |
| 1145 | Ga0501070_0947726 | 3300049586 | Bacteria | 669 |
| 1146 | Ga0501070_1111858 | 3300049586 | Bacteria | 609 |
| 1147 | Ga0501070_1547483 | 3300049586 | Bacteria | 501 |
| 1148 | Ga0501071_0003704 | 3300049587 | Bacteria | 9594 |
| 1149 | Ga0501071_0005948 | 3300049587 | Bacteria | 7895 |
| 1150 | Ga0501071_0308535 | 3300049587 | Bacteria | 1200 |
| 1151 | Ga0501071_0389469 | 3300049587 | Bacteria | 1063 |
| 1152 | Ga0501071_0430651 | 3300049587 | Bacteria | 1009 |
| 1153 | Ga0501071_1323468 | 3300049587 | Bacteria | 556 |
| 1154 | Ga0501072_0018905 | 3300049588 | Bacteria | 5316 |
| 1155 | Ga0501072_0054085 | 3300049588 | Bacteria | 3162 |
| 1156 | Ga0501072_0230228 | 3300049588 | Bacteria | 1476 |
| 1157 | Ga0501072_0330311 | 3300049588 | Bacteria | 1211 |
| 1158 | Ga0501072_0449580 | 3300049588 | Bacteria | 1020 |
| 1159 | Ga0501072_0504454 | 3300049588 | Bacteria | 957 |
| 1160 | Ga0501072_0576215 | 3300049588 | Bacteria | 888 |
| 1161 | Ga0501072_0900001 | 3300049588 | Bacteria | 691 |
| 1162 | Ga0501073_0093221 | 3300049589 | Bacteria | 2092 |
| 1163 | Ga0501073_0477798 | 3300049589 | Bacteria | 862 |
| 1164 | Ga0501073_0644269 | 3300049589 | Bacteria | 731 |
| 1165 | Ga0501073_0931276 | 3300049589 | Bacteria | 598 |
| 1166 | Ga0501074_0014346 | 3300049590 | Bacteria | 5765 |
| 1167 | Ga0501074_0133573 | 3300049590 | Bacteria | 1775 |
| 1168 | Ga0501074_0375209 | 3300049590 | Bacteria | 1009 |
| 1169 | Ga0501074_0460916 | 3300049590 | Bacteria | 901 |
| 1170 | Ga0501074_0751905 | 3300049590 | Bacteria | 687 |
| 1171 | Ga0501074_0814990 | 3300049590 | Bacteria | 658 |
| 1172 | Ga0501074_0867194 | 3300049590 | Bacteria | 636 |
| 1173 | Ga0501075_0017703 | 3300049591 | Bacteria | 5146 |
| 1174 | Ga0501075_0057160 | 3300049591 | Bacteria | 2937 |
| 1175 | Ga0501075_0150308 | 3300049591 | Bacteria | 1775 |
| 1176 | Ga0501075_0475760 | 3300049591 | Bacteria | 953 |
| 1177 | Ga0501075_0558691 | 3300049591 | Bacteria | 873 |
| 1178 | Ga0501075_0667128 | 3300049591 | Bacteria | 792 |
| 1179 | Ga0501075_0699833 | 3300049591 | Bacteria | 772 |
| 1180 | Ga0501076_0007352 | 3300049592 | Bacteria | 8014 |
| 1181 | Ga0501076_0086238 | 3300049592 | Bacteria | 2523 |
| 1182 | Ga0501076_0196834 | 3300049592 | Bacteria | 1645 |
| 1183 | Ga0501076_0299996 | 3300049592 | Bacteria | 1317 |
| 1184 | Ga0501076_0435768 | 3300049592 | Bacteria | 1079 |
| 1185 | Ga0501076_0474133 | 3300049592 | Bacteria | 1031 |
| 1186 | Ga0501076_0630404 | 3300049592 | Bacteria | 884 |
| 1187 | Ga0501076_0777705 | 3300049592 | Bacteria | 790 |
| 1188 | Ga0501076_1135905 | 3300049592 | Bacteria | 643 |
| 1189 | Ga0501077_0003693 | 3300049593 | Bacteria | 9204 |
| 1190 | Ga0501077_0394824 | 3300049593 | Bacteria | 884 |
| 1191 | Ga0501077_0549433 | 3300049593 | Bacteria | 741 |
| 1192 | Ga0501077_0752048 | 3300049593 | Bacteria | 627 |
| 1193 | Ga0501216_031581 | 3300049660 | Bacteria | 980 |
| 1194 | Ga0501227_195147 | 3300049665 | Bacteria | 572 |
| 1195 | Ga0501246_015266 | 3300049676 | Bacteria | 747 |
| 1196 | Ga0501253_116410 | 3300049683 | Bacteria | 643 |
| 1197 | Ga0501221_106772 | 3300049704 | Bacteria | 701 |
| 1198 | Ga0501079_0022088 | 3300049741 | Bacteria | 4875 |
| 1199 | Ga0501079_0027696 | 3300049741 | Bacteria | 4347 |
| 1200 | Ga0501079_0305150 | 3300049741 | Bacteria | 1245 |
| 1201 | Ga0501079_0443421 | 3300049741 | Bacteria | 1019 |
| 1202 | Ga0501079_0518588 | 3300049741 | Bacteria | 937 |
| 1203 | Ga0501079_0537448 | 3300049741 | Bacteria | 919 |
| 1204 | Ga0501080_0141216 | 3300049742 | Bacteria | 2226 |
| 1205 | Ga0501080_0216610 | 3300049742 | Bacteria | 1753 |
| 1206 | Ga0501080_0379218 | 3300049742 | Bacteria | 1274 |
| 1207 | Ga0501080_0731352 | 3300049742 | Bacteria | 871 |
| 1208 | Ga0501080_1336902 | 3300049742 | Bacteria | 613 |
| 1209 | Ga0501081_0212485 | 3300049743 | Bacteria | 1405 |
| 1210 | Ga0501083_0105387 | 3300049744 | Bacteria | 1857 |
| 1211 | Ga0501083_0134682 | 3300049744 | Bacteria | 1619 |
| 1212 | Ga0501083_0746392 | 3300049744 | Bacteria | 637 |
| 1213 | Ga0501035_0097705 | 3300049822 | Bacteria | 2578 |
| 1214 | Ga0501035_0334257 | 3300049822 | Bacteria | 1270 |
| 1215 | Ga0501035_0439763 | 3300049822 | Bacteria | 1080 |
| 1216 | Ga0501035_0660930 | 3300049822 | Bacteria | 846 |
| 1217 | Ga0501035_0889635 | 3300049822 | Bacteria | 706 |
| 1218 | Ga0501044_0004036 | 3300049823 | Bacteria | 16463 |
| 1219 | Ga0501044_0101925 | 3300049823 | Bacteria | 2887 |
| 1220 | Ga0501044_0282550 | 3300049823 | Bacteria | 1593 |
| 1221 | Ga0501044_0777629 | 3300049823 | Bacteria | 838 |
| 1222 | Ga0501044_1297966 | 3300049823 | Bacteria | 594 |
| 1223 | Ga0501045_0006942 | 3300049824 | Bacteria | 7848 |
| 1224 | Ga0501045_0168860 | 3300049824 | Bacteria | 1629 |
| 1225 | Ga0501045_0171369 | 3300049824 | Bacteria | 1616 |
| 1226 | Ga0501045_0378299 | 3300049824 | Bacteria | 1054 |
| 1227 | Ga0501045_0785148 | 3300049824 | Bacteria | 701 |
| 1228 | nmdc:mga03683_2815_c1 | 3300050489 | Bacteria | 5478 |
| 1229 | nmdc:mga03683_48175_c1 | 3300050489 | Bacteria | 1771 |
| 1230 | nmdc:mga03n38_174315_c1 | 3300050490 | Bacteria | 1098 |
| 1231 | nmdc:mga03n38_27461_c1 | 3300050490 | Bacteria | 2362 |
| 1232 | nmdc:mga03n38_46422_c1 | 3300050490 | Bacteria | 1918 |
| 1233 | nmdc:mga03n38_6080_c1 | 3300050490 | Bacteria | 4168 |
| 1234 | nmdc:mga03n38_6390_c1 | 3300050490 | Bacteria | 4090 |
| 1235 | nmdc:mga03n38_978246_c1 | 3300050490 | Bacteria | 501 |
| 1236 | nmdc:mga00v17_180570_c1 | 3300050491 | Bacteria | 1362 |
| 1237 | nmdc:mga00v17_188155_c1 | 3300050491 | Bacteria | 1333 |
| 1238 | nmdc:mga00v17_21651_c2 | 3300050491 | Bacteria | 2083 |
| 1239 | nmdc:mga00v17_33777_c1 | 3300050491 | Bacteria | 3034 |
| 1240 | nmdc:mga00v17_396942_c1 | 3300050491 | Bacteria | 896 |
| 1241 | nmdc:mga00v17_47670_c1 | 3300050491 | Bacteria | 2596 |
| 1242 | nmdc:mga00v17_72501_c1 | 3300050491 | Bacteria | 2137 |
| 1243 | nmdc:mga00v17_78476_c1 | 3300050491 | Bacteria | 2058 |
| 1244 | nmdc:mga00v17_80515_c1 | 3300050491 | Bacteria | 2033 |
| 1245 | nmdc:mga00v17_90693_c2 | 3300050491 | Bacteria | 1411 |
| 1246 | nmdc:mga0yw44_1197_c1 | 3300050492 | Bacteria | 10147 |
| 1247 | nmdc:mga0yw44_12755_c1 | 3300050492 | Bacteria | 4395 |
| 1248 | nmdc:mga0yw44_128443_c1 | 3300050492 | Bacteria | 1639 |
| 1249 | nmdc:mga0yw44_256929_c1 | 3300050492 | Bacteria | 1164 |
| 1250 | nmdc:mga0yw44_265539_c1 | 3300050492 | Bacteria | 1145 |
| 1251 | nmdc:mga0yw44_276350_c1 | 3300050492 | Bacteria | 803 |
| 1252 | nmdc:mga0yw44_341012_c1 | 3300050492 | Bacteria | 1008 |
| 1253 | nmdc:mga0yw44_353326_c1 | 3300050492 | Bacteria | 990 |
| 1254 | nmdc:mga0yw44_405602_c1 | 3300050492 | Bacteria | 922 |
| 1255 | nmdc:mga0yw44_56680_c1 | 3300050492 | Bacteria | 2389 |
| 1256 | nmdc:mga0yw44_666703_c1 | 3300050492 | Bacteria | 707 |
| 1257 | nmdc:mga0yw44_890186_c1 | 3300050492 | Bacteria | 604 |
| 1258 | nmdc:mga0yw44_99006_c1 | 3300050492 | Bacteria | 1855 |
| 1259 | nmdc:mga0k408_305129_c1 | 3300050493 | Bacteria | 950 |
| 1260 | nmdc:mga06z11_1560_c1 | 3300050494 | Bacteria | 8521 |
| 1261 | nmdc:mga06z11_21653_c2 | 3300050494 | Bacteria | 2752 |
| 1262 | nmdc:mga06z11_320333_c1 | 3300050494 | Bacteria | 925 |
| 1263 | nmdc:mga06z11_336706_c1 | 3300050494 | Bacteria | 902 |
| 1264 | nmdc:mga06z11_63927_c1 | 3300050494 | Bacteria | 1927 |
| 1265 | nmdc:mga04h51_137678_c1 | 3300050495 | Bacteria | 923 |
| 1266 | nmdc:mga04h51_24216_c1 | 3300050495 | Bacteria | 1857 |
| 1267 | nmdc:mga04h51_458096_c1 | 3300050495 | Bacteria | 540 |
| 1268 | nmdc:mga04h51_79287_c1 | 3300050495 | Bacteria | 1162 |
| 1269 | nmdc:mga07m45_1335_c1 | 3300050496 | Bacteria | 11242 |
| 1270 | nmdc:mga07m45_201372_c1 | 3300050496 | Bacteria | 1158 |
| 1271 | nmdc:mga07m45_205642_c1 | 3300050496 | Bacteria | 1145 |
| 1272 | nmdc:mga07m45_210168_c1 | 3300050496 | Bacteria | 1132 |
| 1273 | nmdc:mga07m45_227068_c1 | 3300050496 | Bacteria | 1086 |
| 1274 | nmdc:mga07m45_2326_c1 | 3300050496 | Bacteria | 6935 |
| 1275 | nmdc:mga07m45_431698_c1 | 3300050496 | Bacteria | 764 |
| 1276 | nmdc:mga07m45_4612_c1 | 3300050496 | Bacteria | 6756 |
| 1277 | nmdc:mga07m45_488432_c1 | 3300050496 | Bacteria | 713 |
| 1278 | nmdc:mga05p37_10660_c1 | 3300050507 | Bacteria | 10905 |
| 1279 | nmdc:mga05p37_2785_c1 | 3300050507 | Bacteria | 20326 |
| 1280 | nmdc:mga09592_1799_c1 | 3300050508 | Bacteria | 17199 |
| 1281 | nmdc:mga09592_182190_c1 | 3300050508 | Bacteria | 1817 |
| 1282 | nmdc:mga09592_2299_c1 | 3300050508 | Bacteria | 15408 |
| 1283 | nmdc:mga0qj67_10084_c1 | 3300050509 | Bacteria | 7050 |
| 1284 | nmdc:mga06r32_130_c1 | 3300050510 | Bacteria | 55123 |
| 1285 | nmdc:mga06r32_4895_c1 | 3300050510 | Bacteria | 12063 |
| 1286 | nmdc:mga08y16_1113887_c1 | 3300050511 | Bacteria | 764 |
| 1287 | nmdc:mga08y16_277154_c1 | 3300050511 | Bacteria | 1730 |
| 1288 | nmdc:mga08y16_3501_c1 | 3300050511 | Bacteria | 16300 |
| 1289 | nmdc:mga08y16_39303_c1 | 3300050511 | Bacteria | 4965 |
| 1290 | nmdc:mga08y16_738529_c1 | 3300050511 | Bacteria | 981 |
| 1291 | nmdc:mga0n895_1156086_c1 | 3300050512 | Bacteria | 749 |
| 1292 | nmdc:mga0rr50_1181386_c1 | 3300050513 | Bacteria | 650 |
| 1293 | nmdc:mga0a205_497050_c1 | 3300050515 | Bacteria | 1077 |
| 1294 | Ga0495601_0008187 | 3300053077 | Bacteria | 6166 |
| 1295 | Ga0495655_0014460 | 3300053083 | Bacteria | 1655 |
| 1296 | Ga0495655_0075530 | 3300053083 | Bacteria | 952 |
| 1297 | Ga0495655_0092904 | 3300053083 | Bacteria | 882 |
| 1298 | Ga0495619_0021438 | 3300053085 | Bacteria | 4125 |
| 1299 | Ga0495619_0231221 | 3300053085 | Bacteria | 1281 |
| 1300 | Ga0495619_0319711 | 3300053085 | Bacteria | 1074 |
| 1301 | Ga0495619_0547018 | 3300053085 | Bacteria | 794 |
| 1302 | Ga0500644_0000427 | 3300053088 | Bacteria | 19686 |
| 1303 | Ga0500641_0050012 | 3300053096 | Bacteria | 1716 |
| 1304 | Ga0500554_027137 | 3300053102 | Bacteria | 1653 |
| 1305 | Ga0500556_0002190 | 3300053104 | Bacteria | 6566 |
| 1306 | Ga0500593_000062 | 3300053117 | Bacteria | 39716 |
| 1307 | Ga0500628_015990 | 3300053129 | Bacteria | 1443 |
| 1308 | Ga0500628_024032 | 3300053129 | Bacteria | 1262 |
| 1309 | Ga0500573_0044627 | 3300053140 | Bacteria | 2556 |
| 1310 | Ga0501084_0007241 | 3300054114 | Bacteria | 9145 |
| 1311 | Ga0501084_0170123 | 3300054114 | Bacteria | 1839 |
| 1312 | Ga0501084_0242239 | 3300054114 | Bacteria | 1522 |
| 1313 | Ga0501084_1191241 | 3300054114 | Bacteria | 639 |
| 1314 | Ga0501084_1304495 | 3300054114 | Bacteria | 608 |
| 1315 | Ga0501084_1871648 | 3300054114 | Bacteria | 501 |
| 1316 | Ga0590071_009977 | 3300059421 | Bacteria | 2226 |
| 1317 | Ga0590077_031331 | 3300059426 | Bacteria | 1162 |
| 1318 | Ga0590077_061893 | 3300059426 | Bacteria | 849 |
| 1319 | Ga0587066_049092 | 3300059490 | Bacteria | 824 |
| 1320 | Ga0587070_018406 | 3300059491 | Bacteria | 1144 |
| 1321 | Ga0587077_028452 | 3300059493 | Bacteria | 1047 |
| 1322 | Ga0587077_151657 | 3300059493 | Bacteria | 606 |
| 1323 | Ga0587080_025676 | 3300059503 | Bacteria | 996 |
| 1324 | Ga0587083_0036413 | 3300059505 | Bacteria | 1008 |
| 1325 | Ga0587083_0114850 | 3300059505 | Bacteria | 688 |
| 1326 | Ga0587088_070391 | 3300059508 | Bacteria | 728 |
| 1327 | Ga0587090_010894 | 3300059510 | Bacteria | 1269 |
| 1328 | Ga0587090_069525 | 3300059510 | Bacteria | 685 |
| 1329 | Ga0587092_028331 | 3300059512 | Bacteria | 912 |
| 1330 | Ga0587098_007696 | 3300059604 | Bacteria | 1128 |
| 1331 | Ga0587098_042730 | 3300059604 | Bacteria | 665 |
| 1332 | Ga0587106_018837 | 3300059605 | Bacteria | 1001 |
| 1333 | Ga0587106_066057 | 3300059605 | Bacteria | 675 |
| 1334 | Ga0587106_092358 | 3300059605 | Bacteria | 606 |
| 1335 | Ga0587125_057559 | 3300059607 | Bacteria | 562 |
| 1336 | Ga0587101_006481 | 3300059623 | Bacteria | 1345 |
| 1337 | Ga0587109_034388 | 3300059624 | Bacteria | 978 |
| 1338 | Ga0587115_094737 | 3300059626 | Bacteria | 546 |
| 1339 | Ga0587128_013515 | 3300059630 | Bacteria | 1153 |
| 1340 | Ga0587062_005533 | 3300059639 | Bacteria | 1400 |
| 1341 | Ga0587062_088749 | 3300059639 | Bacteria | 586 |
| 1342 | Ga0587067_035930 | 3300059640 | Bacteria | 940 |
| 1343 | Ga0587068_070769 | 3300059641 | Bacteria | 688 |
| 1344 | Ga0587069_012972 | 3300059642 | Bacteria | 1138 |
| 1345 | Ga0587072_017844 | 3300059643 | Bacteria | 1228 |
| 1346 | Ga0587076_006906 | 3300059645 | Bacteria | 1531 |
| 1347 | Ga0587079_041961 | 3300059647 | Bacteria | 928 |
| 1348 | Ga0587100_000563 | 3300059648 | Bacteria | 1834 |
| 1349 | Ga0587105_005902 | 3300059651 | Bacteria | 827 |
| 1350 | Ga0587107_003751 | 3300059652 | Bacteria | 1498 |
| 1351 | Ga0587107_004096 | 3300059652 | Bacteria | 1459 |
| 1352 | Ga0587107_010905 | 3300059652 | Bacteria | 1103 |
| 1353 | Ga0587107_068833 | 3300059652 | Bacteria | 641 |
| 1354 | Ga0587107_087927 | 3300059652 | Bacteria | 595 |
| 1355 | Ga0587110_013166 | 3300059654 | Bacteria | 861 |
| 1356 | Ga0587114_036800 | 3300059655 | Bacteria | 775 |
| 1357 | Ga0587119_037384 | 3300059658 | Bacteria | 685 |
| 1358 | Ga0587071_181229 | 3300060344 | Bacteria | 541 |
| 1359 | Ga0587111_0011255 | 3300060346 | Bacteria | 1555 |
| 1360 | Ga0587111_0245603 | 3300060346 | Bacteria | 527 |
| 1361 | Ga0501082_0220776 | 3300060353 | Bacteria | 1649 |
| 1362 | Ga0501082_0333267 | 3300060353 | Bacteria | 1322 |
| 1363 | Ga0501082_0429944 | 3300060353 | Bacteria | 1153 |
| 1364 | Ga0501082_0836020 | 3300060353 | Bacteria | 805 |
| 1365 | Ga0501082_0880258 | 3300060353 | Bacteria | 783 |
| 1366 | Ga0501082_1134437 | 3300060353 | Bacteria | 683 |
| 1367 | Ga0501082_1564667 | 3300060353 | Bacteria | 576 |
| 1368 | Ga0466962_0029470 | 3300061719 | Bacteria | 2628 |
| 1369 | Ga0466962_0037334 | 3300061719 | Bacteria | 2326 |
| 1370 | Ga0466962_0067962 | 3300061719 | Bacteria | 1701 |
| 1371 | Ga0466962_0105375 | 3300061719 | Bacteria | 1355 |
| 1372 | Ga0466962_0140561 | 3300061719 | Bacteria | 1169 |
| 1373 | Ga0466962_0205770 | 3300061719 | Bacteria | 962 |
| 1374 | Ga0530510_0007003 | 3300061734 | Bacteria | 7854 |
| 1375 | Ga0530510_0070526 | 3300061734 | Bacteria | 2537 |
| 1376 | Ga0530510_0081750 | 3300061734 | Bacteria | 2352 |
| 1377 | Ga0530510_0296722 | 3300061734 | Bacteria | 1209 |
| 1378 | Ga0530510_0317011 | 3300061734 | Bacteria | 1168 |
| 1379 | Ga0530510_0409932 | 3300061734 | Bacteria | 1022 |
| 1380 | Ga0530510_0434177 | 3300061734 | Bacteria | 992 |
| 1381 | Ga0530510_0470702 | 3300061734 | Bacteria | 951 |
| 1382 | Ga0530510_0627415 | 3300061734 | Bacteria | 818 |
| 1383 | Ga0530510_1316569 | 3300061734 | Bacteria | 554 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300020070 | Ga0206356_11221972 | Ga0206356_112219722 | 124 |
| 2 | 3300044901 | Ga0466960_0550917 | Ga0466960_0550917_58_477 | 124 |
| 3 | 3300049127 | Ga0501306_009279 | Ga0501306_009279_422_811 | 124 |
| 4 | 3300049128 | Ga0501308_007774 | Ga0501308_007774_75_464 | 124 |
| 5 | 3300049129 | Ga0501309_000178 | Ga0501309_000178_3769_4158 | 124 |
| 6 | 3300049130 | Ga0501310_052760 | Ga0501310_052760_51_440 | 124 |
| 7 | 3300049131 | Ga0501341_17736 | Ga0501341_17736_47_436 | 124 |
| 8 | 3300049160 | Ga0501304_002507 | Ga0501304_002507_39_428 | 124 |
| 9 | 3300049161 | Ga0501305_044157 | Ga0501305_044157_257_646 | 124 |
| 10 | 3300049162 | Ga0501307_024224 | Ga0501307_024224_51_440 | 124 |
| 11 | 3300049527 | Ga0501311_000103 | Ga0501311_000103_3700_4089 | 124 |
| 12 | 3300049528 | Ga0501312_014599 | Ga0501312_014599_665_1054 | 124 |
| 13 | 3300049529 | Ga0501313_006104 | Ga0501313_006104_858_1247 | 124 |
| 14 | 3300049531 | Ga0501315_000132 | Ga0501315_000132_35_421 | 124 |
| 15 | 3300049531 | Ga0501315_012278 | Ga0501315_012278_48_437 | 124 |
| 16 | 3300049532 | Ga0501316_031851 | Ga0501316_031851_75_464 | 124 |
| 17 | 3300049533 | Ga0501317_002626 | Ga0501317_002626_635_1024 | 124 |
| 18 | 3300049534 | Ga0501318_009636 | Ga0501318_009636_393_782 | 124 |
| 19 | 3300049535 | Ga0501319_032265 | Ga0501319_032265_69_458 | 124 |
| 20 | 3300049536 | Ga0501320_000195 | Ga0501320_000195_2668_3057 | 124 |
| 21 | 3300049537 | Ga0501321_000036 | Ga0501321_000036_5214_5603 | 124 |
| 22 | 3300049538 | Ga0501322_003259 | Ga0501322_003259_605_994 | 124 |
| 23 | 3300049539 | Ga0501323_003789 | Ga0501323_003789_292_681 | 124 |
| 24 | 3300049540 | Ga0501324_007536 | Ga0501324_007536_505_894 | 124 |
| 25 | 3300049541 | Ga0501325_000185 | Ga0501325_000185_80_469 | 124 |
| 26 | 3300049543 | Ga0501327_02154 | Ga0501327_02154_571_960 | 124 |
| 27 | 3300049544 | Ga0501328_01590 | Ga0501328_01590_490_879 | 124 |
| 28 | 3300049546 | Ga0501330_020540 | Ga0501330_020540_49_438 | 124 |
| 29 | 3300049547 | Ga0501331_13252 | Ga0501331_13252_99_488 | 124 |
| 30 | 3300049553 | Ga0501337_021275 | Ga0501337_021275_41_430 | 124 |
| 31 | 3300048914 | Ga0496111_0309142 | Ga0496111_0309142_502_1095 | 127 |
| 32 | 3300009094 | Ga0111539_10831785 | Ga0111539_108317852 | 128 |
| 33 | 3300009148 | Ga0105243_10635011 | Ga0105243_106350112 | 128 |
| 34 | 3300049127 | Ga0501306_004752 | Ga0501306_004752_47_448 | 128 |
| 35 | 3300049528 | Ga0501312_079182 | Ga0501312_079182_114_515 | 128 |
| 36 | 3300049532 | Ga0501316_008263 | Ga0501316_008263_54_455 | 128 |
| 37 | 3300049533 | Ga0501317_015051 | Ga0501317_015051_478_879 | 128 |
| 38 | 3300049534 | Ga0501318_028928 | Ga0501318_028928_82_483 | 128 |
| 39 | 3300049537 | Ga0501321_066729 | Ga0501321_066729_38_439 | 128 |
| 40 | 3300049540 | Ga0501324_047245 | Ga0501324_047245_51_452 | 128 |
| 41 | 3300049578 | Ga0501042_0379379 | Ga0501042_0379379_20_421 | 128 |
| 42 | 3300049593 | Ga0501077_0394824 | Ga0501077_0394824_411_818 | 128 |
| 43 | 3300050511 | nmdc:mga08y16_1113887_c1 | nmdc:mga08y16_1113887_c1_86_532 | 128 |
| 44 | 3300053083 | Ga0495655_0014460 | Ga0495655_0014460_149_583 | 128 |
| 45 | 3300037853 | Ga0436364_0711707 | Ga0436364_0711707_341_823 | 129 |
| 46 | 3300049527 | Ga0501311_074993 | Ga0501311_074993_147_554 | 130 |
| 47 | 3300049590 | Ga0501074_0867194 | Ga0501074_0867194_223_618 | 130 |
| 48 | 3300006038 | Ga0075365_10181107 | Ga0075365_101811073 | 131 |
| 49 | 3300006051 | Ga0075364_10261514 | Ga0075364_102615141 | 131 |
| 50 | 3300006186 | Ga0075369_10048911 | Ga0075369_100489113 | 131 |
| 51 | 3300031995 | Ga0307409_100875547 | Ga0307409_1008755472 | 131 |
| 52 | 3300044683 | Ga0466965_0902143 | Ga0466965_0902143_103_504 | 131 |
| 53 | 3300049130 | Ga0501310_037052 | Ga0501310_037052_97_579 | 131 |
| 54 | 3300049161 | Ga0501305_052611 | Ga0501305_052611_32_514 | 131 |
| 55 | 3300049527 | Ga0501311_019991 | Ga0501311_019991_361_843 | 131 |
| 56 | 3300049528 | Ga0501312_017160 | Ga0501312_017160_167_649 | 131 |
| 57 | 3300049537 | Ga0501321_004843 | Ga0501321_004843_779_1261 | 131 |
| 58 | 3300050491 | nmdc:mga00v17_72501_c1 | nmdc:mga00v17_72501_c1_712_1263 | 131 |
| 59 | 3300050492 | nmdc:mga0yw44_666703_c1 | nmdc:mga0yw44_666703_c1_28_579 | 131 |
| 60 | 3300003911 | JGI25405J52794_10045114 | JGI25405J52794_100451142 | 132 |
| 61 | 3300005459 | Ga0068867_100201481 | Ga0068867_1002014812 | 132 |
| 62 | 3300005937 | Ga0081455_10009428 | Ga0081455_100094288 | 132 |
| 63 | 3300006042 | Ga0075368_10102200 | Ga0075368_101022002 | 132 |
| 64 | 3300006844 | Ga0075428_100002072 | Ga0075428_10000207219 | 132 |
| 65 | 3300006846 | Ga0075430_100080440 | Ga0075430_1000804404 | 132 |
| 66 | 3300006847 | Ga0075431_100004313 | Ga0075431_10000431310 | 132 |
| 67 | 3300006847 | Ga0075431_100038721 | Ga0075431_1000387213 | 132 |
| 68 | 3300006852 | Ga0075433_10641029 | Ga0075433_106410291 | 132 |
| 69 | 3300006871 | Ga0075434_101862647 | Ga0075434_1018626472 | 132 |
| 70 | 3300006880 | Ga0075429_100006773 | Ga0075429_10000677312 | 132 |
| 71 | 3300009094 | Ga0111539_10041331 | Ga0111539_100413313 | 132 |
| 72 | 3300009147 | Ga0114129_10006606 | Ga0114129_1000660624 | 132 |
| 73 | 3300011119 | Ga0105246_10375976 | Ga0105246_103759762 | 132 |
| 74 | 3300013104 | Ga0157370_10813114 | Ga0157370_108131141 | 132 |
| 75 | 3300013306 | Ga0163162_11601871 | Ga0163162_116018712 | 132 |
| 76 | 3300013307 | Ga0157372_11198389 | Ga0157372_111983892 | 132 |
| 77 | 3300014326 | Ga0157380_10712475 | Ga0157380_107124752 | 132 |
| 78 | 3300020078 | Ga0206352_10244107 | Ga0206352_102441072 | 132 |
| 79 | 3300027682 | Ga0209971_1017984 | Ga0209971_10179843 | 132 |
| 80 | 3300032002 | Ga0307416_100850266 | Ga0307416_1008502662 | 132 |
| 81 | 3300032004 | Ga0307414_11118243 | Ga0307414_111182432 | 132 |
| 82 | 3300032126 | Ga0307415_100897958 | Ga0307415_1008979582 | 132 |
| 83 | 3300035089 | Ga0373944_0123308 | Ga0373944_0123308_97_531 | 132 |
| 84 | 3300048903 | Ga0496100_0135127 | Ga0496100_0135127_189_623 | 132 |
| 85 | 3300048903 | Ga0496100_0476446 | Ga0496100_0476446_229_663 | 132 |
| 86 | 3300048904 | Ga0496101_0312267 | Ga0496101_0312267_232_666 | 132 |
| 87 | 3300048905 | Ga0496102_0778201 | Ga0496102_0778201_189_623 | 132 |
| 88 | 3300048906 | Ga0496103_0376991 | Ga0496103_0376991_342_776 | 132 |
| 89 | 3300048907 | Ga0496104_0021580 | Ga0496104_0021580_1419_1853 | 132 |
| 90 | 3300048908 | Ga0496105_0004859 | Ga0496105_0004859_5909_6343 | 132 |
| 91 | 3300048909 | Ga0496106_0566117 | Ga0496106_0566117_374_808 | 132 |
| 92 | 3300048910 | Ga0496107_0340140 | Ga0496107_0340140_257_691 | 132 |
| 93 | 3300048910 | Ga0496107_0465519 | Ga0496107_0465519_257_691 | 132 |
| 94 | 3300048911 | Ga0496108_0245746 | Ga0496108_0245746_929_1363 | 132 |
| 95 | 3300048912 | Ga0496109_0029564 | Ga0496109_0029564_1440_1874 | 132 |
| 96 | 3300048913 | Ga0496110_0280749 | Ga0496110_0280749_611_1045 | 132 |
| 97 | 3300048914 | Ga0496111_0276250 | Ga0496111_0276250_608_1042 | 132 |
| 98 | 3300048915 | Ga0496112_1147788 | Ga0496112_1147788_62_496 | 132 |
| 99 | 3300048917 | Ga0496114_0066334 | Ga0496114_0066334_501_935 | 132 |
| 100 | 3300048918 | Ga0496115_0123607 | Ga0496115_0123607_257_691 | 132 |
| 101 | 3300049527 | Ga0501311_017349 | Ga0501311_017349_526_927 | 132 |
| 102 | 3300049534 | Ga0501318_076638 | Ga0501318_076638_91_492 | 132 |
| 103 | 3300050492 | nmdc:mga0yw44_99006_c1 | nmdc:mga0yw44_99006_c1_496_1074 | 132 |
| 104 | 3300050495 | nmdc:mga04h51_79287_c1 | nmdc:mga04h51_79287_c1_197_775 | 132 |
| 105 | 3300050507 | nmdc:mga05p37_10660_c1 | nmdc:mga05p37_10660_c1_6851_7255 | 132 |
| 106 | 3300050508 | nmdc:mga09592_2299_c1 | nmdc:mga09592_2299_c1_3274_3678 | 132 |
| 107 | 3300050509 | nmdc:mga0qj67_10084_c1 | nmdc:mga0qj67_10084_c1_2622_3026 | 132 |
| 108 | 3300050510 | nmdc:mga06r32_130_c1 | nmdc:mga06r32_130_c1_48993_49397 | 132 |
| 109 | 3300050511 | nmdc:mga08y16_3501_c1 | nmdc:mga08y16_3501_c1_13053_13457 | 132 |
| 110 | 3300050515 | nmdc:mga0a205_497050_c1 | nmdc:mga0a205_497050_c1_104_508 | 132 |
| 111 | 3300003162 | Ga0006778J45830_1047560 | Ga0006778J45830_10475602 | 133 |
| 112 | 3300005329 | Ga0070683_100060577 | Ga0070683_1000605773 | 133 |
| 113 | 3300005344 | Ga0070661_100265186 | Ga0070661_1002651862 | 133 |
| 114 | 3300005366 | Ga0070659_100652320 | Ga0070659_1006523202 | 133 |
| 115 | 3300005455 | Ga0070663_100273521 | Ga0070663_1002735213 | 133 |
| 116 | 3300005564 | Ga0070664_100029753 | Ga0070664_1000297536 | 133 |
| 117 | 3300005577 | Ga0068857_101230025 | Ga0068857_1012300252 | 133 |
| 118 | 3300005843 | Ga0068860_100751614 | Ga0068860_1007516141 | 133 |
| 119 | 3300009093 | Ga0105240_11894518 | Ga0105240_118945182 | 133 |
| 120 | 3300011119 | Ga0105246_10693010 | Ga0105246_106930102 | 133 |
| 121 | 3300013105 | Ga0157369_11794246 | Ga0157369_117942462 | 133 |
| 122 | 3300013308 | Ga0157375_10529730 | Ga0157375_105297303 | 133 |
| 123 | 3300025899 | Ga0207642_10282712 | Ga0207642_102827121 | 133 |
| 124 | 3300025913 | Ga0207695_11577192 | Ga0207695_115771921 | 133 |
| 125 | 3300025920 | Ga0207649_10497819 | Ga0207649_104978192 | 133 |
| 126 | 3300025933 | Ga0207706_11226672 | Ga0207706_112266722 | 133 |
| 127 | 3300025944 | Ga0207661_10142467 | Ga0207661_101424673 | 133 |
| 128 | 3300025945 | Ga0207679_10033027 | Ga0207679_100330276 | 133 |
| 129 | 3300026067 | Ga0207678_11277653 | Ga0207678_112776532 | 133 |
| 130 | 3300032005 | Ga0307411_10625737 | Ga0307411_106257372 | 133 |
| 131 | 3300032133 | Ga0316583_10020342 | Ga0316583_100203426 | 133 |
| 132 | 3300033541 | Ga0316596_1091234 | Ga0316596_10912342 | 133 |
| 133 | 3300037471 | Ga0395905_1408803 | Ga0395905_1408803_159_560 | 133 |
| 134 | 3300044658 | Ga0466972_0089180 | Ga0466972_0089180_830_1231 | 133 |
| 135 | 3300044765 | Ga0466970_0393891 | Ga0466970_0393891_47_448 | 133 |
| 136 | 3300046518 | Ga0495631_0161727 | Ga0495631_0161727_490_897 | 133 |
| 137 | 3300048904 | Ga0496101_0561052 | Ga0496101_0561052_104_706 | 133 |
| 138 | 3300048917 | Ga0496114_0233484 | Ga0496114_0233484_1016_1453 | 133 |
| 139 | 3300049127 | Ga0501306_018050 | Ga0501306_018050_520_933 | 133 |
| 140 | 3300049128 | Ga0501308_028631 | Ga0501308_028631_181_582 | 133 |
| 141 | 3300049162 | Ga0501307_052431 | Ga0501307_052431_82_495 | 133 |
| 142 | 3300049532 | Ga0501316_049227 | Ga0501316_049227_126_557 | 133 |
| 143 | 3300049533 | Ga0501317_019027 | Ga0501317_019027_319_732 | 133 |
| 144 | 3300049533 | Ga0501317_034773 | Ga0501317_034773_98_499 | 133 |
| 145 | 3300049533 | Ga0501317_112878 | Ga0501317_112878_24_437 | 133 |
| 146 | 3300049534 | Ga0501318_039089 | Ga0501318_039089_209_631 | 133 |
| 147 | 3300049569 | Ga0501032_0163970 | Ga0501032_0163970_531_953 | 133 |
| 148 | 3300049569 | Ga0501032_0545219 | Ga0501032_0545219_308_724 | 133 |
| 149 | 3300049570 | Ga0501033_1121739 | Ga0501033_1121739_39_461 | 133 |
| 150 | 3300049573 | Ga0501037_0216570 | Ga0501037_0216570_754_1176 | 133 |
| 151 | 3300049575 | Ga0501039_0521992 | Ga0501039_0521992_495_917 | 133 |
| 152 | 3300049579 | Ga0501043_0387140 | Ga0501043_0387140_580_996 | 133 |
| 153 | 3300049582 | Ga0501048_0208955 | Ga0501048_0208955_423_845 | 133 |
| 154 | 3300049586 | Ga0501070_1547483 | Ga0501070_1547483_58_480 | 133 |
| 155 | 3300049588 | Ga0501072_0449580 | Ga0501072_0449580_60_482 | 133 |
| 156 | 3300049588 | Ga0501072_0900001 | Ga0501072_0900001_225_641 | 133 |
| 157 | 3300049589 | Ga0501073_0931276 | Ga0501073_0931276_123_545 | 133 |
| 158 | 3300049590 | Ga0501074_0751905 | Ga0501074_0751905_84_506 | 133 |
| 159 | 3300049591 | Ga0501075_0699833 | Ga0501075_0699833_14_436 | 133 |
| 160 | 3300049743 | Ga0501081_0212485 | Ga0501081_0212485_545_961 | 133 |
| 161 | 3300049744 | Ga0501083_0746392 | Ga0501083_0746392_71_487 | 133 |
| 162 | 3300049824 | Ga0501045_0785148 | Ga0501045_0785148_174_596 | 133 |
| 163 | 3300054114 | Ga0501084_1304495 | Ga0501084_1304495_54_476 | 133 |
| 164 | 3300059493 | Ga0587077_028452 | Ga0587077_028452_600_1001 | 133 |
| 165 | 3300059505 | Ga0587083_0036413 | Ga0587083_0036413_517_918 | 133 |
| 166 | 3300059640 | Ga0587067_035930 | Ga0587067_035930_453_854 | 133 |
| 167 | 3300061734 | Ga0530510_0434177 | Ga0530510_0434177_445_867 | 133 |
| 168 | iso_pu_bacteria | 2643221617 | 2644099741 | 133 |
| 169 | iso_pu_bacteria | 2643221620 | 2644116627 | 133 |
| 170 | iso_pu_bacteria | 2738541305 | 2738870338 | 133 |
| 171 | iso_pu_bacteria | 2811994874 | 2812331445 | 133 |
| 172 | 3300005329 | Ga0070683_100716249 | Ga0070683_1007162492 | 134 |
| 173 | 3300005337 | Ga0070682_101034634 | Ga0070682_1010346341 | 134 |
| 174 | 3300005345 | Ga0070692_10109517 | Ga0070692_101095172 | 134 |
| 175 | 3300005354 | Ga0070675_100389616 | Ga0070675_1003896163 | 134 |
| 176 | 3300005355 | Ga0070671_100289249 | Ga0070671_1002892492 | 134 |
| 177 | 3300005356 | Ga0070674_100067586 | Ga0070674_1000675865 | 134 |
| 178 | 3300005441 | Ga0070700_100949038 | Ga0070700_1009490382 | 134 |
| 179 | 3300005456 | Ga0070678_100592950 | Ga0070678_1005929502 | 134 |
| 180 | 3300005459 | Ga0068867_100546679 | Ga0068867_1005466792 | 134 |
| 181 | 3300005466 | Ga0070685_10344036 | Ga0070685_103440362 | 134 |
| 182 | 3300005471 | Ga0070698_100392494 | Ga0070698_1003924942 | 134 |
| 183 | 3300005539 | Ga0068853_100074811 | Ga0068853_1000748115 | 134 |
| 184 | 3300005539 | Ga0068853_100589051 | Ga0068853_1005890512 | 134 |
| 185 | 3300005543 | Ga0070672_100113206 | Ga0070672_1001132062 | 134 |
| 186 | 3300005547 | Ga0070693_100595312 | Ga0070693_1005953122 | 134 |
| 187 | 3300005548 | Ga0070665_100204381 | Ga0070665_1002043814 | 134 |
| 188 | 3300005577 | Ga0068857_100101060 | Ga0068857_1001010602 | 134 |
| 189 | 3300005614 | Ga0068856_100881930 | Ga0068856_1008819301 | 134 |
| 190 | 3300005615 | Ga0070702_100073205 | Ga0070702_1000732053 | 134 |
| 191 | 3300005616 | Ga0068852_100789024 | Ga0068852_1007890242 | 134 |
| 192 | 3300005840 | Ga0068870_10444300 | Ga0068870_104443002 | 134 |
| 193 | 3300005842 | Ga0068858_100764730 | Ga0068858_1007647302 | 134 |
| 194 | 3300005937 | Ga0081455_10104192 | Ga0081455_101041923 | 134 |
| 195 | 3300006038 | Ga0075365_10565233 | Ga0075365_105652332 | 134 |
| 196 | 3300006048 | Ga0075363_100035386 | Ga0075363_1000353863 | 134 |
| 197 | 3300006178 | Ga0075367_10041821 | Ga0075367_100418215 | 134 |
| 198 | 3300006881 | Ga0068865_100246657 | Ga0068865_1002466573 | 134 |
| 199 | 3300009098 | Ga0105245_10533897 | Ga0105245_105338972 | 134 |
| 200 | 3300009098 | Ga0105245_11444485 | Ga0105245_114444851 | 134 |
| 201 | 3300009148 | Ga0105243_10126788 | Ga0105243_101267882 | 134 |
| 202 | 3300009148 | Ga0105243_10581361 | Ga0105243_105813613 | 134 |
| 203 | 3300009176 | Ga0105242_10336584 | Ga0105242_103365842 | 134 |
| 204 | 3300009551 | Ga0105238_10608358 | Ga0105238_106083581 | 134 |
| 205 | 3300009553 | Ga0105249_10033506 | Ga0105249_100335065 | 134 |
| 206 | 3300009553 | Ga0105249_10640569 | Ga0105249_106405693 | 134 |
| 207 | 3300013102 | Ga0157371_10354275 | Ga0157371_103542752 | 134 |
| 208 | 3300013102 | Ga0157371_11320876 | Ga0157371_113208761 | 134 |
| 209 | 3300013105 | Ga0157369_10922309 | Ga0157369_109223092 | 134 |
| 210 | 3300013296 | Ga0157374_10693022 | Ga0157374_106930223 | 134 |
| 211 | 3300013306 | Ga0163162_10389264 | Ga0163162_103892642 | 134 |
| 212 | 3300013308 | Ga0157375_10467033 | Ga0157375_104670332 | 134 |
| 213 | 3300014325 | Ga0163163_10224420 | Ga0163163_102244202 | 134 |
| 214 | 3300014497 | Ga0182008_10421450 | Ga0182008_104214502 | 134 |
| 215 | 3300014745 | Ga0157377_10683054 | Ga0157377_106830542 | 134 |
| 216 | 3300017792 | Ga0163161_10026654 | Ga0163161_100266543 | 134 |
| 217 | 3300020070 | Ga0206356_10663620 | Ga0206356_106636202 | 134 |
| 218 | 3300020081 | Ga0206354_10829853 | Ga0206354_108298532 | 134 |
| 219 | 3300020082 | Ga0206353_12040929 | Ga0206353_120409292 | 134 |
| 220 | 3300025893 | Ga0207682_10045174 | Ga0207682_100451743 | 134 |
| 221 | 3300025901 | Ga0207688_10343947 | Ga0207688_103439472 | 134 |
| 222 | 3300025904 | Ga0207647_10167202 | Ga0207647_101672022 | 134 |
| 223 | 3300025908 | Ga0207643_10318706 | Ga0207643_103187062 | 134 |
| 224 | 3300025911 | Ga0207654_10464760 | Ga0207654_104647602 | 134 |
| 225 | 3300025918 | Ga0207662_10240929 | Ga0207662_102409292 | 134 |
| 226 | 3300025924 | Ga0207694_10501976 | Ga0207694_105019763 | 134 |
| 227 | 3300025926 | Ga0207659_10116199 | Ga0207659_101161992 | 134 |
| 228 | 3300025927 | Ga0207687_10334599 | Ga0207687_103345992 | 134 |
| 229 | 3300025935 | Ga0207709_10276395 | Ga0207709_102763953 | 134 |
| 230 | 3300025940 | Ga0207691_10087896 | Ga0207691_100878962 | 134 |
| 231 | 3300025961 | Ga0207712_10093301 | Ga0207712_100933014 | 134 |
| 232 | 3300026023 | Ga0207677_11093085 | Ga0207677_110930852 | 134 |
| 233 | 3300026041 | Ga0207639_10351044 | Ga0207639_103510441 | 134 |
| 234 | 3300026067 | Ga0207678_10673240 | Ga0207678_106732402 | 134 |
| 235 | 3300026075 | Ga0207708_10683706 | Ga0207708_106837062 | 134 |
| 236 | 3300026089 | Ga0207648_10593324 | Ga0207648_105933242 | 134 |
| 237 | 3300026116 | Ga0207674_10013764 | Ga0207674_100137646 | 134 |
| 238 | 3300026118 | Ga0207675_100292959 | Ga0207675_1002929592 | 134 |
| 239 | 3300026121 | Ga0207683_10268970 | Ga0207683_102689703 | 134 |
| 240 | 3300028380 | Ga0268265_11172850 | Ga0268265_111728502 | 134 |
| 241 | 3300030522 | Ga0307512_10033331 | Ga0307512_100333317 | 134 |
| 242 | 3300037466 | Ga0395898_0090098 | Ga0395898_0090098_1814_2380 | 134 |
| 243 | 3300037853 | Ga0436364_0626737 | Ga0436364_0626737_718_1224 | 134 |
| 244 | 3300041443 | Ga0451789_0337217 | Ga0451789_0337217_54_482 | 134 |
| 245 | 3300044658 | Ga0466972_0007943 | Ga0466972_0007943_4278_4682 | 134 |
| 246 | 3300044683 | Ga0466965_0010425 | Ga0466965_0010425_262_666 | 134 |
| 247 | 3300044693 | Ga0466961_0014059 | Ga0466961_0014059_441_845 | 134 |
| 248 | 3300044694 | Ga0466963_0075177 | Ga0466963_0075177_1597_2001 | 134 |
| 249 | 3300044706 | Ga0466964_0065515 | Ga0466964_0065515_636_1040 | 134 |
| 250 | 3300044719 | Ga0466971_0020611 | Ga0466971_0020611_251_655 | 134 |
| 251 | 3300044735 | Ga0466968_0159201 | Ga0466968_0159201_134_538 | 134 |
| 252 | 3300044765 | Ga0466970_0025660 | Ga0466970_0025660_2009_2413 | 134 |
| 253 | 3300044765 | Ga0466970_0417828 | Ga0466970_0417828_48_452 | 134 |
| 254 | 3300044842 | Ga0466957_0041531 | Ga0466957_0041531_1861_2265 | 134 |
| 255 | 3300044842 | Ga0466957_0127653 | Ga0466957_0127653_573_1052 | 134 |
| 256 | 3300044901 | Ga0466960_0270494 | Ga0466960_0270494_346_750 | 134 |
| 257 | 3300045836 | Ga0466958_0066032 | Ga0466958_0066032_1127_1531 | 134 |
| 258 | 3300045976 | Ga0466967_0013542 | Ga0466967_0013542_4353_4757 | 134 |
| 259 | 3300046518 | Ga0495631_0245870 | Ga0495631_0245870_272_730 | 134 |
| 260 | 3300046535 | Ga0495586_0231445 | Ga0495586_0231445_493_897 | 134 |
| 261 | 3300048907 | Ga0496104_0926519 | Ga0496104_0926519_55_657 | 134 |
| 262 | 3300048912 | Ga0496109_0709204 | Ga0496109_0709204_183_641 | 134 |
| 263 | 3300048913 | Ga0496110_0310146 | Ga0496110_0310146_471_929 | 134 |
| 264 | 3300048914 | Ga0496111_0792646 | Ga0496111_0792646_37_495 | 134 |
| 265 | 3300049127 | Ga0501306_049266 | Ga0501306_049266_135_551 | 134 |
| 266 | 3300049127 | Ga0501306_081467 | Ga0501306_081467_120_536 | 134 |
| 267 | 3300049128 | Ga0501308_015225 | Ga0501308_015225_52_468 | 134 |
| 268 | 3300049530 | Ga0501314_006582 | Ga0501314_006582_27_443 | 134 |
| 269 | 3300049531 | Ga0501315_066990 | Ga0501315_066990_123_539 | 134 |
| 270 | 3300049533 | Ga0501317_017566 | Ga0501317_017566_499_915 | 134 |
| 271 | 3300049533 | Ga0501317_104612 | Ga0501317_104612_87_503 | 134 |
| 272 | 3300049536 | Ga0501320_012544 | Ga0501320_012544_430_846 | 134 |
| 273 | 3300049570 | Ga0501033_0061150 | Ga0501033_0061150_1410_1823 | 134 |
| 274 | 3300049571 | Ga0501034_0385484 | Ga0501034_0385484_496_900 | 134 |
| 275 | 3300049572 | Ga0501036_1354913 | Ga0501036_1354913_112_516 | 134 |
| 276 | 3300049579 | Ga0501043_0158139 | Ga0501043_0158139_240_653 | 134 |
| 277 | 3300049583 | Ga0501067_0103653 | Ga0501067_0103653_878_1291 | 134 |
| 278 | 3300049585 | Ga0501069_0299656 | Ga0501069_0299656_465_869 | 134 |
| 279 | 3300049586 | Ga0501070_0828120 | Ga0501070_0828120_83_487 | 134 |
| 280 | 3300049592 | Ga0501076_0474133 | Ga0501076_0474133_109_525 | 134 |
| 281 | 3300050494 | nmdc:mga06z11_21653_c2 | nmdc:mga06z11_21653_c2_2072_2650 | 134 |
| 282 | 3300053083 | Ga0495655_0092904 | Ga0495655_0092904_235_693 | 134 |
| 283 | 3300059490 | Ga0587066_049092 | Ga0587066_049092_187_591 | 134 |
| 284 | 3300059491 | Ga0587070_018406 | Ga0587070_018406_653_1057 | 134 |
| 285 | 3300059503 | Ga0587080_025676 | Ga0587080_025676_408_812 | 134 |
| 286 | 3300059510 | Ga0587090_010894 | Ga0587090_010894_605_1009 | 134 |
| 287 | 3300059512 | Ga0587092_028331 | Ga0587092_028331_120_524 | 134 |
| 288 | 3300059604 | Ga0587098_007696 | Ga0587098_007696_426_830 | 134 |
| 289 | 3300059605 | Ga0587106_066057 | Ga0587106_066057_144_548 | 134 |
| 290 | 3300059607 | Ga0587125_057559 | Ga0587125_057559_79_483 | 134 |
| 291 | 3300059623 | Ga0587101_006481 | Ga0587101_006481_229_633 | 134 |
| 292 | 3300059624 | Ga0587109_034388 | Ga0587109_034388_203_607 | 134 |
| 293 | 3300059626 | Ga0587115_094737 | Ga0587115_094737_92_496 | 134 |
| 294 | 3300059639 | Ga0587062_005533 | Ga0587062_005533_463_867 | 134 |
| 295 | 3300059642 | Ga0587069_012972 | Ga0587069_012972_439_843 | 134 |
| 296 | 3300059643 | Ga0587072_017844 | Ga0587072_017844_264_668 | 134 |
| 297 | 3300059645 | Ga0587076_006906 | Ga0587076_006906_683_1087 | 134 |
| 298 | 3300059647 | Ga0587079_041961 | Ga0587079_041961_354_758 | 134 |
| 299 | 3300059648 | Ga0587100_000563 | Ga0587100_000563_1332_1736 | 134 |
| 300 | 3300059651 | Ga0587105_005902 | Ga0587105_005902_377_781 | 134 |
| 301 | 3300059654 | Ga0587110_013166 | Ga0587110_013166_313_717 | 134 |
| 302 | 3300059655 | Ga0587114_036800 | Ga0587114_036800_79_483 | 134 |
| 303 | 3300059658 | Ga0587119_037384 | Ga0587119_037384_87_491 | 134 |
| 304 | 3300060346 | Ga0587111_0011255 | Ga0587111_0011255_506_910 | 134 |
| 305 | 3300061719 | Ga0466962_0067962 | Ga0466962_0067962_171_575 | 134 |
| 306 | iso_pu_bacteria | 2643221604 | 2644033687 | 134 |
| 307 | 3300003373 | JGI25407J50210_10009484 | JGI25407J50210_100094843 | 135 |
| 308 | 3300005937 | Ga0081455_10000409 | Ga0081455_100004096 | 135 |
| 309 | 3300005981 | Ga0081538_10000088 | Ga0081538_1000008861 | 135 |
| 310 | 3300005981 | Ga0081538_10038576 | Ga0081538_100385765 | 135 |
| 311 | 3300006051 | Ga0075364_10171268 | Ga0075364_101712682 | 135 |
| 312 | 3300006177 | Ga0075362_10026928 | Ga0075362_100269286 | 135 |
| 313 | 3300006353 | Ga0075370_10585152 | Ga0075370_105851522 | 135 |
| 314 | 3300009147 | Ga0114129_10000234 | Ga0114129_100002349 | 135 |
| 315 | 3300013306 | Ga0163162_10545019 | Ga0163162_105450193 | 135 |
| 316 | 3300013307 | Ga0157372_10067801 | Ga0157372_100678018 | 135 |
| 317 | 3300025919 | Ga0207657_10318016 | Ga0207657_103180161 | 135 |
| 318 | 3300026118 | Ga0207675_100926237 | Ga0207675_1009262372 | 135 |
| 319 | 3300027907 | Ga0207428_10010526 | Ga0207428_1001052616 | 135 |
| 320 | 3300032002 | Ga0307416_101061441 | Ga0307416_1010614412 | 135 |
| 321 | 3300041505 | Ga0451849_0357388 | Ga0451849_0357388_37_495 | 135 |
| 322 | 3300044706 | Ga0466964_0713652 | Ga0466964_0713652_62_526 | 135 |
| 323 | 3300044901 | Ga0466960_0153551 | Ga0466960_0153551_790_1215 | 135 |
| 324 | 3300045976 | Ga0466967_0549075 | Ga0466967_0549075_230_664 | 135 |
| 325 | 3300046500 | Ga0495596_0340571 | Ga0495596_0340571_101_532 | 135 |
| 326 | 3300046683 | Ga0495658_0077248 | Ga0495658_0077248_660_1241 | 135 |
| 327 | 3300048904 | Ga0496101_1111537 | Ga0496101_1111537_63_497 | 135 |
| 328 | 3300049128 | Ga0501308_023913 | Ga0501308_023913_293_700 | 135 |
| 329 | 3300049130 | Ga0501310_014670 | Ga0501310_014670_453_872 | 135 |
| 330 | 3300049162 | Ga0501307_074435 | Ga0501307_074435_71_499 | 135 |
| 331 | 3300049527 | Ga0501311_066930 | Ga0501311_066930_117_539 | 135 |
| 332 | 3300049533 | Ga0501317_018365 | Ga0501317_018365_381_803 | 135 |
| 333 | 3300049534 | Ga0501318_019840 | Ga0501318_019840_303_725 | 135 |
| 334 | 3300049539 | Ga0501323_061508 | Ga0501323_061508_115_537 | 135 |
| 335 | 3300049568 | Ga0501031_0015297 | Ga0501031_0015297_3651_4070 | 135 |
| 336 | 3300049568 | Ga0501031_0120709 | Ga0501031_0120709_204_629 | 135 |
| 337 | 3300049569 | Ga0501032_0163681 | Ga0501032_0163681_834_1253 | 135 |
| 338 | 3300049571 | Ga0501034_0224517 | Ga0501034_0224517_1174_1593 | 135 |
| 339 | 3300049572 | Ga0501036_0749634 | Ga0501036_0749634_364_783 | 135 |
| 340 | 3300049573 | Ga0501037_0254772 | Ga0501037_0254772_267_686 | 135 |
| 341 | 3300049574 | Ga0501038_0040267 | Ga0501038_0040267_31_450 | 135 |
| 342 | 3300049575 | Ga0501039_0034588 | Ga0501039_0034588_2694_3113 | 135 |
| 343 | 3300049575 | Ga0501039_0828661 | Ga0501039_0828661_42_467 | 135 |
| 344 | 3300049576 | Ga0501040_0190605 | Ga0501040_0190605_694_1113 | 135 |
| 345 | 3300049576 | Ga0501040_0372261 | Ga0501040_0372261_544_969 | 135 |
| 346 | 3300049576 | Ga0501040_0632195 | Ga0501040_0632195_238_663 | 135 |
| 347 | 3300049577 | Ga0501041_0006740 | Ga0501041_0006740_106_525 | 135 |
| 348 | 3300049578 | Ga0501042_0722915 | Ga0501042_0722915_267_689 | 135 |
| 349 | 3300049582 | Ga0501048_0281957 | Ga0501048_0281957_29_448 | 135 |
| 350 | 3300049584 | Ga0501068_0044498 | Ga0501068_0044498_1453_1872 | 135 |
| 351 | 3300049585 | Ga0501069_0150761 | Ga0501069_0150761_560_979 | 135 |
| 352 | 3300049586 | Ga0501070_1111858 | Ga0501070_1111858_31_450 | 135 |
| 353 | 3300049587 | Ga0501071_0003704 | Ga0501071_0003704_1831_2250 | 135 |
| 354 | 3300049588 | Ga0501072_0018905 | Ga0501072_0018905_2374_2793 | 135 |
| 355 | 3300049591 | Ga0501075_0057160 | Ga0501075_0057160_604_1023 | 135 |
| 356 | 3300049593 | Ga0501077_0003693 | Ga0501077_0003693_6099_6518 | 135 |
| 357 | 3300049741 | Ga0501079_0022088 | Ga0501079_0022088_3587_4006 | 135 |
| 358 | 3300049741 | Ga0501079_0443421 | Ga0501079_0443421_152_577 | 135 |
| 359 | 3300049824 | Ga0501045_0171369 | Ga0501045_0171369_967_1386 | 135 |
| 360 | 3300050489 | nmdc:mga03683_48175_c1 | nmdc:mga03683_48175_c1_13_435 | 135 |
| 361 | 3300050491 | nmdc:mga00v17_90693_c2 | nmdc:mga00v17_90693_c2_630_1052 | 135 |
| 362 | 3300050496 | nmdc:mga07m45_205642_c1 | nmdc:mga07m45_205642_c1_475_897 | 135 |
| 363 | 3300050507 | nmdc:mga05p37_2785_c1 | nmdc:mga05p37_2785_c1_8392_9027 | 135 |
| 364 | 3300050508 | nmdc:mga09592_1799_c1 | nmdc:mga09592_1799_c1_10937_11572 | 135 |
| 365 | 3300050510 | nmdc:mga06r32_4895_c1 | nmdc:mga06r32_4895_c1_11065_11700 | 135 |
| 366 | 3300054114 | Ga0501084_0007241 | Ga0501084_0007241_480_899 | 135 |
| 367 | 3300054114 | Ga0501084_1871648 | Ga0501084_1871648_62_484 | 135 |
| 368 | 3300059493 | Ga0587077_151657 | Ga0587077_151657_115_528 | 135 |
| 369 | 3300059508 | Ga0587088_070391 | Ga0587088_070391_260_673 | 135 |
| 370 | 3300059510 | Ga0587090_069525 | Ga0587090_069525_84_497 | 135 |
| 371 | 3300059604 | Ga0587098_042730 | Ga0587098_042730_39_446 | 135 |
| 372 | 3300059605 | Ga0587106_018837 | Ga0587106_018837_314_913 | 135 |
| 373 | 3300059652 | Ga0587107_003751 | Ga0587107_003751_219_818 | 135 |
| 374 | 3300059652 | Ga0587107_068833 | Ga0587107_068833_65_478 | 135 |
| 375 | 3300060344 | Ga0587071_181229 | Ga0587071_181229_84_497 | 135 |
| 376 | 3300060353 | Ga0501082_1564667 | Ga0501082_1564667_24_446 | 135 |
| 377 | 3300061734 | Ga0530510_0081750 | Ga0530510_0081750_1259_1678 | 135 |
| 378 | iso_pu_bacteria | 2773857762 | 2774396394 | 135 |
| 379 | iso_pu_bacteria | 2808606439 | 2809198050 | 135 |
| 380 | iso_pu_bacteria | 2811994878 | 2812353259 | 135 |
| 381 | iso_pu_bacteria | 2891968417 | 2891969113 | 135 |
| 382 | 3300005356 | Ga0070674_101626818 | Ga0070674_1016268181 | 136 |
| 383 | 3300005441 | Ga0070700_100057255 | Ga0070700_1000572552 | 136 |
| 384 | 3300025935 | Ga0207709_10273292 | Ga0207709_102732922 | 136 |
| 385 | 3300025937 | Ga0207669_11034872 | Ga0207669_110348722 | 136 |
| 386 | 3300026023 | Ga0207677_10132683 | Ga0207677_101326832 | 136 |
| 387 | 3300026075 | Ga0207708_10071771 | Ga0207708_100717716 | 136 |
| 388 | 3300031824 | Ga0307413_10129430 | Ga0307413_101294302 | 136 |
| 389 | 3300031901 | Ga0307406_11270995 | Ga0307406_112709951 | 136 |
| 390 | 3300031911 | Ga0307412_11836423 | Ga0307412_118364232 | 136 |
| 391 | 3300032168 | Ga0316593_10029364 | Ga0316593_100293642 | 136 |
| 392 | 3300041511 | Ga0451855_1287871 | Ga0451855_1287871_15_485 | 136 |
| 393 | 3300044683 | Ga0466965_0021029 | Ga0466965_0021029_2575_2988 | 136 |
| 394 | 3300044706 | Ga0466964_0171153 | Ga0466964_0171153_445_879 | 136 |
| 395 | 3300044706 | Ga0466964_0692021 | Ga0466964_0692021_48_461 | 136 |
| 396 | 3300044719 | Ga0466971_0305243 | Ga0466971_0305243_289_702 | 136 |
| 397 | 3300044765 | Ga0466970_0021669 | Ga0466970_0021669_369_782 | 136 |
| 398 | 3300044842 | Ga0466957_0176113 | Ga0466957_0176113_879_1292 | 136 |
| 399 | 3300044901 | Ga0466960_0039714 | Ga0466960_0039714_1093_1506 | 136 |
| 400 | 3300045976 | Ga0466967_0442002 | Ga0466967_0442002_561_974 | 136 |
| 401 | 3300046457 | Ga0495590_0075600 | Ga0495590_0075600_21_566 | 136 |
| 402 | 3300046459 | Ga0495629_0456676 | Ga0495629_0456676_279_707 | 136 |
| 403 | 3300046462 | Ga0495651_0481029 | Ga0495651_0481029_361_771 | 136 |
| 404 | 3300046477 | Ga0495664_0075173 | Ga0495664_0075173_581_1012 | 136 |
| 405 | 3300046642 | Ga0495634_0250224 | Ga0495634_0250224_141_572 | 136 |
| 406 | 3300048911 | Ga0496108_0214879 | Ga0496108_0214879_558_1001 | 136 |
| 407 | 3300048917 | Ga0496114_1068777 | Ga0496114_1068777_115_576 | 136 |
| 408 | 3300049528 | Ga0501312_033623 | Ga0501312_033623_353_775 | 136 |
| 409 | 3300049539 | Ga0501323_045329 | Ga0501323_045329_159_581 | 136 |
| 410 | 3300049540 | Ga0501324_045939 | Ga0501324_045939_82_492 | 136 |
| 411 | 3300049572 | Ga0501036_0582051 | Ga0501036_0582051_301_726 | 136 |
| 412 | 3300049577 | Ga0501041_0117192 | Ga0501041_0117192_979_1404 | 136 |
| 413 | 3300049578 | Ga0501042_0494290 | Ga0501042_0494290_220_645 | 136 |
| 414 | 3300049583 | Ga0501067_0053577 | Ga0501067_0053577_136_573 | 136 |
| 415 | 3300049583 | Ga0501067_0283496 | Ga0501067_0283496_231_722 | 136 |
| 416 | 3300049585 | Ga0501069_0139303 | Ga0501069_0139303_571_1008 | 136 |
| 417 | 3300049588 | Ga0501072_0054085 | Ga0501072_0054085_573_998 | 136 |
| 418 | 3300049592 | Ga0501076_0299996 | Ga0501076_0299996_231_656 | 136 |
| 419 | 3300049592 | Ga0501076_0435768 | Ga0501076_0435768_467_892 | 136 |
| 420 | 3300049741 | Ga0501079_0518588 | Ga0501079_0518588_102_704 | 136 |
| 421 | 3300049742 | Ga0501080_0379218 | Ga0501080_0379218_670_1095 | 136 |
| 422 | 3300049822 | Ga0501035_0439763 | Ga0501035_0439763_97_522 | 136 |
| 423 | 3300049823 | Ga0501044_0282550 | Ga0501044_0282550_711_1136 | 136 |
| 424 | 3300049824 | Ga0501045_0168860 | Ga0501045_0168860_645_1070 | 136 |
| 425 | 3300053077 | Ga0495601_0008187 | Ga0495601_0008187_3252_3683 | 136 |
| 426 | 3300054114 | Ga0501084_0170123 | Ga0501084_0170123_447_872 | 136 |
| 427 | 3300059426 | Ga0590077_061893 | Ga0590077_061893_296_727 | 136 |
| 428 | 3300060353 | Ga0501082_0333267 | Ga0501082_0333267_882_1307 | 136 |
| 429 | 3300060353 | Ga0501082_0429944 | Ga0501082_0429944_633_1064 | 136 |
| 430 | 3300060353 | Ga0501082_0836020 | Ga0501082_0836020_95_520 | 136 |
| 431 | 3300061719 | Ga0466962_0029470 | Ga0466962_0029470_1700_2113 | 136 |
| 432 | 3300061734 | Ga0530510_0470702 | Ga0530510_0470702_198_635 | 136 |
| 433 | iso_pu_bacteria | 2984576629 | 2984579582 | 136 |
| 434 | iso_pu_bacteria | 2990256926 | 2990257189 | 136 |
| 435 | 3300001989 | JGI24739J22299_10014413 | JGI24739J22299_100144132 | 137 |
| 436 | 3300003578 | Ga0006562J51391_1055045 | Ga0006562J51391_10550452 | 137 |
| 437 | 3300005329 | Ga0070683_100429471 | Ga0070683_1004294712 | 137 |
| 438 | 3300005367 | Ga0070667_101470267 | Ga0070667_1014702671 | 137 |
| 439 | 3300009148 | Ga0105243_10747924 | Ga0105243_107479243 | 137 |
| 440 | 3300020082 | Ga0206353_10143802 | Ga0206353_101438021 | 137 |
| 441 | 3300025944 | Ga0207661_10329831 | Ga0207661_103298312 | 137 |
| 442 | 3300031731 | Ga0307405_10440607 | Ga0307405_104406072 | 137 |
| 443 | 3300031901 | Ga0307406_10368336 | Ga0307406_103683362 | 137 |
| 444 | 3300031901 | Ga0307406_10391940 | Ga0307406_103919403 | 137 |
| 445 | 3300032002 | Ga0307416_100688812 | Ga0307416_1006888122 | 137 |
| 446 | 3300032126 | Ga0307415_101751185 | Ga0307415_1017511851 | 137 |
| 447 | 3300037418 | Ga0395900_0042235 | Ga0395900_0042235_2576_2995 | 137 |
| 448 | 3300037466 | Ga0395898_0523938 | Ga0395898_0523938_348_767 | 137 |
| 449 | 3300037471 | Ga0395905_0660609 | Ga0395905_0660609_460_879 | 137 |
| 450 | 3300038443 | Ga0395901_0149529 | Ga0395901_0149529_655_1074 | 137 |
| 451 | 3300044683 | Ga0466965_0066512 | Ga0466965_0066512_534_953 | 137 |
| 452 | 3300044765 | Ga0466970_0686165 | Ga0466970_0686165_130_549 | 137 |
| 453 | 3300048903 | Ga0496100_0547411 | Ga0496100_0547411_415_834 | 137 |
| 454 | 3300048905 | Ga0496102_0298706 | Ga0496102_0298706_354_773 | 137 |
| 455 | 3300048905 | Ga0496102_0674086 | Ga0496102_0674086_267_728 | 137 |
| 456 | 3300048907 | Ga0496104_0441400 | Ga0496104_0441400_365_784 | 137 |
| 457 | 3300048908 | Ga0496105_0666180 | Ga0496105_0666180_262_681 | 137 |
| 458 | 3300048917 | Ga0496114_0570531 | Ga0496114_0570531_363_782 | 137 |
| 459 | 3300049127 | Ga0501306_043066 | Ga0501306_043066_99_518 | 137 |
| 460 | 3300049130 | Ga0501310_039053 | Ga0501310_039053_146_565 | 137 |
| 461 | 3300049130 | Ga0501310_056296 | Ga0501310_056296_63_488 | 137 |
| 462 | 3300049160 | Ga0501304_041367 | Ga0501304_041367_43_465 | 137 |
| 463 | 3300049162 | Ga0501307_005860 | Ga0501307_005860_368_787 | 137 |
| 464 | 3300049162 | Ga0501307_027832 | Ga0501307_027832_286_720 | 137 |
| 465 | 3300049527 | Ga0501311_082937 | Ga0501311_082937_73_501 | 137 |
| 466 | 3300049532 | Ga0501316_050391 | Ga0501316_050391_121_552 | 137 |
| 467 | 3300049533 | Ga0501317_076224 | Ga0501317_076224_104_523 | 137 |
| 468 | 3300049533 | Ga0501317_080033 | Ga0501317_080033_20_442 | 137 |
| 469 | 3300049536 | Ga0501320_026475 | Ga0501320_026475_141_560 | 137 |
| 470 | 3300049539 | Ga0501323_041980 | Ga0501323_041980_193_612 | 137 |
| 471 | 3300049539 | Ga0501323_056786 | Ga0501323_056786_91_516 | 137 |
| 472 | 3300049540 | Ga0501324_042141 | Ga0501324_042141_12_431 | 137 |
| 473 | 3300049551 | Ga0501335_023778 | Ga0501335_023778_186_614 | 137 |
| 474 | 3300049570 | Ga0501033_1086889 | Ga0501033_1086889_56_484 | 137 |
| 475 | 3300049573 | Ga0501037_0311649 | Ga0501037_0311649_368_934 | 137 |
| 476 | 3300049575 | Ga0501039_0335062 | Ga0501039_0335062_207_773 | 137 |
| 477 | 3300049584 | Ga0501068_0058339 | Ga0501068_0058339_1604_2155 | 137 |
| 478 | 3300049590 | Ga0501074_0133573 | Ga0501074_0133573_1000_1566 | 137 |
| 479 | 3300049591 | Ga0501075_0558691 | Ga0501075_0558691_84_650 | 137 |
| 480 | 3300049822 | Ga0501035_0889635 | Ga0501035_0889635_137_565 | 137 |
| 481 | 3300059652 | Ga0587107_004096 | Ga0587107_004096_643_1056 | 137 |
| 482 | 3300059652 | Ga0587107_010905 | Ga0587107_010905_334_753 | 137 |
| 483 | iso_pu_bacteria | 2643221576 | 2643890021 | 137 |
| 484 | iso_pu_bacteria | 2643221590 | 2643959077 | 137 |
| 485 | iso_pu_bacteria | 2643221615 | 2644091092 | 137 |
| 486 | iso_pu_bacteria | 2643221641 | 2644229142 | 137 |
| 487 | iso_pu_bacteria | 2643221657 | 2644320895 | 137 |
| 488 | iso_pu_bacteria | 2739367898 | 2740168056 | 137 |
| 489 | iso_pu_bacteria | 2855386786 | 2855389961 | 137 |
| 490 | iso_pu_bacteria | 8054609563 | 8054613743 | 137 |
| 491 | 3300005337 | Ga0070682_100508901 | Ga0070682_1005089012 | 138 |
| 492 | 3300005338 | Ga0068868_101665381 | Ga0068868_1016653811 | 138 |
| 493 | 3300005455 | Ga0070663_100732829 | Ga0070663_1007328292 | 138 |
| 494 | 3300005456 | Ga0070678_101599401 | Ga0070678_1015994011 | 138 |
| 495 | 3300005535 | Ga0070684_101232972 | Ga0070684_1012329721 | 138 |
| 496 | 3300005843 | Ga0068860_100021208 | Ga0068860_1000212087 | 138 |
| 497 | 3300006038 | Ga0075365_10179443 | Ga0075365_101794432 | 138 |
| 498 | 3300006038 | Ga0075365_10633990 | Ga0075365_106339902 | 138 |
| 499 | 3300006048 | Ga0075363_100041533 | Ga0075363_1000415333 | 138 |
| 500 | 3300006051 | Ga0075364_10644615 | Ga0075364_106446152 | 138 |
| 501 | 3300006353 | Ga0075370_10189229 | Ga0075370_101892292 | 138 |
| 502 | 3300006846 | Ga0075430_100005226 | Ga0075430_1000052262 | 138 |
| 503 | 3300006847 | Ga0075431_100001734 | Ga0075431_10000173413 | 138 |
| 504 | 3300006880 | Ga0075429_100017134 | Ga0075429_10001713412 | 138 |
| 505 | 3300009094 | Ga0111539_11541607 | Ga0111539_115416072 | 138 |
| 506 | 3300009098 | Ga0105245_11371206 | Ga0105245_113712062 | 138 |
| 507 | 3300009101 | Ga0105247_10551419 | Ga0105247_105514192 | 138 |
| 508 | 3300009148 | Ga0105243_10889462 | Ga0105243_108894622 | 138 |
| 509 | 3300009551 | Ga0105238_10757932 | Ga0105238_107579322 | 138 |
| 510 | 3300010375 | Ga0105239_11517279 | Ga0105239_115172792 | 138 |
| 511 | 3300011119 | Ga0105246_10206720 | Ga0105246_102067202 | 138 |
| 512 | 3300012505 | Ga0157339_1017013 | Ga0157339_10170131 | 138 |
| 513 | 3300013105 | Ga0157369_10488777 | Ga0157369_104887772 | 138 |
| 514 | 3300013105 | Ga0157369_10575182 | Ga0157369_105751823 | 138 |
| 515 | 3300013307 | Ga0157372_11750100 | Ga0157372_117501001 | 138 |
| 516 | 3300013308 | Ga0157375_11269252 | Ga0157375_112692522 | 138 |
| 517 | 3300014325 | Ga0163163_12094559 | Ga0163163_120945591 | 138 |
| 518 | 3300014326 | Ga0157380_12082369 | Ga0157380_120823691 | 138 |
| 519 | 3300014497 | Ga0182008_10098142 | Ga0182008_100981422 | 138 |
| 520 | 3300017792 | Ga0163161_11031377 | Ga0163161_110313772 | 138 |
| 521 | 3300020076 | Ga0206355_1430339 | Ga0206355_14303392 | 138 |
| 522 | 3300025927 | Ga0207687_10578659 | Ga0207687_105786592 | 138 |
| 523 | 3300025937 | Ga0207669_10390659 | Ga0207669_103906592 | 138 |
| 524 | 3300025944 | Ga0207661_10480809 | Ga0207661_104808092 | 138 |
| 525 | 3300026067 | Ga0207678_10482575 | Ga0207678_104825752 | 138 |
| 526 | 3300026121 | Ga0207683_11127210 | Ga0207683_111272102 | 138 |
| 527 | 3300026142 | Ga0207698_10412271 | Ga0207698_104122713 | 138 |
| 528 | 3300028381 | Ga0268264_10000792 | Ga0268264_1000079224 | 138 |
| 529 | 3300035085 | Ga0373929_0041862 | Ga0373929_0041862_85_525 | 138 |
| 530 | 3300035112 | Ga0373932_0356548 | Ga0373932_0356548_16_456 | 138 |
| 531 | 3300035121 | Ga0373960_0098428 | Ga0373960_0098428_477_929 | 138 |
| 532 | 3300035242 | Ga0373962_0127058 | Ga0373962_0127058_250_693 | 138 |
| 533 | 3300037312 | Ga0395899_0495866 | Ga0395899_0495866_207_647 | 138 |
| 534 | 3300037418 | Ga0395900_0080337 | Ga0395900_0080337_673_1113 | 138 |
| 535 | 3300037466 | Ga0395898_0117522 | Ga0395898_0117522_669_1109 | 138 |
| 536 | 3300038443 | Ga0395901_0044740 | Ga0395901_0044740_1928_2368 | 138 |
| 537 | 3300038443 | Ga0395901_0880952 | Ga0395901_0880952_329_748 | 138 |
| 538 | 3300041444 | Ga0451790_03312 | Ga0451790_03312_23_484 | 138 |
| 539 | 3300041511 | Ga0451855_0560015 | Ga0451855_0560015_32_457 | 138 |
| 540 | 3300044683 | Ga0466965_0644282 | Ga0466965_0644282_94_537 | 138 |
| 541 | 3300044694 | Ga0466963_0301232 | Ga0466963_0301232_458_919 | 138 |
| 542 | 3300044735 | Ga0466968_0026632 | Ga0466968_0026632_1116_1538 | 138 |
| 543 | 3300044901 | Ga0466960_0009725 | Ga0466960_0009725_912_1355 | 138 |
| 544 | 3300045976 | Ga0466967_0057496 | Ga0466967_0057496_2740_3201 | 138 |
| 545 | 3300046475 | Ga0495639_0278480 | Ga0495639_0278480_100_546 | 138 |
| 546 | 3300046538 | Ga0495609_0321260 | Ga0495609_0321260_101_541 | 138 |
| 547 | 3300046559 | Ga0495667_0776521 | Ga0495667_0776521_64_510 | 138 |
| 548 | 3300046681 | Ga0495647_0108849 | Ga0495647_0108849_399_845 | 138 |
| 549 | 3300046683 | Ga0495658_0378484 | Ga0495658_0378484_239_688 | 138 |
| 550 | 3300046689 | Ga0495613_0586162 | Ga0495613_0586162_246_692 | 138 |
| 551 | 3300047322 | Ga0495680_0278739 | Ga0495680_0278739_251_697 | 138 |
| 552 | 3300048903 | Ga0496100_0029403 | Ga0496100_0029403_559_999 | 138 |
| 553 | 3300048904 | Ga0496101_0025837 | Ga0496101_0025837_1227_1667 | 138 |
| 554 | 3300048904 | Ga0496101_0907791 | Ga0496101_0907791_239_673 | 138 |
| 555 | 3300048905 | Ga0496102_0004268 | Ga0496102_0004268_6571_7011 | 138 |
| 556 | 3300048906 | Ga0496103_0002413 | Ga0496103_0002413_5370_5810 | 138 |
| 557 | 3300048906 | Ga0496103_0203919 | Ga0496103_0203919_558_977 | 138 |
| 558 | 3300048907 | Ga0496104_0042002 | Ga0496104_0042002_3711_4151 | 138 |
| 559 | 3300048907 | Ga0496104_0152888 | Ga0496104_0152888_173_634 | 138 |
| 560 | 3300048908 | Ga0496105_0065779 | Ga0496105_0065779_1378_1818 | 138 |
| 561 | 3300048908 | Ga0496105_0191069 | Ga0496105_0191069_674_1135 | 138 |
| 562 | 3300048909 | Ga0496106_0005923 | Ga0496106_0005923_2080_2520 | 138 |
| 563 | 3300048911 | Ga0496108_0026274 | Ga0496108_0026274_1599_2039 | 138 |
| 564 | 3300048911 | Ga0496108_0303696 | Ga0496108_0303696_323_781 | 138 |
| 565 | 3300048912 | Ga0496109_0029975 | Ga0496109_0029975_623_1063 | 138 |
| 566 | 3300048912 | Ga0496109_0381469 | Ga0496109_0381469_834_1268 | 138 |
| 567 | 3300048912 | Ga0496109_0584548 | Ga0496109_0584548_190_648 | 138 |
| 568 | 3300048912 | Ga0496109_0682021 | Ga0496109_0682021_11_436 | 138 |
| 569 | 3300048912 | Ga0496109_0844733 | Ga0496109_0844733_330_764 | 138 |
| 570 | 3300048913 | Ga0496110_0003020 | Ga0496110_0003020_6383_6823 | 138 |
| 571 | 3300048913 | Ga0496110_0489336 | Ga0496110_0489336_269_727 | 138 |
| 572 | 3300048914 | Ga0496111_0021913 | Ga0496111_0021913_3563_4003 | 138 |
| 573 | 3300048915 | Ga0496112_0012650 | Ga0496112_0012650_5837_6277 | 138 |
| 574 | 3300048916 | Ga0496113_0299038 | Ga0496113_0299038_706_1146 | 138 |
| 575 | 3300048917 | Ga0496114_0244125 | Ga0496114_0244125_540_980 | 138 |
| 576 | 3300048917 | Ga0496114_0300732 | Ga0496114_0300732_553_987 | 138 |
| 577 | 3300048918 | Ga0496115_0666949 | Ga0496115_0666949_67_501 | 138 |
| 578 | 3300049127 | Ga0501306_008227 | Ga0501306_008227_569_1012 | 138 |
| 579 | 3300049128 | Ga0501308_078160 | Ga0501308_078160_58_477 | 138 |
| 580 | 3300049129 | Ga0501309_004651 | Ga0501309_004651_576_1019 | 138 |
| 581 | 3300049130 | Ga0501310_000215 | Ga0501310_000215_475_918 | 138 |
| 582 | 3300049161 | Ga0501305_011790 | Ga0501305_011790_122_565 | 138 |
| 583 | 3300049161 | Ga0501305_046041 | Ga0501305_046041_126_587 | 138 |
| 584 | 3300049161 | Ga0501305_092746 | Ga0501305_092746_85_504 | 138 |
| 585 | 3300049162 | Ga0501307_001493 | Ga0501307_001493_518_961 | 138 |
| 586 | 3300049162 | Ga0501307_088798 | Ga0501307_088798_44_463 | 138 |
| 587 | 3300049514 | Ga0501291_011421 | Ga0501291_011421_390_833 | 138 |
| 588 | 3300049527 | Ga0501311_000190 | Ga0501311_000190_696_1139 | 138 |
| 589 | 3300049527 | Ga0501311_069162 | Ga0501311_069162_40_459 | 138 |
| 590 | 3300049528 | Ga0501312_006477 | Ga0501312_006477_607_1050 | 138 |
| 591 | 3300049528 | Ga0501312_016524 | Ga0501312_016524_87_506 | 138 |
| 592 | 3300049529 | Ga0501313_005383 | Ga0501313_005383_530_973 | 138 |
| 593 | 3300049531 | Ga0501315_012729 | Ga0501315_012729_125_568 | 138 |
| 594 | 3300049532 | Ga0501316_009854 | Ga0501316_009854_550_993 | 138 |
| 595 | 3300049533 | Ga0501317_000171 | Ga0501317_000171_1250_1693 | 138 |
| 596 | 3300049533 | Ga0501317_059862 | Ga0501317_059862_87_524 | 138 |
| 597 | 3300049534 | Ga0501318_000714 | Ga0501318_000714_486_929 | 138 |
| 598 | 3300049534 | Ga0501318_014331 | Ga0501318_014331_383_817 | 138 |
| 599 | 3300049534 | Ga0501318_059911 | Ga0501318_059911_124_543 | 138 |
| 600 | 3300049535 | Ga0501319_001563 | Ga0501319_001563_552_995 | 138 |
| 601 | 3300049536 | Ga0501320_060886 | Ga0501320_060886_61_480 | 138 |
| 602 | 3300049537 | Ga0501321_000377 | Ga0501321_000377_27_464 | 138 |
| 603 | 3300049537 | Ga0501321_001182 | Ga0501321_001182_1479_1922 | 138 |
| 604 | 3300049537 | Ga0501321_050996 | Ga0501321_050996_105_524 | 138 |
| 605 | 3300049538 | Ga0501322_003301 | Ga0501322_003301_151_594 | 138 |
| 606 | 3300049539 | Ga0501323_000118 | Ga0501323_000118_2578_3021 | 138 |
| 607 | 3300049539 | Ga0501323_051700 | Ga0501323_051700_14_454 | 138 |
| 608 | 3300049540 | Ga0501324_000012 | Ga0501324_000012_5618_6061 | 138 |
| 609 | 3300049541 | Ga0501325_001935 | Ga0501325_001935_343_786 | 138 |
| 610 | 3300049556 | Ga0501340_006300 | Ga0501340_006300_134_577 | 138 |
| 611 | 3300049568 | Ga0501031_0019900 | Ga0501031_0019900_1634_2062 | 138 |
| 612 | 3300049568 | Ga0501031_0311507 | Ga0501031_0311507_252_698 | 138 |
| 613 | 3300049569 | Ga0501032_0027010 | Ga0501032_0027010_1247_1675 | 138 |
| 614 | 3300049571 | Ga0501034_1298238 | Ga0501034_1298238_38_460 | 138 |
| 615 | 3300049572 | Ga0501036_0958206 | Ga0501036_0958206_152_571 | 138 |
| 616 | 3300049573 | Ga0501037_0054932 | Ga0501037_0054932_34_462 | 138 |
| 617 | 3300049574 | Ga0501038_0234621 | Ga0501038_0234621_44_472 | 138 |
| 618 | 3300049575 | Ga0501039_0055448 | Ga0501039_0055448_1279_1707 | 138 |
| 619 | 3300049577 | Ga0501041_0432802 | Ga0501041_0432802_254_673 | 138 |
| 620 | 3300049578 | Ga0501042_0327248 | Ga0501042_0327248_103_531 | 138 |
| 621 | 3300049578 | Ga0501042_0541720 | Ga0501042_0541720_297_743 | 138 |
| 622 | 3300049578 | Ga0501042_0744455 | Ga0501042_0744455_232_651 | 138 |
| 623 | 3300049579 | Ga0501043_0189571 | Ga0501043_0189571_488_916 | 138 |
| 624 | 3300049580 | Ga0501046_0071881 | Ga0501046_0071881_1248_1676 | 138 |
| 625 | 3300049580 | Ga0501046_0604422 | Ga0501046_0604422_323_742 | 138 |
| 626 | 3300049581 | Ga0501047_0033441 | Ga0501047_0033441_4240_4668 | 138 |
| 627 | 3300049582 | Ga0501048_0015873 | Ga0501048_0015873_5034_5462 | 138 |
| 628 | 3300049582 | Ga0501048_0507911 | Ga0501048_0507911_385_804 | 138 |
| 629 | 3300049584 | Ga0501068_0155931 | Ga0501068_0155931_654_1094 | 138 |
| 630 | 3300049584 | Ga0501068_0261968 | Ga0501068_0261968_512_940 | 138 |
| 631 | 3300049585 | Ga0501069_0043121 | Ga0501069_0043121_96_536 | 138 |
| 632 | 3300049585 | Ga0501069_0302659 | Ga0501069_0302659_254_682 | 138 |
| 633 | 3300049586 | Ga0501070_0004983 | Ga0501070_0004983_3034_3453 | 138 |
| 634 | 3300049587 | Ga0501071_0308535 | Ga0501071_0308535_120_560 | 138 |
| 635 | 3300049587 | Ga0501071_0430651 | Ga0501071_0430651_319_738 | 138 |
| 636 | 3300049588 | Ga0501072_0504454 | Ga0501072_0504454_458_877 | 138 |
| 637 | 3300049589 | Ga0501073_0644269 | Ga0501073_0644269_90_518 | 138 |
| 638 | 3300049590 | Ga0501074_0814990 | Ga0501074_0814990_78_506 | 138 |
| 639 | 3300049660 | Ga0501216_031581 | Ga0501216_031581_496_939 | 138 |
| 640 | 3300049676 | Ga0501246_015266 | Ga0501246_015266_92_535 | 138 |
| 641 | 3300049683 | Ga0501253_116410 | Ga0501253_116410_163_606 | 138 |
| 642 | 3300049742 | Ga0501080_0141216 | Ga0501080_0141216_1081_1509 | 138 |
| 643 | 3300049822 | Ga0501035_0097705 | Ga0501035_0097705_1937_2365 | 138 |
| 644 | 3300049823 | Ga0501044_0004036 | Ga0501044_0004036_4574_5002 | 138 |
| 645 | 3300050490 | nmdc:mga03n38_6080_c1 | nmdc:mga03n38_6080_c1_565_1125 | 138 |
| 646 | 3300050492 | nmdc:mga0yw44_405602_c1 | nmdc:mga0yw44_405602_c1_86_646 | 138 |
| 647 | 3300050496 | nmdc:mga07m45_4612_c1 | nmdc:mga07m45_4612_c1_1445_2005 | 138 |
| 648 | 3300050511 | nmdc:mga08y16_738529_c1 | nmdc:mga08y16_738529_c1_462_902 | 138 |
| 649 | 3300050512 | nmdc:mga0n895_1156086_c1 | nmdc:mga0n895_1156086_c1_78_518 | 138 |
| 650 | 3300050513 | nmdc:mga0rr50_1181386_c1 | nmdc:mga0rr50_1181386_c1_79_519 | 138 |
| 651 | 3300053085 | Ga0495619_0231221 | Ga0495619_0231221_554_1006 | 138 |
| 652 | 3300053085 | Ga0495619_0319711 | Ga0495619_0319711_553_999 | 138 |
| 653 | 3300059605 | Ga0587106_092358 | Ga0587106_092358_144_563 | 138 |
| 654 | 3300059639 | Ga0587062_088749 | Ga0587062_088749_47_466 | 138 |
| 655 | 3300059641 | Ga0587068_070769 | Ga0587068_070769_238_657 | 138 |
| 656 | 3300060353 | Ga0501082_0880258 | Ga0501082_0880258_104_667 | 138 |
| 657 | 3300061734 | Ga0530510_0070526 | Ga0530510_0070526_625_1065 | 138 |
| 658 | 3300061734 | Ga0530510_0409932 | Ga0530510_0409932_54_617 | 138 |
| 659 | iso_pu_bacteria | 2857481737 | 2857485187 | 138 |
| 660 | 3300005354 | Ga0070675_101852128 | Ga0070675_1018521281 | 139 |
| 661 | 3300005366 | Ga0070659_100565211 | Ga0070659_1005652112 | 139 |
| 662 | 3300005457 | Ga0070662_100541549 | Ga0070662_1005415493 | 139 |
| 663 | 3300005471 | Ga0070698_100055313 | Ga0070698_1000553135 | 139 |
| 664 | 3300005530 | Ga0070679_101123339 | Ga0070679_1011233391 | 139 |
| 665 | 3300005543 | Ga0070672_101066108 | Ga0070672_1010661082 | 139 |
| 666 | 3300005547 | Ga0070693_100889347 | Ga0070693_1008893472 | 139 |
| 667 | 3300005577 | Ga0068857_100556843 | Ga0068857_1005568432 | 139 |
| 668 | 3300006038 | Ga0075365_10146997 | Ga0075365_101469972 | 139 |
| 669 | 3300006048 | Ga0075363_100124271 | Ga0075363_1001242712 | 139 |
| 670 | 3300006237 | Ga0097621_101652236 | Ga0097621_1016522361 | 139 |
| 671 | 3300006353 | Ga0075370_10236513 | Ga0075370_102365133 | 139 |
| 672 | 3300009553 | Ga0105249_11426410 | Ga0105249_114264102 | 139 |
| 673 | 3300012490 | Ga0157322_1015937 | Ga0157322_10159372 | 139 |
| 674 | 3300012494 | Ga0157341_1009388 | Ga0157341_10093882 | 139 |
| 675 | 3300013102 | Ga0157371_10449972 | Ga0157371_104499722 | 139 |
| 676 | 3300013297 | Ga0157378_10729055 | Ga0157378_107290552 | 139 |
| 677 | 3300013306 | Ga0163162_12638110 | Ga0163162_126381101 | 139 |
| 678 | 3300014326 | Ga0157380_10798099 | Ga0157380_107980992 | 139 |
| 679 | 3300020069 | Ga0197907_10124435 | Ga0197907_101244351 | 139 |
| 680 | 3300025921 | Ga0207652_10877523 | Ga0207652_108775232 | 139 |
| 681 | 3300025931 | Ga0207644_10816936 | Ga0207644_108169362 | 139 |
| 682 | 3300025942 | Ga0207689_10395221 | Ga0207689_103952212 | 139 |
| 683 | 3300025945 | Ga0207679_10480510 | Ga0207679_104805102 | 139 |
| 684 | 3300027866 | Ga0209813_10422413 | Ga0209813_104224132 | 139 |
| 685 | 3300030732 | Ga0316176_1093836 | Ga0316176_10938363 | 139 |
| 686 | 3300030733 | Ga0314311_1063086 | Ga0314311_10630863 | 139 |
| 687 | 3300030744 | Ga0316181_1044632 | Ga0316181_10446323 | 139 |
| 688 | 3300030745 | Ga0316182_1249978 | Ga0316182_12499782 | 139 |
| 689 | 3300031730 | Ga0307516_10792272 | Ga0307516_107922721 | 139 |
| 690 | 3300031824 | Ga0307413_10179289 | Ga0307413_101792892 | 139 |
| 691 | 3300031852 | Ga0307410_10131183 | Ga0307410_101311833 | 139 |
| 692 | 3300031995 | Ga0307409_100328891 | Ga0307409_1003288912 | 139 |
| 693 | 3300032004 | Ga0307414_10400359 | Ga0307414_104003592 | 139 |
| 694 | 3300037312 | Ga0395899_0220065 | Ga0395899_0220065_213_635 | 139 |
| 695 | 3300037418 | Ga0395900_0169253 | Ga0395900_0169253_840_1262 | 139 |
| 696 | 3300037418 | Ga0395900_0906545 | Ga0395900_0906545_354_773 | 139 |
| 697 | 3300037466 | Ga0395898_0032908 | Ga0395898_0032908_4321_4743 | 139 |
| 698 | 3300038443 | Ga0395901_0002011 | Ga0395901_0002011_15075_15497 | 139 |
| 699 | 3300041405 | Ga0439438_017324 | Ga0439438_017324_1173_1595 | 139 |
| 700 | 3300041407 | Ga0439447_022943 | Ga0439447_022943_824_1246 | 139 |
| 701 | 3300041997 | Ga0439431_0008571 | Ga0439431_0008571_1862_2284 | 139 |
| 702 | 3300042004 | Ga0439445_0013830 | Ga0439445_0013830_126_548 | 139 |
| 703 | 3300042156 | Ga0439446_0164790 | Ga0439446_0164790_145_567 | 139 |
| 704 | 3300042435 | Ga0439434_0000725 | Ga0439434_0000725_3304_3726 | 139 |
| 705 | 3300044658 | Ga0466972_0201794 | Ga0466972_0201794_80_505 | 139 |
| 706 | 3300044683 | Ga0466965_0216655 | Ga0466965_0216655_228_647 | 139 |
| 707 | 3300044684 | Ga0466966_0539043 | Ga0466966_0539043_106_543 | 139 |
| 708 | 3300044693 | Ga0466961_0503309 | Ga0466961_0503309_251_670 | 139 |
| 709 | 3300044694 | Ga0466963_0002887 | Ga0466963_0002887_7495_7917 | 139 |
| 710 | 3300044719 | Ga0466971_0134028 | Ga0466971_0134028_404_826 | 139 |
| 711 | 3300044765 | Ga0466970_0007149 | Ga0466970_0007149_4263_4682 | 139 |
| 712 | 3300044765 | Ga0466970_0515876 | Ga0466970_0515876_22_441 | 139 |
| 713 | 3300044765 | Ga0466970_0542329 | Ga0466970_0542329_211_633 | 139 |
| 714 | 3300044842 | Ga0466957_0308782 | Ga0466957_0308782_221_640 | 139 |
| 715 | 3300045049 | Ga0466959_0044069 | Ga0466959_0044069_1471_1893 | 139 |
| 716 | 3300045836 | Ga0466958_0250198 | Ga0466958_0250198_567_989 | 139 |
| 717 | 3300045976 | Ga0466967_0311524 | Ga0466967_0311524_647_1069 | 139 |
| 718 | 3300046459 | Ga0495629_0500075 | Ga0495629_0500075_185_610 | 139 |
| 719 | 3300046463 | Ga0495653_0057884 | Ga0495653_0057884_1736_2161 | 139 |
| 720 | 3300046511 | Ga0495608_0139951 | Ga0495608_0139951_253_678 | 139 |
| 721 | 3300046678 | Ga0495599_0234217 | Ga0495599_0234217_194_619 | 139 |
| 722 | 3300047319 | Ga0495674_1000037 | Ga0495674_1000037_112_537 | 139 |
| 723 | 3300047321 | Ga0495676_0197442 | Ga0495676_0197442_444_869 | 139 |
| 724 | 3300049128 | Ga0501308_021454 | Ga0501308_021454_237_656 | 139 |
| 725 | 3300049129 | Ga0501309_066995 | Ga0501309_066995_105_545 | 139 |
| 726 | 3300049130 | Ga0501310_004536 | Ga0501310_004536_335_757 | 139 |
| 727 | 3300049130 | Ga0501310_060938 | Ga0501310_060938_93_512 | 139 |
| 728 | 3300049130 | Ga0501310_081428 | Ga0501310_081428_12_431 | 139 |
| 729 | 3300049161 | Ga0501305_021222 | Ga0501305_021222_94_513 | 139 |
| 730 | 3300049528 | Ga0501312_078339 | Ga0501312_078339_51_470 | 139 |
| 731 | 3300049528 | Ga0501312_124075 | Ga0501312_124075_47_466 | 139 |
| 732 | 3300049529 | Ga0501313_023498 | Ga0501313_023498_303_722 | 139 |
| 733 | 3300049530 | Ga0501314_014546 | Ga0501314_014546_223_651 | 139 |
| 734 | 3300049532 | Ga0501316_076175 | Ga0501316_076175_48_467 | 139 |
| 735 | 3300049534 | Ga0501318_055256 | Ga0501318_055256_134_553 | 139 |
| 736 | 3300049534 | Ga0501318_086630 | Ga0501318_086630_44_463 | 139 |
| 737 | 3300049536 | Ga0501320_020819 | Ga0501320_020819_34_453 | 139 |
| 738 | 3300049537 | Ga0501321_056278 | Ga0501321_056278_126_545 | 139 |
| 739 | 3300049537 | Ga0501321_058781 | Ga0501321_058781_124_543 | 139 |
| 740 | 3300049538 | Ga0501322_009483 | Ga0501322_009483_88_507 | 139 |
| 741 | 3300049539 | Ga0501323_074484 | Ga0501323_074484_80_499 | 139 |
| 742 | 3300049540 | Ga0501324_037264 | Ga0501324_037264_28_462 | 139 |
| 743 | 3300049571 | Ga0501034_0069200 | Ga0501034_0069200_2173_2598 | 139 |
| 744 | 3300049573 | Ga0501037_0028700 | Ga0501037_0028700_2632_3057 | 139 |
| 745 | 3300049574 | Ga0501038_0187963 | Ga0501038_0187963_296_721 | 139 |
| 746 | 3300049581 | Ga0501047_0023921 | Ga0501047_0023921_5225_5650 | 139 |
| 747 | 3300049583 | Ga0501067_0142954 | Ga0501067_0142954_178_756 | 139 |
| 748 | 3300049583 | Ga0501067_0148213 | Ga0501067_0148213_336_767 | 139 |
| 749 | 3300049583 | Ga0501067_0258598 | Ga0501067_0258598_254_688 | 139 |
| 750 | 3300049585 | Ga0501069_0099451 | Ga0501069_0099451_1058_1492 | 139 |
| 751 | 3300049585 | Ga0501069_0252417 | Ga0501069_0252417_579_1004 | 139 |
| 752 | 3300049586 | Ga0501070_0225481 | Ga0501070_0225481_107_529 | 139 |
| 753 | 3300049589 | Ga0501073_0093221 | Ga0501073_0093221_1084_1506 | 139 |
| 754 | 3300049591 | Ga0501075_0475760 | Ga0501075_0475760_256_693 | 139 |
| 755 | 3300049665 | Ga0501227_195147 | Ga0501227_195147_134_553 | 139 |
| 756 | 3300049741 | Ga0501079_0027696 | Ga0501079_0027696_3433_3855 | 139 |
| 757 | 3300049742 | Ga0501080_0216610 | Ga0501080_0216610_546_968 | 139 |
| 758 | 3300049822 | Ga0501035_0334257 | Ga0501035_0334257_214_639 | 139 |
| 759 | 3300049823 | Ga0501044_0101925 | Ga0501044_0101925_93_518 | 139 |
| 760 | 3300049823 | Ga0501044_0777629 | Ga0501044_0777629_320_742 | 139 |
| 761 | 3300049824 | Ga0501045_0378299 | Ga0501045_0378299_488_913 | 139 |
| 762 | 3300050491 | nmdc:mga00v17_396942_c1 | nmdc:mga00v17_396942_c1_329_748 | 139 |
| 763 | 3300050495 | nmdc:mga04h51_458096_c1 | nmdc:mga04h51_458096_c1_29_448 | 139 |
| 764 | 3300050496 | nmdc:mga07m45_431698_c1 | nmdc:mga07m45_431698_c1_291_710 | 139 |
| 765 | 3300053085 | Ga0495619_0547018 | Ga0495619_0547018_130_555 | 139 |
| 766 | 3300059421 | Ga0590071_009977 | Ga0590071_009977_623_1054 | 139 |
| 767 | 3300059426 | Ga0590077_031331 | Ga0590077_031331_322_753 | 139 |
| 768 | 3300061719 | Ga0466962_0037334 | Ga0466962_0037334_1376_1798 | 139 |
| 769 | 3300005333 | Ga0070677_10477532 | Ga0070677_104775321 | 140 |
| 770 | 3300005338 | Ga0068868_101952144 | Ga0068868_1019521441 | 140 |
| 771 | 3300005339 | Ga0070660_100136216 | Ga0070660_1001362162 | 140 |
| 772 | 3300005530 | Ga0070679_100800880 | Ga0070679_1008008802 | 140 |
| 773 | 3300005547 | Ga0070693_100526403 | Ga0070693_1005264032 | 140 |
| 774 | 3300005718 | Ga0068866_10262124 | Ga0068866_102621242 | 140 |
| 775 | 3300006038 | Ga0075365_10211303 | Ga0075365_102113032 | 140 |
| 776 | 3300006042 | Ga0075368_10001331 | Ga0075368_100013312 | 140 |
| 777 | 3300006042 | Ga0075368_10057698 | Ga0075368_100576983 | 140 |
| 778 | 3300006048 | Ga0075363_100237441 | Ga0075363_1002374413 | 140 |
| 779 | 3300006051 | Ga0075364_10046975 | Ga0075364_100469754 | 140 |
| 780 | 3300006178 | Ga0075367_10029487 | Ga0075367_100294872 | 140 |
| 781 | 3300006178 | Ga0075367_10412588 | Ga0075367_104125882 | 140 |
| 782 | 3300006353 | Ga0075370_10171740 | Ga0075370_101717403 | 140 |
| 783 | 3300006353 | Ga0075370_10217143 | Ga0075370_102171432 | 140 |
| 784 | 3300009148 | Ga0105243_11016600 | Ga0105243_110166002 | 140 |
| 785 | 3300009545 | Ga0105237_10852644 | Ga0105237_108526442 | 140 |
| 786 | 3300010375 | Ga0105239_10024787 | Ga0105239_100247873 | 140 |
| 787 | 3300013105 | Ga0157369_11007682 | Ga0157369_110076821 | 140 |
| 788 | 3300013296 | Ga0157374_11254421 | Ga0157374_112544212 | 140 |
| 789 | 3300013307 | Ga0157372_10356926 | Ga0157372_103569263 | 140 |
| 790 | 3300013308 | Ga0157375_12831267 | Ga0157375_128312671 | 140 |
| 791 | 3300020082 | Ga0206353_11410002 | Ga0206353_114100022 | 140 |
| 792 | 3300025901 | Ga0207688_10244651 | Ga0207688_102446512 | 140 |
| 793 | 3300025904 | Ga0207647_10141073 | Ga0207647_101410732 | 140 |
| 794 | 3300025919 | Ga0207657_10095519 | Ga0207657_100955191 | 140 |
| 795 | 3300025935 | Ga0207709_10479453 | Ga0207709_104794532 | 140 |
| 796 | 3300025939 | Ga0207665_10632995 | Ga0207665_106329952 | 140 |
| 797 | 3300025940 | Ga0207691_10552198 | Ga0207691_105521982 | 140 |
| 798 | 3300025945 | Ga0207679_11626759 | Ga0207679_116267591 | 140 |
| 799 | 3300025961 | Ga0207712_10345426 | Ga0207712_103454263 | 140 |
| 800 | 3300026095 | Ga0207676_12104808 | Ga0207676_121048082 | 140 |
| 801 | 3300026116 | Ga0207674_10902352 | Ga0207674_109023522 | 140 |
| 802 | 3300026118 | Ga0207675_100436195 | Ga0207675_1004361952 | 140 |
| 803 | 3300026118 | Ga0207675_100532514 | Ga0207675_1005325143 | 140 |
| 804 | 3300026142 | Ga0207698_11777425 | Ga0207698_117774251 | 140 |
| 805 | 3300027614 | Ga0209970_1010625 | Ga0209970_10106253 | 140 |
| 806 | 3300030733 | Ga0314311_1091600 | Ga0314311_10916002 | 140 |
| 807 | 3300030733 | Ga0314311_1110141 | Ga0314311_11101413 | 140 |
| 808 | 3300030744 | Ga0316181_1229775 | Ga0316181_12297752 | 140 |
| 809 | 3300031852 | Ga0307410_10717267 | Ga0307410_107172672 | 140 |
| 810 | 3300031852 | Ga0307410_10814649 | Ga0307410_108146492 | 140 |
| 811 | 3300031995 | Ga0307409_100306256 | Ga0307409_1003062563 | 140 |
| 812 | 3300032002 | Ga0307416_100884849 | Ga0307416_1008848491 | 140 |
| 813 | 3300032002 | Ga0307416_102375033 | Ga0307416_1023750332 | 140 |
| 814 | 3300032005 | Ga0307411_10198643 | Ga0307411_101986433 | 140 |
| 815 | 3300034820 | Ga0373959_0041280 | Ga0373959_0041280_375_800 | 140 |
| 816 | 3300035092 | Ga0373952_0029220 | Ga0373952_0029220_591_1016 | 140 |
| 817 | 3300038443 | Ga0395901_0038023 | Ga0395901_0038023_126_557 | 140 |
| 818 | 3300041411 | Ga0439466_0080675 | Ga0439466_0080675_370_795 | 140 |
| 819 | 3300041459 | Ga0451800_1688016 | Ga0451800_1688016_126_569 | 140 |
| 820 | 3300041512 | Ga0451853_2312243 | Ga0451853_2312243_736_1179 | 140 |
| 821 | 3300042002 | Ga0439442_066080 | Ga0439442_066080_328_753 | 140 |
| 822 | 3300044656 | Ga0466969_0042846 | Ga0466969_0042846_897_1328 | 140 |
| 823 | 3300044683 | Ga0466965_0180193 | Ga0466965_0180193_96_533 | 140 |
| 824 | 3300044683 | Ga0466965_0213732 | Ga0466965_0213732_456_896 | 140 |
| 825 | 3300044683 | Ga0466965_0339951 | Ga0466965_0339951_375_806 | 140 |
| 826 | 3300044683 | Ga0466965_0514916 | Ga0466965_0514916_232_657 | 140 |
| 827 | 3300044684 | Ga0466966_0066805 | Ga0466966_0066805_157_588 | 140 |
| 828 | 3300044693 | Ga0466961_0211677 | Ga0466961_0211677_633_1064 | 140 |
| 829 | 3300044693 | Ga0466961_0478448 | Ga0466961_0478448_78_518 | 140 |
| 830 | 3300044694 | Ga0466963_0235872 | Ga0466963_0235872_184_612 | 140 |
| 831 | 3300044694 | Ga0466963_0677370 | Ga0466963_0677370_159_590 | 140 |
| 832 | 3300044706 | Ga0466964_0493307 | Ga0466964_0493307_16_447 | 140 |
| 833 | 3300044719 | Ga0466971_0049834 | Ga0466971_0049834_323_754 | 140 |
| 834 | 3300044765 | Ga0466970_0298319 | Ga0466970_0298319_345_776 | 140 |
| 835 | 3300044842 | Ga0466957_0492980 | Ga0466957_0492980_284_715 | 140 |
| 836 | 3300044842 | Ga0466957_0556831 | Ga0466957_0556831_190_618 | 140 |
| 837 | 3300045836 | Ga0466958_0945592 | Ga0466958_0945592_29_460 | 140 |
| 838 | 3300045976 | Ga0466967_0729642 | Ga0466967_0729642_311_739 | 140 |
| 839 | 3300045976 | Ga0466967_1694736 | Ga0466967_1694736_30_461 | 140 |
| 840 | 3300046459 | Ga0495629_0096372 | Ga0495629_0096372_348_818 | 140 |
| 841 | 3300046461 | Ga0495641_0337918 | Ga0495641_0337918_177_647 | 140 |
| 842 | 3300046473 | Ga0495582_0164038 | Ga0495582_0164038_330_800 | 140 |
| 843 | 3300046517 | Ga0495630_0381578 | Ga0495630_0381578_97_558 | 140 |
| 844 | 3300046615 | Ga0495656_0649857 | Ga0495656_0649857_17_442 | 140 |
| 845 | 3300047319 | Ga0495674_0493845 | Ga0495674_0493845_98_559 | 140 |
| 846 | 3300047321 | Ga0495676_0284682 | Ga0495676_0284682_312_782 | 140 |
| 847 | 3300048903 | Ga0496100_0357801 | Ga0496100_0357801_541_1008 | 140 |
| 848 | 3300048905 | Ga0496102_0420064 | Ga0496102_0420064_656_1123 | 140 |
| 849 | 3300048905 | Ga0496102_1821992 | Ga0496102_1821992_38_481 | 140 |
| 850 | 3300048906 | Ga0496103_0333986 | Ga0496103_0333986_18_443 | 140 |
| 851 | 3300048907 | Ga0496104_0313410 | Ga0496104_0313410_338_760 | 140 |
| 852 | 3300048909 | Ga0496106_0232430 | Ga0496106_0232430_448_873 | 140 |
| 853 | 3300048910 | Ga0496107_0172477 | Ga0496107_0172477_427_894 | 140 |
| 854 | 3300048911 | Ga0496108_0336636 | Ga0496108_0336636_249_716 | 140 |
| 855 | 3300048911 | Ga0496108_0422087 | Ga0496108_0422087_118_561 | 140 |
| 856 | 3300048912 | Ga0496109_1575207 | Ga0496109_1575207_83_505 | 140 |
| 857 | 3300048914 | Ga0496111_0069011 | Ga0496111_0069011_977_1420 | 140 |
| 858 | 3300048915 | Ga0496112_1131876 | Ga0496112_1131876_30_497 | 140 |
| 859 | 3300048917 | Ga0496114_0190045 | Ga0496114_0190045_1183_1650 | 140 |
| 860 | 3300049127 | Ga0501306_011666 | Ga0501306_011666_662_1087 | 140 |
| 861 | 3300049128 | Ga0501308_066625 | Ga0501308_066625_92_517 | 140 |
| 862 | 3300049160 | Ga0501304_007286 | Ga0501304_007286_449_874 | 140 |
| 863 | 3300049161 | Ga0501305_108648 | Ga0501305_108648_51_476 | 140 |
| 864 | 3300049532 | Ga0501316_067268 | Ga0501316_067268_13_438 | 140 |
| 865 | 3300049534 | Ga0501318_083205 | Ga0501318_083205_49_474 | 140 |
| 866 | 3300049568 | Ga0501031_0335783 | Ga0501031_0335783_162_587 | 140 |
| 867 | 3300049569 | Ga0501032_0792926 | Ga0501032_0792926_123_548 | 140 |
| 868 | 3300049571 | Ga0501034_0352454 | Ga0501034_0352454_402_827 | 140 |
| 869 | 3300049572 | Ga0501036_0944105 | Ga0501036_0944105_228_653 | 140 |
| 870 | 3300049573 | Ga0501037_0676042 | Ga0501037_0676042_229_654 | 140 |
| 871 | 3300049575 | Ga0501039_0151078 | Ga0501039_0151078_1287_1712 | 140 |
| 872 | 3300049578 | Ga0501042_0858000 | Ga0501042_0858000_226_651 | 140 |
| 873 | 3300049585 | Ga0501069_0321693 | Ga0501069_0321693_251_847 | 140 |
| 874 | 3300049587 | Ga0501071_0389469 | Ga0501071_0389469_533_958 | 140 |
| 875 | 3300049588 | Ga0501072_0330311 | Ga0501072_0330311_473_898 | 140 |
| 876 | 3300049590 | Ga0501074_0375209 | Ga0501074_0375209_341_766 | 140 |
| 877 | 3300049591 | Ga0501075_0667128 | Ga0501075_0667128_151_576 | 140 |
| 878 | 3300049592 | Ga0501076_0777705 | Ga0501076_0777705_301_726 | 140 |
| 879 | 3300049741 | Ga0501079_0537448 | Ga0501079_0537448_253_678 | 140 |
| 880 | 3300049742 | Ga0501080_0731352 | Ga0501080_0731352_311_736 | 140 |
| 881 | 3300049744 | Ga0501083_0105387 | Ga0501083_0105387_200_625 | 140 |
| 882 | 3300049822 | Ga0501035_0660930 | Ga0501035_0660930_237_662 | 140 |
| 883 | 3300050489 | nmdc:mga03683_2815_c1 | nmdc:mga03683_2815_c1_4520_4960 | 140 |
| 884 | 3300050490 | nmdc:mga03n38_6390_c1 | nmdc:mga03n38_6390_c1_1729_2169 | 140 |
| 885 | 3300050490 | nmdc:mga03n38_978246_c1 | nmdc:mga03n38_978246_c1_59_481 | 140 |
| 886 | 3300050491 | nmdc:mga00v17_21651_c2 | nmdc:mga00v17_21651_c2_1125_1691 | 140 |
| 887 | 3300050491 | nmdc:mga00v17_33777_c1 | nmdc:mga00v17_33777_c1_1991_2524 | 140 |
| 888 | 3300050491 | nmdc:mga00v17_80515_c1 | nmdc:mga00v17_80515_c1_953_1393 | 140 |
| 889 | 3300050492 | nmdc:mga0yw44_12755_c1 | nmdc:mga0yw44_12755_c1_1936_2469 | 140 |
| 890 | 3300050492 | nmdc:mga0yw44_276350_c1 | nmdc:mga0yw44_276350_c1_67_621 | 140 |
| 891 | 3300050492 | nmdc:mga0yw44_56680_c1 | nmdc:mga0yw44_56680_c1_1044_1484 | 140 |
| 892 | 3300050494 | nmdc:mga06z11_320333_c1 | nmdc:mga06z11_320333_c1_107_529 | 140 |
| 893 | 3300050496 | nmdc:mga07m45_1335_c1 | nmdc:mga07m45_1335_c1_612_1052 | 140 |
| 894 | 3300050496 | nmdc:mga07m45_210168_c1 | nmdc:mga07m45_210168_c1_214_639 | 140 |
| 895 | 3300050496 | nmdc:mga07m45_488432_c1 | nmdc:mga07m45_488432_c1_139_564 | 140 |
| 896 | 3300053085 | Ga0495619_0021438 | Ga0495619_0021438_193_657 | 140 |
| 897 | 3300053088 | Ga0500644_0000427 | Ga0500644_0000427_722_1165 | 140 |
| 898 | 3300053140 | Ga0500573_0044627 | Ga0500573_0044627_242_667 | 140 |
| 899 | 3300054114 | Ga0501084_1191241 | Ga0501084_1191241_190_615 | 140 |
| 900 | 3300059630 | Ga0587128_013515 | Ga0587128_013515_80_502 | 140 |
| 901 | 3300060353 | Ga0501082_1134437 | Ga0501082_1134437_63_488 | 140 |
| 902 | 3300061719 | Ga0466962_0140561 | Ga0466962_0140561_275_706 | 140 |
| 903 | 3300061719 | Ga0466962_0205770 | Ga0466962_0205770_361_801 | 140 |
| 904 | 3300061734 | Ga0530510_0627415 | Ga0530510_0627415_180_734 | 140 |
| 905 | 3300061734 | Ga0530510_1316569 | Ga0530510_1316569_76_501 | 140 |
| 906 | 3300000549 | LJQas_1009377 | LJQas_10093773 | 141 |
| 907 | 3300001989 | JGI24739J22299_10012134 | JGI24739J22299_100121342 | 141 |
| 908 | 3300002075 | JGI24738J21930_10001633 | JGI24738J21930_100016339 | 141 |
| 909 | 3300003163 | Ga0006759J45824_1024389 | Ga0006759J45824_10243892 | 141 |
| 910 | 3300003300 | Ga0006758J48902_1015472 | Ga0006758J48902_10154722 | 141 |
| 911 | 3300003308 | Ga0006777J48905_1052029 | Ga0006777J48905_10520292 | 141 |
| 912 | 3300003568 | Ga0006781J51513_1021454 | Ga0006781J51513_10214542 | 141 |
| 913 | 3300003574 | Ga0007410J51695_1013323 | Ga0007410J51695_10133233 | 141 |
| 914 | 3300003577 | Ga0007416J51690_1025482 | Ga0007416J51690_10254822 | 141 |
| 915 | 3300003579 | Ga0007429J51699_1020720 | Ga0007429J51699_10207202 | 141 |
| 916 | 3300003693 | Ga0032354_1008083 | Ga0032354_10080833 | 141 |
| 917 | 3300005327 | Ga0070658_10480236 | Ga0070658_104802362 | 141 |
| 918 | 3300005328 | Ga0070676_11338978 | Ga0070676_113389781 | 141 |
| 919 | 3300005329 | Ga0070683_100173735 | Ga0070683_1001737353 | 141 |
| 920 | 3300005329 | Ga0070683_100553072 | Ga0070683_1005530722 | 141 |
| 921 | 3300005329 | Ga0070683_101995586 | Ga0070683_1019955861 | 141 |
| 922 | 3300005331 | Ga0070670_100520023 | Ga0070670_1005200233 | 141 |
| 923 | 3300005334 | Ga0068869_100441035 | Ga0068869_1004410351 | 141 |
| 924 | 3300005334 | Ga0068869_100569559 | Ga0068869_1005695593 | 141 |
| 925 | 3300005337 | Ga0070682_100028438 | Ga0070682_1000284383 | 141 |
| 926 | 3300005337 | Ga0070682_100114772 | Ga0070682_1001147722 | 141 |
| 927 | 3300005338 | Ga0068868_100096107 | Ga0068868_1000961075 | 141 |
| 928 | 3300005338 | Ga0068868_100945443 | Ga0068868_1009454432 | 141 |
| 929 | 3300005338 | Ga0068868_101154441 | Ga0068868_1011544412 | 141 |
| 930 | 3300005339 | Ga0070660_100917798 | Ga0070660_1009177982 | 141 |
| 931 | 3300005340 | Ga0070689_100181515 | Ga0070689_1001815153 | 141 |
| 932 | 3300005340 | Ga0070689_100605206 | Ga0070689_1006052061 | 141 |
| 933 | 3300005341 | Ga0070691_10169444 | Ga0070691_101694443 | 141 |
| 934 | 3300005343 | Ga0070687_100135823 | Ga0070687_1001358233 | 141 |
| 935 | 3300005347 | Ga0070668_100884440 | Ga0070668_1008844402 | 141 |
| 936 | 3300005347 | Ga0070668_101044808 | Ga0070668_1010448081 | 141 |
| 937 | 3300005354 | Ga0070675_100218333 | Ga0070675_1002183333 | 141 |
| 938 | 3300005356 | Ga0070674_100137963 | Ga0070674_1001379632 | 141 |
| 939 | 3300005356 | Ga0070674_100961039 | Ga0070674_1009610392 | 141 |
| 940 | 3300005364 | Ga0070673_100364268 | Ga0070673_1003642683 | 141 |
| 941 | 3300005364 | Ga0070673_100768922 | Ga0070673_1007689222 | 141 |
| 942 | 3300005365 | Ga0070688_100155630 | Ga0070688_1001556303 | 141 |
| 943 | 3300005365 | Ga0070688_101431845 | Ga0070688_1014318451 | 141 |
| 944 | 3300005366 | Ga0070659_100325951 | Ga0070659_1003259512 | 141 |
| 945 | 3300005367 | Ga0070667_101672116 | Ga0070667_1016721161 | 141 |
| 946 | 3300005438 | Ga0070701_10001181 | Ga0070701_1000118112 | 141 |
| 947 | 3300005438 | Ga0070701_10678506 | Ga0070701_106785061 | 141 |
| 948 | 3300005441 | Ga0070700_100074940 | Ga0070700_1000749403 | 141 |
| 949 | 3300005441 | Ga0070700_100450102 | Ga0070700_1004501022 | 141 |
| 950 | 3300005455 | Ga0070663_100240209 | Ga0070663_1002402093 | 141 |
| 951 | 3300005455 | Ga0070663_100547854 | Ga0070663_1005478542 | 141 |
| 952 | 3300005456 | Ga0070678_100132971 | Ga0070678_1001329713 | 141 |
| 953 | 3300005456 | Ga0070678_101748240 | Ga0070678_1017482401 | 141 |
| 954 | 3300005459 | Ga0068867_100239173 | Ga0068867_1002391732 | 141 |
| 955 | 3300005466 | Ga0070685_10031017 | Ga0070685_100310175 | 141 |
| 956 | 3300005535 | Ga0070684_100233236 | Ga0070684_1002332363 | 141 |
| 957 | 3300005535 | Ga0070684_100488128 | Ga0070684_1004881281 | 141 |
| 958 | 3300005539 | Ga0068853_100238565 | Ga0068853_1002385651 | 141 |
| 959 | 3300005543 | Ga0070672_100002167 | Ga0070672_10000216714 | 141 |
| 960 | 3300005543 | Ga0070672_100443394 | Ga0070672_1004433942 | 141 |
| 961 | 3300005544 | Ga0070686_100090626 | Ga0070686_1000906263 | 141 |
| 962 | 3300005545 | Ga0070695_100379051 | Ga0070695_1003790513 | 141 |
| 963 | 3300005564 | Ga0070664_100533979 | Ga0070664_1005339792 | 141 |
| 964 | 3300005564 | Ga0070664_101093786 | Ga0070664_1010937862 | 141 |
| 965 | 3300005578 | Ga0068854_100056171 | Ga0068854_1000561716 | 141 |
| 966 | 3300005614 | Ga0068856_100151811 | Ga0068856_1001518113 | 141 |
| 967 | 3300005615 | Ga0070702_100174101 | Ga0070702_1001741012 | 141 |
| 968 | 3300005615 | Ga0070702_100180569 | Ga0070702_1001805693 | 141 |
| 969 | 3300005616 | Ga0068852_100002721 | Ga0068852_1000027218 | 141 |
| 970 | 3300005616 | Ga0068852_100390224 | Ga0068852_1003902243 | 141 |
| 971 | 3300005616 | Ga0068852_102375298 | Ga0068852_1023752981 | 141 |
| 972 | 3300005617 | Ga0068859_100200595 | Ga0068859_1002005953 | 141 |
| 973 | 3300005618 | Ga0068864_102156781 | Ga0068864_1021567811 | 141 |
| 974 | 3300005718 | Ga0068866_10876234 | Ga0068866_108762341 | 141 |
| 975 | 3300005719 | Ga0068861_100010271 | Ga0068861_1000102713 | 141 |
| 976 | 3300005719 | Ga0068861_100263512 | Ga0068861_1002635122 | 141 |
| 977 | 3300005719 | Ga0068861_100722917 | Ga0068861_1007229172 | 141 |
| 978 | 3300005834 | Ga0068851_10281691 | Ga0068851_102816912 | 141 |
| 979 | 3300005834 | Ga0068851_10373843 | Ga0068851_103738432 | 141 |
| 980 | 3300005840 | Ga0068870_10000658 | Ga0068870_100006582 | 141 |
| 981 | 3300005840 | Ga0068870_10133942 | Ga0068870_101339422 | 141 |
| 982 | 3300005840 | Ga0068870_10311956 | Ga0068870_103119562 | 141 |
| 983 | 3300005842 | Ga0068858_101461228 | Ga0068858_1014612282 | 141 |
| 984 | 3300006038 | Ga0075365_10010269 | Ga0075365_100102692 | 141 |
| 985 | 3300006038 | Ga0075365_10055583 | Ga0075365_100555833 | 141 |
| 986 | 3300006038 | Ga0075365_10092299 | Ga0075365_100922992 | 141 |
| 987 | 3300006038 | Ga0075365_10367365 | Ga0075365_103673652 | 141 |
| 988 | 3300006038 | Ga0075365_10531700 | Ga0075365_105317002 | 141 |
| 989 | 3300006038 | Ga0075365_10583801 | Ga0075365_105838012 | 141 |
| 990 | 3300006038 | Ga0075365_10766065 | Ga0075365_107660651 | 141 |
| 991 | 3300006038 | Ga0075365_11057997 | Ga0075365_110579971 | 141 |
| 992 | 3300006042 | Ga0075368_10135573 | Ga0075368_101355732 | 141 |
| 993 | 3300006042 | Ga0075368_10208070 | Ga0075368_102080702 | 141 |
| 994 | 3300006048 | Ga0075363_100109106 | Ga0075363_1001091063 | 141 |
| 995 | 3300006048 | Ga0075363_100398529 | Ga0075363_1003985292 | 141 |
| 996 | 3300006048 | Ga0075363_100671169 | Ga0075363_1006711691 | 141 |
| 997 | 3300006051 | Ga0075364_10191422 | Ga0075364_101914222 | 141 |
| 998 | 3300006051 | Ga0075364_10661179 | Ga0075364_106611792 | 141 |
| 999 | 3300006178 | Ga0075367_10025786 | Ga0075367_100257863 | 141 |
| 1000 | 3300006178 | Ga0075367_10210578 | Ga0075367_102105782 | 141 |
| 1001 | 3300006178 | Ga0075367_10504682 | Ga0075367_105046822 | 141 |
| 1002 | 3300006178 | Ga0075367_10567774 | Ga0075367_105677741 | 141 |
| 1003 | 3300006353 | Ga0075370_10064412 | Ga0075370_100644123 | 141 |
| 1004 | 3300006353 | Ga0075370_10489840 | Ga0075370_104898402 | 141 |
| 1005 | 3300006353 | Ga0075370_10592138 | Ga0075370_105921381 | 141 |
| 1006 | 3300006358 | Ga0068871_100785931 | Ga0068871_1007859312 | 141 |
| 1007 | 3300006844 | Ga0075428_101361031 | Ga0075428_1013610312 | 141 |
| 1008 | 3300006880 | Ga0075429_100528534 | Ga0075429_1005285343 | 141 |
| 1009 | 3300006881 | Ga0068865_100006802 | Ga0068865_1000068022 | 141 |
| 1010 | 3300006914 | Ga0075436_100652178 | Ga0075436_1006521782 | 141 |
| 1011 | 3300006931 | Ga0097620_100200581 | Ga0097620_1002005813 | 141 |
| 1012 | 3300007076 | Ga0075435_101429881 | Ga0075435_1014298812 | 141 |
| 1013 | 3300009094 | Ga0111539_10358791 | Ga0111539_103587913 | 141 |
| 1014 | 3300009094 | Ga0111539_10587947 | Ga0111539_105879472 | 141 |
| 1015 | 3300009094 | Ga0111539_11278138 | Ga0111539_112781382 | 141 |
| 1016 | 3300009094 | Ga0111539_11716575 | Ga0111539_117165752 | 141 |
| 1017 | 3300009098 | Ga0105245_10714775 | Ga0105245_107147752 | 141 |
| 1018 | 3300009098 | Ga0105245_11140965 | Ga0105245_111409652 | 141 |
| 1019 | 3300009098 | Ga0105245_13039075 | Ga0105245_130390751 | 141 |
| 1020 | 3300009101 | Ga0105247_10303636 | Ga0105247_103036362 | 141 |
| 1021 | 3300009101 | Ga0105247_10928075 | Ga0105247_109280752 | 141 |
| 1022 | 3300009148 | Ga0105243_10002648 | Ga0105243_1000264813 | 141 |
| 1023 | 3300009148 | Ga0105243_11055573 | Ga0105243_110555732 | 141 |
| 1024 | 3300009176 | Ga0105242_10338520 | Ga0105242_103385202 | 141 |
| 1025 | 3300009177 | Ga0105248_10173273 | Ga0105248_101732734 | 141 |
| 1026 | 3300009551 | Ga0105238_10755879 | Ga0105238_107558792 | 141 |
| 1027 | 3300009551 | Ga0105238_11413781 | Ga0105238_114137812 | 141 |
| 1028 | 3300009553 | Ga0105249_10106364 | Ga0105249_101063642 | 141 |
| 1029 | 3300010375 | Ga0105239_11514235 | Ga0105239_115142351 | 141 |
| 1030 | 3300011119 | Ga0105246_10595867 | Ga0105246_105958672 | 141 |
| 1031 | 3300011119 | Ga0105246_11057755 | Ga0105246_110577552 | 141 |
| 1032 | 3300013104 | Ga0157370_10414908 | Ga0157370_104149081 | 141 |
| 1033 | 3300013104 | Ga0157370_10476036 | Ga0157370_104760363 | 141 |
| 1034 | 3300013104 | Ga0157370_10677002 | Ga0157370_106770022 | 141 |
| 1035 | 3300013105 | Ga0157369_10748908 | Ga0157369_107489082 | 141 |
| 1036 | 3300013306 | Ga0163162_10687283 | Ga0163162_106872833 | 141 |
| 1037 | 3300013307 | Ga0157372_10233202 | Ga0157372_102332023 | 141 |
| 1038 | 3300013307 | Ga0157372_10886991 | Ga0157372_108869912 | 141 |
| 1039 | 3300013308 | Ga0157375_10956945 | Ga0157375_109569452 | 141 |
| 1040 | 3300013308 | Ga0157375_11020196 | Ga0157375_110201962 | 141 |
| 1041 | 3300014325 | Ga0163163_10273182 | Ga0163163_102731822 | 141 |
| 1042 | 3300014325 | Ga0163163_10615159 | Ga0163163_106151593 | 141 |
| 1043 | 3300014325 | Ga0163163_11712571 | Ga0163163_117125711 | 141 |
| 1044 | 3300014326 | Ga0157380_10037515 | Ga0157380_100375155 | 141 |
| 1045 | 3300014326 | Ga0157380_10312725 | Ga0157380_103127253 | 141 |
| 1046 | 3300014745 | Ga0157377_10073460 | Ga0157377_100734602 | 141 |
| 1047 | 3300014969 | Ga0157376_10385576 | Ga0157376_103855762 | 141 |
| 1048 | 3300014969 | Ga0157376_11234222 | Ga0157376_112342222 | 141 |
| 1049 | 3300017792 | Ga0163161_10345769 | Ga0163161_103457693 | 141 |
| 1050 | 3300017792 | Ga0163161_10470460 | Ga0163161_104704602 | 141 |
| 1051 | 3300020080 | Ga0206350_11500533 | Ga0206350_115005331 | 141 |
| 1052 | 3300020080 | Ga0206350_11585932 | Ga0206350_115859322 | 141 |
| 1053 | 3300020081 | Ga0206354_10452849 | Ga0206354_104528492 | 141 |
| 1054 | 3300020081 | Ga0206354_10501550 | Ga0206354_105015502 | 141 |
| 1055 | 3300020081 | Ga0206354_10570029 | Ga0206354_105700292 | 141 |
| 1056 | 3300022467 | Ga0224712_10003451 | Ga0224712_100034512 | 141 |
| 1057 | 3300025321 | Ga0207656_10094901 | Ga0207656_100949012 | 141 |
| 1058 | 3300025321 | Ga0207656_10267857 | Ga0207656_102678572 | 141 |
| 1059 | 3300025899 | Ga0207642_10016301 | Ga0207642_100163015 | 141 |
| 1060 | 3300025900 | Ga0207710_10155554 | Ga0207710_101555543 | 141 |
| 1061 | 3300025901 | Ga0207688_10048546 | Ga0207688_100485464 | 141 |
| 1062 | 3300025901 | Ga0207688_10098689 | Ga0207688_100986892 | 141 |
| 1063 | 3300025901 | Ga0207688_10392964 | Ga0207688_103929641 | 141 |
| 1064 | 3300025903 | Ga0207680_10824931 | Ga0207680_108249311 | 141 |
| 1065 | 3300025904 | Ga0207647_10215247 | Ga0207647_102152473 | 141 |
| 1066 | 3300025908 | Ga0207643_10131737 | Ga0207643_101317372 | 141 |
| 1067 | 3300025908 | Ga0207643_10213357 | Ga0207643_102133572 | 141 |
| 1068 | 3300025908 | Ga0207643_10308427 | Ga0207643_103084272 | 141 |
| 1069 | 3300025909 | Ga0207705_10709473 | Ga0207705_107094731 | 141 |
| 1070 | 3300025909 | Ga0207705_10838842 | Ga0207705_108388422 | 141 |
| 1071 | 3300025918 | Ga0207662_10097436 | Ga0207662_100974362 | 141 |
| 1072 | 3300025918 | Ga0207662_10098352 | Ga0207662_100983522 | 141 |
| 1073 | 3300025918 | Ga0207662_10232937 | Ga0207662_102329372 | 141 |
| 1074 | 3300025923 | Ga0207681_10545666 | Ga0207681_105456662 | 141 |
| 1075 | 3300025925 | Ga0207650_10697896 | Ga0207650_106978962 | 141 |
| 1076 | 3300025926 | Ga0207659_10218769 | Ga0207659_102187692 | 141 |
| 1077 | 3300025927 | Ga0207687_10116619 | Ga0207687_101166193 | 141 |
| 1078 | 3300025927 | Ga0207687_10546324 | Ga0207687_105463242 | 141 |
| 1079 | 3300025932 | Ga0207690_10957684 | Ga0207690_109576842 | 141 |
| 1080 | 3300025933 | Ga0207706_10447768 | Ga0207706_104477682 | 141 |
| 1081 | 3300025934 | Ga0207686_10424045 | Ga0207686_104240453 | 141 |
| 1082 | 3300025934 | Ga0207686_10871285 | Ga0207686_108712852 | 141 |
| 1083 | 3300025935 | Ga0207709_10005029 | Ga0207709_100050292 | 141 |
| 1084 | 3300025936 | Ga0207670_10022974 | Ga0207670_100229742 | 141 |
| 1085 | 3300025937 | Ga0207669_10006873 | Ga0207669_100068732 | 141 |
| 1086 | 3300025940 | Ga0207691_10003431 | Ga0207691_1000343119 | 141 |
| 1087 | 3300025941 | Ga0207711_10062361 | Ga0207711_100623613 | 141 |
| 1088 | 3300025942 | Ga0207689_10271934 | Ga0207689_102719342 | 141 |
| 1089 | 3300025942 | Ga0207689_10496674 | Ga0207689_104966742 | 141 |
| 1090 | 3300025944 | Ga0207661_10238858 | Ga0207661_102388582 | 141 |
| 1091 | 3300025944 | Ga0207661_10371281 | Ga0207661_103712812 | 141 |
| 1092 | 3300025944 | Ga0207661_10433304 | Ga0207661_104333042 | 141 |
| 1093 | 3300025945 | Ga0207679_10232445 | Ga0207679_102324453 | 141 |
| 1094 | 3300025960 | Ga0207651_10840360 | Ga0207651_108403602 | 141 |
| 1095 | 3300025961 | Ga0207712_10295094 | Ga0207712_102950942 | 141 |
| 1096 | 3300025972 | Ga0207668_10963808 | Ga0207668_109638082 | 141 |
| 1097 | 3300025981 | Ga0207640_10194835 | Ga0207640_101948352 | 141 |
| 1098 | 3300026023 | Ga0207677_10260195 | Ga0207677_102601952 | 141 |
| 1099 | 3300026023 | Ga0207677_10897782 | Ga0207677_108977822 | 141 |
| 1100 | 3300026035 | Ga0207703_10858139 | Ga0207703_108581392 | 141 |
| 1101 | 3300026041 | Ga0207639_10547924 | Ga0207639_105479242 | 141 |
| 1102 | 3300026067 | Ga0207678_10236385 | Ga0207678_102363853 | 141 |
| 1103 | 3300026067 | Ga0207678_10402602 | Ga0207678_104026022 | 141 |
| 1104 | 3300026067 | Ga0207678_11349890 | Ga0207678_113498901 | 141 |
| 1105 | 3300026075 | Ga0207708_10002425 | Ga0207708_1000242521 | 141 |
| 1106 | 3300026075 | Ga0207708_10092514 | Ga0207708_100925144 | 141 |
| 1107 | 3300026075 | Ga0207708_10305175 | Ga0207708_103051753 | 141 |
| 1108 | 3300026078 | Ga0207702_10341668 | Ga0207702_103416683 | 141 |
| 1109 | 3300026089 | Ga0207648_10007281 | Ga0207648_1000728113 | 141 |
| 1110 | 3300026089 | Ga0207648_10491238 | Ga0207648_104912383 | 141 |
| 1111 | 3300026095 | Ga0207676_10370140 | Ga0207676_103701402 | 141 |
| 1112 | 3300026116 | Ga0207674_10234946 | Ga0207674_102349462 | 141 |
| 1113 | 3300026118 | Ga0207675_100003879 | Ga0207675_10000387913 | 141 |
| 1114 | 3300026118 | Ga0207675_100485601 | Ga0207675_1004856012 | 141 |
| 1115 | 3300026118 | Ga0207675_101069607 | Ga0207675_1010696071 | 141 |
| 1116 | 3300026121 | Ga0207683_10118248 | Ga0207683_101182483 | 141 |
| 1117 | 3300026121 | Ga0207683_11486503 | Ga0207683_114865031 | 141 |
| 1118 | 3300026142 | Ga0207698_10007471 | Ga0207698_100074713 | 141 |
| 1119 | 3300026142 | Ga0207698_10277773 | Ga0207698_102777732 | 141 |
| 1120 | 3300026142 | Ga0207698_10386897 | Ga0207698_103868973 | 141 |
| 1121 | 3300027866 | Ga0209813_10056987 | Ga0209813_100569873 | 141 |
| 1122 | 3300027907 | Ga0207428_10051104 | Ga0207428_100511043 | 141 |
| 1123 | 3300029277 | Ga0311001_1071007 | Ga0311001_10710072 | 141 |
| 1124 | 3300030732 | Ga0316176_1081384 | Ga0316176_10813843 | 141 |
| 1125 | 3300030742 | Ga0316183_1044482 | Ga0316183_10444823 | 141 |
| 1126 | 3300031731 | Ga0307405_10264638 | Ga0307405_102646383 | 141 |
| 1127 | 3300031731 | Ga0307405_10621457 | Ga0307405_106214572 | 141 |
| 1128 | 3300031824 | Ga0307413_10069421 | Ga0307413_100694213 | 141 |
| 1129 | 3300031824 | Ga0307413_10723827 | Ga0307413_107238272 | 141 |
| 1130 | 3300031824 | Ga0307413_10930263 | Ga0307413_109302632 | 141 |
| 1131 | 3300031852 | Ga0307410_10006052 | Ga0307410_1000605210 | 141 |
| 1132 | 3300031852 | Ga0307410_10097613 | Ga0307410_100976132 | 141 |
| 1133 | 3300031852 | Ga0307410_11011611 | Ga0307410_110116112 | 141 |
| 1134 | 3300031901 | Ga0307406_10152957 | Ga0307406_101529573 | 141 |
| 1135 | 3300031901 | Ga0307406_10373430 | Ga0307406_103734302 | 141 |
| 1136 | 3300031903 | Ga0307407_10013128 | Ga0307407_100131283 | 141 |
| 1137 | 3300031903 | Ga0307407_10451135 | Ga0307407_104511352 | 141 |
| 1138 | 3300031911 | Ga0307412_10235247 | Ga0307412_102352472 | 141 |
| 1139 | 3300031911 | Ga0307412_11004704 | Ga0307412_110047041 | 141 |
| 1140 | 3300031995 | Ga0307409_100004499 | Ga0307409_1000044998 | 141 |
| 1141 | 3300031995 | Ga0307409_100314031 | Ga0307409_1003140312 | 141 |
| 1142 | 3300031995 | Ga0307409_100386549 | Ga0307409_1003865492 | 141 |
| 1143 | 3300031995 | Ga0307409_100467801 | Ga0307409_1004678011 | 141 |
| 1144 | 3300031995 | Ga0307409_100493559 | Ga0307409_1004935592 | 141 |
| 1145 | 3300031995 | Ga0307409_100626279 | Ga0307409_1006262792 | 141 |
| 1146 | 3300031995 | Ga0307409_101333037 | Ga0307409_1013330372 | 141 |
| 1147 | 3300032002 | Ga0307416_100024263 | Ga0307416_1000242634 | 141 |
| 1148 | 3300032002 | Ga0307416_101473045 | Ga0307416_1014730452 | 141 |
| 1149 | 3300032004 | Ga0307414_10077373 | Ga0307414_100773732 | 141 |
| 1150 | 3300032004 | Ga0307414_10655907 | Ga0307414_106559072 | 141 |
| 1151 | 3300032005 | Ga0307411_10034009 | Ga0307411_100340093 | 141 |
| 1152 | 3300032126 | Ga0307415_100113612 | Ga0307415_1001136123 | 141 |
| 1153 | 3300035242 | Ga0373962_0073070 | Ga0373962_0073070_167_601 | 141 |
| 1154 | 3300035691 | Ga0373931_0097053 | Ga0373931_0097053_598_1032 | 141 |
| 1155 | 3300037466 | Ga0395898_0463154 | Ga0395898_0463154_431_997 | 141 |
| 1156 | 3300041406 | Ga0439439_0034120 | Ga0439439_0034120_571_1026 | 141 |
| 1157 | 3300041410 | Ga0439461_0081393 | Ga0439461_0081393_94_549 | 141 |
| 1158 | 3300041443 | Ga0451789_1155910 | Ga0451789_1155910_268_717 | 141 |
| 1159 | 3300041443 | Ga0451789_1213167 | Ga0451789_1213167_89_523 | 141 |
| 1160 | 3300041445 | Ga0451792_01584 | Ga0451792_01584_108_557 | 141 |
| 1161 | 3300041452 | Ga0451793_0939683 | Ga0451793_0939683_33_470 | 141 |
| 1162 | 3300041453 | Ga0451797_0843885 | Ga0451797_0843885_26_451 | 141 |
| 1163 | 3300041453 | Ga0451797_0868523 | Ga0451797_0868523_48_497 | 141 |
| 1164 | 3300041458 | Ga0451798_0514919 | Ga0451798_0514919_80_505 | 141 |
| 1165 | 3300041460 | Ga0451802_0804525 | Ga0451802_0804525_91_525 | 141 |
| 1166 | 3300041486 | Ga0451807_2362550 | Ga0451807_2362550_70_495 | 141 |
| 1167 | 3300041492 | Ga0451835_0543034 | Ga0451835_0543034_16_456 | 141 |
| 1168 | 3300041492 | Ga0451835_0604248 | Ga0451835_0604248_159_593 | 141 |
| 1169 | 3300041494 | Ga0451837_1843479 | Ga0451837_1843479_63_491 | 141 |
| 1170 | 3300041496 | Ga0451839_0171162 | Ga0451839_0171162_154_612 | 141 |
| 1171 | 3300041498 | Ga0451841_0318149 | Ga0451841_0318149_35_484 | 141 |
| 1172 | 3300041498 | Ga0451841_0744881 | Ga0451841_0744881_88_528 | 141 |
| 1173 | 3300041507 | Ga0451851_0981888 | Ga0451851_0981888_162_611 | 141 |
| 1174 | 3300041509 | Ga0451843_0076660 | Ga0451843_0076660_89_538 | 141 |
| 1175 | 3300042007 | Ga0439449_0077931 | Ga0439449_0077931_237_662 | 141 |
| 1176 | 3300042014 | Ga0439457_033137 | Ga0439457_033137_478_933 | 141 |
| 1177 | 3300042015 | Ga0439462_0084425 | Ga0439462_0084425_31_465 | 141 |
| 1178 | 3300042122 | Ga0450920_014777 | Ga0450920_014777_956_1387 | 141 |
| 1179 | 3300042146 | Ga0450907_011557 | Ga0450907_011557_1010_1450 | 141 |
| 1180 | 3300042533 | Ga0450901_027965 | Ga0450901_027965_153_602 | 141 |
| 1181 | 3300044765 | Ga0466970_0340870 | Ga0466970_0340870_255_755 | 141 |
| 1182 | 3300044901 | Ga0466960_0194225 | Ga0466960_0194225_155_655 | 141 |
| 1183 | 3300044901 | Ga0466960_0505297 | Ga0466960_0505297_127_570 | 141 |
| 1184 | 3300046515 | Ga0495620_0049001 | Ga0495620_0049001_753_1178 | 141 |
| 1185 | 3300048904 | Ga0496101_0085853 | Ga0496101_0085853_19_453 | 141 |
| 1186 | 3300048904 | Ga0496101_0588301 | Ga0496101_0588301_238_678 | 141 |
| 1187 | 3300048906 | Ga0496103_0170212 | Ga0496103_0170212_884_1318 | 141 |
| 1188 | 3300048908 | Ga0496105_0367810 | Ga0496105_0367810_473_907 | 141 |
| 1189 | 3300048911 | Ga0496108_0177302 | Ga0496108_0177302_485_919 | 141 |
| 1190 | 3300048911 | Ga0496108_0225093 | Ga0496108_0225093_233_667 | 141 |
| 1191 | 3300048912 | Ga0496109_0025845 | Ga0496109_0025845_4718_5152 | 141 |
| 1192 | 3300048912 | Ga0496109_0426755 | Ga0496109_0426755_732_1166 | 141 |
| 1193 | 3300048913 | Ga0496110_0607993 | Ga0496110_0607993_111_545 | 141 |
| 1194 | 3300048913 | Ga0496110_1733917 | Ga0496110_1733917_52_495 | 141 |
| 1195 | 3300048914 | Ga0496111_0620844 | Ga0496111_0620844_200_634 | 141 |
| 1196 | 3300048914 | Ga0496111_0870876 | Ga0496111_0870876_186_617 | 141 |
| 1197 | 3300048914 | Ga0496111_0881956 | Ga0496111_0881956_30_464 | 141 |
| 1198 | 3300048917 | Ga0496114_0297163 | Ga0496114_0297163_775_1209 | 141 |
| 1199 | 3300048917 | Ga0496114_0782312 | Ga0496114_0782312_246_680 | 141 |
| 1200 | 3300048917 | Ga0496114_1106458 | Ga0496114_1106458_62_502 | 141 |
| 1201 | 3300048927 | Ga0496124_0186718 | Ga0496124_0186718_587_1162 | 141 |
| 1202 | 3300048927 | Ga0496124_0596134 | Ga0496124_0596134_18_443 | 141 |
| 1203 | 3300049127 | Ga0501306_032117 | Ga0501306_032117_236_682 | 141 |
| 1204 | 3300049128 | Ga0501308_011000 | Ga0501308_011000_534_983 | 141 |
| 1205 | 3300049128 | Ga0501308_053802 | Ga0501308_053802_124_549 | 141 |
| 1206 | 3300049129 | Ga0501309_035097 | Ga0501309_035097_43_468 | 141 |
| 1207 | 3300049160 | Ga0501304_011121 | Ga0501304_011121_27_452 | 141 |
| 1208 | 3300049161 | Ga0501305_047739 | Ga0501305_047739_10_435 | 141 |
| 1209 | 3300049162 | Ga0501307_018749 | Ga0501307_018749_385_831 | 141 |
| 1210 | 3300049162 | Ga0501307_035776 | Ga0501307_035776_94_543 | 141 |
| 1211 | 3300049514 | Ga0501291_033669 | Ga0501291_033669_438_863 | 141 |
| 1212 | 3300049527 | Ga0501311_020635 | Ga0501311_020635_420_845 | 141 |
| 1213 | 3300049527 | Ga0501311_057329 | Ga0501311_057329_27_488 | 141 |
| 1214 | 3300049527 | Ga0501311_063885 | Ga0501311_063885_78_524 | 141 |
| 1215 | 3300049528 | Ga0501312_012450 | Ga0501312_012450_636_1091 | 141 |
| 1216 | 3300049531 | Ga0501315_003871 | Ga0501315_003871_31_468 | 141 |
| 1217 | 3300049531 | Ga0501315_043330 | Ga0501315_043330_13_459 | 141 |
| 1218 | 3300049532 | Ga0501316_005123 | Ga0501316_005123_501_926 | 141 |
| 1219 | 3300049532 | Ga0501316_006023 | Ga0501316_006023_726_1181 | 141 |
| 1220 | 3300049533 | Ga0501317_016411 | Ga0501317_016411_310_771 | 141 |
| 1221 | 3300049533 | Ga0501317_022777 | Ga0501317_022777_94_519 | 141 |
| 1222 | 3300049534 | Ga0501318_009977 | Ga0501318_009977_87_530 | 141 |
| 1223 | 3300049534 | Ga0501318_011256 | Ga0501318_011256_217_642 | 141 |
| 1224 | 3300049534 | Ga0501318_015961 | Ga0501318_015961_241_696 | 141 |
| 1225 | 3300049534 | Ga0501318_017620 | Ga0501318_017620_329_790 | 141 |
| 1226 | 3300049534 | Ga0501318_026542 | Ga0501318_026542_79_525 | 141 |
| 1227 | 3300049535 | Ga0501319_004999 | Ga0501319_004999_52_501 | 141 |
| 1228 | 3300049537 | Ga0501321_017738 | Ga0501321_017738_318_779 | 141 |
| 1229 | 3300049537 | Ga0501321_057389 | Ga0501321_057389_14_451 | 141 |
| 1230 | 3300049537 | Ga0501321_087213 | Ga0501321_087213_55_480 | 141 |
| 1231 | 3300049538 | Ga0501322_020039 | Ga0501322_020039_84_509 | 141 |
| 1232 | 3300049539 | Ga0501323_007363 | Ga0501323_007363_759_1214 | 141 |
| 1233 | 3300049539 | Ga0501323_090304 | Ga0501323_090304_41_466 | 141 |
| 1234 | 3300049540 | Ga0501324_004285 | Ga0501324_004285_651_1100 | 141 |
| 1235 | 3300049540 | Ga0501324_009947 | Ga0501324_009947_12_437 | 141 |
| 1236 | 3300049568 | Ga0501031_0633992 | Ga0501031_0633992_211_657 | 141 |
| 1237 | 3300049572 | Ga0501036_0093295 | Ga0501036_0093295_480_923 | 141 |
| 1238 | 3300049572 | Ga0501036_0149769 | Ga0501036_0149769_561_989 | 141 |
| 1239 | 3300049574 | Ga0501038_0647973 | Ga0501038_0647973_103_531 | 141 |
| 1240 | 3300049575 | Ga0501039_0154443 | Ga0501039_0154443_996_1424 | 141 |
| 1241 | 3300049575 | Ga0501039_0551151 | Ga0501039_0551151_339_785 | 141 |
| 1242 | 3300049576 | Ga0501040_0693455 | Ga0501040_0693455_136_564 | 141 |
| 1243 | 3300049578 | Ga0501042_0175282 | Ga0501042_0175282_185_613 | 141 |
| 1244 | 3300049578 | Ga0501042_0607176 | Ga0501042_0607176_227_673 | 141 |
| 1245 | 3300049579 | Ga0501043_0821173 | Ga0501043_0821173_106_540 | 141 |
| 1246 | 3300049580 | Ga0501046_0306352 | Ga0501046_0306352_396_824 | 141 |
| 1247 | 3300049580 | Ga0501046_0447426 | Ga0501046_0447426_169_594 | 141 |
| 1248 | 3300049582 | Ga0501048_0362904 | Ga0501048_0362904_443_886 | 141 |
| 1249 | 3300049583 | Ga0501067_0126611 | Ga0501067_0126611_304_738 | 141 |
| 1250 | 3300049583 | Ga0501067_0213221 | Ga0501067_0213221_20_445 | 141 |
| 1251 | 3300049583 | Ga0501067_0325791 | Ga0501067_0325791_222_653 | 141 |
| 1252 | 3300049584 | Ga0501068_0269761 | Ga0501068_0269761_198_632 | 141 |
| 1253 | 3300049585 | Ga0501069_0406557 | Ga0501069_0406557_147_572 | 141 |
| 1254 | 3300049585 | Ga0501069_0424210 | Ga0501069_0424210_157_585 | 141 |
| 1255 | 3300049586 | Ga0501070_0368123 | Ga0501070_0368123_80_514 | 141 |
| 1256 | 3300049586 | Ga0501070_0947726 | Ga0501070_0947726_118_561 | 141 |
| 1257 | 3300049587 | Ga0501071_1323468 | Ga0501071_1323468_11_439 | 141 |
| 1258 | 3300049588 | Ga0501072_0576215 | Ga0501072_0576215_384_812 | 141 |
| 1259 | 3300049589 | Ga0501073_0477798 | Ga0501073_0477798_263_688 | 141 |
| 1260 | 3300049590 | Ga0501074_0460916 | Ga0501074_0460916_153_581 | 141 |
| 1261 | 3300049591 | Ga0501075_0150308 | Ga0501075_0150308_419_853 | 141 |
| 1262 | 3300049592 | Ga0501076_0086238 | Ga0501076_0086238_1464_1907 | 141 |
| 1263 | 3300049592 | Ga0501076_0196834 | Ga0501076_0196834_640_1242 | 141 |
| 1264 | 3300049592 | Ga0501076_0630404 | Ga0501076_0630404_354_782 | 141 |
| 1265 | 3300049592 | Ga0501076_1135905 | Ga0501076_1135905_18_464 | 141 |
| 1266 | 3300049593 | Ga0501077_0549433 | Ga0501077_0549433_186_614 | 141 |
| 1267 | 3300049593 | Ga0501077_0752048 | Ga0501077_0752048_144_578 | 141 |
| 1268 | 3300049704 | Ga0501221_106772 | Ga0501221_106772_88_537 | 141 |
| 1269 | 3300049742 | Ga0501080_1336902 | Ga0501080_1336902_113_559 | 141 |
| 1270 | 3300049823 | Ga0501044_1297966 | Ga0501044_1297966_79_507 | 141 |
| 1271 | 3300050490 | nmdc:mga03n38_174315_c1 | nmdc:mga03n38_174315_c1_59_493 | 141 |
| 1272 | 3300050490 | nmdc:mga03n38_27461_c1 | nmdc:mga03n38_27461_c1_964_1407 | 141 |
| 1273 | 3300050490 | nmdc:mga03n38_46422_c1 | nmdc:mga03n38_46422_c1_1205_1753 | 141 |
| 1274 | 3300050491 | nmdc:mga00v17_180570_c1 | nmdc:mga00v17_180570_c1_403_828 | 141 |
| 1275 | 3300050491 | nmdc:mga00v17_188155_c1 | nmdc:mga00v17_188155_c1_295_720 | 141 |
| 1276 | 3300050491 | nmdc:mga00v17_47670_c1 | nmdc:mga00v17_47670_c1_2065_2508 | 141 |
| 1277 | 3300050491 | nmdc:mga00v17_78476_c1 | nmdc:mga00v17_78476_c1_268_708 | 141 |
| 1278 | 3300050492 | nmdc:mga0yw44_1197_c1 | nmdc:mga0yw44_1197_c1_1389_1817 | 141 |
| 1279 | 3300050492 | nmdc:mga0yw44_128443_c1 | nmdc:mga0yw44_128443_c1_277_705 | 141 |
| 1280 | 3300050492 | nmdc:mga0yw44_256929_c1 | nmdc:mga0yw44_256929_c1_468_902 | 141 |
| 1281 | 3300050492 | nmdc:mga0yw44_265539_c1 | nmdc:mga0yw44_265539_c1_129_683 | 141 |
| 1282 | 3300050492 | nmdc:mga0yw44_341012_c1 | nmdc:mga0yw44_341012_c1_226_663 | 141 |
| 1283 | 3300050492 | nmdc:mga0yw44_353326_c1 | nmdc:mga0yw44_353326_c1_47_475 | 141 |
| 1284 | 3300050492 | nmdc:mga0yw44_890186_c1 | nmdc:mga0yw44_890186_c1_90_536 | 141 |
| 1285 | 3300050493 | nmdc:mga0k408_305129_c1 | nmdc:mga0k408_305129_c1_270_707 | 141 |
| 1286 | 3300050494 | nmdc:mga06z11_1560_c1 | nmdc:mga06z11_1560_c1_3470_4018 | 141 |
| 1287 | 3300050494 | nmdc:mga06z11_336706_c1 | nmdc:mga06z11_336706_c1_343_771 | 141 |
| 1288 | 3300050494 | nmdc:mga06z11_63927_c1 | nmdc:mga06z11_63927_c1_1328_1756 | 141 |
| 1289 | 3300050495 | nmdc:mga04h51_137678_c1 | nmdc:mga04h51_137678_c1_356_790 | 141 |
| 1290 | 3300050495 | nmdc:mga04h51_24216_c1 | nmdc:mga04h51_24216_c1_1290_1724 | 141 |
| 1291 | 3300050496 | nmdc:mga07m45_201372_c1 | nmdc:mga07m45_201372_c1_360_794 | 141 |
| 1292 | 3300050496 | nmdc:mga07m45_227068_c1 | nmdc:mga07m45_227068_c1_134_565 | 141 |
| 1293 | 3300050496 | nmdc:mga07m45_2326_c1 | nmdc:mga07m45_2326_c1_2406_2849 | 141 |
| 1294 | 3300050508 | nmdc:mga09592_182190_c1 | nmdc:mga09592_182190_c1_894_1328 | 141 |
| 1295 | 3300050511 | nmdc:mga08y16_277154_c1 | nmdc:mga08y16_277154_c1_1073_1501 | 141 |
| 1296 | 3300050511 | nmdc:mga08y16_39303_c1 | nmdc:mga08y16_39303_c1_3482_3916 | 141 |
| 1297 | 3300053083 | Ga0495655_0075530 | Ga0495655_0075530_16_444 | 141 |
| 1298 | 3300053096 | Ga0500641_0050012 | Ga0500641_0050012_595_1173 | 141 |
| 1299 | 3300053102 | Ga0500554_027137 | Ga0500554_027137_219_776 | 141 |
| 1300 | 3300053104 | Ga0500556_0002190 | Ga0500556_0002190_5358_5798 | 141 |
| 1301 | 3300053117 | Ga0500593_000062 | Ga0500593_000062_16275_16715 | 141 |
| 1302 | 3300053129 | Ga0500628_015990 | Ga0500628_015990_708_1148 | 141 |
| 1303 | 3300053129 | Ga0500628_024032 | Ga0500628_024032_467_901 | 141 |
| 1304 | 3300054114 | Ga0501084_0242239 | Ga0501084_0242239_329_757 | 141 |
| 1305 | 3300059505 | Ga0587083_0114850 | Ga0587083_0114850_98_544 | 141 |
| 1306 | 3300059652 | Ga0587107_087927 | Ga0587107_087927_47_496 | 141 |
| 1307 | 3300060346 | Ga0587111_0245603 | Ga0587111_0245603_56_484 | 141 |
| 1308 | 3300060353 | Ga0501082_0220776 | Ga0501082_0220776_616_1059 | 141 |
| 1309 | 3300061734 | Ga0530510_0296722 | Ga0530510_0296722_566_997 | 141 |
| 1310 | 3300061734 | Ga0530510_0317011 | Ga0530510_0317011_504_938 | 141 |
| 1311 | 3300020082 | Ga0206353_10839177 | Ga0206353_108391772 | 142 |
| 1312 | 3300031824 | Ga0307413_11243746 | Ga0307413_112437462 | 142 |
| 1313 | 3300044684 | Ga0466966_0799946 | Ga0466966_0799946_82_519 | 142 |
| 1314 | 3300044765 | Ga0466970_0249866 | Ga0466970_0249866_521_958 | 142 |
| 1315 | 3300049568 | Ga0501031_0036192 | Ga0501031_0036192_1031_1468 | 142 |
| 1316 | 3300049570 | Ga0501033_0545457 | Ga0501033_0545457_261_698 | 142 |
| 1317 | 3300049572 | Ga0501036_0151978 | Ga0501036_0151978_730_1167 | 142 |
| 1318 | 3300049573 | Ga0501037_0160089 | Ga0501037_0160089_865_1302 | 142 |
| 1319 | 3300049574 | Ga0501038_0111224 | Ga0501038_0111224_1352_1789 | 142 |
| 1320 | 3300049575 | Ga0501039_0032214 | Ga0501039_0032214_223_660 | 142 |
| 1321 | 3300049576 | Ga0501040_0019721 | Ga0501040_0019721_1532_1969 | 142 |
| 1322 | 3300049577 | Ga0501041_0126746 | Ga0501041_0126746_1103_1540 | 142 |
| 1323 | 3300049578 | Ga0501042_0021479 | Ga0501042_0021479_3847_4284 | 142 |
| 1324 | 3300049580 | Ga0501046_0244733 | Ga0501046_0244733_198_635 | 142 |
| 1325 | 3300049582 | Ga0501048_0038252 | Ga0501048_0038252_2776_3213 | 142 |
| 1326 | 3300049584 | Ga0501068_0047352 | Ga0501068_0047352_478_915 | 142 |
| 1327 | 3300049587 | Ga0501071_0005948 | Ga0501071_0005948_5805_6242 | 142 |
| 1328 | 3300049588 | Ga0501072_0230228 | Ga0501072_0230228_688_1125 | 142 |
| 1329 | 3300049590 | Ga0501074_0014346 | Ga0501074_0014346_5112_5549 | 142 |
| 1330 | 3300049591 | Ga0501075_0017703 | Ga0501075_0017703_229_666 | 142 |
| 1331 | 3300049592 | Ga0501076_0007352 | Ga0501076_0007352_2745_3182 | 142 |
| 1332 | 3300049741 | Ga0501079_0305150 | Ga0501079_0305150_504_941 | 142 |
| 1333 | 3300049744 | Ga0501083_0134682 | Ga0501083_0134682_693_1130 | 142 |
| 1334 | 3300049824 | Ga0501045_0006942 | Ga0501045_0006942_7161_7598 | 142 |
| 1335 | 3300061734 | Ga0530510_0007003 | Ga0530510_0007003_2242_2679 | 142 |
| 1336 | 3300005366 | Ga0070659_100201752 | Ga0070659_1002017523 | 143 |
| 1337 | 3300005530 | Ga0070679_100047460 | Ga0070679_1000474602 | 143 |
| 1338 | 3300020070 | Ga0206356_10119586 | Ga0206356_101195862 | 143 |
| 1339 | 3300020077 | Ga0206351_10141909 | Ga0206351_101419092 | 143 |
| 1340 | 3300020080 | Ga0206350_10669679 | Ga0206350_106696792 | 143 |
| 1341 | 3300020082 | Ga0206353_11489688 | Ga0206353_114896882 | 143 |
| 1342 | 3300022467 | Ga0224712_10244483 | Ga0224712_102444832 | 143 |
| 1343 | 3300025932 | Ga0207690_10105178 | Ga0207690_101051782 | 143 |
| 1344 | 3300044901 | Ga0466960_0002126 | Ga0466960_0002126_6294_6731 | 143 |
| 1345 | 3300048910 | Ga0496107_0555287 | Ga0496107_0555287_305_745 | 143 |
| 1346 | 3300048913 | Ga0496110_0280148 | Ga0496110_0280148_841_1281 | 143 |
| 1347 | 3300049529 | Ga0501313_047063 | Ga0501313_047063_100_540 | 143 |
| 1348 | 3300005435 | Ga0070714_100035855 | Ga0070714_1000358553 | 144 |
| 1349 | 3300005530 | Ga0070679_101640550 | Ga0070679_1016405501 | 144 |
| 1350 | 3300020082 | Ga0206353_11872656 | Ga0206353_118726562 | 144 |
| 1351 | 3300022467 | Ga0224712_10084624 | Ga0224712_100846243 | 144 |
| 1352 | 3300025929 | Ga0207664_10030840 | Ga0207664_100308403 | 144 |
| 1353 | 3300026142 | Ga0207698_11242847 | Ga0207698_112428472 | 144 |
| 1354 | 3300044656 | Ga0466969_0150416 | Ga0466969_0150416_109_558 | 144 |
| 1355 | 3300044658 | Ga0466972_0340407 | Ga0466972_0340407_225_674 | 144 |
| 1356 | 3300044683 | Ga0466965_0118162 | Ga0466965_0118162_391_840 | 144 |
| 1357 | 3300044684 | Ga0466966_0060595 | Ga0466966_0060595_314_763 | 144 |
| 1358 | 3300044693 | Ga0466961_0089772 | Ga0466961_0089772_1255_1704 | 144 |
| 1359 | 3300044694 | Ga0466963_0047188 | Ga0466963_0047188_66_515 | 144 |
| 1360 | 3300044706 | Ga0466964_0054135 | Ga0466964_0054135_628_1077 | 144 |
| 1361 | 3300044719 | Ga0466971_0128689 | Ga0466971_0128689_660_1109 | 144 |
| 1362 | 3300044735 | Ga0466968_0141573 | Ga0466968_0141573_485_934 | 144 |
| 1363 | 3300044765 | Ga0466970_0589172 | Ga0466970_0589172_110_559 | 144 |
| 1364 | 3300044842 | Ga0466957_0171478 | Ga0466957_0171478_735_1184 | 144 |
| 1365 | 3300044901 | Ga0466960_0744016 | Ga0466960_0744016_110_559 | 144 |
| 1366 | 3300045049 | Ga0466959_0940213 | Ga0466959_0940213_69_518 | 144 |
| 1367 | 3300045976 | Ga0466967_0048014 | Ga0466967_0048014_1881_2330 | 144 |
| 1368 | 3300061719 | Ga0466962_0105375 | Ga0466962_0105375_564_1013 | 144 |
| 1369 | 3300000549 | LJQas_1001376 | LJQas_10013762 | 145 |
| 1370 | 3300026116 | Ga0207674_10730133 | Ga0207674_107301332 | 145 |
| 1371 | 3300031852 | Ga0307410_10528526 | Ga0307410_105285261 | 145 |
| 1372 | 3300031903 | Ga0307407_10163621 | Ga0307407_101636212 | 145 |
| 1373 | 3300031911 | Ga0307412_11905643 | Ga0307412_119056432 | 145 |
| 1374 | 3300032002 | Ga0307416_100127884 | Ga0307416_1001278842 | 145 |
| 1375 | 3300032002 | Ga0307416_100365132 | Ga0307416_1003651322 | 145 |
| 1376 | 3300032005 | Ga0307411_10134877 | Ga0307411_101348773 | 145 |
| 1377 | 3300032126 | Ga0307415_100030696 | Ga0307415_1000306965 | 145 |
| 1378 | 3300032126 | Ga0307415_100199168 | Ga0307415_1001991683 | 145 |
| 1379 | 3300049127 | Ga0501306_024872 | Ga0501306_024872_30_467 | 145 |
| 1380 | 3300049128 | Ga0501308_004488 | Ga0501308_004488_365_802 | 145 |
| 1381 | 3300049129 | Ga0501309_031341 | Ga0501309_031341_289_726 | 145 |
| 1382 | 3300049129 | Ga0501309_070980 | Ga0501309_070980_84_521 | 145 |
| 1383 | 3300049130 | Ga0501310_000840 | Ga0501310_000840_70_507 | 145 |
| 1384 | 3300049160 | Ga0501304_014118 | Ga0501304_014118_51_488 | 145 |
| 1385 | 3300049160 | Ga0501304_031867 | Ga0501304_031867_38_475 | 145 |
| 1386 | 3300049162 | Ga0501307_067857 | Ga0501307_067857_41_478 | 145 |
| 1387 | 3300049527 | Ga0501311_014637 | Ga0501311_014637_248_685 | 145 |
| 1388 | 3300049527 | Ga0501311_056571 | Ga0501311_056571_105_542 | 145 |
| 1389 | 3300049531 | Ga0501315_005704 | Ga0501315_005704_871_1308 | 145 |
| 1390 | 3300049532 | Ga0501316_002526 | Ga0501316_002526_249_686 | 145 |
| 1391 | 3300049533 | Ga0501317_017641 | Ga0501317_017641_46_483 | 145 |
| 1392 | 3300049534 | Ga0501318_060076 | Ga0501318_060076_28_465 | 145 |
| 1393 | 3300049536 | Ga0501320_053954 | Ga0501320_053954_66_503 | 145 |
| 1394 | 3300049537 | Ga0501321_000884 | Ga0501321_000884_1261_1698 | 145 |
| 1395 | 3300049537 | Ga0501321_006614 | Ga0501321_006614_168_605 | 145 |
| 1396 | 3300049538 | Ga0501322_001402 | Ga0501322_001402_566_1003 | 145 |
| 1397 | 3300049538 | Ga0501322_029904 | Ga0501322_029904_48_485 | 145 |
| 1398 | 3300049539 | Ga0501323_028255 | Ga0501323_028255_44_481 | 145 |
| 1399 | 3300049540 | Ga0501324_011807 | Ga0501324_011807_313_750 | 145 |
| 1400 | 3300049540 | Ga0501324_024618 | Ga0501324_024618_34_471 | 145 |
| 1401 | 3300049541 | Ga0501325_005144 | Ga0501325_005144_423_860 | 145 |
| 1402 | 3300049549 | Ga0501333_004428 | Ga0501333_004428_405_842 | 145 |
| 1403 | 3300049556 | Ga0501340_022921 | Ga0501340_022921_43_480 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9665 | 22 | 128 |
| 8c9a-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9622 | 23 | 128 |
| 8c95-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9607 | 22 | 128 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9513 | 23 | 129 |
| 8c8z-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9472 | 22 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1K1P2_86_208_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9208 | 22 | 129 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9195 | 22 | 129 | 3.90.470.10 |
| af_Q9XX18_90_260_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8968 | 22 | 129 | 3.90.470.10 |
| af_A0A0P0YAA5_35_146_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8947 | 22 | 129 | 3.90.470.10 |
| af_Q4DYB8_108_251_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8892 | 19 | 129 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W2CZW6-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9256 | 20 | 129 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A7W7SNW7-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9252 | 20 | 129 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-B2UMT4-F1-model_v4 | Large ribosomal subunit protein uL22 (50S ribosomal protein L22) | 0.9252 | 22 | 131 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A846ZTR3-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9252 | 22 | 129 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A6J7L4Z0-F1-model_v4 | Unannotated protein | 0.925 | 22 | 128 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar