F493589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1391 | 483 | 2782 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100031602|Ga0070690_1000316023 |
| Length | 157 |
| Sequence | MRRSAAKPRKIDPDPIFRNRLVTKLINRAMYDGKKSVIQREVYGAFDLIAKKGEDPMQVFSLAMENVKPQMEVRARRIGGAAYQVPQPVRGVRKEALAIRWIVASSRARSNSEFHTYAEKLATELLEASKNEGGAVRKKQDMEKTADANRAFSHFRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 133 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 134 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 154 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 246 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 250 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 251 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 252 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 261 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 262 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 291 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 309 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 314 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 315 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 316 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 317 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 318 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 319 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 320 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 384 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 385 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 386 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 387 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 388 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 389 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 392 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 393 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 394 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 395 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 396 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 434 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 441 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 460 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 461 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 462 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 464 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 467 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 468 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 470 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 472 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 477 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 478 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 479 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 480 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 481 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 482 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 483 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.01 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.74 |
| Nodule | 0.14 |
| Rhizoplane | 8.91 |
| Rhizosphere | 84.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100031602 | 3300005330 | Bacteria | 3299 |
| 2 | JGI24739J22299_10003680 | 3300001989 | Bacteria | 5846 |
| 3 | JGI24744J21845_10009957 | 3300002077 | Bacteria | 1949 |
| 4 | JGI24034J26672_10026341 | 3300002239 | Bacteria | 932 |
| 5 | JGI24751J29686_10002788 | 3300002459 | Bacteria | 3515 |
| 6 | JGI25153J46596_10019740 | 3300003215 | Bacteria | 2570 |
| 7 | Ga0055536_1002518 | 3300003781 | Bacteria | 10276 |
| 8 | Ga0055530_10015497 | 3300003791 | Bacteria | 2484 |
| 9 | Ga0055540_1016845 | 3300003792 | Bacteria | 2059 |
| 10 | Ga0055531_10016122 | 3300003794 | Bacteria | 3244 |
| 11 | Ga0065165_1052002 | 3300005262 | Bacteria | 1159 |
| 12 | Ga0065712_10221854 | 3300005290 | Bacteria | 1035 |
| 13 | Ga0065715_10120074 | 3300005293 | Bacteria | 2268 |
| 14 | Ga0070658_10117184 | 3300005327 | Bacteria | 2211 |
| 15 | Ga0070676_10003697 | 3300005328 | Bacteria | 8017 |
| 16 | Ga0070683_100066664 | 3300005329 | Bacteria | 3354 |
| 17 | Ga0070690_100000669 | 3300005330 | Bacteria | 17468 |
| 18 | Ga0070690_100437829 | 3300005330 | Bacteria | 967 |
| 19 | Ga0070670_100000376 | 3300005331 | Bacteria | 37212 |
| 20 | Ga0070677_10061351 | 3300005333 | Bacteria | 1552 |
| 21 | Ga0070677_10217266 | 3300005333 | Bacteria | 932 |
| 22 | Ga0068869_100017443 | 3300005334 | Bacteria | 4866 |
| 23 | Ga0068869_100350225 | 3300005334 | Bacteria | 1204 |
| 24 | Ga0068869_100792907 | 3300005334 | Bacteria | 814 |
| 25 | Ga0070666_10010589 | 3300005335 | Bacteria | 5770 |
| 26 | Ga0070666_10238426 | 3300005335 | Bacteria | 1286 |
| 27 | Ga0070680_100002865 | 3300005336 | Bacteria | 12804 |
| 28 | Ga0070680_100022142 | 3300005336 | Bacteria | 5055 |
| 29 | Ga0070680_100045100 | 3300005336 | Bacteria | 3583 |
| 30 | Ga0070680_100063280 | 3300005336 | Bacteria | 3030 |
| 31 | Ga0070682_100000906 | 3300005337 | Bacteria | 17327 |
| 32 | Ga0070682_100002069 | 3300005337 | Bacteria | 11170 |
| 33 | Ga0070682_100080167 | 3300005337 | Bacteria | 2110 |
| 34 | Ga0070682_100457835 | 3300005337 | Bacteria | 979 |
| 35 | Ga0068868_100002279 | 3300005338 | Bacteria | 13258 |
| 36 | Ga0068868_101195933 | 3300005338 | Bacteria | 703 |
| 37 | Ga0070660_100000686 | 3300005339 | Bacteria | 22383 |
| 38 | Ga0070660_100025853 | 3300005339 | Bacteria | 4367 |
| 39 | Ga0070660_100980122 | 3300005339 | Bacteria | 714 |
| 40 | Ga0070689_100000122 | 3300005340 | Bacteria | 44668 |
| 41 | Ga0070689_100001563 | 3300005340 | Bacteria | 14593 |
| 42 | Ga0070689_100561436 | 3300005340 | Bacteria | 985 |
| 43 | Ga0070689_100636419 | 3300005340 | Bacteria | 927 |
| 44 | Ga0070689_100806752 | 3300005340 | Bacteria | 826 |
| 45 | Ga0070689_101300264 | 3300005340 | Bacteria | 655 |
| 46 | Ga0070691_10000490 | 3300005341 | Bacteria | 14859 |
| 47 | Ga0070691_10071705 | 3300005341 | Bacteria | 1682 |
| 48 | Ga0070691_10112071 | 3300005341 | Bacteria | 1366 |
| 49 | Ga0070691_10122218 | 3300005341 | Bacteria | 1312 |
| 50 | Ga0070691_10491655 | 3300005341 | Bacteria | 708 |
| 51 | Ga0070687_100021008 | 3300005343 | Bacteria | 3061 |
| 52 | Ga0070687_100633737 | 3300005343 | Bacteria | 739 |
| 53 | Ga0070661_100000385 | 3300005344 | Bacteria | 34633 |
| 54 | Ga0070661_100113169 | 3300005344 | Bacteria | 2028 |
| 55 | Ga0070692_10001302 | 3300005345 | Bacteria | 8967 |
| 56 | Ga0070692_10087562 | 3300005345 | Bacteria | 1688 |
| 57 | Ga0070692_10135442 | 3300005345 | Bacteria | 1388 |
| 58 | Ga0070692_10188993 | 3300005345 | Bacteria | 1198 |
| 59 | Ga0070692_10350890 | 3300005345 | Bacteria | 917 |
| 60 | Ga0070692_10404232 | 3300005345 | Bacteria | 863 |
| 61 | Ga0070668_100005991 | 3300005347 | Bacteria | 9018 |
| 62 | Ga0070668_100097873 | 3300005347 | Bacteria | 2321 |
| 63 | Ga0070668_100630128 | 3300005347 | Bacteria | 940 |
| 64 | Ga0070668_100717684 | 3300005347 | Bacteria | 883 |
| 65 | Ga0070668_100901193 | 3300005347 | Bacteria | 790 |
| 66 | Ga0070668_101757251 | 3300005347 | Bacteria | 570 |
| 67 | Ga0070669_100002082 | 3300005353 | Bacteria | 14453 |
| 68 | Ga0070669_100832448 | 3300005353 | Bacteria | 786 |
| 69 | Ga0070669_101013596 | 3300005353 | Bacteria | 713 |
| 70 | Ga0070675_100005878 | 3300005354 | Bacteria | 9400 |
| 71 | Ga0070675_101154866 | 3300005354 | Bacteria | 713 |
| 72 | Ga0070671_100001283 | 3300005355 | Bacteria | 18858 |
| 73 | Ga0070671_100302239 | 3300005355 | Bacteria | 1362 |
| 74 | Ga0070674_100000649 | 3300005356 | Bacteria | 17518 |
| 75 | Ga0070674_100097379 | 3300005356 | Bacteria | 2136 |
| 76 | Ga0070674_100530538 | 3300005356 | Bacteria | 985 |
| 77 | Ga0070673_100121391 | 3300005364 | Bacteria | 2180 |
| 78 | Ga0070688_100000217 | 3300005365 | Bacteria | 30556 |
| 79 | Ga0070688_100028311 | 3300005365 | Bacteria | 3343 |
| 80 | Ga0070688_100202736 | 3300005365 | Bacteria | 1389 |
| 81 | Ga0070688_100965974 | 3300005365 | Bacteria | 675 |
| 82 | Ga0070659_100002236 | 3300005366 | Bacteria | 13760 |
| 83 | Ga0070659_100023489 | 3300005366 | Bacteria | 4719 |
| 84 | Ga0070659_100045573 | 3300005366 | Bacteria | 3435 |
| 85 | Ga0070659_100227582 | 3300005366 | Bacteria | 1540 |
| 86 | Ga0070659_100270890 | 3300005366 | Bacteria | 1411 |
| 87 | Ga0070659_100859937 | 3300005366 | Bacteria | 791 |
| 88 | Ga0070667_100002610 | 3300005367 | Bacteria | 15628 |
| 89 | Ga0070667_100092102 | 3300005367 | Bacteria | 2607 |
| 90 | Ga0070667_100128893 | 3300005367 | Bacteria | 2207 |
| 91 | Ga0070667_100226989 | 3300005367 | Bacteria | 1664 |
| 92 | Ga0070667_101605522 | 3300005367 | Unclassified | 611 |
| 93 | Ga0070703_10004053 | 3300005406 | Bacteria | 4136 |
| 94 | Ga0070709_10001232 | 3300005434 | Bacteria | 14032 |
| 95 | Ga0070709_10288704 | 3300005434 | Bacteria | 1194 |
| 96 | Ga0070709_10735828 | 3300005434 | Bacteria | 770 |
| 97 | Ga0070714_100018042 | 3300005435 | Bacteria | 5725 |
| 98 | Ga0070713_100001927 | 3300005436 | Bacteria | 13398 |
| 99 | Ga0070713_100078299 | 3300005436 | Bacteria | 2814 |
| 100 | Ga0070710_10166478 | 3300005437 | Bacteria | 1371 |
| 101 | Ga0070701_10004381 | 3300005438 | Bacteria | 5709 |
| 102 | Ga0070711_100000834 | 3300005439 | Bacteria | 16154 |
| 103 | Ga0070711_100512272 | 3300005439 | Bacteria | 991 |
| 104 | Ga0070711_100752604 | 3300005439 | Bacteria | 824 |
| 105 | Ga0070705_100001704 | 3300005440 | Bacteria | 11456 |
| 106 | Ga0070705_100004368 | 3300005440 | Bacteria | 6882 |
| 107 | Ga0070705_100461106 | 3300005440 | Bacteria | 956 |
| 108 | Ga0070700_100002377 | 3300005441 | Bacteria | 9585 |
| 109 | Ga0070700_100065396 | 3300005441 | Bacteria | 2306 |
| 110 | Ga0070700_100091434 | 3300005441 | Bacteria | 1987 |
| 111 | Ga0070700_100091728 | 3300005441 | Bacteria | 1984 |
| 112 | Ga0070700_100098903 | 3300005441 | Bacteria | 1918 |
| 113 | Ga0070700_100353274 | 3300005441 | Bacteria | 1090 |
| 114 | Ga0070700_100711397 | 3300005441 | Bacteria | 800 |
| 115 | Ga0070694_100000195 | 3300005444 | Bacteria | 32086 |
| 116 | Ga0070694_100036040 | 3300005444 | Bacteria | 3274 |
| 117 | Ga0070694_100133401 | 3300005444 | Bacteria | 1797 |
| 118 | Ga0070694_100202098 | 3300005444 | Bacteria | 1482 |
| 119 | Ga0070694_100389255 | 3300005444 | Bacteria | 1089 |
| 120 | Ga0070694_100637231 | 3300005444 | Bacteria | 861 |
| 121 | Ga0070708_100056503 | 3300005445 | Bacteria | 3492 |
| 122 | Ga0070708_100093871 | 3300005445 | Bacteria | 2737 |
| 123 | Ga0070663_100000352 | 3300005455 | Bacteria | 24139 |
| 124 | Ga0070663_100001782 | 3300005455 | Bacteria | 11977 |
| 125 | Ga0070663_100071693 | 3300005455 | Bacteria | 2522 |
| 126 | Ga0070663_100192549 | 3300005455 | Bacteria | 1587 |
| 127 | Ga0070663_100350786 | 3300005455 | Bacteria | 1195 |
| 128 | Ga0070678_100001137 | 3300005456 | Bacteria | 14044 |
| 129 | Ga0070662_100000412 | 3300005457 | Bacteria | 25384 |
| 130 | Ga0070662_100550682 | 3300005457 | Bacteria | 967 |
| 131 | Ga0070662_100836164 | 3300005457 | Bacteria | 784 |
| 132 | Ga0070662_101037584 | 3300005457 | Bacteria | 703 |
| 133 | Ga0070681_10005865 | 3300005458 | Bacteria | 11891 |
| 134 | Ga0070681_10023484 | 3300005458 | Bacteria | 6202 |
| 135 | Ga0070681_10042377 | 3300005458 | Bacteria | 4561 |
| 136 | Ga0070681_10164070 | 3300005458 | Bacteria | 2145 |
| 137 | Ga0070681_10185822 | 3300005458 | Bacteria | 1999 |
| 138 | Ga0070681_10250538 | 3300005458 | Bacteria | 1684 |
| 139 | Ga0068867_100070990 | 3300005459 | Bacteria | 2604 |
| 140 | Ga0070685_10005479 | 3300005466 | Bacteria | 6429 |
| 141 | Ga0070685_10679033 | 3300005466 | Bacteria | 749 |
| 142 | Ga0070706_100334391 | 3300005467 | Bacteria | 1412 |
| 143 | Ga0070706_100991629 | 3300005467 | Bacteria | 775 |
| 144 | Ga0070706_102146987 | 3300005467 | Bacteria | 505 |
| 145 | Ga0070707_100045980 | 3300005468 | Bacteria | 4177 |
| 146 | Ga0070707_100689963 | 3300005468 | Bacteria | 984 |
| 147 | Ga0070707_100858955 | 3300005468 | Bacteria | 872 |
| 148 | Ga0070698_100105371 | 3300005471 | Bacteria | 2790 |
| 149 | Ga0070698_100271798 | 3300005471 | Bacteria | 1626 |
| 150 | Ga0070698_101452714 | 3300005471 | Bacteria | 637 |
| 151 | Ga0070699_100002571 | 3300005518 | Bacteria | 16279 |
| 152 | Ga0070699_100613012 | 3300005518 | Bacteria | 993 |
| 153 | Ga0070679_100014791 | 3300005530 | Bacteria | 7498 |
| 154 | Ga0070679_100068971 | 3300005530 | Bacteria | 3527 |
| 155 | Ga0070679_100728392 | 3300005530 | Bacteria | 934 |
| 156 | Ga0070684_100225818 | 3300005535 | Bacteria | 1709 |
| 157 | Ga0070697_100000391 | 3300005536 | Bacteria | 34002 |
| 158 | Ga0070697_100066290 | 3300005536 | Bacteria | 2952 |
| 159 | Ga0070697_100330332 | 3300005536 | Bacteria | 1314 |
| 160 | Ga0068853_100001595 | 3300005539 | Bacteria | 16513 |
| 161 | Ga0068853_100095708 | 3300005539 | Bacteria | 2619 |
| 162 | Ga0068853_101329379 | 3300005539 | Bacteria | 695 |
| 163 | Ga0070672_100008680 | 3300005543 | Bacteria | 6968 |
| 164 | Ga0070686_100000853 | 3300005544 | Bacteria | 17703 |
| 165 | Ga0070686_100000940 | 3300005544 | Bacteria | 16774 |
| 166 | Ga0070695_100000238 | 3300005545 | Bacteria | 27265 |
| 167 | Ga0070695_100013344 | 3300005545 | Bacteria | 4935 |
| 168 | Ga0070695_100028804 | 3300005545 | Bacteria | 3448 |
| 169 | Ga0070695_100069546 | 3300005545 | Bacteria | 2301 |
| 170 | Ga0070695_100180109 | 3300005545 | Bacteria | 1497 |
| 171 | Ga0070695_100226022 | 3300005545 | Bacteria | 1351 |
| 172 | Ga0070695_100328434 | 3300005545 | Bacteria | 1139 |
| 173 | Ga0070695_100559307 | 3300005545 | Bacteria | 893 |
| 174 | Ga0070696_100000815 | 3300005546 | Bacteria | 20059 |
| 175 | Ga0070696_100006241 | 3300005546 | Bacteria | 7976 |
| 176 | Ga0070696_100200406 | 3300005546 | Bacteria | 1490 |
| 177 | Ga0070696_100290248 | 3300005546 | Bacteria | 1249 |
| 178 | Ga0070693_100089116 | 3300005547 | Bacteria | 1856 |
| 179 | Ga0070693_100231277 | 3300005547 | Bacteria | 1216 |
| 180 | Ga0070665_100052313 | 3300005548 | Bacteria | 4097 |
| 181 | Ga0070665_101071652 | 3300005548 | Bacteria | 818 |
| 182 | Ga0070704_100000124 | 3300005549 | Bacteria | 27978 |
| 183 | Ga0070704_100006261 | 3300005549 | Bacteria | 7001 |
| 184 | Ga0070704_100280374 | 3300005549 | Bacteria | 1380 |
| 185 | Ga0068855_100002691 | 3300005563 | Bacteria | 21916 |
| 186 | Ga0068855_100069700 | 3300005563 | Bacteria | 4092 |
| 187 | Ga0070664_100186343 | 3300005564 | Bacteria | 1847 |
| 188 | Ga0068857_100034156 | 3300005577 | Bacteria | 4500 |
| 189 | Ga0068857_100310077 | 3300005577 | Bacteria | 1456 |
| 190 | Ga0068857_100332947 | 3300005577 | Bacteria | 1403 |
| 191 | Ga0068854_100022328 | 3300005578 | Bacteria | 4308 |
| 192 | Ga0068854_100095464 | 3300005578 | Bacteria | 2220 |
| 193 | Ga0068854_100325520 | 3300005578 | Bacteria | 1251 |
| 194 | Ga0068854_100453359 | 3300005578 | Bacteria | 1072 |
| 195 | Ga0068854_100458028 | 3300005578 | Bacteria | 1067 |
| 196 | Ga0068856_100002821 | 3300005614 | Bacteria | 17787 |
| 197 | Ga0068856_100743676 | 3300005614 | Bacteria | 1001 |
| 198 | Ga0070702_100000018 | 3300005615 | Bacteria | 47204 |
| 199 | Ga0070702_100020165 | 3300005615 | Bacteria | 3488 |
| 200 | Ga0070702_100095027 | 3300005615 | Bacteria | 1816 |
| 201 | Ga0070702_100450512 | 3300005615 | Bacteria | 933 |
| 202 | Ga0068852_100067019 | 3300005616 | Bacteria | 3138 |
| 203 | Ga0068852_100544065 | 3300005616 | Bacteria | 1161 |
| 204 | Ga0068852_101766950 | 3300005616 | Bacteria | 641 |
| 205 | Ga0068859_100006726 | 3300005617 | Bacteria | 11681 |
| 206 | Ga0068859_100019657 | 3300005617 | Bacteria | 6783 |
| 207 | Ga0068859_100073753 | 3300005617 | Bacteria | 3451 |
| 208 | Ga0068859_100224454 | 3300005617 | Bacteria | 1967 |
| 209 | Ga0068859_100591668 | 3300005617 | Bacteria | 1203 |
| 210 | Ga0068859_101558607 | 3300005617 | Bacteria | 729 |
| 211 | Ga0068859_101828721 | 3300005617 | Bacteria | 671 |
| 212 | Ga0068864_100002243 | 3300005618 | Bacteria | 15978 |
| 213 | Ga0068864_100144705 | 3300005618 | Bacteria | 2148 |
| 214 | Ga0068864_100347956 | 3300005618 | Bacteria | 1398 |
| 215 | Ga0068864_101084319 | 3300005618 | Bacteria | 797 |
| 216 | Ga0068866_10016535 | 3300005718 | Bacteria | 3299 |
| 217 | Ga0068866_10162137 | 3300005718 | Bacteria | 1305 |
| 218 | Ga0068866_10371120 | 3300005718 | Bacteria | 915 |
| 219 | Ga0068866_10547415 | 3300005718 | Bacteria | 773 |
| 220 | Ga0068861_100021853 | 3300005719 | Bacteria | 4602 |
| 221 | Ga0068861_100052445 | 3300005719 | Bacteria | 3100 |
| 222 | Ga0068861_100059827 | 3300005719 | Bacteria | 2918 |
| 223 | Ga0068861_100121537 | 3300005719 | Bacteria | 2107 |
| 224 | Ga0068861_100128342 | 3300005719 | Bacteria | 2055 |
| 225 | Ga0068861_100199791 | 3300005719 | Bacteria | 1677 |
| 226 | Ga0068851_10290140 | 3300005834 | Bacteria | 938 |
| 227 | Ga0068870_10142969 | 3300005840 | Bacteria | 1402 |
| 228 | Ga0068870_10379296 | 3300005840 | Bacteria | 915 |
| 229 | Ga0068863_100035631 | 3300005841 | Bacteria | 4738 |
| 230 | Ga0068863_101263919 | 3300005841 | Bacteria | 745 |
| 231 | Ga0068863_101553316 | 3300005841 | Bacteria | 671 |
| 232 | Ga0068858_100014450 | 3300005842 | Bacteria | 7439 |
| 233 | Ga0068858_100059439 | 3300005842 | Bacteria | 3533 |
| 234 | Ga0068858_100102790 | 3300005842 | Bacteria | 2666 |
| 235 | Ga0068858_100231289 | 3300005842 | Bacteria | 1753 |
| 236 | Ga0068858_100818811 | 3300005842 | Bacteria | 909 |
| 237 | Ga0068858_101058738 | 3300005842 | Bacteria | 796 |
| 238 | Ga0068860_100000598 | 3300005843 | Bacteria | 43069 |
| 239 | Ga0068860_100730924 | 3300005843 | Bacteria | 1001 |
| 240 | Ga0068860_100735572 | 3300005843 | Bacteria | 997 |
| 241 | Ga0068860_100747308 | 3300005843 | Bacteria | 990 |
| 242 | Ga0068860_100768968 | 3300005843 | Bacteria | 976 |
| 243 | Ga0068860_101148659 | 3300005843 | Bacteria | 796 |
| 244 | Ga0068862_100002462 | 3300005844 | Bacteria | 16405 |
| 245 | Ga0068862_100008039 | 3300005844 | Bacteria | 8730 |
| 246 | Ga0068862_100021045 | 3300005844 | Bacteria | 5450 |
| 247 | Ga0068862_100355084 | 3300005844 | Bacteria | 1361 |
| 248 | Ga0068862_100516980 | 3300005844 | Bacteria | 1135 |
| 249 | Ga0068862_101384035 | 3300005844 | Bacteria | 706 |
| 250 | Ga0081455_10004292 | 3300005937 | Bacteria | 16046 |
| 251 | Ga0081455_10007585 | 3300005937 | Bacteria | 11406 |
| 252 | Ga0081455_10308714 | 3300005937 | Bacteria | 1131 |
| 253 | Ga0081540_1001954 | 3300005983 | Bacteria | 17230 |
| 254 | Ga0081540_1039855 | 3300005983 | Bacteria | 2457 |
| 255 | Ga0081539_10046146 | 3300005985 | Bacteria | 2499 |
| 256 | Ga0081539_10050726 | 3300005985 | Bacteria | 2345 |
| 257 | Ga0070717_10330910 | 3300006028 | Bacteria | 1359 |
| 258 | Ga0075365_10003505 | 3300006038 | Bacteria | 8109 |
| 259 | Ga0075365_10078853 | 3300006038 | Bacteria | 2228 |
| 260 | Ga0075368_10007190 | 3300006042 | Bacteria | 3923 |
| 261 | Ga0075368_10088331 | 3300006042 | Bacteria | 1266 |
| 262 | Ga0075368_10164231 | 3300006042 | Bacteria | 931 |
| 263 | Ga0075363_100004707 | 3300006048 | Bacteria | 6005 |
| 264 | Ga0075363_100133533 | 3300006048 | Bacteria | 1393 |
| 265 | Ga0075363_100254370 | 3300006048 | Bacteria | 1012 |
| 266 | Ga0075363_100279414 | 3300006048 | Bacteria | 966 |
| 267 | Ga0075364_10589678 | 3300006051 | Bacteria | 759 |
| 268 | Ga0075432_10009193 | 3300006058 | Bacteria | 3366 |
| 269 | Ga0075432_10024708 | 3300006058 | Bacteria | 2060 |
| 270 | Ga0070715_10009598 | 3300006163 | Bacteria | 3417 |
| 271 | Ga0070716_100004896 | 3300006173 | Bacteria | 6440 |
| 272 | Ga0070716_100205373 | 3300006173 | Bacteria | 1313 |
| 273 | Ga0070716_100274689 | 3300006173 | Bacteria | 1160 |
| 274 | Ga0070716_100510710 | 3300006173 | Bacteria | 888 |
| 275 | Ga0070716_100739079 | 3300006173 | Bacteria | 756 |
| 276 | Ga0070712_100002909 | 3300006175 | Bacteria | 10615 |
| 277 | Ga0070712_100034164 | 3300006175 | Bacteria | 3445 |
| 278 | Ga0070712_100236495 | 3300006175 | Bacteria | 1453 |
| 279 | Ga0070712_100800337 | 3300006175 | Bacteria | 809 |
| 280 | Ga0075362_10184200 | 3300006177 | Bacteria | 1012 |
| 281 | Ga0075367_10113166 | 3300006178 | Bacteria | 1667 |
| 282 | Ga0075367_10254589 | 3300006178 | Bacteria | 1101 |
| 283 | Ga0075366_10107355 | 3300006195 | Bacteria | 1679 |
| 284 | Ga0075366_10200191 | 3300006195 | Bacteria | 1215 |
| 285 | Ga0097621_100087331 | 3300006237 | Bacteria | 2604 |
| 286 | Ga0097621_100216659 | 3300006237 | Bacteria | 1667 |
| 287 | Ga0097621_100330010 | 3300006237 | Bacteria | 1353 |
| 288 | Ga0097621_101619135 | 3300006237 | Bacteria | 616 |
| 289 | Ga0068871_100389102 | 3300006358 | Bacteria | 1240 |
| 290 | Ga0068871_100847370 | 3300006358 | Bacteria | 845 |
| 291 | Ga0075428_100025828 | 3300006844 | Bacteria | 6504 |
| 292 | Ga0075428_100044339 | 3300006844 | Bacteria | 4887 |
| 293 | Ga0075428_100116926 | 3300006844 | Bacteria | 2904 |
| 294 | Ga0075428_100184052 | 3300006844 | Bacteria | 2260 |
| 295 | Ga0075428_100211533 | 3300006844 | Bacteria | 2095 |
| 296 | Ga0075428_100301142 | 3300006844 | Bacteria | 1724 |
| 297 | Ga0075428_100963850 | 3300006844 | Bacteria | 904 |
| 298 | Ga0075430_100029402 | 3300006846 | Bacteria | 4664 |
| 299 | Ga0075430_100161869 | 3300006846 | Bacteria | 1863 |
| 300 | Ga0075430_100305244 | 3300006846 | Bacteria | 1316 |
| 301 | Ga0075430_100449279 | 3300006846 | Bacteria | 1064 |
| 302 | Ga0075430_101247234 | 3300006846 | Bacteria | 612 |
| 303 | Ga0075431_100002019 | 3300006847 | Bacteria | 19380 |
| 304 | Ga0075431_100014350 | 3300006847 | Bacteria | 8013 |
| 305 | Ga0075431_100048216 | 3300006847 | Bacteria | 4393 |
| 306 | Ga0075431_100085221 | 3300006847 | Bacteria | 3261 |
| 307 | Ga0075433_10002400 | 3300006852 | Bacteria | 14254 |
| 308 | Ga0075433_10006677 | 3300006852 | Bacteria | 9138 |
| 309 | Ga0075433_10126528 | 3300006852 | Bacteria | 2269 |
| 310 | Ga0075433_10180830 | 3300006852 | Bacteria | 1876 |
| 311 | Ga0075433_10303775 | 3300006852 | Bacteria | 1413 |
| 312 | Ga0075434_100033297 | 3300006871 | Bacteria | 5085 |
| 313 | Ga0075434_100055563 | 3300006871 | Bacteria | 3934 |
| 314 | Ga0075434_100061871 | 3300006871 | Bacteria | 3725 |
| 315 | Ga0075434_100454741 | 3300006871 | Bacteria | 1302 |
| 316 | Ga0075434_100541745 | 3300006871 | Bacteria | 1184 |
| 317 | Ga0075434_100961198 | 3300006871 | Bacteria | 868 |
| 318 | Ga0075429_100018835 | 3300006880 | Bacteria | 5980 |
| 319 | Ga0075429_100796467 | 3300006880 | Bacteria | 828 |
| 320 | Ga0068865_100004683 | 3300006881 | Bacteria | 8261 |
| 321 | Ga0068865_100271014 | 3300006881 | Bacteria | 1348 |
| 322 | Ga0075436_100001383 | 3300006914 | Bacteria | 16514 |
| 323 | Ga0097620_100006726 | 3300006931 | Bacteria | 11681 |
| 324 | Ga0097620_100019656 | 3300006931 | Bacteria | 6783 |
| 325 | Ga0097620_100073751 | 3300006931 | Bacteria | 3451 |
| 326 | Ga0097620_100224447 | 3300006931 | Bacteria | 1967 |
| 327 | Ga0097620_100591697 | 3300006931 | Bacteria | 1203 |
| 328 | Ga0097620_101558773 | 3300006931 | Bacteria | 729 |
| 329 | Ga0097620_101828964 | 3300006931 | Bacteria | 671 |
| 330 | Ga0075435_100043632 | 3300007076 | Bacteria | 3590 |
| 331 | Ga0075435_100723045 | 3300007076 | Bacteria | 866 |
| 332 | Ga0105251_10264466 | 3300009011 | Bacteria | 776 |
| 333 | Ga0105244_10397305 | 3300009036 | Bacteria | 634 |
| 334 | Ga0105250_10018370 | 3300009092 | Bacteria | 2832 |
| 335 | Ga0105240_10670007 | 3300009093 | Bacteria | 1135 |
| 336 | Ga0111539_10006608 | 3300009094 | Bacteria | 14940 |
| 337 | Ga0111539_10023934 | 3300009094 | Bacteria | 7503 |
| 338 | Ga0111539_10028568 | 3300009094 | Bacteria | 6802 |
| 339 | Ga0111539_10080826 | 3300009094 | Bacteria | 3823 |
| 340 | Ga0111539_10135824 | 3300009094 | Bacteria | 2880 |
| 341 | Ga0111539_10188116 | 3300009094 | Bacteria | 2410 |
| 342 | Ga0111539_11143466 | 3300009094 | Bacteria | 905 |
| 343 | Ga0111539_11268994 | 3300009094 | Bacteria | 855 |
| 344 | Ga0105245_10000718 | 3300009098 | Bacteria | 29853 |
| 345 | Ga0105245_10766781 | 3300009098 | Bacteria | 1001 |
| 346 | Ga0105245_11641566 | 3300009098 | Bacteria | 695 |
| 347 | Ga0105247_10028576 | 3300009101 | Bacteria | 3375 |
| 348 | Ga0105247_10542179 | 3300009101 | Bacteria | 854 |
| 349 | Ga0105247_10598600 | 3300009101 | Bacteria | 817 |
| 350 | Ga0105247_10968515 | 3300009101 | Bacteria | 662 |
| 351 | Ga0114129_10067547 | 3300009147 | Bacteria | 4986 |
| 352 | Ga0114129_10114822 | 3300009147 | Bacteria | 3713 |
| 353 | Ga0114129_10159816 | 3300009147 | Bacteria | 3079 |
| 354 | Ga0114129_10334793 | 3300009147 | Bacteria | 2009 |
| 355 | Ga0114129_10467716 | 3300009147 | Bacteria | 1652 |
| 356 | Ga0114129_10800767 | 3300009147 | Bacteria | 1202 |
| 357 | Ga0114129_10980056 | 3300009147 | Bacteria | 1066 |
| 358 | Ga0114129_11692413 | 3300009147 | Bacteria | 772 |
| 359 | Ga0114129_13325443 | 3300009147 | Bacteria | 519 |
| 360 | Ga0105243_10007855 | 3300009148 | Bacteria | 8198 |
| 361 | Ga0105243_10016692 | 3300009148 | Bacteria | 5551 |
| 362 | Ga0105243_10096050 | 3300009148 | Bacteria | 2451 |
| 363 | Ga0105243_10164045 | 3300009148 | Bacteria | 1918 |
| 364 | Ga0105243_10346945 | 3300009148 | Bacteria | 1362 |
| 365 | Ga0105243_11690859 | 3300009148 | Bacteria | 662 |
| 366 | Ga0105241_10001150 | 3300009174 | Bacteria | 20135 |
| 367 | Ga0105241_10016819 | 3300009174 | Bacteria | 5369 |
| 368 | Ga0105241_10750543 | 3300009174 | Bacteria | 895 |
| 369 | Ga0105242_10003790 | 3300009176 | Bacteria | 11752 |
| 370 | Ga0105242_10612942 | 3300009176 | Bacteria | 1053 |
| 371 | Ga0105242_10844179 | 3300009176 | Bacteria | 911 |
| 372 | Ga0105248_10017659 | 3300009177 | Bacteria | 7869 |
| 373 | Ga0105248_10090078 | 3300009177 | Bacteria | 3454 |
| 374 | Ga0105248_10249035 | 3300009177 | Bacteria | 2000 |
| 375 | Ga0105237_10001618 | 3300009545 | Bacteria | 29243 |
| 376 | Ga0105237_10025489 | 3300009545 | Bacteria | 6047 |
| 377 | Ga0105237_10164275 | 3300009545 | Bacteria | 2219 |
| 378 | Ga0105237_10906856 | 3300009545 | Bacteria | 888 |
| 379 | Ga0105238_10038405 | 3300009551 | Bacteria | 4863 |
| 380 | Ga0105238_10278955 | 3300009551 | Bacteria | 1652 |
| 381 | Ga0105238_11897910 | 3300009551 | Bacteria | 629 |
| 382 | Ga0105249_10000814 | 3300009553 | Bacteria | 28107 |
| 383 | Ga0105249_10060094 | 3300009553 | Bacteria | 3487 |
| 384 | Ga0105249_10726781 | 3300009553 | Bacteria | 1054 |
| 385 | Ga0105249_10749652 | 3300009553 | Bacteria | 1038 |
| 386 | Ga0105249_11004495 | 3300009553 | Bacteria | 903 |
| 387 | Ga0105249_11539348 | 3300009553 | Bacteria | 737 |
| 388 | Ga0105239_10022201 | 3300010375 | Bacteria | 6995 |
| 389 | Ga0105239_10135147 | 3300010375 | Bacteria | 2745 |
| 390 | Ga0105239_10248297 | 3300010375 | Bacteria | 1999 |
| 391 | Ga0105239_10367586 | 3300010375 | Bacteria | 1625 |
| 392 | Ga0105239_12863633 | 3300010375 | Bacteria | 563 |
| 393 | Ga0105239_13198934 | 3300010375 | Bacteria | 533 |
| 394 | Ga0105246_10008999 | 3300011119 | Bacteria | 6148 |
| 395 | Ga0105246_10050163 | 3300011119 | Bacteria | 2861 |
| 396 | Ga0105246_10058936 | 3300011119 | Bacteria | 2662 |
| 397 | Ga0105246_10195815 | 3300011119 | Bacteria | 1567 |
| 398 | Ga0105246_10628531 | 3300011119 | Bacteria | 932 |
| 399 | Ga0157321_1002735 | 3300012487 | Bacteria | 1005 |
| 400 | Ga0157335_1010858 | 3300012492 | Bacteria | 738 |
| 401 | Ga0157342_1016568 | 3300012507 | Bacteria | 817 |
| 402 | Ga0157373_10013558 | 3300013100 | Bacteria | 5980 |
| 403 | Ga0157373_10057191 | 3300013100 | Bacteria | 2767 |
| 404 | Ga0157371_10010822 | 3300013102 | Bacteria | 7081 |
| 405 | Ga0157371_10178968 | 3300013102 | Bacteria | 1516 |
| 406 | Ga0157370_10018923 | 3300013104 | Bacteria | 6925 |
| 407 | Ga0157370_10022083 | 3300013104 | Bacteria | 6337 |
| 408 | Ga0157370_10109337 | 3300013104 | Bacteria | 2584 |
| 409 | Ga0157369_10012851 | 3300013105 | Bacteria | 9490 |
| 410 | Ga0157369_10237379 | 3300013105 | Bacteria | 1905 |
| 411 | Ga0157369_10382635 | 3300013105 | Bacteria | 1460 |
| 412 | Ga0157374_10012339 | 3300013296 | Bacteria | 7433 |
| 413 | Ga0157374_10287176 | 3300013296 | Unclassified | 1625 |
| 414 | Ga0157378_10006735 | 3300013297 | Bacteria | 10037 |
| 415 | Ga0157378_10073149 | 3300013297 | Bacteria | 3081 |
| 416 | Ga0157378_10220717 | 3300013297 | Bacteria | 1802 |
| 417 | Ga0157378_10447402 | 3300013297 | Bacteria | 1281 |
| 418 | Ga0157378_10870715 | 3300013297 | Bacteria | 930 |
| 419 | Ga0163162_10004532 | 3300013306 | Bacteria | 13382 |
| 420 | Ga0163162_10213855 | 3300013306 | Bacteria | 2058 |
| 421 | Ga0163162_10594627 | 3300013306 | Bacteria | 1233 |
| 422 | Ga0163162_11855357 | 3300013306 | Bacteria | 690 |
| 423 | Ga0163162_12134791 | 3300013306 | Bacteria | 643 |
| 424 | Ga0157372_10019801 | 3300013307 | Bacteria | 7251 |
| 425 | Ga0157372_10064568 | 3300013307 | Bacteria | 4107 |
| 426 | Ga0157372_10367294 | 3300013307 | Bacteria | 1677 |
| 427 | Ga0157372_10888664 | 3300013307 | Bacteria | 1034 |
| 428 | Ga0157375_10043922 | 3300013308 | Bacteria | 4337 |
| 429 | Ga0157375_10196112 | 3300013308 | Bacteria | 2174 |
| 430 | Ga0157375_10396202 | 3300013308 | Bacteria | 1547 |
| 431 | Ga0157375_11372090 | 3300013308 | Bacteria | 832 |
| 432 | Ga0163163_10026373 | 3300014325 | Bacteria | 5553 |
| 433 | Ga0163163_10143990 | 3300014325 | Bacteria | 2426 |
| 434 | Ga0157380_10003574 | 3300014326 | Bacteria | 10693 |
| 435 | Ga0157380_10118277 | 3300014326 | Bacteria | 2240 |
| 436 | Ga0157380_10659844 | 3300014326 | Bacteria | 1045 |
| 437 | Ga0157380_11283587 | 3300014326 | Bacteria | 779 |
| 438 | Ga0157380_11873382 | 3300014326 | Bacteria | 660 |
| 439 | Ga0157377_10254445 | 3300014745 | Bacteria | 1140 |
| 440 | Ga0157377_10488350 | 3300014745 | Bacteria | 858 |
| 441 | Ga0157377_10667616 | 3300014745 | Bacteria | 750 |
| 442 | Ga0157377_11316939 | 3300014745 | Bacteria | 565 |
| 443 | Ga0157377_11477652 | 3300014745 | Bacteria | 539 |
| 444 | Ga0157379_10015080 | 3300014968 | Bacteria | 6778 |
| 445 | Ga0157379_10016719 | 3300014968 | Bacteria | 6455 |
| 446 | Ga0157379_10152930 | 3300014968 | Bacteria | 2081 |
| 447 | Ga0157379_10472628 | 3300014968 | Bacteria | 1159 |
| 448 | Ga0157379_10694896 | 3300014968 | Bacteria | 954 |
| 449 | Ga0157379_10892907 | 3300014968 | Bacteria | 843 |
| 450 | Ga0157376_10000606 | 3300014969 | Bacteria | 23175 |
| 451 | Ga0157376_10470382 | 3300014969 | Bacteria | 1230 |
| 452 | Ga0157376_10783890 | 3300014969 | Bacteria | 965 |
| 453 | Ga0163161_10002394 | 3300017792 | Bacteria | 13438 |
| 454 | Ga0163161_10009458 | 3300017792 | Bacteria | 6747 |
| 455 | Ga0163161_10116346 | 3300017792 | Bacteria | 2004 |
| 456 | Ga0163161_10759798 | 3300017792 | Bacteria | 812 |
| 457 | Ga0197907_11483265 | 3300020069 | Bacteria | 542 |
| 458 | Ga0213872_10132952 | 3300021361 | Bacteria | 1095 |
| 459 | Ga0213876_10022060 | 3300021384 | Bacteria | 3368 |
| 460 | Ga0213876_10423739 | 3300021384 | Bacteria | 708 |
| 461 | Ga0213871_10030922 | 3300021441 | Bacteria | 1395 |
| 462 | Ga0224572_1093388 | 3300024225 | Bacteria | 555 |
| 463 | Ga0209676_1008643 | 3300025292 | Bacteria | 4509 |
| 464 | Ga0209758_1016521 | 3300025297 | Bacteria | 3743 |
| 465 | Ga0209758_1054523 | 3300025297 | Bacteria | 1365 |
| 466 | Ga0209050_1014417 | 3300025298 | Bacteria | 3406 |
| 467 | Ga0209256_1029617 | 3300025299 | Bacteria | 1523 |
| 468 | Ga0209051_1011025 | 3300025303 | Bacteria | 4506 |
| 469 | Ga0209257_1007191 | 3300025304 | Bacteria | 6832 |
| 470 | Ga0207656_10227735 | 3300025321 | Bacteria | 908 |
| 471 | Ga0207653_10001732 | 3300025885 | Bacteria | 6967 |
| 472 | Ga0207653_10008442 | 3300025885 | Bacteria | 3208 |
| 473 | Ga0207692_10002601 | 3300025898 | Bacteria | 6941 |
| 474 | Ga0207642_10179543 | 3300025899 | Bacteria | 1152 |
| 475 | Ga0207642_10188324 | 3300025899 | Bacteria | 1130 |
| 476 | Ga0207642_10280697 | 3300025899 | Bacteria | 958 |
| 477 | Ga0207710_10033641 | 3300025900 | Bacteria | 2249 |
| 478 | Ga0207710_10247588 | 3300025900 | Bacteria | 890 |
| 479 | Ga0207688_10000685 | 3300025901 | Bacteria | 16721 |
| 480 | Ga0207680_10004197 | 3300025903 | Bacteria | 6819 |
| 481 | Ga0207647_10001956 | 3300025904 | Bacteria | 15734 |
| 482 | Ga0207647_10026538 | 3300025904 | Bacteria | 3789 |
| 483 | Ga0207647_10126221 | 3300025904 | Bacteria | 1506 |
| 484 | Ga0207685_10039371 | 3300025905 | Bacteria | 1754 |
| 485 | Ga0207699_10000692 | 3300025906 | Bacteria | 16128 |
| 486 | Ga0207699_10334343 | 3300025906 | Bacteria | 1066 |
| 487 | Ga0207699_10645384 | 3300025906 | Bacteria | 773 |
| 488 | Ga0207645_10012210 | 3300025907 | Bacteria | 5833 |
| 489 | Ga0207645_10254541 | 3300025907 | Bacteria | 1162 |
| 490 | Ga0207645_10296051 | 3300025907 | Bacteria | 1077 |
| 491 | Ga0207645_10370527 | 3300025907 | Bacteria | 960 |
| 492 | Ga0207643_10190093 | 3300025908 | Bacteria | 1246 |
| 493 | Ga0207643_10612253 | 3300025908 | Bacteria | 701 |
| 494 | Ga0207705_10102282 | 3300025909 | Bacteria | 2109 |
| 495 | Ga0207684_10423995 | 3300025910 | Bacteria | 1143 |
| 496 | Ga0207684_10668588 | 3300025910 | Bacteria | 884 |
| 497 | Ga0207654_10008946 | 3300025911 | Bacteria | 5078 |
| 498 | Ga0207654_10019158 | 3300025911 | Bacteria | 3606 |
| 499 | Ga0207654_10545463 | 3300025911 | Bacteria | 823 |
| 500 | Ga0207654_11098240 | 3300025911 | Bacteria | 579 |
| 501 | Ga0207707_10004025 | 3300025912 | Bacteria | 13037 |
| 502 | Ga0207707_10126099 | 3300025912 | Bacteria | 2239 |
| 503 | Ga0207707_10148837 | 3300025912 | Bacteria | 2047 |
| 504 | Ga0207707_10203186 | 3300025912 | Bacteria | 1727 |
| 505 | Ga0207707_10303093 | 3300025912 | Bacteria | 1381 |
| 506 | Ga0207695_10473876 | 3300025913 | Bacteria | 1134 |
| 507 | Ga0207695_10525623 | 3300025913 | Bacteria | 1065 |
| 508 | Ga0207671_10081612 | 3300025914 | Bacteria | 2425 |
| 509 | Ga0207671_10083800 | 3300025914 | Bacteria | 2394 |
| 510 | Ga0207671_10239751 | 3300025914 | Bacteria | 1424 |
| 511 | Ga0207671_10459644 | 3300025914 | Bacteria | 1014 |
| 512 | Ga0207693_10002667 | 3300025915 | Bacteria | 15496 |
| 513 | Ga0207693_10050769 | 3300025915 | Bacteria | 3256 |
| 514 | Ga0207693_10343264 | 3300025915 | Bacteria | 1169 |
| 515 | Ga0207693_10438020 | 3300025915 | Bacteria | 1022 |
| 516 | Ga0207663_10001067 | 3300025916 | Bacteria | 12565 |
| 517 | Ga0207663_10547133 | 3300025916 | Bacteria | 904 |
| 518 | Ga0207660_10018343 | 3300025917 | Bacteria | 4662 |
| 519 | Ga0207660_10036326 | 3300025917 | Bacteria | 3425 |
| 520 | Ga0207660_10063001 | 3300025917 | Bacteria | 2672 |
| 521 | Ga0207660_10343883 | 3300025917 | Bacteria | 1195 |
| 522 | Ga0207662_10002067 | 3300025918 | Bacteria | 9951 |
| 523 | Ga0207662_10455378 | 3300025918 | Bacteria | 875 |
| 524 | Ga0207662_10570154 | 3300025918 | Bacteria | 785 |
| 525 | Ga0207657_10000282 | 3300025919 | Bacteria | 54101 |
| 526 | Ga0207657_10032470 | 3300025919 | Bacteria | 4716 |
| 527 | Ga0207657_10569233 | 3300025919 | Bacteria | 885 |
| 528 | Ga0207657_10847256 | 3300025919 | Bacteria | 705 |
| 529 | Ga0207649_10028091 | 3300025920 | Bacteria | 3309 |
| 530 | Ga0207649_10216538 | 3300025920 | Bacteria | 1362 |
| 531 | Ga0207649_10887824 | 3300025920 | Bacteria | 698 |
| 532 | Ga0207652_10049921 | 3300025921 | Bacteria | 3583 |
| 533 | Ga0207652_10066636 | 3300025921 | Bacteria | 3121 |
| 534 | Ga0207652_10292555 | 3300025921 | Bacteria | 1469 |
| 535 | Ga0207652_11164199 | 3300025921 | Bacteria | 672 |
| 536 | Ga0207646_10246047 | 3300025922 | Bacteria | 1615 |
| 537 | Ga0207646_10737384 | 3300025922 | Bacteria | 880 |
| 538 | Ga0207681_10084571 | 3300025923 | Bacteria | 2249 |
| 539 | Ga0207681_10453056 | 3300025923 | Bacteria | 1044 |
| 540 | Ga0207694_10036374 | 3300025924 | Bacteria | 3779 |
| 541 | Ga0207694_10605319 | 3300025924 | Bacteria | 922 |
| 542 | Ga0207694_10866786 | 3300025924 | Bacteria | 763 |
| 543 | Ga0207650_10012981 | 3300025925 | Bacteria | 5760 |
| 544 | Ga0207659_10116815 | 3300025926 | Bacteria | 2038 |
| 545 | Ga0207659_10746692 | 3300025926 | Bacteria | 839 |
| 546 | Ga0207687_10003322 | 3300025927 | Bacteria | 10868 |
| 547 | Ga0207687_10205948 | 3300025927 | Bacteria | 1540 |
| 548 | Ga0207687_10695739 | 3300025927 | Bacteria | 862 |
| 549 | Ga0207700_10001020 | 3300025928 | Bacteria | 16161 |
| 550 | Ga0207700_10022703 | 3300025928 | Bacteria | 4309 |
| 551 | Ga0207700_10775292 | 3300025928 | Bacteria | 857 |
| 552 | Ga0207700_11051592 | 3300025928 | Bacteria | 728 |
| 553 | Ga0207700_11198204 | 3300025928 | Bacteria | 678 |
| 554 | Ga0207644_10171793 | 3300025931 | Bacteria | 1693 |
| 555 | Ga0207644_10176747 | 3300025931 | Bacteria | 1670 |
| 556 | Ga0207690_10073607 | 3300025932 | Bacteria | 2363 |
| 557 | Ga0207690_10180182 | 3300025932 | Bacteria | 1590 |
| 558 | Ga0207690_10271737 | 3300025932 | Bacteria | 1317 |
| 559 | Ga0207690_10316459 | 3300025932 | Bacteria | 1226 |
| 560 | Ga0207690_10628381 | 3300025932 | Bacteria | 878 |
| 561 | Ga0207690_10874361 | 3300025932 | Bacteria | 745 |
| 562 | Ga0207706_10000270 | 3300025933 | Bacteria | 56584 |
| 563 | Ga0207706_10058445 | 3300025933 | Bacteria | 3396 |
| 564 | Ga0207706_10107100 | 3300025933 | Bacteria | 2460 |
| 565 | Ga0207706_10631627 | 3300025933 | Bacteria | 918 |
| 566 | Ga0207706_10663538 | 3300025933 | Bacteria | 892 |
| 567 | Ga0207706_10857337 | 3300025933 | Bacteria | 769 |
| 568 | Ga0207686_10302879 | 3300025934 | Bacteria | 1188 |
| 569 | Ga0207709_10006830 | 3300025935 | Bacteria | 6384 |
| 570 | Ga0207709_10109558 | 3300025935 | Bacteria | 1844 |
| 571 | Ga0207709_10131695 | 3300025935 | Bacteria | 1705 |
| 572 | Ga0207709_10523121 | 3300025935 | Bacteria | 929 |
| 573 | Ga0207709_11133556 | 3300025935 | Bacteria | 643 |
| 574 | Ga0207670_10000642 | 3300025936 | Bacteria | 18604 |
| 575 | Ga0207670_10029223 | 3300025936 | Bacteria | 3509 |
| 576 | Ga0207670_10673025 | 3300025936 | Bacteria | 855 |
| 577 | Ga0207670_10721099 | 3300025936 | Bacteria | 827 |
| 578 | Ga0207670_10730585 | 3300025936 | Bacteria | 821 |
| 579 | Ga0207670_11415890 | 3300025936 | Bacteria | 590 |
| 580 | Ga0207669_10084859 | 3300025937 | Bacteria | 2042 |
| 581 | Ga0207669_10153276 | 3300025937 | Bacteria | 1617 |
| 582 | Ga0207669_10632456 | 3300025937 | Bacteria | 873 |
| 583 | Ga0207704_10059428 | 3300025938 | Bacteria | 2360 |
| 584 | Ga0207704_11243992 | 3300025938 | Bacteria | 635 |
| 585 | Ga0207665_10000898 | 3300025939 | Bacteria | 20034 |
| 586 | Ga0207665_10163210 | 3300025939 | Bacteria | 1604 |
| 587 | Ga0207665_10242056 | 3300025939 | Bacteria | 1329 |
| 588 | Ga0207691_10057833 | 3300025940 | Bacteria | 3528 |
| 589 | Ga0207691_11023799 | 3300025940 | Bacteria | 689 |
| 590 | Ga0207711_10003368 | 3300025941 | Bacteria | 13851 |
| 591 | Ga0207711_11126324 | 3300025941 | Bacteria | 726 |
| 592 | Ga0207689_10076718 | 3300025942 | Bacteria | 2747 |
| 593 | Ga0207689_10212476 | 3300025942 | Bacteria | 1598 |
| 594 | Ga0207689_10360679 | 3300025942 | Bacteria | 1208 |
| 595 | Ga0207689_10490702 | 3300025942 | Bacteria | 1029 |
| 596 | Ga0207661_10080767 | 3300025944 | Bacteria | 2684 |
| 597 | Ga0207679_10001363 | 3300025945 | Bacteria | 15383 |
| 598 | Ga0207679_10098094 | 3300025945 | Bacteria | 2284 |
| 599 | Ga0207679_11191740 | 3300025945 | Bacteria | 699 |
| 600 | Ga0207667_10035591 | 3300025949 | Bacteria | 5341 |
| 601 | Ga0207667_10078715 | 3300025949 | Bacteria | 3416 |
| 602 | Ga0207667_10221936 | 3300025949 | Bacteria | 1936 |
| 603 | Ga0207667_10586223 | 3300025949 | Bacteria | 1125 |
| 604 | Ga0207667_11412906 | 3300025949 | Bacteria | 669 |
| 605 | Ga0207667_11436670 | 3300025949 | Bacteria | 662 |
| 606 | Ga0207651_10223211 | 3300025960 | Bacteria | 1524 |
| 607 | Ga0207651_10770582 | 3300025960 | Bacteria | 851 |
| 608 | Ga0207712_10001373 | 3300025961 | Bacteria | 16667 |
| 609 | Ga0207712_10013838 | 3300025961 | Bacteria | 5174 |
| 610 | Ga0207712_11409388 | 3300025961 | Bacteria | 624 |
| 611 | Ga0207668_10006213 | 3300025972 | Bacteria | 7052 |
| 612 | Ga0207668_10095533 | 3300025972 | Bacteria | 2194 |
| 613 | Ga0207668_10126956 | 3300025972 | Bacteria | 1941 |
| 614 | Ga0207668_10718232 | 3300025972 | Bacteria | 879 |
| 615 | Ga0207668_11212400 | 3300025972 | Bacteria | 678 |
| 616 | Ga0207668_11431729 | 3300025972 | Bacteria | 623 |
| 617 | Ga0207668_11545160 | 3300025972 | Bacteria | 599 |
| 618 | Ga0207640_10078850 | 3300025981 | Bacteria | 2243 |
| 619 | Ga0207640_10093395 | 3300025981 | Bacteria | 2090 |
| 620 | Ga0207640_10324387 | 3300025981 | Bacteria | 1227 |
| 621 | Ga0207640_10417543 | 3300025981 | Bacteria | 1097 |
| 622 | Ga0207658_10029474 | 3300025986 | Bacteria | 3876 |
| 623 | Ga0207658_10234178 | 3300025986 | Bacteria | 1552 |
| 624 | Ga0207658_10268558 | 3300025986 | Bacteria | 1457 |
| 625 | Ga0207658_10399861 | 3300025986 | Bacteria | 1207 |
| 626 | Ga0207658_11214489 | 3300025986 | Bacteria | 689 |
| 627 | Ga0207677_10013013 | 3300026023 | Bacteria | 4808 |
| 628 | Ga0207677_10705069 | 3300026023 | Bacteria | 896 |
| 629 | Ga0207703_10004600 | 3300026035 | Bacteria | 11288 |
| 630 | Ga0207703_10073903 | 3300026035 | Bacteria | 2821 |
| 631 | Ga0207703_10107868 | 3300026035 | Bacteria | 2371 |
| 632 | Ga0207703_10185199 | 3300026035 | Bacteria | 1840 |
| 633 | Ga0207703_10598623 | 3300026035 | Bacteria | 1043 |
| 634 | Ga0207639_10037169 | 3300026041 | Bacteria | 3615 |
| 635 | Ga0207639_10039336 | 3300026041 | Bacteria | 3523 |
| 636 | Ga0207639_10866690 | 3300026041 | Bacteria | 843 |
| 637 | Ga0207639_11005581 | 3300026041 | Bacteria | 781 |
| 638 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 639 | Ga0207678_10001987 | 3300026067 | Bacteria | 18624 |
| 640 | Ga0207678_10061912 | 3300026067 | Bacteria | 3218 |
| 641 | Ga0207678_10110263 | 3300026067 | Bacteria | 2348 |
| 642 | Ga0207678_10165656 | 3300026067 | Bacteria | 1887 |
| 643 | Ga0207678_10421822 | 3300026067 | Bacteria | 1157 |
| 644 | Ga0207678_10900854 | 3300026067 | Bacteria | 782 |
| 645 | Ga0207708_10013264 | 3300026075 | Bacteria | 6154 |
| 646 | Ga0207708_10025042 | 3300026075 | Bacteria | 4514 |
| 647 | Ga0207708_10158056 | 3300026075 | Bacteria | 1788 |
| 648 | Ga0207708_10232694 | 3300026075 | Bacteria | 1480 |
| 649 | Ga0207708_10241021 | 3300026075 | Bacteria | 1454 |
| 650 | Ga0207708_10448455 | 3300026075 | Bacteria | 1074 |
| 651 | Ga0207708_10559405 | 3300026075 | Bacteria | 965 |
| 652 | Ga0207708_10662461 | 3300026075 | Bacteria | 889 |
| 653 | Ga0207702_10041809 | 3300026078 | Bacteria | 3843 |
| 654 | Ga0207702_10327512 | 3300026078 | Bacteria | 1460 |
| 655 | Ga0207641_10396814 | 3300026088 | Bacteria | 1324 |
| 656 | Ga0207641_10574227 | 3300026088 | Bacteria | 1102 |
| 657 | Ga0207641_11146540 | 3300026088 | Bacteria | 776 |
| 658 | Ga0207641_11671657 | 3300026088 | Bacteria | 639 |
| 659 | Ga0207648_10012357 | 3300026089 | Bacteria | 7993 |
| 660 | Ga0207648_10246208 | 3300026089 | Bacteria | 1593 |
| 661 | Ga0207648_10465295 | 3300026089 | Bacteria | 1153 |
| 662 | Ga0207648_10504985 | 3300026089 | Bacteria | 1107 |
| 663 | Ga0207648_10870603 | 3300026089 | Bacteria | 841 |
| 664 | Ga0207676_10028970 | 3300026095 | Bacteria | 4141 |
| 665 | Ga0207676_10132645 | 3300026095 | Bacteria | 2120 |
| 666 | Ga0207676_10415696 | 3300026095 | Bacteria | 1260 |
| 667 | Ga0207674_10022215 | 3300026116 | Bacteria | 6819 |
| 668 | Ga0207674_10047521 | 3300026116 | Bacteria | 4398 |
| 669 | Ga0207674_10404751 | 3300026116 | Bacteria | 1319 |
| 670 | Ga0207675_100001292 | 3300026118 | Bacteria | 25099 |
| 671 | Ga0207675_100062290 | 3300026118 | Bacteria | 3483 |
| 672 | Ga0207675_100203980 | 3300026118 | Bacteria | 1900 |
| 673 | Ga0207675_100331062 | 3300026118 | Bacteria | 1489 |
| 674 | Ga0207675_100572559 | 3300026118 | Bacteria | 1130 |
| 675 | Ga0207683_10001738 | 3300026121 | Bacteria | 19398 |
| 676 | Ga0207683_10062468 | 3300026121 | Bacteria | 3280 |
| 677 | Ga0207698_10016384 | 3300026142 | Bacteria | 4992 |
| 678 | Ga0207698_10105982 | 3300026142 | Bacteria | 2343 |
| 679 | Ga0209983_1050263 | 3300027665 | Bacteria | 912 |
| 680 | Ga0209998_10024125 | 3300027717 | Bacteria | 1318 |
| 681 | Ga0209998_10090624 | 3300027717 | Bacteria | 749 |
| 682 | Ga0209813_10007002 | 3300027866 | Bacteria | 2799 |
| 683 | Ga0209813_10015540 | 3300027866 | Bacteria | 2065 |
| 684 | Ga0209813_10015864 | 3300027866 | Bacteria | 2048 |
| 685 | Ga0209974_10159032 | 3300027876 | Bacteria | 819 |
| 686 | Ga0207428_10063093 | 3300027907 | Bacteria | 2928 |
| 687 | Ga0207428_10091218 | 3300027907 | Bacteria | 2365 |
| 688 | Ga0207428_10126762 | 3300027907 | Bacteria | 1955 |
| 689 | Ga0207428_10142958 | 3300027907 | Bacteria | 1825 |
| 690 | Ga0207428_10397050 | 3300027907 | Bacteria | 1010 |
| 691 | Ga0207428_10455529 | 3300027907 | Bacteria | 932 |
| 692 | Ga0268266_10030323 | 3300028379 | Bacteria | 4595 |
| 693 | Ga0268266_10317764 | 3300028379 | Bacteria | 1457 |
| 694 | Ga0268266_10466616 | 3300028379 | Bacteria | 1202 |
| 695 | Ga0268266_10777071 | 3300028379 | Bacteria | 925 |
| 696 | Ga0268266_11289615 | 3300028379 | Bacteria | 706 |
| 697 | Ga0268265_10002634 | 3300028380 | Bacteria | 13325 |
| 698 | Ga0268265_10259078 | 3300028380 | Bacteria | 1545 |
| 699 | Ga0268265_10788200 | 3300028380 | Bacteria | 925 |
| 700 | Ga0268264_10062737 | 3300028381 | Bacteria | 3122 |
| 701 | Ga0268264_10546665 | 3300028381 | Bacteria | 1135 |
| 702 | Ga0268264_10555818 | 3300028381 | Bacteria | 1126 |
| 703 | Ga0265760_10094842 | 3300031090 | Bacteria | 938 |
| 704 | Ga0265330_10049935 | 3300031235 | Bacteria | 1835 |
| 705 | Ga0265330_10087553 | 3300031235 | Bacteria | 1338 |
| 706 | Ga0265332_10089584 | 3300031238 | Bacteria | 1302 |
| 707 | Ga0265332_10386488 | 3300031238 | Bacteria | 578 |
| 708 | Ga0265328_10006537 | 3300031239 | Bacteria | 4918 |
| 709 | Ga0265328_10098118 | 3300031239 | Bacteria | 1084 |
| 710 | Ga0265325_10038876 | 3300031241 | Bacteria | 2508 |
| 711 | Ga0265340_10256356 | 3300031247 | Bacteria | 779 |
| 712 | Ga0265339_10004332 | 3300031249 | Bacteria | 9696 |
| 713 | Ga0265331_10004690 | 3300031250 | Bacteria | 8465 |
| 714 | Ga0265331_10033198 | 3300031250 | Bacteria | 2553 |
| 715 | Ga0265331_10077686 | 3300031250 | Bacteria | 1546 |
| 716 | Ga0265316_10028405 | 3300031344 | Bacteria | 4616 |
| 717 | Ga0265316_10049860 | 3300031344 | Bacteria | 3296 |
| 718 | Ga0307513_10051533 | 3300031456 | Bacteria | 4439 |
| 719 | Ga0265313_10099214 | 3300031595 | Bacteria | 1295 |
| 720 | Ga0316575_10041479 | 3300031665 | Bacteria | 1820 |
| 721 | Ga0316579_10033148 | 3300031691 | Bacteria | 2370 |
| 722 | Ga0265314_10011275 | 3300031711 | Bacteria | 7393 |
| 723 | Ga0265314_10068619 | 3300031711 | Bacteria | 2383 |
| 724 | Ga0265342_10560019 | 3300031712 | Bacteria | 579 |
| 725 | Ga0316576_10024290 | 3300031727 | Bacteria | 4230 |
| 726 | Ga0316576_10079460 | 3300031727 | Bacteria | 2431 |
| 727 | Ga0316578_10109648 | 3300031728 | Bacteria | 1657 |
| 728 | Ga0316578_10110133 | 3300031728 | Bacteria | 1653 |
| 729 | Ga0307516_10044963 | 3300031730 | Bacteria | 4365 |
| 730 | Ga0316577_10009470 | 3300031733 | Bacteria | 5240 |
| 731 | Ga0307413_10754168 | 3300031824 | Bacteria | 814 |
| 732 | Ga0307410_10621707 | 3300031852 | Bacteria | 903 |
| 733 | Ga0307406_10036177 | 3300031901 | Bacteria | 3040 |
| 734 | Ga0307407_10643051 | 3300031903 | Bacteria | 794 |
| 735 | Ga0307412_10073835 | 3300031911 | Bacteria | 2335 |
| 736 | Ga0307412_10188353 | 3300031911 | Bacteria | 1558 |
| 737 | Ga0307412_11157684 | 3300031911 | Bacteria | 691 |
| 738 | Ga0307415_100310957 | 3300032126 | Bacteria | 1309 |
| 739 | Ga0307415_101727444 | 3300032126 | Bacteria | 604 |
| 740 | Ga0316583_10006475 | 3300032133 | Bacteria | 4208 |
| 741 | Ga0316585_10000354 | 3300032137 | Bacteria | 10487 |
| 742 | Ga0316580_10004849 | 3300032139 | Bacteria | 3911 |
| 743 | Ga0316593_10004600 | 3300032168 | Bacteria | 3557 |
| 744 | Ga0316593_10137614 | 3300032168 | Bacteria | 884 |
| 745 | Ga0316593_10334379 | 3300032168 | Bacteria | 578 |
| 746 | Ga0316592_1000038 | 3300033524 | Bacteria | 10480 |
| 747 | Ga0316586_1000750 | 3300033527 | Bacteria | 3328 |
| 748 | Ga0316587_1026022 | 3300033529 | Bacteria | 1018 |
| 749 | Ga0316596_1000071 | 3300033541 | Bacteria | 11803 |
| 750 | Ga0316596_1000341 | 3300033541 | Bacteria | 7619 |
| 751 | Ga0373958_0002782 | 3300034819 | Bacteria | 2482 |
| 752 | Ga0373958_0007763 | 3300034819 | Bacteria | 1719 |
| 753 | Ga0373958_0199378 | 3300034819 | Bacteria | 523 |
| 754 | Ga0373959_0092431 | 3300034820 | Bacteria | 711 |
| 755 | Ga0373959_0153067 | 3300034820 | Bacteria | 584 |
| 756 | Ga0373928_0022650 | 3300035084 | Bacteria | 1334 |
| 757 | Ga0373928_0121457 | 3300035084 | Bacteria | 700 |
| 758 | Ga0373929_0039124 | 3300035085 | Bacteria | 1046 |
| 759 | Ga0373934_0059436 | 3300035086 | Bacteria | 1522 |
| 760 | Ga0373940_0094714 | 3300035088 | Bacteria | 899 |
| 761 | Ga0373944_0016534 | 3300035089 | Bacteria | 2082 |
| 762 | Ga0373944_0194227 | 3300035089 | Bacteria | 733 |
| 763 | Ga0373949_0005456 | 3300035090 | Bacteria | 2835 |
| 764 | Ga0373949_0007190 | 3300035090 | Bacteria | 2441 |
| 765 | Ga0373951_0026168 | 3300035091 | Bacteria | 1358 |
| 766 | Ga0373951_0026176 | 3300035091 | Bacteria | 1358 |
| 767 | Ga0373951_0098987 | 3300035091 | Bacteria | 773 |
| 768 | Ga0373951_0115755 | 3300035091 | Bacteria | 725 |
| 769 | Ga0373923_0036411 | 3300035111 | Bacteria | 2009 |
| 770 | Ga0373932_0021762 | 3300035112 | Bacteria | 1696 |
| 771 | Ga0373932_0170764 | 3300035112 | Bacteria | 757 |
| 772 | Ga0373932_0312795 | 3300035112 | Bacteria | 589 |
| 773 | Ga0373939_0010771 | 3300035114 | Bacteria | 2295 |
| 774 | Ga0373939_0140327 | 3300035114 | Bacteria | 871 |
| 775 | Ga0373941_0016203 | 3300035115 | Bacteria | 2022 |
| 776 | Ga0373953_0012782 | 3300035117 | Bacteria | 2981 |
| 777 | Ga0373954_0047545 | 3300035118 | Bacteria | 2008 |
| 778 | Ga0373954_0198084 | 3300035118 | Bacteria | 987 |
| 779 | Ga0373956_0065806 | 3300035119 | Bacteria | 1647 |
| 780 | Ga0373957_0056667 | 3300035120 | Bacteria | 1509 |
| 781 | Ga0373957_0102117 | 3300035120 | Bacteria | 1149 |
| 782 | Ga0373960_0043759 | 3300035121 | Bacteria | 1305 |
| 783 | Ga0373960_0171541 | 3300035121 | Bacteria | 752 |
| 784 | Ga0373960_0298427 | 3300035121 | Bacteria | 598 |
| 785 | Ga0373943_0101641 | 3300035170 | Bacteria | 1504 |
| 786 | Ga0373955_0085186 | 3300035172 | Bacteria | 1793 |
| 787 | Ga0373942_0030108 | 3300035207 | Bacteria | 1428 |
| 788 | Ga0373961_0056190 | 3300035241 | Bacteria | 1182 |
| 789 | Ga0373961_0115072 | 3300035241 | Bacteria | 885 |
| 790 | Ga0373962_0002684 | 3300035242 | Bacteria | 4233 |
| 791 | Ga0373962_0153953 | 3300035242 | Bacteria | 754 |
| 792 | Ga0316574_0199041 | 3300035398 | Bacteria | 1287 |
| 793 | Ga0316574_0440126 | 3300035398 | Bacteria | 817 |
| 794 | Ga0373924_0046598 | 3300035410 | Bacteria | 1787 |
| 795 | Ga0373931_0000685 | 3300035691 | Bacteria | 14057 |
| 796 | Ga0373931_0008300 | 3300035691 | Bacteria | 4920 |
| 797 | Ga0373931_0011519 | 3300035691 | Bacteria | 4275 |
| 798 | Ga0373931_0037963 | 3300035691 | Bacteria | 2517 |
| 799 | Ga0373931_0109918 | 3300035691 | Bacteria | 1563 |
| 800 | Ga0373935_0195031 | 3300035692 | Bacteria | 1397 |
| 801 | Ga0373935_0244761 | 3300035692 | Bacteria | 1253 |
| 802 | Ga0373935_0381976 | 3300035692 | Bacteria | 1009 |
| 803 | Ga0373927_0002605 | 3300035695 | Bacteria | 13149 |
| 804 | Ga0373927_0023112 | 3300035695 | Bacteria | 4072 |
| 805 | Ga0373927_0028547 | 3300035695 | Bacteria | 3640 |
| 806 | Ga0373933_0018678 | 3300035724 | Bacteria | 3902 |
| 807 | Ga0373933_1098334 | 3300035724 | Bacteria | 524 |
| 808 | Ga0373947_0008559 | 3300035725 | Bacteria | 5892 |
| 809 | Ga0373947_0083872 | 3300035725 | Bacteria | 1977 |
| 810 | Ga0373947_0376656 | 3300035725 | Bacteria | 955 |
| 811 | Ga0373947_0826018 | 3300035725 | Bacteria | 633 |
| 812 | Ga0373937_0137277 | 3300036401 | Bacteria | 2287 |
| 813 | Ga0373937_0139978 | 3300036401 | Bacteria | 2263 |
| 814 | Ga0373937_0692262 | 3300036401 | Bacteria | 966 |
| 815 | Ga0373937_0876545 | 3300036401 | Bacteria | 846 |
| 816 | Ga0310112_011278 | 3300036458 | Bacteria | 1276 |
| 817 | Ga0316582_0193869 | 3300036647 | Bacteria | 1384 |
| 818 | Ga0316584_0001985 | 3300036712 | Bacteria | 12764 |
| 819 | Ga0316584_0030059 | 3300036712 | Bacteria | 4012 |
| 820 | Ga0373925_0045923 | 3300037068 | Bacteria | 3246 |
| 821 | Ga0373925_0052738 | 3300037068 | Bacteria | 3039 |
| 822 | Ga0373925_0148264 | 3300037068 | Bacteria | 1840 |
| 823 | Ga0373925_0836978 | 3300037068 | Bacteria | 758 |
| 824 | Ga0373925_1363849 | 3300037068 | Bacteria | 581 |
| 825 | Ga0395899_0457765 | 3300037312 | Bacteria | 834 |
| 826 | Ga0395900_0065470 | 3300037418 | Bacteria | 3734 |
| 827 | Ga0395898_0004337 | 3300037466 | Bacteria | 15530 |
| 828 | Ga0395905_0002506 | 3300037471 | Bacteria | 20297 |
| 829 | Ga0316581_0015698 | 3300037588 | Bacteria | 2167 |
| 830 | Ga0395901_0002674 | 3300038443 | Bacteria | 17986 |
| 831 | Ga0400483_133534 | 3300039062 | Bacteria | 1191 |
| 832 | Ga0400483_267907 | 3300039062 | Bacteria | 2246 |
| 833 | Ga0400489_21280 | 3300039093 | Bacteria | 3406 |
| 834 | Ga0436365_0373305 | 3300039437 | Bacteria | 931 |
| 835 | Ga0436365_1239138 | 3300039437 | Bacteria | 8147 |
| 836 | Ga0436360_0571027 | 3300039438 | Bacteria | 789 |
| 837 | Ga0436360_0645792 | 3300039438 | Bacteria | 862 |
| 838 | Ga0436360_0817917 | 3300039438 | Bacteria | 3375 |
| 839 | Ga0436360_1044379 | 3300039438 | Bacteria | 1527 |
| 840 | Ga0436360_1063772 | 3300039438 | Bacteria | 1452 |
| 841 | Ga0436361_0083999 | 3300039447 | Bacteria | 1653 |
| 842 | Ga0436361_0430933 | 3300039447 | Bacteria | 1334 |
| 843 | Ga0436361_0586937 | 3300039447 | Bacteria | 1952 |
| 844 | Ga0436361_0611695 | 3300039447 | Bacteria | 1353 |
| 845 | Ga0436362_0086357 | 3300039453 | Bacteria | 960 |
| 846 | Ga0436362_0587836 | 3300039453 | Bacteria | 969 |
| 847 | Ga0439450_121751 | 3300042008 | Bacteria | 672 |
| 848 | Ga0439435_0081480 | 3300042436 | Bacteria | 972 |
| 849 | Ga0439444_0072780 | 3300042437 | Bacteria | 739 |
| 850 | Ga0451577_0000008 | 3300042876 | Bacteria | 692992 |
| 851 | Ga0451577_0083132 | 3300042876 | Bacteria | 2856 |
| 852 | Ga0451577_0414523 | 3300042876 | Bacteria | 1223 |
| 853 | Ga0453683_0197226 | 3300044673 | Bacteria | 1278 |
| 854 | Ga0453683_1113283 | 3300044673 | Bacteria | 527 |
| 855 | Ga0466966_0477214 | 3300044684 | Bacteria | 750 |
| 856 | Ga0453684_0000032 | 3300044712 | Bacteria | 745626 |
| 857 | Ga0453684_0000652 | 3300044712 | Bacteria | 125090 |
| 858 | Ga0453684_0003639 | 3300044712 | Bacteria | 34251 |
| 859 | Ga0453684_0005247 | 3300044712 | Bacteria | 25923 |
| 860 | Ga0453684_0008205 | 3300044712 | Bacteria | 18833 |
| 861 | Ga0453684_0010967 | 3300044712 | Bacteria | 15319 |
| 862 | Ga0453684_0597072 | 3300044712 | Unclassified | 1210 |
| 863 | Ga0466968_0125467 | 3300044735 | Bacteria | 1164 |
| 864 | Ga0466970_0306312 | 3300044765 | Bacteria | 897 |
| 865 | Ga0451576_0060264 | 3300045051 | Unclassified | 3960 |
| 866 | Ga0451576_0123410 | 3300045051 | Bacteria | 2697 |
| 867 | Ga0451576_0170881 | 3300045051 | Bacteria | 2269 |
| 868 | Ga0495592_0487702 | 3300046454 | Bacteria | 767 |
| 869 | Ga0495603_0000644 | 3300046455 | Bacteria | 19646 |
| 870 | Ga0495590_0179042 | 3300046457 | Bacteria | 775 |
| 871 | Ga0495629_0000177 | 3300046459 | Bacteria | 56906 |
| 872 | Ga0495638_0201963 | 3300046460 | Bacteria | 1122 |
| 873 | Ga0495638_0230829 | 3300046460 | Bacteria | 1030 |
| 874 | Ga0495638_0341699 | 3300046460 | Bacteria | 793 |
| 875 | Ga0495651_0385215 | 3300046462 | Bacteria | 919 |
| 876 | Ga0495580_0000498 | 3300046472 | Bacteria | 32908 |
| 877 | Ga0495580_0054202 | 3300046472 | Bacteria | 2829 |
| 878 | Ga0495580_0148738 | 3300046472 | Bacteria | 1623 |
| 879 | Ga0495580_0218192 | 3300046472 | Bacteria | 1311 |
| 880 | Ga0495582_0000185 | 3300046473 | Bacteria | 34065 |
| 881 | Ga0495639_0002889 | 3300046475 | Bacteria | 7477 |
| 882 | Ga0495664_0155753 | 3300046477 | Bacteria | 1386 |
| 883 | Ga0495584_0019937 | 3300046491 | Bacteria | 3407 |
| 884 | Ga0495584_0456114 | 3300046491 | Bacteria | 650 |
| 885 | Ga0495594_0000023 | 3300046499 | Bacteria | 70363 |
| 886 | Ga0495607_0138995 | 3300046501 | Bacteria | 1255 |
| 887 | Ga0495583_0350624 | 3300046506 | Bacteria | 582 |
| 888 | Ga0495608_0258169 | 3300046511 | Bacteria | 1085 |
| 889 | Ga0495628_0603188 | 3300046516 | Bacteria | 784 |
| 890 | Ga0495631_0323793 | 3300046518 | Bacteria | 656 |
| 891 | Ga0495643_0178632 | 3300046522 | Bacteria | 1033 |
| 892 | Ga0495644_0097060 | 3300046523 | Bacteria | 1114 |
| 893 | Ga0495644_0185129 | 3300046523 | Bacteria | 801 |
| 894 | Ga0495666_0089895 | 3300046526 | Bacteria | 1449 |
| 895 | Ga0495666_0302972 | 3300046526 | Bacteria | 723 |
| 896 | Ga0495652_0108553 | 3300046529 | Bacteria | 2236 |
| 897 | Ga0495654_0005576 | 3300046530 | Bacteria | 7288 |
| 898 | Ga0495665_0158714 | 3300046531 | Bacteria | 1179 |
| 899 | Ga0495640_0536766 | 3300046533 | Bacteria | 710 |
| 900 | Ga0495640_0667962 | 3300046533 | Bacteria | 625 |
| 901 | Ga0495587_0060127 | 3300046536 | Bacteria | 2229 |
| 902 | Ga0495609_0264142 | 3300046538 | Bacteria | 707 |
| 903 | Ga0495622_0012059 | 3300046557 | Bacteria | 3996 |
| 904 | Ga0495633_0160999 | 3300046558 | Bacteria | 1035 |
| 905 | Ga0495667_0047741 | 3300046559 | Bacteria | 2828 |
| 906 | Ga0495668_0053374 | 3300046616 | Bacteria | 2235 |
| 907 | Ga0495634_0033371 | 3300046642 | Bacteria | 3538 |
| 908 | Ga0495625_0151632 | 3300046660 | Bacteria | 1558 |
| 909 | Ga0495635_0294666 | 3300046663 | Bacteria | 1088 |
| 910 | Ga0495659_0029200 | 3300046664 | Bacteria | 1913 |
| 911 | Ga0495661_0179077 | 3300046665 | Bacteria | 1125 |
| 912 | Ga0495588_0112637 | 3300046674 | Bacteria | 1433 |
| 913 | Ga0495657_0079161 | 3300046675 | Bacteria | 2129 |
| 914 | Ga0495657_0900145 | 3300046675 | Bacteria | 503 |
| 915 | Ga0495647_0021652 | 3300046681 | Bacteria | 2316 |
| 916 | Ga0495658_0002288 | 3300046683 | Bacteria | 9659 |
| 917 | Ga0495613_0000209 | 3300046689 | Bacteria | 57674 |
| 918 | Ga0495624_0244080 | 3300046690 | Bacteria | 1087 |
| 919 | Ga0495670_0233670 | 3300046691 | Bacteria | 978 |
| 920 | Ga0495670_0407470 | 3300046691 | Bacteria | 735 |
| 921 | Ga0495671_0452285 | 3300046692 | Bacteria | 614 |
| 922 | Ga0495589_0216761 | 3300046794 | Bacteria | 900 |
| 923 | Ga0495660_0165098 | 3300046810 | Bacteria | 1083 |
| 924 | Ga0495581_0001042 | 3300047315 | Bacteria | 15004 |
| 925 | Ga0495604_0087435 | 3300047317 | Bacteria | 2321 |
| 926 | Ga0495672_0127853 | 3300047320 | Bacteria | 1341 |
| 927 | Ga0495672_0243898 | 3300047320 | Bacteria | 876 |
| 928 | Ga0495676_0013652 | 3300047321 | Bacteria | 7289 |
| 929 | Ga0495676_0595926 | 3300047321 | Bacteria | 720 |
| 930 | Ga0495680_0823796 | 3300047322 | Bacteria | 605 |
| 931 | Ga0495683_0157375 | 3300047323 | Bacteria | 1053 |
| 932 | Ga0495675_0066595 | 3300047444 | Bacteria | 2277 |
| 933 | Ga0495677_0056224 | 3300047445 | Bacteria | 1453 |
| 934 | Ga0495684_0479018 | 3300047471 | Bacteria | 860 |
| 935 | Ga0495593_0000822 | 3300047673 | Bacteria | 18013 |
| 936 | Ga0495614_0000618 | 3300048089 | Bacteria | 14895 |
| 937 | Ga0495626_0180140 | 3300048091 | Bacteria | 876 |
| 938 | Ga0496100_0011664 | 3300048903 | Bacteria | 5008 |
| 939 | Ga0496100_0063587 | 3300048903 | Bacteria | 2439 |
| 940 | Ga0496100_0072381 | 3300048903 | Bacteria | 2304 |
| 941 | Ga0496100_0074061 | 3300048903 | Bacteria | 2280 |
| 942 | Ga0496100_0131383 | 3300048903 | Bacteria | 1764 |
| 943 | Ga0496100_0540612 | 3300048903 | Bacteria | 901 |
| 944 | Ga0496100_0562191 | 3300048903 | Bacteria | 883 |
| 945 | Ga0496101_0009865 | 3300048904 | Bacteria | 6290 |
| 946 | Ga0496101_0014103 | 3300048904 | Bacteria | 5366 |
| 947 | Ga0496101_0158638 | 3300048904 | Bacteria | 1734 |
| 948 | Ga0496101_0180244 | 3300048904 | Bacteria | 1626 |
| 949 | Ga0496101_0222451 | 3300048904 | Bacteria | 1465 |
| 950 | Ga0496101_0400471 | 3300048904 | Bacteria | 1081 |
| 951 | Ga0496101_0529491 | 3300048904 | Bacteria | 931 |
| 952 | Ga0496101_0746767 | 3300048904 | Bacteria | 772 |
| 953 | Ga0496101_0781035 | 3300048904 | Bacteria | 753 |
| 954 | Ga0496101_0861968 | 3300048904 | Bacteria | 713 |
| 955 | Ga0496101_1278358 | 3300048904 | Bacteria | 574 |
| 956 | Ga0496102_0003666 | 3300048905 | Bacteria | 12983 |
| 957 | Ga0496102_0021232 | 3300048905 | Bacteria | 5742 |
| 958 | Ga0496102_0037637 | 3300048905 | Bacteria | 4365 |
| 959 | Ga0496102_0054619 | 3300048905 | Bacteria | 3643 |
| 960 | Ga0496102_0086307 | 3300048905 | Bacteria | 2898 |
| 961 | Ga0496102_0142179 | 3300048905 | Bacteria | 2250 |
| 962 | Ga0496102_0167272 | 3300048905 | Bacteria | 2069 |
| 963 | Ga0496102_0258273 | 3300048905 | Bacteria | 1642 |
| 964 | Ga0496102_0883914 | 3300048905 | Bacteria | 815 |
| 965 | Ga0496103_0004549 | 3300048906 | Bacteria | 8395 |
| 966 | Ga0496103_0053968 | 3300048906 | Bacteria | 2491 |
| 967 | Ga0496103_0054499 | 3300048906 | Bacteria | 2478 |
| 968 | Ga0496103_0085750 | 3300048906 | Bacteria | 1984 |
| 969 | Ga0496103_0137323 | 3300048906 | Bacteria | 1563 |
| 970 | Ga0496103_0143434 | 3300048906 | Bacteria | 1528 |
| 971 | Ga0496103_0176728 | 3300048906 | Bacteria | 1372 |
| 972 | Ga0496103_0886414 | 3300048906 | Bacteria | 560 |
| 973 | Ga0496104_0000216 | 3300048907 | Bacteria | 50674 |
| 974 | Ga0496104_0002392 | 3300048907 | Bacteria | 16158 |
| 975 | Ga0496104_0011428 | 3300048907 | Bacteria | 7952 |
| 976 | Ga0496104_0047709 | 3300048907 | Bacteria | 4037 |
| 977 | Ga0496104_0137839 | 3300048907 | Bacteria | 2344 |
| 978 | Ga0496104_0164226 | 3300048907 | Bacteria | 2129 |
| 979 | Ga0496104_0356915 | 3300048907 | Bacteria | 1374 |
| 980 | Ga0496104_0533539 | 3300048907 | Bacteria | 1084 |
| 981 | Ga0496104_0784088 | 3300048907 | Bacteria | 859 |
| 982 | Ga0496104_1212750 | 3300048907 | Bacteria | 658 |
| 983 | Ga0496105_0006833 | 3300048908 | Bacteria | 8775 |
| 984 | Ga0496105_0007408 | 3300048908 | Bacteria | 8492 |
| 985 | Ga0496105_0181573 | 3300048908 | Bacteria | 1723 |
| 986 | Ga0496105_0195984 | 3300048908 | Bacteria | 1650 |
| 987 | Ga0496105_0248773 | 3300048908 | Bacteria | 1441 |
| 988 | Ga0496105_0355062 | 3300048908 | Bacteria | 1170 |
| 989 | Ga0496105_0790024 | 3300048908 | Bacteria | 722 |
| 990 | Ga0496105_1339131 | 3300048908 | Bacteria | 521 |
| 991 | Ga0496106_0014032 | 3300048909 | Bacteria | 5923 |
| 992 | Ga0496106_0020151 | 3300048909 | Bacteria | 4947 |
| 993 | Ga0496106_0034165 | 3300048909 | Bacteria | 3797 |
| 994 | Ga0496106_0153542 | 3300048909 | Bacteria | 1817 |
| 995 | Ga0496106_0203109 | 3300048909 | Bacteria | 1577 |
| 996 | Ga0496106_0213960 | 3300048909 | Bacteria | 1536 |
| 997 | Ga0496106_0503269 | 3300048909 | Bacteria | 973 |
| 998 | Ga0496106_1330790 | 3300048909 | Bacteria | 557 |
| 999 | Ga0496107_0002978 | 3300048910 | Bacteria | 11215 |
| 1000 | Ga0496107_0051098 | 3300048910 | Bacteria | 2981 |
| 1001 | Ga0496107_0087501 | 3300048910 | Bacteria | 2274 |
| 1002 | Ga0496107_0128296 | 3300048910 | Bacteria | 1871 |
| 1003 | Ga0496107_0161717 | 3300048910 | Bacteria | 1659 |
| 1004 | Ga0496107_0673999 | 3300048910 | Bacteria | 761 |
| 1005 | Ga0496108_0029327 | 3300048911 | Bacteria | 4555 |
| 1006 | Ga0496108_0041617 | 3300048911 | Bacteria | 3836 |
| 1007 | Ga0496108_0152896 | 3300048911 | Bacteria | 1992 |
| 1008 | Ga0496108_0217641 | 3300048911 | Bacteria | 1659 |
| 1009 | Ga0496108_0286212 | 3300048911 | Bacteria | 1435 |
| 1010 | Ga0496108_0314137 | 3300048911 | Bacteria | 1365 |
| 1011 | Ga0496108_0752042 | 3300048911 | Bacteria | 843 |
| 1012 | Ga0496108_0895023 | 3300048911 | Bacteria | 762 |
| 1013 | Ga0496108_1160598 | 3300048911 | Bacteria | 654 |
| 1014 | Ga0496109_0005439 | 3300048912 | Bacteria | 10654 |
| 1015 | Ga0496109_0019124 | 3300048912 | Bacteria | 6033 |
| 1016 | Ga0496109_0030933 | 3300048912 | Bacteria | 4799 |
| 1017 | Ga0496109_0046146 | 3300048912 | Bacteria | 3957 |
| 1018 | Ga0496109_0060268 | 3300048912 | Bacteria | 3468 |
| 1019 | Ga0496109_0185742 | 3300048912 | Bacteria | 1953 |
| 1020 | Ga0496109_0226901 | 3300048912 | Bacteria | 1757 |
| 1021 | Ga0496109_0381404 | 3300048912 | Bacteria | 1332 |
| 1022 | Ga0496110_0007047 | 3300048913 | Bacteria | 8943 |
| 1023 | Ga0496110_0024815 | 3300048913 | Bacteria | 5115 |
| 1024 | Ga0496110_0033078 | 3300048913 | Bacteria | 4471 |
| 1025 | Ga0496110_0035233 | 3300048913 | Bacteria | 4341 |
| 1026 | Ga0496110_0080612 | 3300048913 | Bacteria | 2901 |
| 1027 | Ga0496110_0092172 | 3300048913 | Bacteria | 2711 |
| 1028 | Ga0496110_0197312 | 3300048913 | Bacteria | 1828 |
| 1029 | Ga0496110_0397583 | 3300048913 | Bacteria | 1256 |
| 1030 | Ga0496110_0474394 | 3300048913 | Bacteria | 1140 |
| 1031 | Ga0496111_0000831 | 3300048914 | Bacteria | 16630 |
| 1032 | Ga0496111_0021719 | 3300048914 | Bacteria | 4484 |
| 1033 | Ga0496111_0036697 | 3300048914 | Bacteria | 3505 |
| 1034 | Ga0496111_0091964 | 3300048914 | Bacteria | 2223 |
| 1035 | Ga0496111_0210073 | 3300048914 | Bacteria | 1446 |
| 1036 | Ga0496111_0335788 | 3300048914 | Bacteria | 1119 |
| 1037 | Ga0496112_0013078 | 3300048915 | Bacteria | 7656 |
| 1038 | Ga0496112_0046858 | 3300048915 | Bacteria | 4241 |
| 1039 | Ga0496112_0054785 | 3300048915 | Bacteria | 3919 |
| 1040 | Ga0496112_0064649 | 3300048915 | Bacteria | 3610 |
| 1041 | Ga0496112_0068039 | 3300048915 | Bacteria | 3516 |
| 1042 | Ga0496112_0290465 | 3300048915 | Bacteria | 1581 |
| 1043 | Ga0496112_0675044 | 3300048915 | Bacteria | 962 |
| 1044 | Ga0496113_0034328 | 3300048916 | Bacteria | 3701 |
| 1045 | Ga0496113_0067510 | 3300048916 | Bacteria | 2712 |
| 1046 | Ga0496113_0210369 | 3300048916 | Bacteria | 1548 |
| 1047 | Ga0496114_0006659 | 3300048917 | Bacteria | 9106 |
| 1048 | Ga0496114_0049973 | 3300048917 | Bacteria | 3480 |
| 1049 | Ga0496114_0109813 | 3300048917 | Bacteria | 2362 |
| 1050 | Ga0496114_0544702 | 3300048917 | Bacteria | 1025 |
| 1051 | Ga0496114_0854744 | 3300048917 | Bacteria | 790 |
| 1052 | Ga0496114_1061057 | 3300048917 | Bacteria | 694 |
| 1053 | Ga0496115_0027506 | 3300048918 | Bacteria | 4449 |
| 1054 | Ga0496115_0028276 | 3300048918 | Bacteria | 4394 |
| 1055 | Ga0496115_0035138 | 3300048918 | Bacteria | 3964 |
| 1056 | Ga0496115_0089669 | 3300048918 | Bacteria | 2511 |
| 1057 | Ga0496115_0108912 | 3300048918 | Bacteria | 2274 |
| 1058 | Ga0496115_0213094 | 3300048918 | Bacteria | 1595 |
| 1059 | Ga0496115_0300579 | 3300048918 | Bacteria | 1315 |
| 1060 | Ga0496115_0572119 | 3300048918 | Bacteria | 901 |
| 1061 | Ga0496115_0921778 | 3300048918 | Bacteria | 672 |
| 1062 | Ga0496122_0002761 | 3300048925 | Bacteria | 24237 |
| 1063 | Ga0496123_0002923 | 3300048926 | Bacteria | 19986 |
| 1064 | Ga0496124_0104578 | 3300048927 | Bacteria | 2289 |
| 1065 | Ga0496124_0155757 | 3300048927 | Bacteria | 1787 |
| 1066 | Ga0496124_0174143 | 3300048927 | Bacteria | 1663 |
| 1067 | Ga0496126_0229728 | 3300048929 | Bacteria | 1555 |
| 1068 | Ga0496126_0723637 | 3300048929 | Bacteria | 771 |
| 1069 | Ga0496126_0739606 | 3300048929 | Bacteria | 760 |
| 1070 | Ga0501308_036951 | 3300049128 | Bacteria | 676 |
| 1071 | Ga0501031_0015742 | 3300049568 | Bacteria | 4909 |
| 1072 | Ga0501031_0124425 | 3300049568 | Bacteria | 1684 |
| 1073 | Ga0501031_0817588 | 3300049568 | Bacteria | 597 |
| 1074 | Ga0501032_0026968 | 3300049569 | Bacteria | 3950 |
| 1075 | Ga0501032_0180814 | 3300049569 | Bacteria | 1381 |
| 1076 | Ga0501032_0403613 | 3300049569 | Bacteria | 878 |
| 1077 | Ga0501032_0413034 | 3300049569 | Bacteria | 866 |
| 1078 | Ga0501032_0494865 | 3300049569 | Bacteria | 782 |
| 1079 | Ga0501033_0637546 | 3300049570 | Bacteria | 729 |
| 1080 | Ga0501033_0688421 | 3300049570 | Bacteria | 696 |
| 1081 | Ga0501033_0912419 | 3300049570 | Bacteria | 590 |
| 1082 | Ga0501033_0940705 | 3300049570 | Bacteria | 579 |
| 1083 | Ga0501034_0084509 | 3300049571 | Bacteria | 3175 |
| 1084 | Ga0501034_0423062 | 3300049571 | Bacteria | 1253 |
| 1085 | Ga0501036_0011493 | 3300049572 | Bacteria | 7331 |
| 1086 | Ga0501036_0509958 | 3300049572 | Bacteria | 1000 |
| 1087 | Ga0501036_0943255 | 3300049572 | Bacteria | 707 |
| 1088 | Ga0501036_0957382 | 3300049572 | Bacteria | 701 |
| 1089 | Ga0501036_0962178 | 3300049572 | Bacteria | 699 |
| 1090 | Ga0501037_0368428 | 3300049573 | Bacteria | 989 |
| 1091 | Ga0501037_0454662 | 3300049573 | Bacteria | 873 |
| 1092 | Ga0501037_0508563 | 3300049573 | Bacteria | 816 |
| 1093 | Ga0501037_0632712 | 3300049573 | Bacteria | 716 |
| 1094 | Ga0501037_0722531 | 3300049573 | Bacteria | 661 |
| 1095 | Ga0501038_0040318 | 3300049574 | Bacteria | 4080 |
| 1096 | Ga0501038_0043951 | 3300049574 | Bacteria | 3883 |
| 1097 | Ga0501038_0103763 | 3300049574 | Bacteria | 2364 |
| 1098 | Ga0501038_0215612 | 3300049574 | Bacteria | 1534 |
| 1099 | Ga0501038_0244434 | 3300049574 | Bacteria | 1424 |
| 1100 | Ga0501038_0377332 | 3300049574 | Bacteria | 1100 |
| 1101 | Ga0501039_0047469 | 3300049575 | Bacteria | 3319 |
| 1102 | Ga0501039_0102579 | 3300049575 | Bacteria | 2233 |
| 1103 | Ga0501039_0111547 | 3300049575 | Bacteria | 2138 |
| 1104 | Ga0501039_0298062 | 3300049575 | Bacteria | 1267 |
| 1105 | Ga0501039_0458142 | 3300049575 | Bacteria | 1001 |
| 1106 | Ga0501039_0488920 | 3300049575 | Bacteria | 966 |
| 1107 | Ga0501039_0791487 | 3300049575 | Bacteria | 740 |
| 1108 | Ga0501040_0028204 | 3300049576 | Bacteria | 3783 |
| 1109 | Ga0501040_0131387 | 3300049576 | Bacteria | 1761 |
| 1110 | Ga0501040_0154989 | 3300049576 | Bacteria | 1617 |
| 1111 | Ga0501040_0365950 | 3300049576 | Bacteria | 1034 |
| 1112 | Ga0501040_0477028 | 3300049576 | Bacteria | 899 |
| 1113 | Ga0501040_0716713 | 3300049576 | Bacteria | 723 |
| 1114 | Ga0501041_0021811 | 3300049577 | Bacteria | 3836 |
| 1115 | Ga0501041_0092487 | 3300049577 | Bacteria | 1867 |
| 1116 | Ga0501041_0105027 | 3300049577 | Bacteria | 1750 |
| 1117 | Ga0501041_0117214 | 3300049577 | Bacteria | 1654 |
| 1118 | Ga0501041_0126602 | 3300049577 | Bacteria | 1590 |
| 1119 | Ga0501041_0180825 | 3300049577 | Bacteria | 1320 |
| 1120 | Ga0501041_0228652 | 3300049577 | Bacteria | 1168 |
| 1121 | Ga0501041_0498414 | 3300049577 | Bacteria | 775 |
| 1122 | Ga0501042_0017762 | 3300049578 | Bacteria | 4911 |
| 1123 | Ga0501042_0099190 | 3300049578 | Bacteria | 2094 |
| 1124 | Ga0501042_0112951 | 3300049578 | Bacteria | 1956 |
| 1125 | Ga0501042_0200366 | 3300049578 | Bacteria | 1439 |
| 1126 | Ga0501042_0404909 | 3300049578 | Bacteria | 988 |
| 1127 | Ga0501042_0682073 | 3300049578 | Bacteria | 747 |
| 1128 | Ga0501043_0258134 | 3300049579 | Bacteria | 1341 |
| 1129 | Ga0501043_0515946 | 3300049579 | Bacteria | 891 |
| 1130 | Ga0501043_0753919 | 3300049579 | Bacteria | 707 |
| 1131 | Ga0501046_0002625 | 3300049580 | Bacteria | 16787 |
| 1132 | Ga0501046_0324190 | 3300049580 | Bacteria | 1122 |
| 1133 | Ga0501046_0546387 | 3300049580 | Bacteria | 826 |
| 1134 | Ga0501046_0626781 | 3300049580 | Bacteria | 761 |
| 1135 | Ga0501046_0638158 | 3300049580 | Bacteria | 753 |
| 1136 | Ga0501047_0040402 | 3300049581 | Bacteria | 4511 |
| 1137 | Ga0501048_0193045 | 3300049582 | Bacteria | 1443 |
| 1138 | Ga0501048_0258396 | 3300049582 | Bacteria | 1237 |
| 1139 | Ga0501048_0337337 | 3300049582 | Bacteria | 1074 |
| 1140 | Ga0501048_0396254 | 3300049582 | Bacteria | 986 |
| 1141 | Ga0501048_0456270 | 3300049582 | Bacteria | 915 |
| 1142 | Ga0501048_0469464 | 3300049582 | Bacteria | 902 |
| 1143 | Ga0501067_0056296 | 3300049583 | Bacteria | 2179 |
| 1144 | Ga0501067_0288344 | 3300049583 | Bacteria | 914 |
| 1145 | Ga0501068_0109422 | 3300049584 | Bacteria | 1717 |
| 1146 | Ga0501068_0130935 | 3300049584 | Bacteria | 1568 |
| 1147 | Ga0501068_0154445 | 3300049584 | Bacteria | 1444 |
| 1148 | Ga0501068_0418936 | 3300049584 | Bacteria | 865 |
| 1149 | Ga0501068_0959895 | 3300049584 | Bacteria | 563 |
| 1150 | Ga0501069_0096618 | 3300049585 | Bacteria | 1674 |
| 1151 | Ga0501069_0356825 | 3300049585 | Bacteria | 862 |
| 1152 | Ga0501069_0537782 | 3300049585 | Bacteria | 699 |
| 1153 | Ga0501070_0067955 | 3300049586 | Bacteria | 2951 |
| 1154 | Ga0501070_0518013 | 3300049586 | Bacteria | 957 |
| 1155 | Ga0501070_0918108 | 3300049586 | Bacteria | 682 |
| 1156 | Ga0501071_0024493 | 3300049587 | Bacteria | 4223 |
| 1157 | Ga0501071_0032410 | 3300049587 | Bacteria | 3710 |
| 1158 | Ga0501071_0063978 | 3300049587 | Bacteria | 2668 |
| 1159 | Ga0501071_0092876 | 3300049587 | Bacteria | 2218 |
| 1160 | Ga0501071_0100192 | 3300049587 | Bacteria | 2135 |
| 1161 | Ga0501071_0237972 | 3300049587 | Bacteria | 1372 |
| 1162 | Ga0501071_0411846 | 3300049587 | Bacteria | 1033 |
| 1163 | Ga0501071_0845326 | 3300049587 | Bacteria | 706 |
| 1164 | Ga0501071_0946092 | 3300049587 | Bacteria | 665 |
| 1165 | Ga0501071_1471194 | 3300049587 | Bacteria | 526 |
| 1166 | Ga0501072_0007998 | 3300049588 | Bacteria | 8024 |
| 1167 | Ga0501072_0051029 | 3300049588 | Bacteria | 3257 |
| 1168 | Ga0501072_0177462 | 3300049588 | Bacteria | 1699 |
| 1169 | Ga0501072_0220656 | 3300049588 | Bacteria | 1511 |
| 1170 | Ga0501072_0303812 | 3300049588 | Bacteria | 1268 |
| 1171 | Ga0501072_0350941 | 3300049588 | Bacteria | 1171 |
| 1172 | Ga0501072_0628981 | 3300049588 | Bacteria | 845 |
| 1173 | Ga0501072_0793966 | 3300049588 | Bacteria | 742 |
| 1174 | Ga0501073_0003226 | 3300049589 | Bacteria | 12241 |
| 1175 | Ga0501073_0034381 | 3300049589 | Bacteria | 3608 |
| 1176 | Ga0501073_0185954 | 3300049589 | Bacteria | 1438 |
| 1177 | Ga0501073_0224250 | 3300049589 | Bacteria | 1298 |
| 1178 | Ga0501073_0226708 | 3300049589 | Bacteria | 1291 |
| 1179 | Ga0501073_0273992 | 3300049589 | Bacteria | 1164 |
| 1180 | Ga0501073_0333103 | 3300049589 | Bacteria | 1048 |
| 1181 | Ga0501073_0485092 | 3300049589 | Bacteria | 855 |
| 1182 | Ga0501073_0911896 | 3300049589 | Bacteria | 605 |
| 1183 | Ga0501074_0049751 | 3300049590 | Bacteria | 3025 |
| 1184 | Ga0501074_0071636 | 3300049590 | Bacteria | 2491 |
| 1185 | Ga0501074_0088706 | 3300049590 | Bacteria | 2215 |
| 1186 | Ga0501074_0152505 | 3300049590 | Bacteria | 1651 |
| 1187 | Ga0501074_0161149 | 3300049590 | Bacteria | 1602 |
| 1188 | Ga0501074_0697669 | 3300049590 | Bacteria | 716 |
| 1189 | Ga0501074_0862709 | 3300049590 | Bacteria | 637 |
| 1190 | Ga0501075_0069225 | 3300049591 | Bacteria | 2666 |
| 1191 | Ga0501075_0118370 | 3300049591 | Bacteria | 2014 |
| 1192 | Ga0501075_0136404 | 3300049591 | Bacteria | 1869 |
| 1193 | Ga0501075_0139726 | 3300049591 | Bacteria | 1845 |
| 1194 | Ga0501075_0193490 | 3300049591 | Bacteria | 1551 |
| 1195 | Ga0501075_0265147 | 3300049591 | Bacteria | 1309 |
| 1196 | Ga0501075_0303252 | 3300049591 | Bacteria | 1217 |
| 1197 | Ga0501075_0484004 | 3300049591 | Bacteria | 944 |
| 1198 | Ga0501075_0529279 | 3300049591 | Bacteria | 899 |
| 1199 | Ga0501075_0596746 | 3300049591 | Bacteria | 842 |
| 1200 | Ga0501076_0000421 | 3300049592 | Bacteria | 26662 |
| 1201 | Ga0501076_0030475 | 3300049592 | Bacteria | 4201 |
| 1202 | Ga0501076_0050061 | 3300049592 | Bacteria | 3304 |
| 1203 | Ga0501076_0057669 | 3300049592 | Bacteria | 3084 |
| 1204 | Ga0501076_0382244 | 3300049592 | Bacteria | 1157 |
| 1205 | Ga0501076_0984771 | 3300049592 | Bacteria | 695 |
| 1206 | Ga0501077_0011663 | 3300049593 | Bacteria | 5493 |
| 1207 | Ga0501077_0019816 | 3300049593 | Bacteria | 4255 |
| 1208 | Ga0501077_0052806 | 3300049593 | Bacteria | 2580 |
| 1209 | Ga0501077_0065778 | 3300049593 | Bacteria | 2299 |
| 1210 | Ga0501077_0081898 | 3300049593 | Bacteria | 2045 |
| 1211 | Ga0501077_0117015 | 3300049593 | Bacteria | 1689 |
| 1212 | Ga0501077_0173814 | 3300049593 | Bacteria | 1368 |
| 1213 | Ga0501077_0178839 | 3300049593 | Bacteria | 1348 |
| 1214 | Ga0501077_0255735 | 3300049593 | Bacteria | 1114 |
| 1215 | Ga0501077_0723721 | 3300049593 | Bacteria | 640 |
| 1216 | Ga0501238_002767 | 3300049671 | Bacteria | 2120 |
| 1217 | Ga0501079_0011059 | 3300049741 | Bacteria | 6882 |
| 1218 | Ga0501079_0015440 | 3300049741 | Bacteria | 5827 |
| 1219 | Ga0501079_0025437 | 3300049741 | Bacteria | 4540 |
| 1220 | Ga0501079_0029982 | 3300049741 | Bacteria | 4179 |
| 1221 | Ga0501079_0064992 | 3300049741 | Bacteria | 2814 |
| 1222 | Ga0501079_0085340 | 3300049741 | Bacteria | 2443 |
| 1223 | Ga0501079_0392322 | 3300049741 | Bacteria | 1089 |
| 1224 | Ga0501079_0533735 | 3300049741 | Bacteria | 922 |
| 1225 | Ga0501079_0810015 | 3300049741 | Bacteria | 737 |
| 1226 | Ga0501080_0027369 | 3300049742 | Bacteria | 5300 |
| 1227 | Ga0501080_0095552 | 3300049742 | Bacteria | 2760 |
| 1228 | Ga0501080_0141837 | 3300049742 | Bacteria | 2221 |
| 1229 | Ga0501080_0204600 | 3300049742 | Bacteria | 1811 |
| 1230 | Ga0501080_0251891 | 3300049742 | Bacteria | 1610 |
| 1231 | Ga0501080_0347057 | 3300049742 | Bacteria | 1341 |
| 1232 | Ga0501080_0488439 | 3300049742 | Bacteria | 1101 |
| 1233 | Ga0501080_0658635 | 3300049742 | Bacteria | 926 |
| 1234 | Ga0501081_0003198 | 3300049743 | Bacteria | 10403 |
| 1235 | Ga0501081_0040953 | 3300049743 | Bacteria | 3171 |
| 1236 | Ga0501081_0047963 | 3300049743 | Bacteria | 2939 |
| 1237 | Ga0501081_0056768 | 3300049743 | Bacteria | 2706 |
| 1238 | Ga0501081_0077134 | 3300049743 | Bacteria | 2328 |
| 1239 | Ga0501081_0095052 | 3300049743 | Bacteria | 2100 |
| 1240 | Ga0501081_0172437 | 3300049743 | Bacteria | 1562 |
| 1241 | Ga0501081_0296293 | 3300049743 | Bacteria | 1186 |
| 1242 | Ga0501081_0644853 | 3300049743 | Bacteria | 794 |
| 1243 | Ga0501081_1009083 | 3300049743 | Bacteria | 629 |
| 1244 | Ga0501081_1094349 | 3300049743 | Bacteria | 603 |
| 1245 | Ga0501083_0031587 | 3300049744 | Bacteria | 3634 |
| 1246 | Ga0501083_0102047 | 3300049744 | Bacteria | 1891 |
| 1247 | Ga0501083_0154544 | 3300049744 | Bacteria | 1502 |
| 1248 | Ga0501083_0205601 | 3300049744 | Bacteria | 1284 |
| 1249 | Ga0501269_020609 | 3300049766 | Bacteria | 822 |
| 1250 | Ga0501035_0189930 | 3300049822 | Bacteria | 1766 |
| 1251 | Ga0501035_0459005 | 3300049822 | Bacteria | 1053 |
| 1252 | Ga0501035_0543506 | 3300049822 | Bacteria | 952 |
| 1253 | Ga0501035_0898209 | 3300049822 | Bacteria | 702 |
| 1254 | Ga0501044_0012400 | 3300049823 | Bacteria | 9228 |
| 1255 | Ga0501045_0013725 | 3300049824 | Bacteria | 5727 |
| 1256 | Ga0501045_0057300 | 3300049824 | Bacteria | 2851 |
| 1257 | Ga0501045_0060738 | 3300049824 | Bacteria | 2771 |
| 1258 | Ga0501045_0076359 | 3300049824 | Bacteria | 2468 |
| 1259 | Ga0501045_0243269 | 3300049824 | Bacteria | 1339 |
| 1260 | Ga0501045_0528192 | 3300049824 | Bacteria | 876 |
| 1261 | Ga0501045_0811197 | 3300049824 | Bacteria | 689 |
| 1262 | Ga0501045_0964782 | 3300049824 | Bacteria | 625 |
| 1263 | Ga0501045_1337924 | 3300049824 | Bacteria | 521 |
| 1264 | nmdc:mga03n38_26789_c1 | 3300050490 | Bacteria | 2384 |
| 1265 | nmdc:mga03n38_94395_c1 | 3300050490 | Bacteria | 1431 |
| 1266 | nmdc:mga00v17_114995_c1 | 3300050491 | Bacteria | 1709 |
| 1267 | nmdc:mga00v17_166581_c1 | 3300050491 | Bacteria | 1420 |
| 1268 | nmdc:mga0yw44_4728_c1 | 3300050492 | Bacteria | 5791 |
| 1269 | nmdc:mga0yw44_608088_c1 | 3300050492 | Bacteria | 743 |
| 1270 | nmdc:mga0k408_197363_c1 | 3300050493 | Bacteria | 1201 |
| 1271 | nmdc:mga06z11_23902_c1 | 3300050494 | Bacteria | 2877 |
| 1272 | nmdc:mga06z11_284143_c1 | 3300050494 | Bacteria | 981 |
| 1273 | nmdc:mga06z11_33224_c1 | 3300050494 | Bacteria | 2523 |
| 1274 | nmdc:mga04h51_18257_c1 | 3300050495 | Bacteria | 2064 |
| 1275 | nmdc:mga04h51_1973_c1 | 3300050495 | Bacteria | 4790 |
| 1276 | nmdc:mga04h51_23062_c1 | 3300050495 | Bacteria | 1891 |
| 1277 | nmdc:mga07m45_360574_c1 | 3300050496 | Bacteria | 844 |
| 1278 | nmdc:mga05p37_1470845_c1 | 3300050507 | Bacteria | 681 |
| 1279 | nmdc:mga05p37_159475_c1 | 3300050507 | Bacteria | 2756 |
| 1280 | nmdc:mga05p37_27138_c1 | 3300050507 | Bacteria | 6970 |
| 1281 | nmdc:mga05p37_301565_c1 | 3300050507 | Bacteria | 1903 |
| 1282 | nmdc:mga05p37_454063_c1 | 3300050507 | Bacteria | 1482 |
| 1283 | nmdc:mga05p37_49398_c1 | 3300050507 | Bacteria | 5174 |
| 1284 | nmdc:mga05p37_878206_c1 | 3300050507 | Bacteria | 970 |
| 1285 | nmdc:mga09592_219384_c1 | 3300050508 | Bacteria | 1648 |
| 1286 | nmdc:mga09592_694129_c1 | 3300050508 | Bacteria | 867 |
| 1287 | nmdc:mga0qj67_170797_c1 | 3300050509 | Bacteria | 1765 |
| 1288 | nmdc:mga0qj67_224050_c1 | 3300050509 | Bacteria | 1526 |
| 1289 | nmdc:mga0qj67_400386_c1 | 3300050509 | Bacteria | 1108 |
| 1290 | nmdc:mga0qj67_43677_c1 | 3300050509 | Bacteria | 3530 |
| 1291 | nmdc:mga06r32_207621_c1 | 3300050510 | Bacteria | 1947 |
| 1292 | nmdc:mga06r32_209769_c1 | 3300050510 | Bacteria | 1936 |
| 1293 | nmdc:mga06r32_2831_c1 | 3300050510 | Bacteria | 15564 |
| 1294 | nmdc:mga06r32_381632_c1 | 3300050510 | Bacteria | 1392 |
| 1295 | nmdc:mga06r32_45743_c1 | 3300050510 | Bacteria | 4173 |
| 1296 | nmdc:mga08y16_1006887_c1 | 3300050511 | Bacteria | 813 |
| 1297 | nmdc:mga08y16_354098_c1 | 3300050511 | Bacteria | 1508 |
| 1298 | nmdc:mga08y16_479248_c1 | 3300050511 | Bacteria | 1266 |
| 1299 | nmdc:mga08y16_51471_c1 | 3300050511 | Bacteria | 4309 |
| 1300 | nmdc:mga08y16_560714_c1 | 3300050511 | Bacteria | 1155 |
| 1301 | nmdc:mga08y16_79584_c1 | 3300050511 | Bacteria | 3416 |
| 1302 | nmdc:mga0n895_1137071_c1 | 3300050512 | Bacteria | 757 |
| 1303 | nmdc:mga0n895_1205724_c1 | 3300050512 | Bacteria | 731 |
| 1304 | nmdc:mga0n895_200439_c1 | 3300050512 | Bacteria | 2027 |
| 1305 | nmdc:mga0n895_28374_c1 | 3300050512 | Bacteria | 5323 |
| 1306 | nmdc:mga0n895_30261_c1 | 3300050512 | Bacteria | 5172 |
| 1307 | nmdc:mga0rr50_13958_c1 | 3300050513 | Bacteria | 5249 |
| 1308 | nmdc:mga0rr50_173912_c1 | 3300050513 | Bacteria | 1756 |
| 1309 | nmdc:mga0rr50_6581_c1 | 3300050513 | Bacteria | 7097 |
| 1310 | nmdc:mga08x19_58182_c1 | 3300050514 | Bacteria | 2500 |
| 1311 | nmdc:mga0a205_17244_c1 | 3300050515 | Bacteria | 6765 |
| 1312 | nmdc:mga0a205_22301_c1 | 3300050515 | Bacteria | 5996 |
| 1313 | nmdc:mga0a205_377889_c1 | 3300050515 | Bacteria | 1282 |
| 1314 | nmdc:mga0a205_38046_c1 | 3300050515 | Bacteria | 4627 |
| 1315 | nmdc:mga0a205_56983_c1 | 3300050515 | Bacteria | 3773 |
| 1316 | nmdc:mga0a205_74311_c1 | 3300050515 | Bacteria | 3285 |
| 1317 | Ga0495601_0015804 | 3300053077 | Bacteria | 4568 |
| 1318 | Ga0495601_0033953 | 3300053077 | Bacteria | 3179 |
| 1319 | Ga0495601_0702920 | 3300053077 | Bacteria | 645 |
| 1320 | Ga0495612_0039940 | 3300053078 | Bacteria | 1910 |
| 1321 | Ga0495655_0000679 | 3300053083 | Bacteria | 5465 |
| 1322 | Ga0495655_0028926 | 3300053083 | Bacteria | 1328 |
| 1323 | Ga0495595_0123678 | 3300053084 | Bacteria | 1261 |
| 1324 | Ga0495595_0430932 | 3300053084 | Bacteria | 669 |
| 1325 | Ga0495619_0003085 | 3300053085 | Bacteria | 10813 |
| 1326 | Ga0495619_0040299 | 3300053085 | Bacteria | 3053 |
| 1327 | Ga0495619_0047711 | 3300053085 | Bacteria | 2821 |
| 1328 | Ga0495619_0412724 | 3300053085 | Bacteria | 932 |
| 1329 | Ga0495619_0561373 | 3300053085 | Bacteria | 783 |
| 1330 | Ga0500644_0230434 | 3300053088 | Bacteria | 775 |
| 1331 | Ga0500646_0271481 | 3300053090 | Bacteria | 602 |
| 1332 | Ga0500583_0267577 | 3300053092 | Bacteria | 841 |
| 1333 | Ga0500651_0633458 | 3300053093 | Bacteria | 577 |
| 1334 | Ga0500641_0136250 | 3300053096 | Bacteria | 1060 |
| 1335 | Ga0500641_0230867 | 3300053096 | Bacteria | 782 |
| 1336 | Ga0500650_0065747 | 3300053098 | Bacteria | 1694 |
| 1337 | Ga0500650_0271518 | 3300053098 | Bacteria | 756 |
| 1338 | Ga0500555_005793 | 3300053103 | Bacteria | 3506 |
| 1339 | Ga0500556_0001703 | 3300053104 | Bacteria | 8393 |
| 1340 | Ga0500556_0176632 | 3300053104 | Bacteria | 844 |
| 1341 | Ga0500562_015287 | 3300053108 | Bacteria | 1968 |
| 1342 | Ga0500594_0164320 | 3300053118 | Bacteria | 719 |
| 1343 | Ga0500618_005553 | 3300053125 | Bacteria | 3815 |
| 1344 | Ga0500618_016257 | 3300053125 | Bacteria | 1864 |
| 1345 | Ga0500652_159728 | 3300053131 | Bacteria | 932 |
| 1346 | Ga0500616_0006596 | 3300053153 | Bacteria | 7567 |
| 1347 | Ga0500616_0009861 | 3300053153 | Bacteria | 5756 |
| 1348 | Ga0500616_0023836 | 3300053153 | Bacteria | 3406 |
| 1349 | Ga0500616_0155080 | 3300053153 | Bacteria | 1056 |
| 1350 | Ga0500645_037607 | 3300053730 | Bacteria | 1437 |
| 1351 | Ga0501084_0004756 | 3300054114 | Bacteria | 11097 |
| 1352 | Ga0501084_0060676 | 3300054114 | Bacteria | 3165 |
| 1353 | Ga0501084_0069792 | 3300054114 | Bacteria | 2942 |
| 1354 | Ga0501084_0083487 | 3300054114 | Bacteria | 2681 |
| 1355 | Ga0501084_0164633 | 3300054114 | Bacteria | 1871 |
| 1356 | Ga0501084_0288349 | 3300054114 | Bacteria | 1386 |
| 1357 | Ga0501084_0390430 | 3300054114 | Bacteria | 1176 |
| 1358 | Ga0501084_0834579 | 3300054114 | Bacteria | 776 |
| 1359 | Ga0587068_011988 | 3300059641 | Bacteria | 1317 |
| 1360 | Ga0587111_0006178 | 3300060346 | Bacteria | 1887 |
| 1361 | Ga0501082_0024683 | 3300060353 | Bacteria | 5182 |
| 1362 | Ga0501082_0026929 | 3300060353 | Bacteria | 4953 |
| 1363 | Ga0501082_0027843 | 3300060353 | Bacteria | 4867 |
| 1364 | Ga0501082_0061171 | 3300060353 | Bacteria | 3242 |
| 1365 | Ga0501082_0089971 | 3300060353 | Bacteria | 2650 |
| 1366 | Ga0501082_0181067 | 3300060353 | Bacteria | 1833 |
| 1367 | Ga0501082_0271970 | 3300060353 | Bacteria | 1474 |
| 1368 | Ga0501082_0302697 | 3300060353 | Bacteria | 1392 |
| 1369 | Ga0501082_0350329 | 3300060353 | Bacteria | 1287 |
| 1370 | Ga0501082_0424543 | 3300060353 | Bacteria | 1161 |
| 1371 | Ga0501082_0573731 | 3300060353 | Bacteria | 987 |
| 1372 | Ga0501082_0896486 | 3300060353 | Bacteria | 776 |
| 1373 | Ga0501082_0978755 | 3300060353 | Bacteria | 740 |
| 1374 | Ga0501082_1034502 | 3300060353 | Bacteria | 718 |
| 1375 | Ga0501082_1193922 | 3300060353 | Bacteria | 665 |
| 1376 | Ga0501082_1509349 | 3300060353 | Bacteria | 587 |
| 1377 | Ga0530510_0015060 | 3300061734 | Bacteria | 5462 |
| 1378 | Ga0530510_0020058 | 3300061734 | Bacteria | 4753 |
| 1379 | Ga0530510_0033570 | 3300061734 | Bacteria | 3694 |
| 1380 | Ga0530510_0039532 | 3300061734 | Bacteria | 3405 |
| 1381 | Ga0530510_0041216 | 3300061734 | Bacteria | 3333 |
| 1382 | Ga0530510_0332355 | 3300061734 | Bacteria | 1140 |
| 1383 | Ga0530510_0349592 | 3300061734 | Bacteria | 1110 |
| 1384 | Ga0530510_0484071 | 3300061734 | Bacteria | 937 |
| 1385 | 2511169850 | 2510917026 | Bacteria | 7046020 |
| 1386 | 2585995368 | 2585427633 | Bacteria | 6413184 |
| 1387 | 2585999923 | 2585427634 | Bacteria | 6455027 |
| 1388 | 2819683833 | 2818991461 | Bacteria | 7026071 |
| 1389 | 2854901777 | 2854896431 | Bacteria | 5869725 |
| 1390 | 2854919396 | 2854916844 | Bacteria | 5725939 |
| 1391 | 2919177506 | 2919171160 | Bacteria | 6499771 |
| 1392 | Ga0070690_100031602 | |||
| 1393 | JGI24739J22299_10003680 | |||
| 1394 | JGI24744J21845_10009957 | |||
| 1395 | JGI24034J26672_10026341 | |||
| 1396 | JGI24751J29686_10002788 | |||
| 1397 | JGI25153J46596_10019740 | |||
| 1398 | Ga0055536_1002518 | |||
| 1399 | Ga0055530_10015497 | |||
| 1400 | Ga0055540_1016845 | |||
| 1401 | Ga0055531_10016122 | |||
| 1402 | Ga0065165_1052002 | |||
| 1403 | Ga0065712_10221854 | |||
| 1404 | Ga0065715_10120074 | |||
| 1405 | Ga0070658_10117184 | |||
| 1406 | Ga0070676_10003697 | |||
| 1407 | Ga0070683_100066664 | |||
| 1408 | Ga0070690_100000669 | |||
| 1409 | Ga0070690_100437829 | |||
| 1410 | Ga0070670_100000376 | |||
| 1411 | Ga0070677_10061351 | |||
| 1412 | Ga0070677_10217266 | |||
| 1413 | Ga0068869_100017443 | |||
| 1414 | Ga0068869_100350225 | |||
| 1415 | Ga0068869_100792907 | |||
| 1416 | Ga0070666_10010589 | |||
| 1417 | Ga0070666_10238426 | |||
| 1418 | Ga0070680_100002865 | |||
| 1419 | Ga0070680_100022142 | |||
| 1420 | Ga0070680_100045100 | |||
| 1421 | Ga0070680_100063280 | |||
| 1422 | Ga0070682_100000906 | |||
| 1423 | Ga0070682_100002069 | |||
| 1424 | Ga0070682_100080167 | |||
| 1425 | Ga0070682_100457835 | |||
| 1426 | Ga0068868_100002279 | |||
| 1427 | Ga0068868_101195933 | |||
| 1428 | Ga0070660_100000686 | |||
| 1429 | Ga0070660_100025853 | |||
| 1430 | Ga0070660_100980122 | |||
| 1431 | Ga0070689_100000122 | |||
| 1432 | Ga0070689_100001563 | |||
| 1433 | Ga0070689_100561436 | |||
| 1434 | Ga0070689_100636419 | |||
| 1435 | Ga0070689_100806752 | |||
| 1436 | Ga0070689_101300264 | |||
| 1437 | Ga0070691_10000490 | |||
| 1438 | Ga0070691_10071705 | |||
| 1439 | Ga0070691_10112071 | |||
| 1440 | Ga0070691_10122218 | |||
| 1441 | Ga0070691_10491655 | |||
| 1442 | Ga0070687_100021008 | |||
| 1443 | Ga0070687_100633737 | |||
| 1444 | Ga0070661_100000385 | |||
| 1445 | Ga0070661_100113169 | |||
| 1446 | Ga0070692_10001302 | |||
| 1447 | Ga0070692_10087562 | |||
| 1448 | Ga0070692_10135442 | |||
| 1449 | Ga0070692_10188993 | |||
| 1450 | Ga0070692_10350890 | |||
| 1451 | Ga0070692_10404232 | |||
| 1452 | Ga0070668_100005991 | |||
| 1453 | Ga0070668_100097873 | |||
| 1454 | Ga0070668_100630128 | |||
| 1455 | Ga0070668_100717684 | |||
| 1456 | Ga0070668_100901193 | |||
| 1457 | Ga0070668_101757251 | |||
| 1458 | Ga0070669_100002082 | |||
| 1459 | Ga0070669_100832448 | |||
| 1460 | Ga0070669_101013596 | |||
| 1461 | Ga0070675_100005878 | |||
| 1462 | Ga0070675_101154866 | |||
| 1463 | Ga0070671_100001283 | |||
| 1464 | Ga0070671_100302239 | |||
| 1465 | Ga0070674_100000649 | |||
| 1466 | Ga0070674_100097379 | |||
| 1467 | Ga0070674_100530538 | |||
| 1468 | Ga0070673_100121391 | |||
| 1469 | Ga0070688_100000217 | |||
| 1470 | Ga0070688_100028311 | |||
| 1471 | Ga0070688_100202736 | |||
| 1472 | Ga0070688_100965974 | |||
| 1473 | Ga0070659_100002236 | |||
| 1474 | Ga0070659_100023489 | |||
| 1475 | Ga0070659_100045573 | |||
| 1476 | Ga0070659_100227582 | |||
| 1477 | Ga0070659_100270890 | |||
| 1478 | Ga0070659_100859937 | |||
| 1479 | Ga0070667_100002610 | |||
| 1480 | Ga0070667_100092102 | |||
| 1481 | Ga0070667_100128893 | |||
| 1482 | Ga0070667_100226989 | |||
| 1483 | Ga0070667_101605522 | |||
| 1484 | Ga0070703_10004053 | |||
| 1485 | Ga0070709_10001232 | |||
| 1486 | Ga0070709_10288704 | |||
| 1487 | Ga0070709_10735828 | |||
| 1488 | Ga0070714_100018042 | |||
| 1489 | Ga0070713_100001927 | |||
| 1490 | Ga0070713_100078299 | |||
| 1491 | Ga0070710_10166478 | |||
| 1492 | Ga0070701_10004381 | |||
| 1493 | Ga0070711_100000834 | |||
| 1494 | Ga0070711_100512272 | |||
| 1495 | Ga0070711_100752604 | |||
| 1496 | Ga0070705_100001704 | |||
| 1497 | Ga0070705_100004368 | |||
| 1498 | Ga0070705_100461106 | |||
| 1499 | Ga0070700_100002377 | |||
| 1500 | Ga0070700_100065396 | |||
| 1501 | Ga0070700_100091434 | |||
| 1502 | Ga0070700_100091728 | |||
| 1503 | Ga0070700_100098903 | |||
| 1504 | Ga0070700_100353274 | |||
| 1505 | Ga0070700_100711397 | |||
| 1506 | Ga0070694_100000195 | |||
| 1507 | Ga0070694_100036040 | |||
| 1508 | Ga0070694_100133401 | |||
| 1509 | Ga0070694_100202098 | |||
| 1510 | Ga0070694_100389255 | |||
| 1511 | Ga0070694_100637231 | |||
| 1512 | Ga0070708_100056503 | |||
| 1513 | Ga0070708_100093871 | |||
| 1514 | Ga0070663_100000352 | |||
| 1515 | Ga0070663_100001782 | |||
| 1516 | Ga0070663_100071693 | |||
| 1517 | Ga0070663_100192549 | |||
| 1518 | Ga0070663_100350786 | |||
| 1519 | Ga0070678_100001137 | |||
| 1520 | Ga0070662_100000412 | |||
| 1521 | Ga0070662_100550682 | |||
| 1522 | Ga0070662_100836164 | |||
| 1523 | Ga0070662_101037584 | |||
| 1524 | Ga0070681_10005865 | |||
| 1525 | Ga0070681_10023484 | |||
| 1526 | Ga0070681_10042377 | |||
| 1527 | Ga0070681_10164070 | |||
| 1528 | Ga0070681_10185822 | |||
| 1529 | Ga0070681_10250538 | |||
| 1530 | Ga0068867_100070990 | |||
| 1531 | Ga0070685_10005479 | |||
| 1532 | Ga0070685_10679033 | |||
| 1533 | Ga0070706_100334391 | |||
| 1534 | Ga0070706_100991629 | |||
| 1535 | Ga0070706_102146987 | |||
| 1536 | Ga0070707_100045980 | |||
| 1537 | Ga0070707_100689963 | |||
| 1538 | Ga0070707_100858955 | |||
| 1539 | Ga0070698_100105371 | |||
| 1540 | Ga0070698_100271798 | |||
| 1541 | Ga0070698_101452714 | |||
| 1542 | Ga0070699_100002571 | |||
| 1543 | Ga0070699_100613012 | |||
| 1544 | Ga0070679_100014791 | |||
| 1545 | Ga0070679_100068971 | |||
| 1546 | Ga0070679_100728392 | |||
| 1547 | Ga0070684_100225818 | |||
| 1548 | Ga0070697_100000391 | |||
| 1549 | Ga0070697_100066290 | |||
| 1550 | Ga0070697_100330332 | |||
| 1551 | Ga0068853_100001595 | |||
| 1552 | Ga0068853_100095708 | |||
| 1553 | Ga0068853_101329379 | |||
| 1554 | Ga0070672_100008680 | |||
| 1555 | Ga0070686_100000853 | |||
| 1556 | Ga0070686_100000940 | |||
| 1557 | Ga0070695_100000238 | |||
| 1558 | Ga0070695_100013344 | |||
| 1559 | Ga0070695_100028804 | |||
| 1560 | Ga0070695_100069546 | |||
| 1561 | Ga0070695_100180109 | |||
| 1562 | Ga0070695_100226022 | |||
| 1563 | Ga0070695_100328434 | |||
| 1564 | Ga0070695_100559307 | |||
| 1565 | Ga0070696_100000815 | |||
| 1566 | Ga0070696_100006241 | |||
| 1567 | Ga0070696_100200406 | |||
| 1568 | Ga0070696_100290248 | |||
| 1569 | Ga0070693_100089116 | |||
| 1570 | Ga0070693_100231277 | |||
| 1571 | Ga0070665_100052313 | |||
| 1572 | Ga0070665_101071652 | |||
| 1573 | Ga0070704_100000124 | |||
| 1574 | Ga0070704_100006261 | |||
| 1575 | Ga0070704_100280374 | |||
| 1576 | Ga0068855_100002691 | |||
| 1577 | Ga0068855_100069700 | |||
| 1578 | Ga0070664_100186343 | |||
| 1579 | Ga0068857_100034156 | |||
| 1580 | Ga0068857_100310077 | |||
| 1581 | Ga0068857_100332947 | |||
| 1582 | Ga0068854_100022328 | |||
| 1583 | Ga0068854_100095464 | |||
| 1584 | Ga0068854_100325520 | |||
| 1585 | Ga0068854_100453359 | |||
| 1586 | Ga0068854_100458028 | |||
| 1587 | Ga0068856_100002821 | |||
| 1588 | Ga0068856_100743676 | |||
| 1589 | Ga0070702_100000018 | |||
| 1590 | Ga0070702_100020165 | |||
| 1591 | Ga0070702_100095027 | |||
| 1592 | Ga0070702_100450512 | |||
| 1593 | Ga0068852_100067019 | |||
| 1594 | Ga0068852_100544065 | |||
| 1595 | Ga0068852_101766950 | |||
| 1596 | Ga0068859_100006726 | |||
| 1597 | Ga0068859_100019657 | |||
| 1598 | Ga0068859_100073753 | |||
| 1599 | Ga0068859_100224454 | |||
| 1600 | Ga0068859_100591668 | |||
| 1601 | Ga0068859_101558607 | |||
| 1602 | Ga0068859_101828721 | |||
| 1603 | Ga0068864_100002243 | |||
| 1604 | Ga0068864_100144705 | |||
| 1605 | Ga0068864_100347956 | |||
| 1606 | Ga0068864_101084319 | |||
| 1607 | Ga0068866_10016535 | |||
| 1608 | Ga0068866_10162137 | |||
| 1609 | Ga0068866_10371120 | |||
| 1610 | Ga0068866_10547415 | |||
| 1611 | Ga0068861_100021853 | |||
| 1612 | Ga0068861_100052445 | |||
| 1613 | Ga0068861_100059827 | |||
| 1614 | Ga0068861_100121537 | |||
| 1615 | Ga0068861_100128342 | |||
| 1616 | Ga0068861_100199791 | |||
| 1617 | Ga0068851_10290140 | |||
| 1618 | Ga0068870_10142969 | |||
| 1619 | Ga0068870_10379296 | |||
| 1620 | Ga0068863_100035631 | |||
| 1621 | Ga0068863_101263919 | |||
| 1622 | Ga0068863_101553316 | |||
| 1623 | Ga0068858_100014450 | |||
| 1624 | Ga0068858_100059439 | |||
| 1625 | Ga0068858_100102790 | |||
| 1626 | Ga0068858_100231289 | |||
| 1627 | Ga0068858_100818811 | |||
| 1628 | Ga0068858_101058738 | |||
| 1629 | Ga0068860_100000598 | |||
| 1630 | Ga0068860_100730924 | |||
| 1631 | Ga0068860_100735572 | |||
| 1632 | Ga0068860_100747308 | |||
| 1633 | Ga0068860_100768968 | |||
| 1634 | Ga0068860_101148659 | |||
| 1635 | Ga0068862_100002462 | |||
| 1636 | Ga0068862_100008039 | |||
| 1637 | Ga0068862_100021045 | |||
| 1638 | Ga0068862_100355084 | |||
| 1639 | Ga0068862_100516980 | |||
| 1640 | Ga0068862_101384035 | |||
| 1641 | Ga0081455_10004292 | |||
| 1642 | Ga0081455_10007585 | |||
| 1643 | Ga0081455_10308714 | |||
| 1644 | Ga0081540_1001954 | |||
| 1645 | Ga0081540_1039855 | |||
| 1646 | Ga0081539_10046146 | |||
| 1647 | Ga0081539_10050726 | |||
| 1648 | Ga0070717_10330910 | |||
| 1649 | Ga0075365_10003505 | |||
| 1650 | Ga0075365_10078853 | |||
| 1651 | Ga0075368_10007190 | |||
| 1652 | Ga0075368_10088331 | |||
| 1653 | Ga0075368_10164231 | |||
| 1654 | Ga0075363_100004707 | |||
| 1655 | Ga0075363_100133533 | |||
| 1656 | Ga0075363_100254370 | |||
| 1657 | Ga0075363_100279414 | |||
| 1658 | Ga0075364_10589678 | |||
| 1659 | Ga0075432_10009193 | |||
| 1660 | Ga0075432_10024708 | |||
| 1661 | Ga0070715_10009598 | |||
| 1662 | Ga0070716_100004896 | |||
| 1663 | Ga0070716_100205373 | |||
| 1664 | Ga0070716_100274689 | |||
| 1665 | Ga0070716_100510710 | |||
| 1666 | Ga0070716_100739079 | |||
| 1667 | Ga0070712_100002909 | |||
| 1668 | Ga0070712_100034164 | |||
| 1669 | Ga0070712_100236495 | |||
| 1670 | Ga0070712_100800337 | |||
| 1671 | Ga0075362_10184200 | |||
| 1672 | Ga0075367_10113166 | |||
| 1673 | Ga0075367_10254589 | |||
| 1674 | Ga0075366_10107355 | |||
| 1675 | Ga0075366_10200191 | |||
| 1676 | Ga0097621_100087331 | |||
| 1677 | Ga0097621_100216659 | |||
| 1678 | Ga0097621_100330010 | |||
| 1679 | Ga0097621_101619135 | |||
| 1680 | Ga0068871_100389102 | |||
| 1681 | Ga0068871_100847370 | |||
| 1682 | Ga0075428_100025828 | |||
| 1683 | Ga0075428_100044339 | |||
| 1684 | Ga0075428_100116926 | |||
| 1685 | Ga0075428_100184052 | |||
| 1686 | Ga0075428_100211533 | |||
| 1687 | Ga0075428_100301142 | |||
| 1688 | Ga0075428_100963850 | |||
| 1689 | Ga0075430_100029402 | |||
| 1690 | Ga0075430_100161869 | |||
| 1691 | Ga0075430_100305244 | |||
| 1692 | Ga0075430_100449279 | |||
| 1693 | Ga0075430_101247234 | |||
| 1694 | Ga0075431_100002019 | |||
| 1695 | Ga0075431_100014350 | |||
| 1696 | Ga0075431_100048216 | |||
| 1697 | Ga0075431_100085221 | |||
| 1698 | Ga0075433_10002400 | |||
| 1699 | Ga0075433_10006677 | |||
| 1700 | Ga0075433_10126528 | |||
| 1701 | Ga0075433_10180830 | |||
| 1702 | Ga0075433_10303775 | |||
| 1703 | Ga0075434_100033297 | |||
| 1704 | Ga0075434_100055563 | |||
| 1705 | Ga0075434_100061871 | |||
| 1706 | Ga0075434_100454741 | |||
| 1707 | Ga0075434_100541745 | |||
| 1708 | Ga0075434_100961198 | |||
| 1709 | Ga0075429_100018835 | |||
| 1710 | Ga0075429_100796467 | |||
| 1711 | Ga0068865_100004683 | |||
| 1712 | Ga0068865_100271014 | |||
| 1713 | Ga0075436_100001383 | |||
| 1714 | Ga0097620_100006726 | |||
| 1715 | Ga0097620_100019656 | |||
| 1716 | Ga0097620_100073751 | |||
| 1717 | Ga0097620_100224447 | |||
| 1718 | Ga0097620_100591697 | |||
| 1719 | Ga0097620_101558773 | |||
| 1720 | Ga0097620_101828964 | |||
| 1721 | Ga0075435_100043632 | |||
| 1722 | Ga0075435_100723045 | |||
| 1723 | Ga0105251_10264466 | |||
| 1724 | Ga0105244_10397305 | |||
| 1725 | Ga0105250_10018370 | |||
| 1726 | Ga0105240_10670007 | |||
| 1727 | Ga0111539_10006608 | |||
| 1728 | Ga0111539_10023934 | |||
| 1729 | Ga0111539_10028568 | |||
| 1730 | Ga0111539_10080826 | |||
| 1731 | Ga0111539_10135824 | |||
| 1732 | Ga0111539_10188116 | |||
| 1733 | Ga0111539_11143466 | |||
| 1734 | Ga0111539_11268994 | |||
| 1735 | Ga0105245_10000718 | |||
| 1736 | Ga0105245_10766781 | |||
| 1737 | Ga0105245_11641566 | |||
| 1738 | Ga0105247_10028576 | |||
| 1739 | Ga0105247_10542179 | |||
| 1740 | Ga0105247_10598600 | |||
| 1741 | Ga0105247_10968515 | |||
| 1742 | Ga0114129_10067547 | |||
| 1743 | Ga0114129_10114822 | |||
| 1744 | Ga0114129_10159816 | |||
| 1745 | Ga0114129_10334793 | |||
| 1746 | Ga0114129_10467716 | |||
| 1747 | Ga0114129_10800767 | |||
| 1748 | Ga0114129_10980056 | |||
| 1749 | Ga0114129_11692413 | |||
| 1750 | Ga0114129_13325443 | |||
| 1751 | Ga0105243_10007855 | |||
| 1752 | Ga0105243_10016692 | |||
| 1753 | Ga0105243_10096050 | |||
| 1754 | Ga0105243_10164045 | |||
| 1755 | Ga0105243_10346945 | |||
| 1756 | Ga0105243_11690859 | |||
| 1757 | Ga0105241_10001150 | |||
| 1758 | Ga0105241_10016819 | |||
| 1759 | Ga0105241_10750543 | |||
| 1760 | Ga0105242_10003790 | |||
| 1761 | Ga0105242_10612942 | |||
| 1762 | Ga0105242_10844179 | |||
| 1763 | Ga0105248_10017659 | |||
| 1764 | Ga0105248_10090078 | |||
| 1765 | Ga0105248_10249035 | |||
| 1766 | Ga0105237_10001618 | |||
| 1767 | Ga0105237_10025489 | |||
| 1768 | Ga0105237_10164275 | |||
| 1769 | Ga0105237_10906856 | |||
| 1770 | Ga0105238_10038405 | |||
| 1771 | Ga0105238_10278955 | |||
| 1772 | Ga0105238_11897910 | |||
| 1773 | Ga0105249_10000814 | |||
| 1774 | Ga0105249_10060094 | |||
| 1775 | Ga0105249_10726781 | |||
| 1776 | Ga0105249_10749652 | |||
| 1777 | Ga0105249_11004495 | |||
| 1778 | Ga0105249_11539348 | |||
| 1779 | Ga0105239_10022201 | |||
| 1780 | Ga0105239_10135147 | |||
| 1781 | Ga0105239_10248297 | |||
| 1782 | Ga0105239_10367586 | |||
| 1783 | Ga0105239_12863633 | |||
| 1784 | Ga0105239_13198934 | |||
| 1785 | Ga0105246_10008999 | |||
| 1786 | Ga0105246_10050163 | |||
| 1787 | Ga0105246_10058936 | |||
| 1788 | Ga0105246_10195815 | |||
| 1789 | Ga0105246_10628531 | |||
| 1790 | Ga0157321_1002735 | |||
| 1791 | Ga0157335_1010858 | |||
| 1792 | Ga0157342_1016568 | |||
| 1793 | Ga0157373_10013558 | |||
| 1794 | Ga0157373_10057191 | |||
| 1795 | Ga0157371_10010822 | |||
| 1796 | Ga0157371_10178968 | |||
| 1797 | Ga0157370_10018923 | |||
| 1798 | Ga0157370_10022083 | |||
| 1799 | Ga0157370_10109337 | |||
| 1800 | Ga0157369_10012851 | |||
| 1801 | Ga0157369_10237379 | |||
| 1802 | Ga0157369_10382635 | |||
| 1803 | Ga0157374_10012339 | |||
| 1804 | Ga0157374_10287176 | |||
| 1805 | Ga0157378_10006735 | |||
| 1806 | Ga0157378_10073149 | |||
| 1807 | Ga0157378_10220717 | |||
| 1808 | Ga0157378_10447402 | |||
| 1809 | Ga0157378_10870715 | |||
| 1810 | Ga0163162_10004532 | |||
| 1811 | Ga0163162_10213855 | |||
| 1812 | Ga0163162_10594627 | |||
| 1813 | Ga0163162_11855357 | |||
| 1814 | Ga0163162_12134791 | |||
| 1815 | Ga0157372_10019801 | |||
| 1816 | Ga0157372_10064568 | |||
| 1817 | Ga0157372_10367294 | |||
| 1818 | Ga0157372_10888664 | |||
| 1819 | Ga0157375_10043922 | |||
| 1820 | Ga0157375_10196112 | |||
| 1821 | Ga0157375_10396202 | |||
| 1822 | Ga0157375_11372090 | |||
| 1823 | Ga0163163_10026373 | |||
| 1824 | Ga0163163_10143990 | |||
| 1825 | Ga0157380_10003574 | |||
| 1826 | Ga0157380_10118277 | |||
| 1827 | Ga0157380_10659844 | |||
| 1828 | Ga0157380_11283587 | |||
| 1829 | Ga0157380_11873382 | |||
| 1830 | Ga0157377_10254445 | |||
| 1831 | Ga0157377_10488350 | |||
| 1832 | Ga0157377_10667616 | |||
| 1833 | Ga0157377_11316939 | |||
| 1834 | Ga0157377_11477652 | |||
| 1835 | Ga0157379_10015080 | |||
| 1836 | Ga0157379_10016719 | |||
| 1837 | Ga0157379_10152930 | |||
| 1838 | Ga0157379_10472628 | |||
| 1839 | Ga0157379_10694896 | |||
| 1840 | Ga0157379_10892907 | |||
| 1841 | Ga0157376_10000606 | |||
| 1842 | Ga0157376_10470382 | |||
| 1843 | Ga0157376_10783890 | |||
| 1844 | Ga0163161_10002394 | |||
| 1845 | Ga0163161_10009458 | |||
| 1846 | Ga0163161_10116346 | |||
| 1847 | Ga0163161_10759798 | |||
| 1848 | Ga0197907_11483265 | |||
| 1849 | Ga0213872_10132952 | |||
| 1850 | Ga0213876_10022060 | |||
| 1851 | Ga0213876_10423739 | |||
| 1852 | Ga0213871_10030922 | |||
| 1853 | Ga0224572_1093388 | |||
| 1854 | Ga0209676_1008643 | |||
| 1855 | Ga0209758_1016521 | |||
| 1856 | Ga0209758_1054523 | |||
| 1857 | Ga0209050_1014417 | |||
| 1858 | Ga0209256_1029617 | |||
| 1859 | Ga0209051_1011025 | |||
| 1860 | Ga0209257_1007191 | |||
| 1861 | Ga0207656_10227735 | |||
| 1862 | Ga0207653_10001732 | |||
| 1863 | Ga0207653_10008442 | |||
| 1864 | Ga0207692_10002601 | |||
| 1865 | Ga0207642_10179543 | |||
| 1866 | Ga0207642_10188324 | |||
| 1867 | Ga0207642_10280697 | |||
| 1868 | Ga0207710_10033641 | |||
| 1869 | Ga0207710_10247588 | |||
| 1870 | Ga0207688_10000685 | |||
| 1871 | Ga0207680_10004197 | |||
| 1872 | Ga0207647_10001956 | |||
| 1873 | Ga0207647_10026538 | |||
| 1874 | Ga0207647_10126221 | |||
| 1875 | Ga0207685_10039371 | |||
| 1876 | Ga0207699_10000692 | |||
| 1877 | Ga0207699_10334343 | |||
| 1878 | Ga0207699_10645384 | |||
| 1879 | Ga0207645_10012210 | |||
| 1880 | Ga0207645_10254541 | |||
| 1881 | Ga0207645_10296051 | |||
| 1882 | Ga0207645_10370527 | |||
| 1883 | Ga0207643_10190093 | |||
| 1884 | Ga0207643_10612253 | |||
| 1885 | Ga0207705_10102282 | |||
| 1886 | Ga0207684_10423995 | |||
| 1887 | Ga0207684_10668588 | |||
| 1888 | Ga0207654_10008946 | |||
| 1889 | Ga0207654_10019158 | |||
| 1890 | Ga0207654_10545463 | |||
| 1891 | Ga0207654_11098240 | |||
| 1892 | Ga0207707_10004025 | |||
| 1893 | Ga0207707_10126099 | |||
| 1894 | Ga0207707_10148837 | |||
| 1895 | Ga0207707_10203186 | |||
| 1896 | Ga0207707_10303093 | |||
| 1897 | Ga0207695_10473876 | |||
| 1898 | Ga0207695_10525623 | |||
| 1899 | Ga0207671_10081612 | |||
| 1900 | Ga0207671_10083800 | |||
| 1901 | Ga0207671_10239751 | |||
| 1902 | Ga0207671_10459644 | |||
| 1903 | Ga0207693_10002667 | |||
| 1904 | Ga0207693_10050769 | |||
| 1905 | Ga0207693_10343264 | |||
| 1906 | Ga0207693_10438020 | |||
| 1907 | Ga0207663_10001067 | |||
| 1908 | Ga0207663_10547133 | |||
| 1909 | Ga0207660_10018343 | |||
| 1910 | Ga0207660_10036326 | |||
| 1911 | Ga0207660_10063001 | |||
| 1912 | Ga0207660_10343883 | |||
| 1913 | Ga0207662_10002067 | |||
| 1914 | Ga0207662_10455378 | |||
| 1915 | Ga0207662_10570154 | |||
| 1916 | Ga0207657_10000282 | |||
| 1917 | Ga0207657_10032470 | |||
| 1918 | Ga0207657_10569233 | |||
| 1919 | Ga0207657_10847256 | |||
| 1920 | Ga0207649_10028091 | |||
| 1921 | Ga0207649_10216538 | |||
| 1922 | Ga0207649_10887824 | |||
| 1923 | Ga0207652_10049921 | |||
| 1924 | Ga0207652_10066636 | |||
| 1925 | Ga0207652_10292555 | |||
| 1926 | Ga0207652_11164199 | |||
| 1927 | Ga0207646_10246047 | |||
| 1928 | Ga0207646_10737384 | |||
| 1929 | Ga0207681_10084571 | |||
| 1930 | Ga0207681_10453056 | |||
| 1931 | Ga0207694_10036374 | |||
| 1932 | Ga0207694_10605319 | |||
| 1933 | Ga0207694_10866786 | |||
| 1934 | Ga0207650_10012981 | |||
| 1935 | Ga0207659_10116815 | |||
| 1936 | Ga0207659_10746692 | |||
| 1937 | Ga0207687_10003322 | |||
| 1938 | Ga0207687_10205948 | |||
| 1939 | Ga0207687_10695739 | |||
| 1940 | Ga0207700_10001020 | |||
| 1941 | Ga0207700_10022703 | |||
| 1942 | Ga0207700_10775292 | |||
| 1943 | Ga0207700_11051592 | |||
| 1944 | Ga0207700_11198204 | |||
| 1945 | Ga0207644_10171793 | |||
| 1946 | Ga0207644_10176747 | |||
| 1947 | Ga0207690_10073607 | |||
| 1948 | Ga0207690_10180182 | |||
| 1949 | Ga0207690_10271737 | |||
| 1950 | Ga0207690_10316459 | |||
| 1951 | Ga0207690_10628381 | |||
| 1952 | Ga0207690_10874361 | |||
| 1953 | Ga0207706_10000270 | |||
| 1954 | Ga0207706_10058445 | |||
| 1955 | Ga0207706_10107100 | |||
| 1956 | Ga0207706_10631627 | |||
| 1957 | Ga0207706_10663538 | |||
| 1958 | Ga0207706_10857337 | |||
| 1959 | Ga0207686_10302879 | |||
| 1960 | Ga0207709_10006830 | |||
| 1961 | Ga0207709_10109558 | |||
| 1962 | Ga0207709_10131695 | |||
| 1963 | Ga0207709_10523121 | |||
| 1964 | Ga0207709_11133556 | |||
| 1965 | Ga0207670_10000642 | |||
| 1966 | Ga0207670_10029223 | |||
| 1967 | Ga0207670_10673025 | |||
| 1968 | Ga0207670_10721099 | |||
| 1969 | Ga0207670_10730585 | |||
| 1970 | Ga0207670_11415890 | |||
| 1971 | Ga0207669_10084859 | |||
| 1972 | Ga0207669_10153276 | |||
| 1973 | Ga0207669_10632456 | |||
| 1974 | Ga0207704_10059428 | |||
| 1975 | Ga0207704_11243992 | |||
| 1976 | Ga0207665_10000898 | |||
| 1977 | Ga0207665_10163210 | |||
| 1978 | Ga0207665_10242056 | |||
| 1979 | Ga0207691_10057833 | |||
| 1980 | Ga0207691_11023799 | |||
| 1981 | Ga0207711_10003368 | |||
| 1982 | Ga0207711_11126324 | |||
| 1983 | Ga0207689_10076718 | |||
| 1984 | Ga0207689_10212476 | |||
| 1985 | Ga0207689_10360679 | |||
| 1986 | Ga0207689_10490702 | |||
| 1987 | Ga0207661_10080767 | |||
| 1988 | Ga0207679_10001363 | |||
| 1989 | Ga0207679_10098094 | |||
| 1990 | Ga0207679_11191740 | |||
| 1991 | Ga0207667_10035591 | |||
| 1992 | Ga0207667_10078715 | |||
| 1993 | Ga0207667_10221936 | |||
| 1994 | Ga0207667_10586223 | |||
| 1995 | Ga0207667_11412906 | |||
| 1996 | Ga0207667_11436670 | |||
| 1997 | Ga0207651_10223211 | |||
| 1998 | Ga0207651_10770582 | |||
| 1999 | Ga0207712_10001373 | |||
| 2000 | Ga0207712_10013838 | |||
| 2001 | Ga0207712_11409388 | |||
| 2002 | Ga0207668_10006213 | |||
| 2003 | Ga0207668_10095533 | |||
| 2004 | Ga0207668_10126956 | |||
| 2005 | Ga0207668_10718232 | |||
| 2006 | Ga0207668_11212400 | |||
| 2007 | Ga0207668_11431729 | |||
| 2008 | Ga0207668_11545160 | |||
| 2009 | Ga0207640_10078850 | |||
| 2010 | Ga0207640_10093395 | |||
| 2011 | Ga0207640_10324387 | |||
| 2012 | Ga0207640_10417543 | |||
| 2013 | Ga0207658_10029474 | |||
| 2014 | Ga0207658_10234178 | |||
| 2015 | Ga0207658_10268558 | |||
| 2016 | Ga0207658_10399861 | |||
| 2017 | Ga0207658_11214489 | |||
| 2018 | Ga0207677_10013013 | |||
| 2019 | Ga0207677_10705069 | |||
| 2020 | Ga0207703_10004600 | |||
| 2021 | Ga0207703_10073903 | |||
| 2022 | Ga0207703_10107868 | |||
| 2023 | Ga0207703_10185199 | |||
| 2024 | Ga0207703_10598623 | |||
| 2025 | Ga0207639_10037169 | |||
| 2026 | Ga0207639_10039336 | |||
| 2027 | Ga0207639_10866690 | |||
| 2028 | Ga0207639_11005581 | |||
| 2029 | Ga0207678_10000118 | |||
| 2030 | Ga0207678_10001987 | |||
| 2031 | Ga0207678_10061912 | |||
| 2032 | Ga0207678_10110263 | |||
| 2033 | Ga0207678_10165656 | |||
| 2034 | Ga0207678_10421822 | |||
| 2035 | Ga0207678_10900854 | |||
| 2036 | Ga0207708_10013264 | |||
| 2037 | Ga0207708_10025042 | |||
| 2038 | Ga0207708_10158056 | |||
| 2039 | Ga0207708_10232694 | |||
| 2040 | Ga0207708_10241021 | |||
| 2041 | Ga0207708_10448455 | |||
| 2042 | Ga0207708_10559405 | |||
| 2043 | Ga0207708_10662461 | |||
| 2044 | Ga0207702_10041809 | |||
| 2045 | Ga0207702_10327512 | |||
| 2046 | Ga0207641_10396814 | |||
| 2047 | Ga0207641_10574227 | |||
| 2048 | Ga0207641_11146540 | |||
| 2049 | Ga0207641_11671657 | |||
| 2050 | Ga0207648_10012357 | |||
| 2051 | Ga0207648_10246208 | |||
| 2052 | Ga0207648_10465295 | |||
| 2053 | Ga0207648_10504985 | |||
| 2054 | Ga0207648_10870603 | |||
| 2055 | Ga0207676_10028970 | |||
| 2056 | Ga0207676_10132645 | |||
| 2057 | Ga0207676_10415696 | |||
| 2058 | Ga0207674_10022215 | |||
| 2059 | Ga0207674_10047521 | |||
| 2060 | Ga0207674_10404751 | |||
| 2061 | Ga0207675_100001292 | |||
| 2062 | Ga0207675_100062290 | |||
| 2063 | Ga0207675_100203980 | |||
| 2064 | Ga0207675_100331062 | |||
| 2065 | Ga0207675_100572559 | |||
| 2066 | Ga0207683_10001738 | |||
| 2067 | Ga0207683_10062468 | |||
| 2068 | Ga0207698_10016384 | |||
| 2069 | Ga0207698_10105982 | |||
| 2070 | Ga0209983_1050263 | |||
| 2071 | Ga0209998_10024125 | |||
| 2072 | Ga0209998_10090624 | |||
| 2073 | Ga0209813_10007002 | |||
| 2074 | Ga0209813_10015540 | |||
| 2075 | Ga0209813_10015864 | |||
| 2076 | Ga0209974_10159032 | |||
| 2077 | Ga0207428_10063093 | |||
| 2078 | Ga0207428_10091218 | |||
| 2079 | Ga0207428_10126762 | |||
| 2080 | Ga0207428_10142958 | |||
| 2081 | Ga0207428_10397050 | |||
| 2082 | Ga0207428_10455529 | |||
| 2083 | Ga0268266_10030323 | |||
| 2084 | Ga0268266_10317764 | |||
| 2085 | Ga0268266_10466616 | |||
| 2086 | Ga0268266_10777071 | |||
| 2087 | Ga0268266_11289615 | |||
| 2088 | Ga0268265_10002634 | |||
| 2089 | Ga0268265_10259078 | |||
| 2090 | Ga0268265_10788200 | |||
| 2091 | Ga0268264_10062737 | |||
| 2092 | Ga0268264_10546665 | |||
| 2093 | Ga0268264_10555818 | |||
| 2094 | Ga0265760_10094842 | |||
| 2095 | Ga0265330_10049935 | |||
| 2096 | Ga0265330_10087553 | |||
| 2097 | Ga0265332_10089584 | |||
| 2098 | Ga0265332_10386488 | |||
| 2099 | Ga0265328_10006537 | |||
| 2100 | Ga0265328_10098118 | |||
| 2101 | Ga0265325_10038876 | |||
| 2102 | Ga0265340_10256356 | |||
| 2103 | Ga0265339_10004332 | |||
| 2104 | Ga0265331_10004690 | |||
| 2105 | Ga0265331_10033198 | |||
| 2106 | Ga0265331_10077686 | |||
| 2107 | Ga0265316_10028405 | |||
| 2108 | Ga0265316_10049860 | |||
| 2109 | Ga0307513_10051533 | |||
| 2110 | Ga0265313_10099214 | |||
| 2111 | Ga0316575_10041479 | |||
| 2112 | Ga0316579_10033148 | |||
| 2113 | Ga0265314_10011275 | |||
| 2114 | Ga0265314_10068619 | |||
| 2115 | Ga0265342_10560019 | |||
| 2116 | Ga0316576_10024290 | |||
| 2117 | Ga0316576_10079460 | |||
| 2118 | Ga0316578_10109648 | |||
| 2119 | Ga0316578_10110133 | |||
| 2120 | Ga0307516_10044963 | |||
| 2121 | Ga0316577_10009470 | |||
| 2122 | Ga0307413_10754168 | |||
| 2123 | Ga0307410_10621707 | |||
| 2124 | Ga0307406_10036177 | |||
| 2125 | Ga0307407_10643051 | |||
| 2126 | Ga0307412_10073835 | |||
| 2127 | Ga0307412_10188353 | |||
| 2128 | Ga0307412_11157684 | |||
| 2129 | Ga0307415_100310957 | |||
| 2130 | Ga0307415_101727444 | |||
| 2131 | Ga0316583_10006475 | |||
| 2132 | Ga0316585_10000354 | |||
| 2133 | Ga0316580_10004849 | |||
| 2134 | Ga0316593_10004600 | |||
| 2135 | Ga0316593_10137614 | |||
| 2136 | Ga0316593_10334379 | |||
| 2137 | Ga0316592_1000038 | |||
| 2138 | Ga0316586_1000750 | |||
| 2139 | Ga0316587_1026022 | |||
| 2140 | Ga0316596_1000071 | |||
| 2141 | Ga0316596_1000341 | |||
| 2142 | Ga0373958_0002782 | |||
| 2143 | Ga0373958_0007763 | |||
| 2144 | Ga0373958_0199378 | |||
| 2145 | Ga0373959_0092431 | |||
| 2146 | Ga0373959_0153067 | |||
| 2147 | Ga0373928_0022650 | |||
| 2148 | Ga0373928_0121457 | |||
| 2149 | Ga0373929_0039124 | |||
| 2150 | Ga0373934_0059436 | |||
| 2151 | Ga0373940_0094714 | |||
| 2152 | Ga0373944_0016534 | |||
| 2153 | Ga0373944_0194227 | |||
| 2154 | Ga0373949_0005456 | |||
| 2155 | Ga0373949_0007190 | |||
| 2156 | Ga0373951_0026168 | |||
| 2157 | Ga0373951_0026176 | |||
| 2158 | Ga0373951_0098987 | |||
| 2159 | Ga0373951_0115755 | |||
| 2160 | Ga0373923_0036411 | |||
| 2161 | Ga0373932_0021762 | |||
| 2162 | Ga0373932_0170764 | |||
| 2163 | Ga0373932_0312795 | |||
| 2164 | Ga0373939_0010771 | |||
| 2165 | Ga0373939_0140327 | |||
| 2166 | Ga0373941_0016203 | |||
| 2167 | Ga0373953_0012782 | |||
| 2168 | Ga0373954_0047545 | |||
| 2169 | Ga0373954_0198084 | |||
| 2170 | Ga0373956_0065806 | |||
| 2171 | Ga0373957_0056667 | |||
| 2172 | Ga0373957_0102117 | |||
| 2173 | Ga0373960_0043759 | |||
| 2174 | Ga0373960_0171541 | |||
| 2175 | Ga0373960_0298427 | |||
| 2176 | Ga0373943_0101641 | |||
| 2177 | Ga0373955_0085186 | |||
| 2178 | Ga0373942_0030108 | |||
| 2179 | Ga0373961_0056190 | |||
| 2180 | Ga0373961_0115072 | |||
| 2181 | Ga0373962_0002684 | |||
| 2182 | Ga0373962_0153953 | |||
| 2183 | Ga0316574_0199041 | |||
| 2184 | Ga0316574_0440126 | |||
| 2185 | Ga0373924_0046598 | |||
| 2186 | Ga0373931_0000685 | |||
| 2187 | Ga0373931_0008300 | |||
| 2188 | Ga0373931_0011519 | |||
| 2189 | Ga0373931_0037963 | |||
| 2190 | Ga0373931_0109918 | |||
| 2191 | Ga0373935_0195031 | |||
| 2192 | Ga0373935_0244761 | |||
| 2193 | Ga0373935_0381976 | |||
| 2194 | Ga0373927_0002605 | |||
| 2195 | Ga0373927_0023112 | |||
| 2196 | Ga0373927_0028547 | |||
| 2197 | Ga0373933_0018678 | |||
| 2198 | Ga0373933_1098334 | |||
| 2199 | Ga0373947_0008559 | |||
| 2200 | Ga0373947_0083872 | |||
| 2201 | Ga0373947_0376656 | |||
| 2202 | Ga0373947_0826018 | |||
| 2203 | Ga0373937_0137277 | |||
| 2204 | Ga0373937_0139978 | |||
| 2205 | Ga0373937_0692262 | |||
| 2206 | Ga0373937_0876545 | |||
| 2207 | Ga0310112_011278 | |||
| 2208 | Ga0316582_0193869 | |||
| 2209 | Ga0316584_0001985 | |||
| 2210 | Ga0316584_0030059 | |||
| 2211 | Ga0373925_0045923 | |||
| 2212 | Ga0373925_0052738 | |||
| 2213 | Ga0373925_0148264 | |||
| 2214 | Ga0373925_0836978 | |||
| 2215 | Ga0373925_1363849 | |||
| 2216 | Ga0395899_0457765 | |||
| 2217 | Ga0395900_0065470 | |||
| 2218 | Ga0395898_0004337 | |||
| 2219 | Ga0395905_0002506 | |||
| 2220 | Ga0316581_0015698 | |||
| 2221 | Ga0395901_0002674 | |||
| 2222 | Ga0400483_133534 | |||
| 2223 | Ga0400483_267907 | |||
| 2224 | Ga0400489_21280 | |||
| 2225 | Ga0436365_0373305 | |||
| 2226 | Ga0436365_1239138 | |||
| 2227 | Ga0436360_0571027 | |||
| 2228 | Ga0436360_0645792 | |||
| 2229 | Ga0436360_0817917 | |||
| 2230 | Ga0436360_1044379 | |||
| 2231 | Ga0436360_1063772 | |||
| 2232 | Ga0436361_0083999 | |||
| 2233 | Ga0436361_0430933 | |||
| 2234 | Ga0436361_0586937 | |||
| 2235 | Ga0436361_0611695 | |||
| 2236 | Ga0436362_0086357 | |||
| 2237 | Ga0436362_0587836 | |||
| 2238 | Ga0439450_121751 | |||
| 2239 | Ga0439435_0081480 | |||
| 2240 | Ga0439444_0072780 | |||
| 2241 | Ga0451577_0000008 | |||
| 2242 | Ga0451577_0083132 | |||
| 2243 | Ga0451577_0414523 | |||
| 2244 | Ga0453683_0197226 | |||
| 2245 | Ga0453683_1113283 | |||
| 2246 | Ga0466966_0477214 | |||
| 2247 | Ga0453684_0000032 | |||
| 2248 | Ga0453684_0000652 | |||
| 2249 | Ga0453684_0003639 | |||
| 2250 | Ga0453684_0005247 | |||
| 2251 | Ga0453684_0008205 | |||
| 2252 | Ga0453684_0010967 | |||
| 2253 | Ga0453684_0597072 | |||
| 2254 | Ga0466968_0125467 | |||
| 2255 | Ga0466970_0306312 | |||
| 2256 | Ga0451576_0060264 | |||
| 2257 | Ga0451576_0123410 | |||
| 2258 | Ga0451576_0170881 | |||
| 2259 | Ga0495592_0487702 | |||
| 2260 | Ga0495603_0000644 | |||
| 2261 | Ga0495590_0179042 | |||
| 2262 | Ga0495629_0000177 | |||
| 2263 | Ga0495638_0201963 | |||
| 2264 | Ga0495638_0230829 | |||
| 2265 | Ga0495638_0341699 | |||
| 2266 | Ga0495651_0385215 | |||
| 2267 | Ga0495580_0000498 | |||
| 2268 | Ga0495580_0054202 | |||
| 2269 | Ga0495580_0148738 | |||
| 2270 | Ga0495580_0218192 | |||
| 2271 | Ga0495582_0000185 | |||
| 2272 | Ga0495639_0002889 | |||
| 2273 | Ga0495664_0155753 | |||
| 2274 | Ga0495584_0019937 | |||
| 2275 | Ga0495584_0456114 | |||
| 2276 | Ga0495594_0000023 | |||
| 2277 | Ga0495607_0138995 | |||
| 2278 | Ga0495583_0350624 | |||
| 2279 | Ga0495608_0258169 | |||
| 2280 | Ga0495628_0603188 | |||
| 2281 | Ga0495631_0323793 | |||
| 2282 | Ga0495643_0178632 | |||
| 2283 | Ga0495644_0097060 | |||
| 2284 | Ga0495644_0185129 | |||
| 2285 | Ga0495666_0089895 | |||
| 2286 | Ga0495666_0302972 | |||
| 2287 | Ga0495652_0108553 | |||
| 2288 | Ga0495654_0005576 | |||
| 2289 | Ga0495665_0158714 | |||
| 2290 | Ga0495640_0536766 | |||
| 2291 | Ga0495640_0667962 | |||
| 2292 | Ga0495587_0060127 | |||
| 2293 | Ga0495609_0264142 | |||
| 2294 | Ga0495622_0012059 | |||
| 2295 | Ga0495633_0160999 | |||
| 2296 | Ga0495667_0047741 | |||
| 2297 | Ga0495668_0053374 | |||
| 2298 | Ga0495634_0033371 | |||
| 2299 | Ga0495625_0151632 | |||
| 2300 | Ga0495635_0294666 | |||
| 2301 | Ga0495659_0029200 | |||
| 2302 | Ga0495661_0179077 | |||
| 2303 | Ga0495588_0112637 | |||
| 2304 | Ga0495657_0079161 | |||
| 2305 | Ga0495657_0900145 | |||
| 2306 | Ga0495647_0021652 | |||
| 2307 | Ga0495658_0002288 | |||
| 2308 | Ga0495613_0000209 | |||
| 2309 | Ga0495624_0244080 | |||
| 2310 | Ga0495670_0233670 | |||
| 2311 | Ga0495670_0407470 | |||
| 2312 | Ga0495671_0452285 | |||
| 2313 | Ga0495589_0216761 | |||
| 2314 | Ga0495660_0165098 | |||
| 2315 | Ga0495581_0001042 | |||
| 2316 | Ga0495604_0087435 | |||
| 2317 | Ga0495672_0127853 | |||
| 2318 | Ga0495672_0243898 | |||
| 2319 | Ga0495676_0013652 | |||
| 2320 | Ga0495676_0595926 | |||
| 2321 | Ga0495680_0823796 | |||
| 2322 | Ga0495683_0157375 | |||
| 2323 | Ga0495675_0066595 | |||
| 2324 | Ga0495677_0056224 | |||
| 2325 | Ga0495684_0479018 | |||
| 2326 | Ga0495593_0000822 | |||
| 2327 | Ga0495614_0000618 | |||
| 2328 | Ga0495626_0180140 | |||
| 2329 | Ga0496100_0011664 | |||
| 2330 | Ga0496100_0063587 | |||
| 2331 | Ga0496100_0072381 | |||
| 2332 | Ga0496100_0074061 | |||
| 2333 | Ga0496100_0131383 | |||
| 2334 | Ga0496100_0540612 | |||
| 2335 | Ga0496100_0562191 | |||
| 2336 | Ga0496101_0009865 | |||
| 2337 | Ga0496101_0014103 | |||
| 2338 | Ga0496101_0158638 | |||
| 2339 | Ga0496101_0180244 | |||
| 2340 | Ga0496101_0222451 | |||
| 2341 | Ga0496101_0400471 | |||
| 2342 | Ga0496101_0529491 | |||
| 2343 | Ga0496101_0746767 | |||
| 2344 | Ga0496101_0781035 | |||
| 2345 | Ga0496101_0861968 | |||
| 2346 | Ga0496101_1278358 | |||
| 2347 | Ga0496102_0003666 | |||
| 2348 | Ga0496102_0021232 | |||
| 2349 | Ga0496102_0037637 | |||
| 2350 | Ga0496102_0054619 | |||
| 2351 | Ga0496102_0086307 | |||
| 2352 | Ga0496102_0142179 | |||
| 2353 | Ga0496102_0167272 | |||
| 2354 | Ga0496102_0258273 | |||
| 2355 | Ga0496102_0883914 | |||
| 2356 | Ga0496103_0004549 | |||
| 2357 | Ga0496103_0053968 | |||
| 2358 | Ga0496103_0054499 | |||
| 2359 | Ga0496103_0085750 | |||
| 2360 | Ga0496103_0137323 | |||
| 2361 | Ga0496103_0143434 | |||
| 2362 | Ga0496103_0176728 | |||
| 2363 | Ga0496103_0886414 | |||
| 2364 | Ga0496104_0000216 | |||
| 2365 | Ga0496104_0002392 | |||
| 2366 | Ga0496104_0011428 | |||
| 2367 | Ga0496104_0047709 | |||
| 2368 | Ga0496104_0137839 | |||
| 2369 | Ga0496104_0164226 | |||
| 2370 | Ga0496104_0356915 | |||
| 2371 | Ga0496104_0533539 | |||
| 2372 | Ga0496104_0784088 | |||
| 2373 | Ga0496104_1212750 | |||
| 2374 | Ga0496105_0006833 | |||
| 2375 | Ga0496105_0007408 | |||
| 2376 | Ga0496105_0181573 | |||
| 2377 | Ga0496105_0195984 | |||
| 2378 | Ga0496105_0248773 | |||
| 2379 | Ga0496105_0355062 | |||
| 2380 | Ga0496105_0790024 | |||
| 2381 | Ga0496105_1339131 | |||
| 2382 | Ga0496106_0014032 | |||
| 2383 | Ga0496106_0020151 | |||
| 2384 | Ga0496106_0034165 | |||
| 2385 | Ga0496106_0153542 | |||
| 2386 | Ga0496106_0203109 | |||
| 2387 | Ga0496106_0213960 | |||
| 2388 | Ga0496106_0503269 | |||
| 2389 | Ga0496106_1330790 | |||
| 2390 | Ga0496107_0002978 | |||
| 2391 | Ga0496107_0051098 | |||
| 2392 | Ga0496107_0087501 | |||
| 2393 | Ga0496107_0128296 | |||
| 2394 | Ga0496107_0161717 | |||
| 2395 | Ga0496107_0673999 | |||
| 2396 | Ga0496108_0029327 | |||
| 2397 | Ga0496108_0041617 | |||
| 2398 | Ga0496108_0152896 | |||
| 2399 | Ga0496108_0217641 | |||
| 2400 | Ga0496108_0286212 | |||
| 2401 | Ga0496108_0314137 | |||
| 2402 | Ga0496108_0752042 | |||
| 2403 | Ga0496108_0895023 | |||
| 2404 | Ga0496108_1160598 | |||
| 2405 | Ga0496109_0005439 | |||
| 2406 | Ga0496109_0019124 | |||
| 2407 | Ga0496109_0030933 | |||
| 2408 | Ga0496109_0046146 | |||
| 2409 | Ga0496109_0060268 | |||
| 2410 | Ga0496109_0185742 | |||
| 2411 | Ga0496109_0226901 | |||
| 2412 | Ga0496109_0381404 | |||
| 2413 | Ga0496110_0007047 | |||
| 2414 | Ga0496110_0024815 | |||
| 2415 | Ga0496110_0033078 | |||
| 2416 | Ga0496110_0035233 | |||
| 2417 | Ga0496110_0080612 | |||
| 2418 | Ga0496110_0092172 | |||
| 2419 | Ga0496110_0197312 | |||
| 2420 | Ga0496110_0397583 | |||
| 2421 | Ga0496110_0474394 | |||
| 2422 | Ga0496111_0000831 | |||
| 2423 | Ga0496111_0021719 | |||
| 2424 | Ga0496111_0036697 | |||
| 2425 | Ga0496111_0091964 | |||
| 2426 | Ga0496111_0210073 | |||
| 2427 | Ga0496111_0335788 | |||
| 2428 | Ga0496112_0013078 | |||
| 2429 | Ga0496112_0046858 | |||
| 2430 | Ga0496112_0054785 | |||
| 2431 | Ga0496112_0064649 | |||
| 2432 | Ga0496112_0068039 | |||
| 2433 | Ga0496112_0290465 | |||
| 2434 | Ga0496112_0675044 | |||
| 2435 | Ga0496113_0034328 | |||
| 2436 | Ga0496113_0067510 | |||
| 2437 | Ga0496113_0210369 | |||
| 2438 | Ga0496114_0006659 | |||
| 2439 | Ga0496114_0049973 | |||
| 2440 | Ga0496114_0109813 | |||
| 2441 | Ga0496114_0544702 | |||
| 2442 | Ga0496114_0854744 | |||
| 2443 | Ga0496114_1061057 | |||
| 2444 | Ga0496115_0027506 | |||
| 2445 | Ga0496115_0028276 | |||
| 2446 | Ga0496115_0035138 | |||
| 2447 | Ga0496115_0089669 | |||
| 2448 | Ga0496115_0108912 | |||
| 2449 | Ga0496115_0213094 | |||
| 2450 | Ga0496115_0300579 | |||
| 2451 | Ga0496115_0572119 | |||
| 2452 | Ga0496115_0921778 | |||
| 2453 | Ga0496122_0002761 | |||
| 2454 | Ga0496123_0002923 | |||
| 2455 | Ga0496124_0104578 | |||
| 2456 | Ga0496124_0155757 | |||
| 2457 | Ga0496124_0174143 | |||
| 2458 | Ga0496126_0229728 | |||
| 2459 | Ga0496126_0723637 | |||
| 2460 | Ga0496126_0739606 | |||
| 2461 | Ga0501308_036951 | |||
| 2462 | Ga0501031_0015742 | |||
| 2463 | Ga0501031_0124425 | |||
| 2464 | Ga0501031_0817588 | |||
| 2465 | Ga0501032_0026968 | |||
| 2466 | Ga0501032_0180814 | |||
| 2467 | Ga0501032_0403613 | |||
| 2468 | Ga0501032_0413034 | |||
| 2469 | Ga0501032_0494865 | |||
| 2470 | Ga0501033_0637546 | |||
| 2471 | Ga0501033_0688421 | |||
| 2472 | Ga0501033_0912419 | |||
| 2473 | Ga0501033_0940705 | |||
| 2474 | Ga0501034_0084509 | |||
| 2475 | Ga0501034_0423062 | |||
| 2476 | Ga0501036_0011493 | |||
| 2477 | Ga0501036_0509958 | |||
| 2478 | Ga0501036_0943255 | |||
| 2479 | Ga0501036_0957382 | |||
| 2480 | Ga0501036_0962178 | |||
| 2481 | Ga0501037_0368428 | |||
| 2482 | Ga0501037_0454662 | |||
| 2483 | Ga0501037_0508563 | |||
| 2484 | Ga0501037_0632712 | |||
| 2485 | Ga0501037_0722531 | |||
| 2486 | Ga0501038_0040318 | |||
| 2487 | Ga0501038_0043951 | |||
| 2488 | Ga0501038_0103763 | |||
| 2489 | Ga0501038_0215612 | |||
| 2490 | Ga0501038_0244434 | |||
| 2491 | Ga0501038_0377332 | |||
| 2492 | Ga0501039_0047469 | |||
| 2493 | Ga0501039_0102579 | |||
| 2494 | Ga0501039_0111547 | |||
| 2495 | Ga0501039_0298062 | |||
| 2496 | Ga0501039_0458142 | |||
| 2497 | Ga0501039_0488920 | |||
| 2498 | Ga0501039_0791487 | |||
| 2499 | Ga0501040_0028204 | |||
| 2500 | Ga0501040_0131387 | |||
| 2501 | Ga0501040_0154989 | |||
| 2502 | Ga0501040_0365950 | |||
| 2503 | Ga0501040_0477028 | |||
| 2504 | Ga0501040_0716713 | |||
| 2505 | Ga0501041_0021811 | |||
| 2506 | Ga0501041_0092487 | |||
| 2507 | Ga0501041_0105027 | |||
| 2508 | Ga0501041_0117214 | |||
| 2509 | Ga0501041_0126602 | |||
| 2510 | Ga0501041_0180825 | |||
| 2511 | Ga0501041_0228652 | |||
| 2512 | Ga0501041_0498414 | |||
| 2513 | Ga0501042_0017762 | |||
| 2514 | Ga0501042_0099190 | |||
| 2515 | Ga0501042_0112951 | |||
| 2516 | Ga0501042_0200366 | |||
| 2517 | Ga0501042_0404909 | |||
| 2518 | Ga0501042_0682073 | |||
| 2519 | Ga0501043_0258134 | |||
| 2520 | Ga0501043_0515946 | |||
| 2521 | Ga0501043_0753919 | |||
| 2522 | Ga0501046_0002625 | |||
| 2523 | Ga0501046_0324190 | |||
| 2524 | Ga0501046_0546387 | |||
| 2525 | Ga0501046_0626781 | |||
| 2526 | Ga0501046_0638158 | |||
| 2527 | Ga0501047_0040402 | |||
| 2528 | Ga0501048_0193045 | |||
| 2529 | Ga0501048_0258396 | |||
| 2530 | Ga0501048_0337337 | |||
| 2531 | Ga0501048_0396254 | |||
| 2532 | Ga0501048_0456270 | |||
| 2533 | Ga0501048_0469464 | |||
| 2534 | Ga0501067_0056296 | |||
| 2535 | Ga0501067_0288344 | |||
| 2536 | Ga0501068_0109422 | |||
| 2537 | Ga0501068_0130935 | |||
| 2538 | Ga0501068_0154445 | |||
| 2539 | Ga0501068_0418936 | |||
| 2540 | Ga0501068_0959895 | |||
| 2541 | Ga0501069_0096618 | |||
| 2542 | Ga0501069_0356825 | |||
| 2543 | Ga0501069_0537782 | |||
| 2544 | Ga0501070_0067955 | |||
| 2545 | Ga0501070_0518013 | |||
| 2546 | Ga0501070_0918108 | |||
| 2547 | Ga0501071_0024493 | |||
| 2548 | Ga0501071_0032410 | |||
| 2549 | Ga0501071_0063978 | |||
| 2550 | Ga0501071_0092876 | |||
| 2551 | Ga0501071_0100192 | |||
| 2552 | Ga0501071_0237972 | |||
| 2553 | Ga0501071_0411846 | |||
| 2554 | Ga0501071_0845326 | |||
| 2555 | Ga0501071_0946092 | |||
| 2556 | Ga0501071_1471194 | |||
| 2557 | Ga0501072_0007998 | |||
| 2558 | Ga0501072_0051029 | |||
| 2559 | Ga0501072_0177462 | |||
| 2560 | Ga0501072_0220656 | |||
| 2561 | Ga0501072_0303812 | |||
| 2562 | Ga0501072_0350941 | |||
| 2563 | Ga0501072_0628981 | |||
| 2564 | Ga0501072_0793966 | |||
| 2565 | Ga0501073_0003226 | |||
| 2566 | Ga0501073_0034381 | |||
| 2567 | Ga0501073_0185954 | |||
| 2568 | Ga0501073_0224250 | |||
| 2569 | Ga0501073_0226708 | |||
| 2570 | Ga0501073_0273992 | |||
| 2571 | Ga0501073_0333103 | |||
| 2572 | Ga0501073_0485092 | |||
| 2573 | Ga0501073_0911896 | |||
| 2574 | Ga0501074_0049751 | |||
| 2575 | Ga0501074_0071636 | |||
| 2576 | Ga0501074_0088706 | |||
| 2577 | Ga0501074_0152505 | |||
| 2578 | Ga0501074_0161149 | |||
| 2579 | Ga0501074_0697669 | |||
| 2580 | Ga0501074_0862709 | |||
| 2581 | Ga0501075_0069225 | |||
| 2582 | Ga0501075_0118370 | |||
| 2583 | Ga0501075_0136404 | |||
| 2584 | Ga0501075_0139726 | |||
| 2585 | Ga0501075_0193490 | |||
| 2586 | Ga0501075_0265147 | |||
| 2587 | Ga0501075_0303252 | |||
| 2588 | Ga0501075_0484004 | |||
| 2589 | Ga0501075_0529279 | |||
| 2590 | Ga0501075_0596746 | |||
| 2591 | Ga0501076_0000421 | |||
| 2592 | Ga0501076_0030475 | |||
| 2593 | Ga0501076_0050061 | |||
| 2594 | Ga0501076_0057669 | |||
| 2595 | Ga0501076_0382244 | |||
| 2596 | Ga0501076_0984771 | |||
| 2597 | Ga0501077_0011663 | |||
| 2598 | Ga0501077_0019816 | |||
| 2599 | Ga0501077_0052806 | |||
| 2600 | Ga0501077_0065778 | |||
| 2601 | Ga0501077_0081898 | |||
| 2602 | Ga0501077_0117015 | |||
| 2603 | Ga0501077_0173814 | |||
| 2604 | Ga0501077_0178839 | |||
| 2605 | Ga0501077_0255735 | |||
| 2606 | Ga0501077_0723721 | |||
| 2607 | Ga0501238_002767 | |||
| 2608 | Ga0501079_0011059 | |||
| 2609 | Ga0501079_0015440 | |||
| 2610 | Ga0501079_0025437 | |||
| 2611 | Ga0501079_0029982 | |||
| 2612 | Ga0501079_0064992 | |||
| 2613 | Ga0501079_0085340 | |||
| 2614 | Ga0501079_0392322 | |||
| 2615 | Ga0501079_0533735 | |||
| 2616 | Ga0501079_0810015 | |||
| 2617 | Ga0501080_0027369 | |||
| 2618 | Ga0501080_0095552 | |||
| 2619 | Ga0501080_0141837 | |||
| 2620 | Ga0501080_0204600 | |||
| 2621 | Ga0501080_0251891 | |||
| 2622 | Ga0501080_0347057 | |||
| 2623 | Ga0501080_0488439 | |||
| 2624 | Ga0501080_0658635 | |||
| 2625 | Ga0501081_0003198 | |||
| 2626 | Ga0501081_0040953 | |||
| 2627 | Ga0501081_0047963 | |||
| 2628 | Ga0501081_0056768 | |||
| 2629 | Ga0501081_0077134 | |||
| 2630 | Ga0501081_0095052 | |||
| 2631 | Ga0501081_0172437 | |||
| 2632 | Ga0501081_0296293 | |||
| 2633 | Ga0501081_0644853 | |||
| 2634 | Ga0501081_1009083 | |||
| 2635 | Ga0501081_1094349 | |||
| 2636 | Ga0501083_0031587 | |||
| 2637 | Ga0501083_0102047 | |||
| 2638 | Ga0501083_0154544 | |||
| 2639 | Ga0501083_0205601 | |||
| 2640 | Ga0501269_020609 | |||
| 2641 | Ga0501035_0189930 | |||
| 2642 | Ga0501035_0459005 | |||
| 2643 | Ga0501035_0543506 | |||
| 2644 | Ga0501035_0898209 | |||
| 2645 | Ga0501044_0012400 | |||
| 2646 | Ga0501045_0013725 | |||
| 2647 | Ga0501045_0057300 | |||
| 2648 | Ga0501045_0060738 | |||
| 2649 | Ga0501045_0076359 | |||
| 2650 | Ga0501045_0243269 | |||
| 2651 | Ga0501045_0528192 | |||
| 2652 | Ga0501045_0811197 | |||
| 2653 | Ga0501045_0964782 | |||
| 2654 | Ga0501045_1337924 | |||
| 2655 | nmdc:mga03n38_26789_c1 | |||
| 2656 | nmdc:mga03n38_94395_c1 | |||
| 2657 | nmdc:mga00v17_114995_c1 | |||
| 2658 | nmdc:mga00v17_166581_c1 | |||
| 2659 | nmdc:mga0yw44_4728_c1 | |||
| 2660 | nmdc:mga0yw44_608088_c1 | |||
| 2661 | nmdc:mga0k408_197363_c1 | |||
| 2662 | nmdc:mga06z11_23902_c1 | |||
| 2663 | nmdc:mga06z11_284143_c1 | |||
| 2664 | nmdc:mga06z11_33224_c1 | |||
| 2665 | nmdc:mga04h51_18257_c1 | |||
| 2666 | nmdc:mga04h51_1973_c1 | |||
| 2667 | nmdc:mga04h51_23062_c1 | |||
| 2668 | nmdc:mga07m45_360574_c1 | |||
| 2669 | nmdc:mga05p37_1470845_c1 | |||
| 2670 | nmdc:mga05p37_159475_c1 | |||
| 2671 | nmdc:mga05p37_27138_c1 | |||
| 2672 | nmdc:mga05p37_301565_c1 | |||
| 2673 | nmdc:mga05p37_454063_c1 | |||
| 2674 | nmdc:mga05p37_49398_c1 | |||
| 2675 | nmdc:mga05p37_878206_c1 | |||
| 2676 | nmdc:mga09592_219384_c1 | |||
| 2677 | nmdc:mga09592_694129_c1 | |||
| 2678 | nmdc:mga0qj67_170797_c1 | |||
| 2679 | nmdc:mga0qj67_224050_c1 | |||
| 2680 | nmdc:mga0qj67_400386_c1 | |||
| 2681 | nmdc:mga0qj67_43677_c1 | |||
| 2682 | nmdc:mga06r32_207621_c1 | |||
| 2683 | nmdc:mga06r32_209769_c1 | |||
| 2684 | nmdc:mga06r32_2831_c1 | |||
| 2685 | nmdc:mga06r32_381632_c1 | |||
| 2686 | nmdc:mga06r32_45743_c1 | |||
| 2687 | nmdc:mga08y16_1006887_c1 | |||
| 2688 | nmdc:mga08y16_354098_c1 | |||
| 2689 | nmdc:mga08y16_479248_c1 | |||
| 2690 | nmdc:mga08y16_51471_c1 | |||
| 2691 | nmdc:mga08y16_560714_c1 | |||
| 2692 | nmdc:mga08y16_79584_c1 | |||
| 2693 | nmdc:mga0n895_1137071_c1 | |||
| 2694 | nmdc:mga0n895_1205724_c1 | |||
| 2695 | nmdc:mga0n895_200439_c1 | |||
| 2696 | nmdc:mga0n895_28374_c1 | |||
| 2697 | nmdc:mga0n895_30261_c1 | |||
| 2698 | nmdc:mga0rr50_13958_c1 | |||
| 2699 | nmdc:mga0rr50_173912_c1 | |||
| 2700 | nmdc:mga0rr50_6581_c1 | |||
| 2701 | nmdc:mga08x19_58182_c1 | |||
| 2702 | nmdc:mga0a205_17244_c1 | |||
| 2703 | nmdc:mga0a205_22301_c1 | |||
| 2704 | nmdc:mga0a205_377889_c1 | |||
| 2705 | nmdc:mga0a205_38046_c1 | |||
| 2706 | nmdc:mga0a205_56983_c1 | |||
| 2707 | nmdc:mga0a205_74311_c1 | |||
| 2708 | Ga0495601_0015804 | |||
| 2709 | Ga0495601_0033953 | |||
| 2710 | Ga0495601_0702920 | |||
| 2711 | Ga0495612_0039940 | |||
| 2712 | Ga0495655_0000679 | |||
| 2713 | Ga0495655_0028926 | |||
| 2714 | Ga0495595_0123678 | |||
| 2715 | Ga0495595_0430932 | |||
| 2716 | Ga0495619_0003085 | |||
| 2717 | Ga0495619_0040299 | |||
| 2718 | Ga0495619_0047711 | |||
| 2719 | Ga0495619_0412724 | |||
| 2720 | Ga0495619_0561373 | |||
| 2721 | Ga0500644_0230434 | |||
| 2722 | Ga0500646_0271481 | |||
| 2723 | Ga0500583_0267577 | |||
| 2724 | Ga0500651_0633458 | |||
| 2725 | Ga0500641_0136250 | |||
| 2726 | Ga0500641_0230867 | |||
| 2727 | Ga0500650_0065747 | |||
| 2728 | Ga0500650_0271518 | |||
| 2729 | Ga0500555_005793 | |||
| 2730 | Ga0500556_0001703 | |||
| 2731 | Ga0500556_0176632 | |||
| 2732 | Ga0500562_015287 | |||
| 2733 | Ga0500594_0164320 | |||
| 2734 | Ga0500618_005553 | |||
| 2735 | Ga0500618_016257 | |||
| 2736 | Ga0500652_159728 | |||
| 2737 | Ga0500616_0006596 | |||
| 2738 | Ga0500616_0009861 | |||
| 2739 | Ga0500616_0023836 | |||
| 2740 | Ga0500616_0155080 | |||
| 2741 | Ga0500645_037607 | |||
| 2742 | Ga0501084_0004756 | |||
| 2743 | Ga0501084_0060676 | |||
| 2744 | Ga0501084_0069792 | |||
| 2745 | Ga0501084_0083487 | |||
| 2746 | Ga0501084_0164633 | |||
| 2747 | Ga0501084_0288349 | |||
| 2748 | Ga0501084_0390430 | |||
| 2749 | Ga0501084_0834579 | |||
| 2750 | Ga0587068_011988 | |||
| 2751 | Ga0587111_0006178 | |||
| 2752 | Ga0501082_0024683 | |||
| 2753 | Ga0501082_0026929 | |||
| 2754 | Ga0501082_0027843 | |||
| 2755 | Ga0501082_0061171 | |||
| 2756 | Ga0501082_0089971 | |||
| 2757 | Ga0501082_0181067 | |||
| 2758 | Ga0501082_0271970 | |||
| 2759 | Ga0501082_0302697 | |||
| 2760 | Ga0501082_0350329 | |||
| 2761 | Ga0501082_0424543 | |||
| 2762 | Ga0501082_0573731 | |||
| 2763 | Ga0501082_0896486 | |||
| 2764 | Ga0501082_0978755 | |||
| 2765 | Ga0501082_1034502 | |||
| 2766 | Ga0501082_1193922 | |||
| 2767 | Ga0501082_1509349 | |||
| 2768 | Ga0530510_0015060 | |||
| 2769 | Ga0530510_0020058 | |||
| 2770 | Ga0530510_0033570 | |||
| 2771 | Ga0530510_0039532 | |||
| 2772 | Ga0530510_0041216 | |||
| 2773 | Ga0530510_0332355 | |||
| 2774 | Ga0530510_0349592 | |||
| 2775 | Ga0530510_0484071 | |||
| 2776 | 2511169850 | |||
| 2777 | 2585995368 | |||
| 2778 | 2585999923 | |||
| 2779 | 2819683833 | |||
| 2780 | 2854901777 | |||
| 2781 | 2854919396 | |||
| 2782 | 2919177506 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdv-assembly1.cif.gz_H | rnase r bound to a 30s degradation intermediate (state ii) | 0.9939 | 22 | 127 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.9819 | 12 | 152 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9808 | 12 | 152 |
| 7p7u-assembly1.cif.gz_h | e. faecalis 70s ribosome with p-trna, state iv | 0.9765 | 6 | 154 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.975 | 12 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x8rg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9726 | 6 | 152 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9638 | 10 | 148 | 1.10.455.10 |
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9632 | 3 | 156 | 1.10.455.10 |
| 5mmjg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9601 | 2 | 155 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9568 | 10 | 148 | 1.10.455.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 0.9976 | 12 | 149 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 0.9904 | 12 | 149 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2N6U8M5-F1-model_v4 | deleted | 0.9872 | 12 | 126 |
|
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 0.9861 | 34 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2J0MZE0-F1-model_v4 | Small ribosomal subunit protein uS7 | 0.9839 | 11 | 153 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |