F493541

General Info

Members Datasets Scaffolds Average Seq Length
1383 659 1148 380

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0040071|Ga0495599_0040071_463_1776
Length 437
Sequence VLATWAGGQFGAGLGACAERDAPRSKTRPGRVTKKLLPAAVLNRQPAFFHFKVARIESMSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGVDGTAGKLLAFAGHTDVVPTGPLEQWHSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVAAHPAHRGSIAFLITSDEEGPATDGTVKVVEALQARGERMDYCIVGEPTSSTQFGDMVKNGRRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNIHSGTGATNVIPGHADVMFNFRFSTASTVEGLQARVHAILDKHDLDYDLQWTVSGLPFLTPRGDLSNALAKAIKDETGVSTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEVAHIEPLKNVYRRVLEQLIA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
11 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
12 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
13 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
14 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
15 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
16 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
17 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
21 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
22 2519103095 Burkholderia sp. KJ006 Isolate Nodule
23 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
24 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
25 2547132181 Kosakonia sacchari SP1 Isolate Stem
26 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
27 2561511199 Enterobacter sp. R4-368 Isolate Nodule
28 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
29 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
30 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
31 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
32 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
33 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
34 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
35 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
36 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
37 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
38 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
39 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
40 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
41 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
42 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
43 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
44 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
45 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
46 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
47 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
48 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
49 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
50 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
51 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
52 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
53 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
54 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
55 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
56 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
57 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
58 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
59 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
60 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
61 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
62 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
63 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
64 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
65 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
66 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
67 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
68 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
69 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
70 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
71 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
72 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
73 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
74 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
75 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
76 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
77 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
78 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
79 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
80 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
81 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
82 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
83 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
84 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
85 2636415599 Klebsiella variicola DX120E Isolate Unclassified
86 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
87 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
88 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
89 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
90 2643221660 Methylibium sp. Root1272 Isolate Unclassified
91 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
92 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
93 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
94 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
95 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
96 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
97 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
98 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
99 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
100 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
101 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
102 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
103 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
104 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
105 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
106 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
107 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
108 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
109 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
110 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
111 2751185917 Enterobacter sp. HK169 Isolate Unclassified
112 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
113 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
114 2775507074 Klebsiella sp. D5A Isolate Unclassified
115 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
116 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
117 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
118 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
119 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
120 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
121 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
122 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
123 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
124 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
125 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
126 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
127 2818991450 Burkholderia sp. 604 Isolate Unclassified
128 2818991452 Burkholderia cepacia 561 Isolate Unclassified
129 2821118458 Enterobacter asburiae 609 Isolate Unclassified
130 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
131 2831864461 Roseateles noduli HZ7 Isolate Nodule
132 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
133 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
134 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
135 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
136 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
137 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
138 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
139 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
140 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
141 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
142 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
143 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
144 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
145 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
146 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
147 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
148 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
149 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
150 2876601092 Pantoea endophytica 596 Isolate Unclassified
151 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
152 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
153 2885266251 Ralstonia sp. SET104 Isolate Nodule
154 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
155 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
156 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
157 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
158 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
159 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
160 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
161 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
162 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
163 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
164 2904504865 Serratia marcescens 1822 Isolate Unclassified
165 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
166 2904564687 Burkholderia sp. 571 Isolate Unclassified
167 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
168 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
169 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
170 2919150387 Rahnella aceris 1817 Isolate Unclassified
171 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
172 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
173 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
174 2927143783 Rahnella sp. 2050 Isolate Unclassified
175 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
176 2928058823 Ralstonia sp. 1138 Isolate Unclassified
177 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
178 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
179 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
180 2928163908 Burkholderia sp. 567 Isolate Unclassified
181 2928170801 Burkholderia sp. 572 Isolate Unclassified
182 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
183 2928536128 Burkholderia sola 565 Isolate Unclassified
184 2932406140 Serratia sp. 2723 Isolate Rhizosphere
185 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
186 2937539931 Pantoea sp. LS15 Isolate Unclassified
187 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
188 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
189 2939577877 Serratia sp. 509 Isolate Rhizosphere
190 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
191 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
192 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
193 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
194 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
195 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
196 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
197 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
198 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
199 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
200 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
201 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
202 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
203 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
204 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
205 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
206 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
207 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
208 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
209 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
210 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
211 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
212 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
213 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
214 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
215 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
216 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
217 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
218 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
219 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
220 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
221 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
222 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
223 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
224 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
225 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
226 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
227 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
228 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
229 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
230 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
231 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
232 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
233 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
234 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
235 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
236 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
237 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
238 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
239 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
240 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
241 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
242 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
243 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
244 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
245 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
246 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
247 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
248 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
249 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
250 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
251 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
252 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
253 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
254 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
255 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
256 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
257 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
258 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
259 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
260 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
261 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
262 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
263 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
264 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
265 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
266 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
267 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
268 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
269 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
270 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
271 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
272 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
273 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
274 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
275 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
276 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
277 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
278 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
279 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
280 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
281 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
282 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
283 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
284 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
285 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
286 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
287 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
288 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
289 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
290 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
291 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
292 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
293 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
294 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
295 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
296 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
297 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
298 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
299 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
300 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
301 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
302 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
308 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
309 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
310 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
311 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
312 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
313 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
314 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
315 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
316 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
317 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
318 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
319 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
320 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
321 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
322 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
323 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
324 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
325 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
326 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
327 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
328 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
329 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
330 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
331 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
332 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
334 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
335 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
336 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
337 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
338 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
339 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
346 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
347 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
349 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
350 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
353 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
354 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
355 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
356 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
359 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
362 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
363 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
364 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
366 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
367 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
416 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
418 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
422 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
426 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
427 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
428 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
429 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
430 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
431 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
432 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
433 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
434 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
435 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
436 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
437 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
438 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
439 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
440 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
441 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
442 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
443 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
444 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
445 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
446 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
447 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
448 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
449 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
450 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
451 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
452 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
453 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
454 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
455 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
456 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
457 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
458 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
459 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
460 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
461 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
462 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
463 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
464 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
465 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
466 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
467 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
468 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
469 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
470 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
471 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
472 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
473 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
474 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
475 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
476 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
477 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
478 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
479 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
480 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
481 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
482 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
483 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
484 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
485 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
486 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
487 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
488 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
489 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
490 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
491 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
492 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
493 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
494 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
495 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
496 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
497 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
498 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
499 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
500 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
501 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
502 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
503 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
504 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
505 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
506 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
507 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
508 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
509 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
510 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
511 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
512 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
513 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
514 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
515 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
516 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
517 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
518 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
519 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
520 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
521 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
522 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
523 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
524 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
525 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
526 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
527 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
528 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
529 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
530 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
531 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
532 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
533 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
534 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
535 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
536 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
537 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
538 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
539 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
540 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
541 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
542 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
543 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
544 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
545 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
546 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
547 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
548 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
549 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
550 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
551 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
552 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
553 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
554 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
555 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
556 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
557 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
558 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
559 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
560 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
561 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
562 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
563 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
564 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
565 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
566 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
567 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
568 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
569 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
570 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
571 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
572 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
573 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
574 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
575 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
576 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
577 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
578 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
579 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
580 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
581 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
582 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
583 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
584 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
585 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
586 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
587 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
588 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
589 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
590 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
591 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
596 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
597 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
598 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
599 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
600 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
601 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
602 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
603 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
604 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
605 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
606 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
607 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
608 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
609 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
610 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
611 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
612 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
613 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
614 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
615 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
616 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
617 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
618 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
619 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
620 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
621 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
622 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
623 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
624 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
625 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
626 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
627 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
628 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
629 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
630 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
631 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
632 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
633 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
634 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
635 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
636 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
637 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
638 8018221730 Enterobacter sp. CM29 Isolate Unclassified
639 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
640 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
641 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
642 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
643 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
644 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
645 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
646 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
647 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
648 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
649 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
650 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
651 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
652 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
653 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
654 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
655 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
656 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
657 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
658 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
659 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.79
Metatranscriptomes 0.22
Isolates 16.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 15.76
Nodule 3.11
Rhizoplane 6.94
Rhizosphere 56.83
Stem 0.07
Stem Tuber 0.51
Unclassified 16.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_704441 2162886007 Bacteria 5639
2 JGI24741J21665_1002292 3300001915 Bacteria 5038
3 JGI24740J21852_10000707 3300001979 Bacteria 14462
4 JGI24740J21852_10001478 3300001979 Bacteria 10792
5 JGI24739J22299_10009567 3300001989 Bacteria 3607
6 JGI24739J22299_10019743 3300001989 Bacteria 2410
7 JGI24735J21928_10000304 3300002067 Bacteria 17151
8 JGI24735J21928_10000392 3300002067 Bacteria 15199
9 JGI24735J21928_10000462 3300002067 Bacteria 14300
10 JGI24735J21928_10003854 3300002067 Bacteria 5076
11 JGI24735J21928_10028720 3300002067 Bacteria 1660
12 JGI25155J39150_1000002 3300002704 Bacteria 292156
13 JGI25156J39149_1000003 3300002705 Bacteria 305434
14 JGI25156J39149_1000913 3300002705 Bacteria 14473
15 JGI25156J39149_1001040 3300002705 Bacteria 12889
16 JGI25156J39149_1001634 3300002705 Bacteria 9121
17 JGI25156J39149_1010984 3300002705 Bacteria 2084
18 JGI25154J39366_1000009 3300002738 Bacteria 305408
19 JGI25154J39366_1000362 3300002738 Bacteria 25735
20 JGI25157J39369_1000002 3300002741 Bacteria 305434
21 JGI25163J39215_1000065 3300002771 Bacteria 47718
22 JGI25164J39214_1000014 3300002772 Bacteria 219691
23 JGI25152J39213_1006266 3300002773 Bacteria 3287
24 JGI25150J39212_1003024 3300002774 Bacteria 4036
25 JGI25159J45721_1000296 3300002987 Bacteria 23321
26 JGI25159J45721_1003417 3300002987 Bacteria 5618
27 JGI25151J46595_10011762 3300003187 Bacteria 4009
28 JGI25151J46595_10013678 3300003187 Bacteria 3642
29 JGI25151J46595_10032951 3300003187 Bacteria 2001
30 JGI25165J46597_1002348 3300003214 Bacteria 6356
31 JGI25153J46596_10000871 3300003215 Bacteria 18391
32 JGI25153J46596_10003388 3300003215 Bacteria 8937
33 rootL2_10011738 3300003322 Bacteria 2705
34 rootL2_10113845 3300003322 Bacteria 2293
35 JGI25160J50197_1000102 3300003354 Bacteria 82464
36 JGI25160J50197_1000123 3300003354 Bacteria 70031
37 JGI25161J50226_1000032 3300003374 Bacteria 138440
38 Ga0055538_1000005 3300003751 Bacteria 575218
39 Ga0055538_1001322 3300003751 Bacteria 4973
40 Ga0055539_1000007 3300003752 Bacteria 575218
41 Ga0055539_1000100 3300003752 Bacteria 100406
42 Ga0055533_1000009 3300003756 Bacteria 575218
43 Ga0055533_1000235 3300003756 Bacteria 36089
44 Ga0055533_1001261 3300003756 Bacteria 6944
45 Ga0055532_1000001 3300003758 Bacteria 1119836
46 Ga0055532_1000127 3300003758 Bacteria 75964
47 Ga0055532_1000944 3300003758 Bacteria 9337
48 Ga0055525_1000010 3300003759 Bacteria 575218
49 Ga0055525_1000444 3300003759 Bacteria 23721
50 Ga0055525_1000505 3300003759 Bacteria 19389
51 Ga0055527_1000002 3300003760 Bacteria 830488
52 Ga0055535_1000001 3300003761 Bacteria 1119836
53 Ga0055535_1000140 3300003761 Bacteria 75964
54 Ga0055542_1000001 3300003762 Bacteria 1119836
55 Ga0055542_1001376 3300003762 Bacteria 12374
56 Ga0055529_1000026 3300003763 Bacteria 293254
57 Ga0055529_1000230 3300003763 Bacteria 71040
58 Ga0055529_1001316 3300003763 Bacteria 8427
59 Ga0055526_1001657 3300003771 Bacteria 15630
60 Ga0055526_1022565 3300003771 Bacteria 2135
61 Ga0055537_1000079 3300003773 Bacteria 69953
62 Ga0055537_1006004 3300003773 Bacteria 3152
63 Ga0055524_1000012 3300003775 Bacteria 260384
64 Ga0055524_1001692 3300003775 Bacteria 12282
65 Ga0055536_1000380 3300003781 Bacteria 32625
66 Ga0055534_1000670 3300003784 Bacteria 17182
67 Ga0055534_1001102 3300003784 Bacteria 11482
68 Ga0055534_1001506 3300003784 Bacteria 9171
69 Ga0055534_1002359 3300003784 Bacteria 6590
70 Ga0055534_1005936 3300003784 Bacteria 3169
71 Ga0055528_1000563 3300003790 Bacteria 28211
72 Ga0055528_1003000 3300003790 Bacteria 8724
73 Ga0055530_10000218 3300003791 Bacteria 51314
74 Ga0055540_1000012 3300003792 Bacteria 262667
75 Ga0055541_1000005 3300003841 Bacteria 575218
76 Ga0055541_1003952 3300003841 Bacteria 2736
77 Ga0058692_1000303 3300003856 Bacteria 24919
78 Ga0058692_1000379 3300003856 Bacteria 21285
79 Ga0058692_1007200 3300003856 Bacteria 2978
80 Ga0055543_1000405 3300004625 Bacteria 27361
81 Ga0055543_1004541 3300004625 Bacteria 3748
82 Ga0065165_1000848 3300005262 Bacteria 40071
83 Ga0065165_1000995 3300005262 Bacteria 34985
84 Ga0065165_1001389 3300005262 Bacteria 26545
85 Ga0065165_1002021 3300005262 Bacteria 18891
86 Ga0065165_1009528 3300005262 Bacteria 4341
87 Ga0065165_1023112 3300005262 Bacteria 2115
88 Ga0065165_1024685 3300005262 Bacteria 2014
89 Ga0065165_1041329 3300005262 Bacteria 1370
90 Ga0065704_10000399 3300005289 Bacteria 23507
91 Ga0065704_10001052 3300005289 Bacteria 20106
92 Ga0065704_10001579 3300005289 Bacteria 16572
93 Ga0065704_10076648 3300005289 Bacteria 5018
94 Ga0065704_10083775 3300005289 Bacteria 3420
95 Ga0065707_10124464 3300005295 Bacteria 2043
96 Ga0070658_10003021 3300005327 Bacteria 13917
97 Ga0070658_10003785 3300005327 Bacteria 12392
98 Ga0070677_10020938 3300005333 Bacteria 2391
99 Ga0068869_100047431 3300005334 Bacteria 3103
100 Ga0070666_10026070 3300005335 Bacteria 3816
101 Ga0070682_100069419 3300005337 Bacteria 2250
102 Ga0068868_100051963 3300005338 Bacteria 3226
103 Ga0070660_100000046 3300005339 Bacteria 70459
104 Ga0070660_100010130 3300005339 Bacteria 6653
105 Ga0070661_100000057 3300005344 Bacteria 87637
106 Ga0070661_100113362 3300005344 Bacteria 2026
107 Ga0070669_100009144 3300005353 Bacteria 7061
108 Ga0070669_100012088 3300005353 Bacteria 6127
109 Ga0070669_100014256 3300005353 Bacteria 5656
110 Ga0070669_100017532 3300005353 Bacteria 5108
111 Ga0070675_100001690 3300005354 Bacteria 16286
112 Ga0070675_100094704 3300005354 Bacteria 2506
113 Ga0070671_100005306 3300005355 Bacteria 10280
114 Ga0070671_100025777 3300005355 Bacteria 4827
115 Ga0070671_100036625 3300005355 Bacteria 4069
116 Ga0070671_100150550 3300005355 Bacteria 1965
117 Ga0070671_100203348 3300005355 Bacteria 1680
118 Ga0070674_100164252 3300005356 Bacteria 1687
119 Ga0070673_100002697 3300005364 Bacteria 10877
120 Ga0070673_100005484 3300005364 Bacteria 8122
121 Ga0070659_100000510 3300005366 Bacteria 28529
122 Ga0070659_100020442 3300005366 Bacteria 5028
123 Ga0070659_100030772 3300005366 Bacteria 4154
124 Ga0070667_100000372 3300005367 Bacteria 48979
125 Ga0070700_100001032 3300005441 Bacteria 13767
126 Ga0070700_100006423 3300005441 Bacteria 6287
127 Ga0070663_100000105 3300005455 Bacteria 38796
128 Ga0070663_100002402 3300005455 Bacteria 10533
129 Ga0070663_100005278 3300005455 Bacteria 7663
130 Ga0070663_100156409 3300005455 Bacteria 1752
131 Ga0070678_100053616 3300005456 Bacteria 2933
132 Ga0070662_100001379 3300005457 Bacteria 14952
133 Ga0070662_100020685 3300005457 Bacteria 4487
134 Ga0068867_100003272 3300005459 Bacteria 11413
135 Ga0068867_100003992 3300005459 Bacteria 10379
136 Ga0068867_100006509 3300005459 Bacteria 8254
137 Ga0068867_100090294 3300005459 Bacteria 2324
138 Ga0068867_100163460 3300005459 Bacteria 1757
139 Ga0068853_100025283 3300005539 Bacteria 4982
140 Ga0070672_100000338 3300005543 Bacteria 26932
141 Ga0070672_100001803 3300005543 Bacteria 13392
142 Ga0070672_100122201 3300005543 Bacteria 2132
143 Ga0070672_100292362 3300005543 Bacteria 1380
144 Ga0070665_100000255 3300005548 Bacteria 88289
145 Ga0070665_100026204 3300005548 Bacteria 5871
146 Ga0068855_100003042 3300005563 Bacteria 20540
147 Ga0068855_100007312 3300005563 Bacteria 13379
148 Ga0068855_100039740 3300005563 Bacteria 5585
149 Ga0070664_100000008 3300005564 Bacteria 173734
150 Ga0070664_100072980 3300005564 Bacteria 2944
151 Ga0070664_100204982 3300005564 Bacteria 1761
152 Ga0068857_100135934 3300005577 Bacteria 2219
153 Ga0068857_100187637 3300005577 Bacteria 1883
154 Ga0068854_100000072 3300005578 Bacteria 72718
155 Ga0068856_100000009 3300005614 Bacteria 181448
156 Ga0068856_100031125 3300005614 Bacteria 5219
157 Ga0068852_100289532 3300005616 Bacteria 1582
158 Ga0068864_100021723 3300005618 Bacteria 5375
159 Ga0068864_100155989 3300005618 Bacteria 2072
160 Ga0068861_100008083 3300005719 Bacteria 7235
161 Ga0068851_10028395 3300005834 Bacteria 2764
162 Ga0068870_10083323 3300005840 Bacteria 1772
163 Ga0068863_100059509 3300005841 Bacteria 3614
164 Ga0068858_100308478 3300005842 Bacteria 1511
165 Ga0068860_100207568 3300005843 Bacteria 1900
166 Ga0068862_100021669 3300005844 Bacteria 5373
167 Ga0068862_100064649 3300005844 Bacteria 3150
168 Ga0075368_10003139 3300006042 Bacteria 5485
169 Ga0075363_100006667 3300006048 Bacteria 5265
170 Ga0075363_100130373 3300006048 Bacteria 1410
171 Ga0075364_10020463 3300006051 Bacteria 4161
172 Ga0075364_10050921 3300006051 Bacteria 2704
173 Ga0075364_10082628 3300006051 Bacteria 2125
174 Ga0075362_10022906 3300006177 Bacteria 2636
175 Ga0075367_10007819 3300006178 Bacteria 5500
176 Ga0075366_10000464 3300006195 Bacteria 18904
177 Ga0075366_10001059 3300006195 Bacteria 13503
178 Ga0075366_10008134 3300006195 Bacteria 5818
179 Ga0075366_10010331 3300006195 Bacteria 5240
180 Ga0075366_10018201 3300006195 Bacteria 4055
181 Ga0075366_10097725 3300006195 Bacteria 1761
182 Ga0097621_100020144 3300006237 Bacteria 5136
183 Ga0097621_100040483 3300006237 Bacteria 3747
184 Ga0075370_10017106 3300006353 Bacteria 3913
185 Ga0075370_10023309 3300006353 Bacteria 3407
186 Ga0075370_10077002 3300006353 Bacteria 1914
187 Ga0075370_10133028 3300006353 Bacteria 1452
188 Ga0068871_100003474 3300006358 Bacteria 10827
189 Ga0068871_100079338 3300006358 Bacteria 2716
190 Ga0079104_1000075 3300006946 Bacteria 148544
191 Ga0079104_1000111 3300006946 Bacteria 116796
192 Ga0079104_1000258 3300006946 Bacteria 70651
193 Ga0079104_1000667 3300006946 Bacteria 32312
194 Ga0079104_1000959 3300006946 Bacteria 22624
195 Ga0079104_1001574 3300006946 Bacteria 14933
196 Ga0079104_1002049 3300006946 Bacteria 11684
197 Ga0079104_1002639 3300006946 Bacteria 9346
198 Ga0099826_10000012 3300006948 Bacteria 283499
199 Ga0105251_10000738 3300009011 Bacteria 29954
200 Ga0105251_10001354 3300009011 Bacteria 21182
201 Ga0105251_10001810 3300009011 Bacteria 17702
202 Ga0105251_10003968 3300009011 Bacteria 10481
203 Ga0105251_10004288 3300009011 Bacteria 9793
204 Ga0105251_10005117 3300009011 Bacteria 8680
205 Ga0105251_10018972 3300009011 Bacteria 3643
206 Ga0105251_10041499 3300009011 Bacteria 2239
207 Ga0105244_10000090 3300009036 Bacteria 97171
208 Ga0105244_10000144 3300009036 Bacteria 73870
209 Ga0105244_10000149 3300009036 Bacteria 73409
210 Ga0105244_10000679 3300009036 Bacteria 29859
211 Ga0105244_10002219 3300009036 Bacteria 14802
212 Ga0105244_10003061 3300009036 Bacteria 12243
213 Ga0105244_10005707 3300009036 Bacteria 8216
214 Ga0105244_10007965 3300009036 Bacteria 6672
215 Ga0105244_10008326 3300009036 Bacteria 6485
216 Ga0105244_10030222 3300009036 Bacteria 2884
217 Ga0105244_10047079 3300009036 Bacteria 2213
218 Ga0105250_10000011 3300009092 Bacteria 276144
219 Ga0105250_10000105 3300009092 Bacteria 75608
220 Ga0105250_10000285 3300009092 Bacteria 40638
221 Ga0105250_10001428 3300009092 Bacteria 12896
222 Ga0105250_10019937 3300009092 Bacteria 2712
223 Ga0105250_10023443 3300009092 Bacteria 2486
224 Ga0105240_10002341 3300009093 Bacteria 30608
225 Ga0105240_10054612 3300009093 Bacteria 5006
226 Ga0105240_10212526 3300009093 Bacteria 2259
227 Ga0105240_10265739 3300009093 Bacteria 1977
228 Ga0105240_10284978 3300009093 Bacteria 1896
229 Ga0111539_10110214 3300009094 Bacteria 3230
230 Ga0111539_10333289 3300009094 Bacteria 1766
231 Ga0105245_10062771 3300009098 Bacteria 3353
232 Ga0105245_10073785 3300009098 Bacteria 3103
233 Ga0105243_10005488 3300009148 Bacteria 9889
234 Ga0105243_10027102 3300009148 Bacteria 4389
235 Ga0105241_10067401 3300009174 Bacteria 2770
236 Ga0105248_10007653 3300009177 Bacteria 11869
237 Ga0105248_10026509 3300009177 Bacteria 6447
238 Ga0105237_10018302 3300009545 Bacteria 7250
239 Ga0105237_10039588 3300009545 Bacteria 4759
240 Ga0105237_10173035 3300009545 Bacteria 2159
241 Ga0105238_10001497 3300009551 Bacteria 23442
242 Ga0105238_10010153 3300009551 Bacteria 9444
243 Ga0105239_10022568 3300010375 Bacteria 6939
244 Ga0105239_10068680 3300010375 Bacteria 3895
245 Ga0105246_10050782 3300011119 Bacteria 2845
246 Ga0157326_1000943 3300012513 Bacteria 3334
247 Ga0157373_10000788 3300013100 Bacteria 24425
248 Ga0157373_10009043 3300013100 Bacteria 7371
249 Ga0157373_10073707 3300013100 Bacteria 2409
250 Ga0157371_10000007 3300013102 Bacteria 401847
251 Ga0157371_10000068 3300013102 Bacteria 168110
252 Ga0157371_10000780 3300013102 Bacteria 36631
253 Ga0157371_10002606 3300013102 Bacteria 17116
254 Ga0157371_10013847 3300013102 Bacteria 6109
255 Ga0157371_10079796 3300013102 Bacteria 2318
256 Ga0157370_10000200 3300013104 Bacteria 75469
257 Ga0157370_10001346 3300013104 Bacteria 30508
258 Ga0157370_10003399 3300013104 Bacteria 18693
259 Ga0157370_10004165 3300013104 Bacteria 16733
260 Ga0157370_10094701 3300013104 Bacteria 2802
261 Ga0157369_10000511 3300013105 Bacteria 51116
262 Ga0157369_10000806 3300013105 Bacteria 40098
263 Ga0157369_10000979 3300013105 Bacteria 36209
264 Ga0157369_10005782 3300013105 Bacteria 14377
265 Ga0157369_10009691 3300013105 Bacteria 11016
266 Ga0157369_10022155 3300013105 Bacteria 7098
267 Ga0157369_10047494 3300013105 Bacteria 4660
268 Ga0157369_10419267 3300013105 Bacteria 1388
269 Ga0157374_10000107 3300013296 Bacteria 75925
270 Ga0157374_10052257 3300013296 Bacteria 3805
271 Ga0157374_10167192 3300013296 Bacteria 2144
272 Ga0163162_10008076 3300013306 Bacteria 10271
273 Ga0163162_10012861 3300013306 Bacteria 8175
274 Ga0163162_10051090 3300013306 Bacteria 4146
275 Ga0157372_10000142 3300013307 Bacteria 79172
276 Ga0157372_10001253 3300013307 Bacteria 27455
277 Ga0157372_10004539 3300013307 Bacteria 14782
278 Ga0157372_10012280 3300013307 Bacteria 9124
279 Ga0157372_10114919 3300013307 Bacteria 3085
280 Ga0157372_10144570 3300013307 Bacteria 2743
281 Ga0157372_10176345 3300013307 Bacteria 2474
282 Ga0157372_10193418 3300013307 Bacteria 2356
283 Ga0157375_10037300 3300013308 Bacteria 4656
284 Ga0157375_10617514 3300013308 Bacteria 1242
285 Ga0157380_10010968 3300014326 Bacteria 6535
286 Ga0157380_10038519 3300014326 Bacteria 3713
287 Ga0157377_10006681 3300014745 Bacteria 5520
288 Ga0157377_10145171 3300014745 Bacteria 1462
289 Ga0157379_10083111 3300014968 Bacteria 2870
290 Ga0157376_10006346 3300014969 Bacteria 8350
291 Ga0157376_10211793 3300014969 Bacteria 1789
292 Ga0182006_1000024 3300015261 Bacteria 257431
293 Ga0182006_1031181 3300015261 Bacteria 2150
294 Ga0182007_10000581 3300015262 Bacteria 21489
295 Ga0182007_10010832 3300015262 Bacteria 3581
296 Ga0183366_1001 3300015679 Bacteria 2743932
297 Ga0183370_1001 3300015680 Bacteria 2743932
298 Ga0183369_1001 3300015685 Bacteria 2743932
299 Ga0183368_1001 3300015687 Bacteria 2743932
300 Ga0183361_10006 3300016635 Bacteria 368532
301 Ga0163161_10020133 3300017792 Bacteria 4679
302 Ga0163161_10097655 3300017792 Bacteria 2182
303 Ga0163161_10206594 3300017792 Bacteria 1515
304 Ga0206351_10197686 3300020077 Bacteria 6596
305 Ga0154015_1570145 3300020610 Bacteria 20499
306 Ga0213872_10000090 3300021361 Bacteria 83813
307 Ga0213872_10001577 3300021361 Bacteria 14529
308 Ga0213876_10000079 3300021384 Bacteria 110609
309 Ga0213875_10001769 3300021388 Bacteria 13535
310 Ga0224712_10001924 3300022467 Bacteria 5002
311 Ga0209435_100001 3300025206 Bacteria 1424171
312 Ga0209435_104850 3300025206 Bacteria 1514
313 Ga0209760_100092 3300025207 Bacteria 71682
314 Ga0209784_100001 3300025224 Bacteria 3600592
315 Ga0209784_100003 3300025224 Bacteria 1379451
316 Ga0209784_100815 3300025224 Bacteria 7115
317 Ga0209784_101192 3300025224 Bacteria 4004
318 Ga0209566_100001 3300025225 Bacteria 3600765
319 Ga0209566_100002 3300025225 Bacteria 2614868
320 Ga0209566_100421 3300025225 Bacteria 32639
321 Ga0209566_100504 3300025225 Bacteria 27098
322 Ga0209566_102138 3300025225 Bacteria 4001
323 Ga0209674_100002 3300025226 Bacteria 3600592
324 Ga0209674_100005 3300025226 Bacteria 1708125
325 Ga0209674_100008 3300025226 Bacteria 1076909
326 Ga0209674_100161 3300025226 Bacteria 87684
327 Ga0209674_100267 3300025226 Bacteria 40569
328 Ga0209674_101381 3300025226 Bacteria 6524
329 Ga0209672_100001 3300025228 Bacteria 2828210
330 Ga0209672_100014 3300025228 Bacteria 546252
331 Ga0209672_100023 3300025228 Bacteria 371758
332 Ga0209672_100530 3300025228 Bacteria 20839
333 Ga0209672_100934 3300025228 Bacteria 13147
334 Ga0209672_100935 3300025228 Bacteria 13147
335 Ga0209147_100001 3300025229 Bacteria 2384371
336 Ga0209147_100002 3300025229 Bacteria 2158988
337 Ga0209147_100094 3300025229 Bacteria 167145
338 Ga0209147_100104 3300025229 Bacteria 158375
339 Ga0209147_101244 3300025229 Bacteria 10032
340 Ga0209563_100004 3300025230 Bacteria 1814108
341 Ga0209563_100008 3300025230 Bacteria 1554545
342 Ga0209563_100468 3300025230 Bacteria 13843
343 Ga0207427_100002 3300025231 Bacteria 1355321
344 Ga0207427_102517 3300025231 Bacteria 4857
345 Ga0209437_100007 3300025233 Bacteria 938377
346 Ga0209258_100001 3300025242 Bacteria 2384269
347 Ga0209258_100002 3300025242 Bacteria 2158988
348 Ga0209258_100040 3300025242 Bacteria 385401
349 Ga0209258_100142 3300025242 Bacteria 165865
350 Ga0209646_1000001 3300025246 Bacteria 3092932
351 Ga0209646_1000059 3300025246 Bacteria 256909
352 Ga0209026_1000003 3300025250 Bacteria 1060571
353 Ga0209677_100004 3300025253 Bacteria 1554545
354 Ga0209677_100009 3300025253 Bacteria 749530
355 Ga0209148_1000003 3300025254 Bacteria 2384288
356 Ga0209148_1000021 3300025254 Bacteria 714645
357 Ga0209148_1000035 3300025254 Bacteria 548413
358 Ga0209759_1000001 3300025256 Bacteria 2799452
359 Ga0209759_1000029 3300025256 Bacteria 286968
360 Ga0209759_1000030 3300025256 Bacteria 285649
361 Ga0209759_1000260 3300025256 Bacteria 76538
362 Ga0209759_1001844 3300025256 Bacteria 10606
363 Ga0209759_1003073 3300025256 Bacteria 6864
364 Ga0209759_1012730 3300025256 Bacteria 2315
365 Ga0209759_1020056 3300025256 Bacteria 1566
366 Ga0209129_1000104 3300025258 Bacteria 161264
367 Ga0209129_1000200 3300025258 Bacteria 77042
368 Ga0209129_1005824 3300025258 Bacteria 4201
369 Ga0209233_1000016 3300025261 Bacteria 907830
370 Ga0209233_1001979 3300025261 Bacteria 7778
371 Ga0209565_1000004 3300025263 Bacteria 983150
372 Ga0209565_1000021 3300025263 Bacteria 406281
373 Ga0209565_1011180 3300025263 Bacteria 2194
374 Ga0209455_1000001 3300025272 Bacteria 2384278
375 Ga0209455_1000021 3300025272 Bacteria 699993
376 Ga0209455_1000072 3300025272 Bacteria 293074
377 Ga0209673_1000140 3300025273 Bacteria 157575
378 Ga0209130_1000082 3300025284 Bacteria 164441
379 Ga0209130_1000094 3300025284 Bacteria 145569
380 Ga0209130_1007922 3300025284 Bacteria 3204
381 Ga0209675_1000061 3300025291 Bacteria 181096
382 Ga0209675_1000149 3300025291 Bacteria 93109
383 Ga0209675_1001200 3300025291 Bacteria 15715
384 Ga0209675_1002449 3300025291 Bacteria 9536
385 Ga0209676_1000014 3300025292 Bacteria 793514
386 Ga0209676_1000029 3300025292 Bacteria 520536
387 Ga0209676_1007000 3300025292 Bacteria 5419
388 Ga0209676_1008263 3300025292 Bacteria 4678
389 Ga0209025_1000522 3300025294 Bacteria 73140
390 Ga0209025_1001239 3300025294 Bacteria 35471
391 Ga0209025_1001542 3300025294 Bacteria 29365
392 Ga0209025_1005993 3300025294 Bacteria 9654
393 Ga0209025_1009504 3300025294 Bacteria 6757
394 Ga0209025_1024163 3300025294 Bacteria 3148
395 Ga0209564_1000003 3300025295 Bacteria 1585848
396 Ga0209564_1000046 3300025295 Bacteria 373787
397 Ga0209564_1000455 3300025295 Bacteria 69085
398 Ga0209564_1000979 3300025295 Bacteria 35983
399 Ga0209564_1001045 3300025295 Bacteria 33865
400 Ga0209564_1001145 3300025295 Bacteria 31078
401 Ga0209564_1002205 3300025295 Bacteria 16256
402 Ga0209564_1024894 3300025295 Bacteria 2032
403 Ga0209758_1000096 3300025297 Bacteria 231496
404 Ga0209758_1000285 3300025297 Bacteria 99959
405 Ga0209758_1011374 3300025297 Bacteria 5164
406 Ga0209758_1015813 3300025297 Bacteria 3879
407 Ga0209050_1000003 3300025298 Bacteria 1609245
408 Ga0209050_1003867 3300025298 Bacteria 10643
409 Ga0209050_1032394 3300025298 Bacteria 1608
410 Ga0209256_1000001 3300025299 Bacteria 2166974
411 Ga0209256_1000280 3300025299 Bacteria 89706
412 Ga0209256_1000625 3300025299 Bacteria 48667
413 Ga0207426_1000071 3300025302 Bacteria 329539
414 Ga0207426_1000125 3300025302 Bacteria 217504
415 Ga0207426_1005035 3300025302 Bacteria 6195
416 Ga0209051_1000003 3300025303 Bacteria 1609245
417 Ga0209257_1000018 3300025304 Bacteria 836016
418 Ga0209257_1005482 3300025304 Bacteria 8882
419 Ga0209257_1008179 3300025304 Bacteria 6051
420 Ga0207697_10018314 3300025315 Bacteria 2873
421 Ga0207656_10014406 3300025321 Bacteria 3045
422 Ga0207696_1000026 3300025711 Bacteria 418166
423 Ga0207696_1000035 3300025711 Bacteria 339626
424 Ga0207696_1000131 3300025711 Bacteria 132958
425 Ga0207696_1000166 3300025711 Bacteria 104368
426 Ga0207696_1001091 3300025711 Bacteria 15967
427 Ga0207696_1001841 3300025711 Bacteria 10888
428 Ga0207696_1006550 3300025711 Bacteria 4680
429 Ga0207696_1008073 3300025711 Bacteria 4063
430 Ga0207696_1020296 3300025711 Bacteria 2147
431 Ga0207655_1000002 3300025728 Bacteria 1148694
432 Ga0207655_1000004 3300025728 Bacteria 1021221
433 Ga0207655_1000007 3300025728 Bacteria 773492
434 Ga0207655_1000029 3300025728 Bacteria 432187
435 Ga0207655_1000062 3300025728 Bacteria 258054
436 Ga0207655_1000303 3300025728 Bacteria 73938
437 Ga0207655_1000621 3300025728 Bacteria 42638
438 Ga0207655_1000831 3300025728 Bacteria 33294
439 Ga0207655_1008564 3300025728 Bacteria 6474
440 Ga0207655_1010391 3300025728 Bacteria 5646
441 Ga0207655_1026057 3300025728 Bacteria 2817
442 Ga0207655_1035782 3300025728 Bacteria 2211
443 Ga0207713_1000052 3300025735 Bacteria 222663
444 Ga0207713_1000069 3300025735 Bacteria 191229
445 Ga0207713_1000084 3300025735 Bacteria 160822
446 Ga0207713_1000443 3300025735 Bacteria 43551
447 Ga0207713_1000864 3300025735 Bacteria 27722
448 Ga0207713_1002028 3300025735 Bacteria 15170
449 Ga0207713_1009216 3300025735 Bacteria 5590
450 Ga0207682_10000222 3300025893 Bacteria 25665
451 Ga0207682_10073981 3300025893 Bacteria 1448
452 Ga0207688_10079126 3300025901 Bacteria 1874
453 Ga0207680_10126860 3300025903 Bacteria 1676
454 Ga0207647_10000498 3300025904 Bacteria 31401
455 Ga0207647_10000605 3300025904 Bacteria 27980
456 Ga0207647_10025613 3300025904 Bacteria 3872
457 Ga0207645_10000759 3300025907 Bacteria 26825
458 Ga0207645_10035427 3300025907 Bacteria 3205
459 Ga0207645_10087465 3300025907 Bacteria 2002
460 Ga0207643_10056938 3300025908 Bacteria 2224
461 Ga0207643_10059306 3300025908 Bacteria 2183
462 Ga0207705_10004376 3300025909 Bacteria 10676
463 Ga0207705_10033405 3300025909 Bacteria 3675
464 Ga0207695_10000729 3300025913 Bacteria 63923
465 Ga0207695_10024266 3300025913 Bacteria 6828
466 Ga0207671_10042198 3300025914 Bacteria 3376
467 Ga0207671_10052362 3300025914 Bacteria 3025
468 Ga0207662_10105412 3300025918 Bacteria 1752
469 Ga0207657_10000004 3300025919 Bacteria 247179
470 Ga0207657_10004856 3300025919 Bacteria 14157
471 Ga0207657_10042471 3300025919 Bacteria 4011
472 Ga0207649_10000138 3300025920 Bacteria 61616
473 Ga0207649_10031701 3300025920 Bacteria 3144
474 Ga0207681_10001252 3300025923 Bacteria 16394
475 Ga0207681_10006080 3300025923 Bacteria 7404
476 Ga0207681_10021178 3300025923 Bacteria 4129
477 Ga0207650_10057624 3300025925 Bacteria 2890
478 Ga0207659_10001462 3300025926 Bacteria 14092
479 Ga0207659_10010366 3300025926 Bacteria 5855
480 Ga0207659_10043760 3300025926 Bacteria 3147
481 Ga0207687_10105337 3300025927 Bacteria 2083
482 Ga0207644_10034065 3300025931 Bacteria 3563
483 Ga0207690_10000102 3300025932 Bacteria 69683
484 Ga0207690_10001152 3300025932 Bacteria 16774
485 Ga0207706_10001019 3300025933 Bacteria 28600
486 Ga0207706_10032233 3300025933 Bacteria 4667
487 Ga0207709_10008663 3300025935 Bacteria 5614
488 Ga0207709_10021947 3300025935 Bacteria 3617
489 Ga0207669_10037250 3300025937 Bacteria 2788
490 Ga0207669_10137037 3300025937 Bacteria 1692
491 Ga0207704_10005743 3300025938 Bacteria 5737
492 Ga0207691_10001693 3300025940 Bacteria 21768
493 Ga0207691_10009952 3300025940 Bacteria 9131
494 Ga0207691_10039764 3300025940 Bacteria 4350
495 Ga0207691_10051960 3300025940 Bacteria 3744
496 Ga0207691_10287108 3300025940 Bacteria 1415
497 Ga0207689_10000267 3300025942 Bacteria 47185
498 Ga0207689_10054721 3300025942 Bacteria 3285
499 Ga0207661_10182666 3300025944 Bacteria 1833
500 Ga0207679_10000001 3300025945 Bacteria 777444
501 Ga0207679_10116150 3300025945 Bacteria 2121
502 Ga0207667_10001214 3300025949 Bacteria 32246
503 Ga0207667_10002775 3300025949 Bacteria 21673
504 Ga0207667_10011537 3300025949 Bacteria 10264
505 Ga0207667_10099085 3300025949 Bacteria 3007
506 Ga0207651_10012381 3300025960 Bacteria 4826
507 Ga0207651_10127341 3300025960 Bacteria 1943
508 Ga0207712_10109232 3300025961 Bacteria 2071
509 Ga0207640_10000088 3300025981 Bacteria 72802
510 Ga0207658_10001495 3300025986 Bacteria 18165
511 Ga0207658_10027495 3300025986 Bacteria 3997
512 Ga0207677_10030713 3300026023 Bacteria 3433
513 Ga0207677_10219457 3300026023 Bacteria 1524
514 Ga0207639_10047798 3300026041 Bacteria 3236
515 Ga0207678_10000001 3300026067 Bacteria 433184
516 Ga0207678_10000738 3300026067 Bacteria 29963
517 Ga0207678_10002867 3300026067 Bacteria 15651
518 Ga0207678_10126758 3300026067 Bacteria 2177
519 Ga0207708_10002428 3300026075 Bacteria 13686
520 Ga0207708_10031194 3300026075 Bacteria 4044
521 Ga0207708_10198009 3300026075 Bacteria 1602
522 Ga0207702_10000024 3300026078 Bacteria 187719
523 Ga0207648_10004977 3300026089 Bacteria 13507
524 Ga0207648_10012028 3300026089 Bacteria 8118
525 Ga0207648_10024696 3300026089 Bacteria 5361
526 Ga0207648_10194466 3300026089 Bacteria 1798
527 Ga0207648_10210298 3300026089 Bacteria 1727
528 Ga0207648_10286475 3300026089 Bacteria 1474
529 Ga0207674_10000214 3300026116 Bacteria 71833
530 Ga0207674_10016539 3300026116 Bacteria 8069
531 Ga0207674_10090360 3300026116 Bacteria 3054
532 Ga0207675_100000232 3300026118 Bacteria 52682
533 Ga0207675_100006634 3300026118 Bacteria 10945
534 Ga0207675_100100637 3300026118 Bacteria 2723
535 Ga0207675_100221991 3300026118 Bacteria 1821
536 Ga0207683_10065916 3300026121 Bacteria 3193
537 Ga0207683_10082750 3300026121 Bacteria 2852
538 Ga0207698_10005724 3300026142 Bacteria 7704
539 Ga0207698_10028347 3300026142 Bacteria 3992
540 Ga0207698_10084969 3300026142 Bacteria 2568
541 Ga0209281_1000004 3300027111 Bacteria 1253949
542 Ga0209281_1000014 3300027111 Bacteria 643021
543 Ga0209281_1000079 3300027111 Bacteria 261444
544 Ga0209281_1000142 3300027111 Bacteria 174280
545 Ga0209281_1000171 3300027111 Bacteria 153284
546 Ga0209281_1000698 3300027111 Bacteria 33996
547 Ga0209281_1000739 3300027111 Bacteria 31834
548 Ga0209281_1000906 3300027111 Bacteria 24781
549 Ga0209281_1001184 3300027111 Bacteria 17915
550 Ga0209281_1001659 3300027111 Bacteria 11808
551 Ga0209371_1000001 3300027312 Bacteria 2771503
552 Ga0209371_1000015 3300027312 Bacteria 659640
553 Ga0209371_1000079 3300027312 Bacteria 187621
554 Ga0209371_1000084 3300027312 Bacteria 180842
555 Ga0209371_1000190 3300027312 Bacteria 89981
556 Ga0209371_1000279 3300027312 Bacteria 58814
557 Ga0209371_1000407 3300027312 Bacteria 44809
558 Ga0209371_1000659 3300027312 Bacteria 30108
559 Ga0209371_1000855 3300027312 Bacteria 24645
560 Ga0209371_1001264 3300027312 Bacteria 17946
561 Ga0209371_1001382 3300027312 Bacteria 16693
562 Ga0209371_1001386 3300027312 Bacteria 16650
563 Ga0209371_1005670 3300027312 Bacteria 4884
564 Ga0209371_1006594 3300027312 Bacteria 4260
565 Ga0209371_1019801 3300027312 Bacteria 1671
566 Ga0209282_1000028 3300027666 Bacteria 159466
567 Ga0209966_1000004 3300027695 Bacteria 108133
568 Ga0209998_10010904 3300027717 Bacteria 1882
569 Ga0209974_10001532 3300027876 Bacteria 8385
570 Ga0207428_10075761 3300027907 Bacteria 2636
571 Ga0207428_10179220 3300027907 Bacteria 1602
572 Ga0268266_10000933 3300028379 Bacteria 37300
573 Ga0268266_10120795 3300028379 Bacteria 2331
574 Ga0268265_10004824 3300028380 Bacteria 9294
575 Ga0268264_10021745 3300028381 Bacteria 5237
576 Ga0268264_10149949 3300028381 Bacteria 2090
577 Ga0268264_10381187 3300028381 Bacteria 1350
578 Ga0307517_10003248 3300028786 Bacteria 25445
579 Ga0307515_10000041 3300028794 Bacteria 319110
580 Ga0307515_10025544 3300028794 Bacteria 10212
581 Ga0307515_10048148 3300028794 Bacteria 6454
582 Ga0307515_10088677 3300028794 Bacteria 3906
583 Ga0307515_10265181 3300028794 Bacteria 1447
584 Ga0265338_10000028 3300028800 Bacteria 279132
585 Ga0265338_10000741 3300028800 Bacteria 55680
586 Ga0265324_10048243 3300029957 Bacteria 1464
587 Ga0268256_1000001 3300030500 Bacteria 2771065
588 Ga0268256_1000018 3300030500 Bacteria 594572
589 Ga0268256_1000069 3300030500 Bacteria 195391
590 Ga0268256_1000075 3300030500 Bacteria 180814
591 Ga0268256_1000090 3300030500 Bacteria 153976
592 Ga0268256_1000183 3300030500 Bacteria 74143
593 Ga0268256_1000531 3300030500 Bacteria 31533
594 Ga0268256_1001062 3300030500 Bacteria 18284
595 Ga0268256_1001260 3300030500 Bacteria 15774
596 Ga0268256_1001426 3300030500 Bacteria 14431
597 Ga0268256_1005102 3300030500 Bacteria 5239
598 Ga0268256_1008862 3300030500 Bacteria 3403
599 Ga0268256_1012380 3300030500 Bacteria 2639
600 Ga0268256_1015612 3300030500 Bacteria 2208
601 Ga0307512_10097523 3300030522 Bacteria 2010
602 Ga0265332_10007434 3300031238 Bacteria 4952
603 Ga0265328_10000121 3300031239 Bacteria 37217
604 Ga0265331_10000055 3300031250 Bacteria 177693
605 Ga0265331_10087229 3300031250 Bacteria 1445
606 Ga0265327_10000045 3300031251 Bacteria 282880
607 Ga0265327_10003428 3300031251 Bacteria 15161
608 Ga0265327_10019994 3300031251 Bacteria 4097
609 Ga0307513_10018375 3300031456 Bacteria 8356
610 Ga0307513_10156513 3300031456 Bacteria 2178
611 Ga0307513_10221232 3300031456 Bacteria 1714
612 Ga0307509_10000092 3300031507 Bacteria 124019
613 Ga0307509_10002037 3300031507 Bacteria 33298
614 Ga0307509_10014105 3300031507 Bacteria 9424
615 Ga0307509_10053226 3300031507 Bacteria 4317
616 Ga0307408_100004785 3300031548 Bacteria 9121
617 Ga0307408_100005566 3300031548 Bacteria 8420
618 Ga0307408_100042193 3300031548 Bacteria 3239
619 Ga0307408_100138087 3300031548 Bacteria 1910
620 Ga0307508_10000594 3300031616 Bacteria 43299
621 Ga0307508_10007413 3300031616 Bacteria 10216
622 Ga0307508_10098622 3300031616 Bacteria 2515
623 Ga0307514_10098011 3300031649 Bacteria 2114
624 Ga0307514_10115888 3300031649 Bacteria 1884
625 Ga0316575_10025677 3300031665 Bacteria 2286
626 Ga0307405_10049022 3300031731 Bacteria 2608
627 Ga0307413_10016262 3300031824 Bacteria 3838
628 Ga0307413_10062062 3300031824 Bacteria 2310
629 Ga0307412_10000021 3300031911 Bacteria 250629
630 Ga0307412_10121659 3300031911 Bacteria 1880
631 Ga0307409_100012184 3300031995 Bacteria 5467
632 Ga0307416_100014376 3300032002 Bacteria 5422
633 Ga0307411_10055503 3300032005 Bacteria 2606
634 Ga0307415_100180022 3300032126 Bacteria 1657
635 Ga0307507_10053322 3300033179 Bacteria 3865
636 Ga0307510_10012482 3300033180 Bacteria 10079
637 Ga0307510_10045807 3300033180 Bacteria 4713
638 Ga0307510_10090271 3300033180 Bacteria 2911
639 Ga0373931_0001546 3300035691 Bacteria 9925
640 Ga0395899_0000007 3300037312 Bacteria 629129
641 Ga0395899_0057002 3300037312 Bacteria 2886
642 Ga0395899_0061163 3300037312 Bacteria 2774
643 Ga0395899_0076329 3300037312 Bacteria 2446
644 Ga0395900_0000026 3300037418 Bacteria 313470
645 Ga0395900_0001159 3300037418 Bacteria 33030
646 Ga0395900_0031653 3300037418 Bacteria 5437
647 Ga0395900_0069818 3300037418 Bacteria 3611
648 Ga0395900_0182491 3300037418 Bacteria 2132
649 Ga0395898_0000497 3300037466 Bacteria 76853
650 Ga0395898_0000784 3300037466 Bacteria 54539
651 Ga0395898_0124764 3300037466 Bacteria 2466
652 Ga0395905_0000459 3300037471 Bacteria 57003
653 Ga0395905_0003226 3300037471 Bacteria 17538
654 Ga0395905_0039423 3300037471 Bacteria 4432
655 Ga0395905_0069175 3300037471 Bacteria 3307
656 Ga0395905_0208172 3300037471 Bacteria 1833
657 Ga0436364_1329714 3300037853 Bacteria 45658
658 Ga0395901_0000077 3300038443 Bacteria 135073
659 Ga0395901_0000296 3300038443 Bacteria 61806
660 Ga0395901_0003986 3300038443 Bacteria 14860
661 Ga0436365_0181312 3300039437 Bacteria 1645
662 Ga0436365_0380661 3300039437 Bacteria 3746
663 Ga0436365_1091962 3300039437 Bacteria 109548
664 Ga0436365_1914962 3300039437 Bacteria 12322
665 Ga0436361_0624331 3300039447 Bacteria 6509
666 Ga0436361_0692684 3300039447 Bacteria 133303
667 Ga0436361_0734074 3300039447 Bacteria 42530
668 Ga0439438_001562 3300041405 Bacteria 10086
669 Ga0439438_002218 3300041405 Bacteria 8361
670 Ga0439447_003440 3300041407 Bacteria 5626
671 Ga0451789_1242607 3300041443 Bacteria 1884
672 Ga0451853_3442227 3300041512 Bacteria 9276
673 Ga0439448_0000988 3300042005 Bacteria 7068
674 Ga0439452_000002 3300042010 Bacteria 1377577
675 Ga0439452_000036 3300042010 Bacteria 158675
676 Ga0439452_000089 3300042010 Bacteria 79368
677 Ga0439452_000235 3300042010 Bacteria 38565
678 Ga0439452_000816 3300042010 Bacteria 14589
679 Ga0450900_006298 3300042136 Bacteria 1432
680 Ga0439435_0003906 3300042436 Bacteria 3156
681 Ga0439464_0003592 3300042439 Bacteria 3929
682 Ga0439464_0019621 3300042439 Bacteria 1847
683 Ga0451577_0010348 3300042876 Bacteria 8927
684 Ga0451577_0069143 3300042876 Bacteria 3149
685 Ga0466969_0007486 3300044656 Bacteria 5806
686 Ga0466969_0033304 3300044656 Bacteria 2617
687 Ga0466972_0036679 3300044658 Bacteria 2397
688 Ga0466972_0037298 3300044658 Bacteria 2376
689 Ga0466972_0052572 3300044658 Bacteria 1963
690 Ga0466981_0000019 3300044669 Bacteria 91861
691 Ga0453683_0143402 3300044673 Bacteria 1508
692 Ga0466965_0018895 3300044683 Bacteria 3307
693 Ga0466965_0048207 3300044683 Bacteria 2110
694 Ga0466966_0000084 3300044684 Bacteria 58535
695 Ga0466966_0000362 3300044684 Bacteria 29495
696 Ga0466966_0004483 3300044684 Bacteria 9210
697 Ga0466966_0005728 3300044684 Bacteria 8177
698 Ga0466961_0000427 3300044693 Bacteria 26808
699 Ga0466961_0000544 3300044693 Bacteria 23991
700 Ga0466961_0001445 3300044693 Bacteria 14751
701 Ga0466961_0023009 3300044693 Bacteria 4008
702 Ga0466961_0035146 3300044693 Bacteria 3218
703 Ga0466963_0005199 3300044694 Bacteria 7598
704 Ga0466963_0026351 3300044694 Bacteria 3717
705 Ga0466964_0002299 3300044706 Bacteria 6780
706 Ga0466964_0036045 3300044706 Bacteria 1981
707 Ga0453684_0001126 3300044712 Bacteria 83760
708 Ga0453684_0003805 3300044712 Bacteria 33295
709 Ga0453684_0320019 3300044712 Bacteria 1757
710 Ga0466971_0002907 3300044719 Bacteria 7267
711 Ga0466971_0083903 3300044719 Bacteria 1454
712 Ga0466970_0012108 3300044765 Bacteria 4405
713 Ga0466957_0009283 3300044842 Bacteria 5612
714 Ga0466957_0037239 3300044842 Bacteria 2928
715 Ga0466959_0006868 3300045049 Bacteria 7938
716 Ga0466959_0007452 3300045049 Bacteria 7678
717 Ga0466959_0013229 3300045049 Bacteria 5976
718 Ga0451576_0001379 3300045051 Bacteria 41763
719 Ga0451576_0015852 3300045051 Bacteria 8335
720 Ga0451576_0056029 3300045051 Bacteria 4124
721 Ga0451576_0324705 3300045051 Bacteria 1611
722 Ga0466958_0001681 3300045836 Bacteria 10674
723 Ga0466958_0005145 3300045836 Bacteria 6992
724 Ga0466958_0014545 3300045836 Bacteria 4492
725 Ga0466958_0107075 3300045836 Bacteria 1743
726 Ga0495592_0000413 3300046454 Bacteria 32677
727 Ga0495592_0010535 3300046454 Bacteria 6972
728 Ga0495603_0006170 3300046455 Bacteria 7166
729 Ga0495590_0005435 3300046457 Bacteria 5056
730 Ga0495591_000001 3300046458 Bacteria 503087
731 Ga0495591_000066 3300046458 Bacteria 121317
732 Ga0495591_006822 3300046458 Bacteria 4968
733 Ga0495591_008803 3300046458 Bacteria 4086
734 Ga0495629_0000172 3300046459 Bacteria 57319
735 Ga0495629_0000506 3300046459 Bacteria 32709
736 Ga0495629_0002744 3300046459 Bacteria 13472
737 Ga0495629_0057883 3300046459 Bacteria 2709
738 Ga0495629_0100044 3300046459 Bacteria 2023
739 Ga0495638_0000724 3300046460 Bacteria 35505
740 Ga0495638_0015989 3300046460 Bacteria 5029
741 Ga0495638_0157399 3300046460 Bacteria 1313
742 Ga0495651_0017252 3300046462 Bacteria 5593
743 Ga0495653_0019400 3300046463 Bacteria 5514
744 Ga0495653_0019791 3300046463 Bacteria 5456
745 Ga0495653_0022992 3300046463 Bacteria 5041
746 Ga0495653_0030155 3300046463 Bacteria 4323
747 Ga0495653_0043631 3300046463 Bacteria 3485
748 Ga0495653_0073444 3300046463 Bacteria 2552
749 Ga0495650_0000016 3300046471 Bacteria 554693
750 Ga0495650_0000282 3300046471 Bacteria 96956
751 Ga0495650_0006200 3300046471 Bacteria 7504
752 Ga0495650_0007870 3300046471 Bacteria 6330
753 Ga0495650_0011447 3300046471 Bacteria 4857
754 Ga0495650_0042066 3300046471 Bacteria 1949
755 Ga0495580_0002910 3300046472 Bacteria 14703
756 Ga0495580_0006463 3300046472 Bacteria 9538
757 Ga0495580_0018014 3300046472 Bacteria 5265
758 Ga0495580_0059891 3300046472 Bacteria 2675
759 Ga0495580_0093406 3300046472 Bacteria 2094
760 Ga0495582_0001714 3300046473 Bacteria 12364
761 Ga0495582_0115445 3300046473 Bacteria 1510
762 Ga0495582_0132145 3300046473 Bacteria 1411
763 Ga0495605_0002724 3300046474 Bacteria 10782
764 Ga0495605_0003771 3300046474 Bacteria 8993
765 Ga0495605_0011246 3300046474 Bacteria 4996
766 Ga0495605_0037059 3300046474 Bacteria 2455
767 Ga0495605_0064509 3300046474 Bacteria 1744
768 Ga0495664_0001580 3300046477 Bacteria 12085
769 Ga0495664_0021769 3300046477 Bacteria 3704
770 Ga0495664_0047901 3300046477 Bacteria 2537
771 Ga0495664_0049736 3300046477 Bacteria 2488
772 Ga0495594_0032831 3300046499 Bacteria 2819
773 Ga0495596_0000464 3300046500 Bacteria 25748
774 Ga0495596_0012405 3300046500 Bacteria 3649
775 Ga0495596_0013080 3300046500 Bacteria 3532
776 Ga0495596_0033012 3300046500 Bacteria 2061
777 Ga0495607_0036436 3300046501 Bacteria 2964
778 Ga0495583_0009682 3300046506 Bacteria 5726
779 Ga0495583_0012014 3300046506 Bacteria 4932
780 Ga0495606_0000318 3300046507 Bacteria 82802
781 Ga0495606_0003649 3300046507 Bacteria 16140
782 Ga0495606_0005502 3300046507 Bacteria 12113
783 Ga0495606_0006216 3300046507 Bacteria 11099
784 Ga0495606_0025325 3300046507 Bacteria 4251
785 Ga0495608_0000972 3300046511 Bacteria 20254
786 Ga0495608_0006938 3300046511 Bacteria 8021
787 Ga0495610_0001926 3300046512 Bacteria 17906
788 Ga0495610_0001938 3300046512 Bacteria 17830
789 Ga0495616_0003931 3300046513 Bacteria 9464
790 Ga0495616_0038228 3300046513 Bacteria 2465
791 Ga0495618_0003662 3300046514 Bacteria 9526
792 Ga0495618_0012834 3300046514 Bacteria 5092
793 Ga0495618_0043358 3300046514 Bacteria 2838
794 Ga0495620_0005352 3300046515 Bacteria 7176
795 Ga0495620_0008055 3300046515 Bacteria 5672
796 Ga0495628_0012653 3300046516 Bacteria 7109
797 Ga0495628_0063088 3300046516 Bacteria 2903
798 Ga0495630_0032279 3300046517 Bacteria 3901
799 Ga0495630_0066106 3300046517 Bacteria 2717
800 Ga0495631_0019888 3300046518 Bacteria 3143
801 Ga0495637_0003212 3300046520 Bacteria 8727
802 Ga0495643_0027330 3300046522 Bacteria 3209
803 Ga0495644_0008789 3300046523 Bacteria 3884
804 Ga0495648_0084740 3300046524 Bacteria 1792
805 Ga0495648_0086599 3300046524 Bacteria 1766
806 Ga0495666_0001321 3300046526 Bacteria 11998
807 Ga0495666_0004894 3300046526 Bacteria 6772
808 Ga0495642_0019634 3300046528 Bacteria 2650
809 Ga0495642_0065478 3300046528 Bacteria 1513
810 Ga0495652_0023493 3300046529 Bacteria 5465
811 Ga0495652_0043262 3300046529 Bacteria 3880
812 Ga0495652_0063919 3300046529 Bacteria 3098
813 Ga0495652_0068546 3300046529 Bacteria 2971
814 Ga0495652_0115701 3300046529 Bacteria 2148
815 Ga0495654_0000033 3300046530 Bacteria 201799
816 Ga0495654_0000055 3300046530 Bacteria 142121
817 Ga0495654_0003551 3300046530 Bacteria 9509
818 Ga0495654_0008618 3300046530 Bacteria 5622
819 Ga0495654_0035205 3300046530 Bacteria 2523
820 Ga0495654_0135188 3300046530 Bacteria 1103
821 Ga0495665_0003857 3300046531 Bacteria 8115
822 Ga0495665_0018084 3300046531 Bacteria 3789
823 Ga0495665_0046983 3300046531 Bacteria 2290
824 Ga0495665_0057008 3300046531 Bacteria 2062
825 Ga0495665_0124720 3300046531 Bacteria 1348
826 Ga0495640_0069191 3300046533 Bacteria 2374
827 Ga0495586_0004311 3300046535 Bacteria 7598
828 Ga0495586_0065834 3300046535 Bacteria 1975
829 Ga0495587_0019557 3300046536 Bacteria 4189
830 Ga0495609_0001831 3300046538 Bacteria 13621
831 Ga0495621_0045583 3300046539 Bacteria 1553
832 Ga0495597_0000112 3300046542 Bacteria 72402
833 Ga0495597_0000354 3300046542 Bacteria 40920
834 Ga0495597_0003154 3300046542 Bacteria 9868
835 Ga0495645_0000357 3300046543 Bacteria 31874
836 Ga0495645_0009233 3300046543 Bacteria 6891
837 Ga0495622_0000551 3300046557 Bacteria 22485
838 Ga0495622_0010729 3300046557 Bacteria 4227
839 Ga0495622_0036110 3300046557 Bacteria 2305
840 Ga0495667_0125064 3300046559 Bacteria 1660
841 Ga0495668_0020606 3300046616 Bacteria 3791
842 Ga0495668_0022906 3300046616 Bacteria 3567
843 Ga0495668_0067009 3300046616 Bacteria 1975
844 Ga0495634_0029934 3300046642 Bacteria 3764
845 Ga0495634_0055984 3300046642 Bacteria 2636
846 Ga0495625_0017124 3300046660 Bacteria 5680
847 Ga0495625_0041262 3300046660 Bacteria 3360
848 Ga0495625_0044735 3300046660 Bacteria 3203
849 Ga0495635_0005954 3300046663 Bacteria 8507
850 Ga0495635_0030228 3300046663 Bacteria 3764
851 Ga0495661_0008523 3300046665 Bacteria 7088
852 Ga0495661_0054035 3300046665 Bacteria 2413
853 Ga0495661_0093070 3300046665 Bacteria 1711
854 Ga0495588_0004132 3300046674 Bacteria 6393
855 Ga0495588_0013181 3300046674 Bacteria 3933
856 Ga0495588_0018457 3300046674 Bacteria 3402
857 Ga0495599_0040071 3300046678 Bacteria 2942
858 Ga0495623_0008552 3300046679 Bacteria 6647
859 Ga0495623_0010914 3300046679 Bacteria 5881
860 Ga0495646_0025935 3300046680 Bacteria 3682
861 Ga0495646_0037729 3300046680 Bacteria 2987
862 Ga0495646_0054746 3300046680 Bacteria 2398
863 Ga0495646_0057937 3300046680 Bacteria 2317
864 Ga0495669_0026341 3300046684 Bacteria 2541
865 Ga0495613_0003580 3300046689 Bacteria 11638
866 Ga0495613_0013703 3300046689 Bacteria 6015
867 Ga0495613_0070594 3300046689 Bacteria 2547
868 Ga0495624_0013999 3300046690 Bacteria 5458
869 Ga0495624_0031318 3300046690 Bacteria 3459
870 Ga0495624_0054625 3300046690 Bacteria 2517
871 Ga0495670_0026371 3300046691 Bacteria 2876
872 Ga0495671_0007138 3300046692 Bacteria 6397
873 Ga0495671_0017632 3300046692 Bacteria 3798
874 Ga0495649_0006065 3300046694 Bacteria 7557
875 Ga0495649_0006663 3300046694 Bacteria 7169
876 Ga0495649_0028670 3300046694 Bacteria 3085
877 Ga0495589_0004533 3300046794 Bacteria 7387
878 Ga0495589_0011136 3300046794 Bacteria 4667
879 Ga0495589_0012497 3300046794 Bacteria 4397
880 Ga0495589_0013954 3300046794 Bacteria 4142
881 Ga0495600_0003827 3300046809 Bacteria 8915
882 Ga0495660_0000007 3300046810 Bacteria 485295
883 Ga0495660_0000017 3300046810 Bacteria 320655
884 Ga0495660_0047842 3300046810 Bacteria 2340
885 Ga0495660_0078528 3300046810 Bacteria 1735
886 Ga0495581_0005000 3300047315 Bacteria 7680
887 Ga0495581_0017429 3300047315 Bacteria 4171
888 Ga0495581_0022055 3300047315 Bacteria 3691
889 Ga0495581_0026657 3300047315 Bacteria 3350
890 Ga0495581_0032019 3300047315 Bacteria 3045
891 Ga0495581_0059180 3300047315 Bacteria 2213
892 Ga0495581_0087182 3300047315 Bacteria 1810
893 Ga0495604_0038131 3300047317 Bacteria 3781
894 Ga0495604_0051054 3300047317 Bacteria 3208
895 Ga0495604_0067973 3300047317 Bacteria 2706
896 Ga0495636_0033949 3300047318 Bacteria 2098
897 Ga0495636_0056849 3300047318 Bacteria 1647
898 Ga0495674_0003612 3300047319 Bacteria 15056
899 Ga0495674_0008069 3300047319 Bacteria 10052
900 Ga0495674_0048438 3300047319 Bacteria 3760
901 Ga0495674_0050490 3300047319 Bacteria 3670
902 Ga0495674_0092897 3300047319 Bacteria 2575
903 Ga0495674_0165473 3300047319 Bacteria 1848
904 Ga0495674_0181119 3300047319 Bacteria 1754
905 Ga0495672_0000001 3300047320 Bacteria 1458820
906 Ga0495672_0000009 3300047320 Bacteria 557755
907 Ga0495672_0003268 3300047320 Bacteria 14029
908 Ga0495676_0022958 3300047321 Bacteria 5421
909 Ga0495676_0052435 3300047321 Bacteria 3256
910 Ga0495680_0018438 3300047322 Bacteria 5926
911 Ga0495680_0024575 3300047322 Bacteria 4996
912 Ga0495680_0027463 3300047322 Bacteria 4675
913 Ga0495680_0101575 3300047322 Bacteria 2142
914 Ga0495683_0007379 3300047323 Bacteria 5958
915 Ga0495683_0025313 3300047323 Bacteria 3043
916 Ga0495683_0026851 3300047323 Bacteria 2946
917 Ga0495683_0073432 3300047323 Bacteria 1677
918 Ga0495687_000015 3300047443 Bacteria 365627
919 Ga0495687_000421 3300047443 Bacteria 52470
920 Ga0495687_008170 3300047443 Bacteria 6034
921 Ga0495687_011651 3300047443 Bacteria 4710
922 Ga0495687_034108 3300047443 Bacteria 2302
923 Ga0495687_039183 3300047443 Bacteria 2098
924 Ga0495687_065240 3300047443 Bacteria 1483
925 Ga0495675_0019316 3300047444 Bacteria 4328
926 Ga0495675_0023932 3300047444 Bacteria 3892
927 Ga0495679_000032 3300047446 Bacteria 171636
928 Ga0495679_000214 3300047446 Bacteria 49621
929 Ga0495679_002722 3300047446 Bacteria 8812
930 Ga0495679_011957 3300047446 Bacteria 3330
931 Ga0495685_017388 3300047447 Bacteria 2463
932 Ga0495673_0000019 3300047469 Bacteria 554389
933 Ga0495673_0000071 3300047469 Bacteria 217117
934 Ga0495673_0022497 3300047469 Bacteria 3087
935 Ga0495673_0055471 3300047469 Bacteria 1718
936 Ga0495686_0000002 3300047472 Bacteria 1050777
937 Ga0495593_0040336 3300047673 Bacteria 2513
938 Ga0495602_0016898 3300048088 Bacteria 7321
939 Ga0495602_0032598 3300048088 Bacteria 4903
940 Ga0495602_0059754 3300048088 Bacteria 3325
941 Ga0495614_0011687 3300048089 Bacteria 3859
942 Ga0495626_0004577 3300048091 Bacteria 8431
943 Ga0496100_0002406 3300048903 Bacteria 9478
944 Ga0496100_0030684 3300048903 Bacteria 3336
945 Ga0496100_0077293 3300048903 Bacteria 2237
946 Ga0496101_0001779 3300048904 Bacteria 12954
947 Ga0496101_0001970 3300048904 Bacteria 12441
948 Ga0496101_0003292 3300048904 Bacteria 10049
949 Ga0496102_0001049 3300048905 Bacteria 25567
950 Ga0496102_0005053 3300048905 Bacteria 11168
951 Ga0496102_0018370 3300048905 Bacteria 6143
952 Ga0496102_0056284 3300048905 Bacteria 3587
953 Ga0496102_0155584 3300048905 Bacteria 2149
954 Ga0496103_0002203 3300048906 Bacteria 12354
955 Ga0496103_0003261 3300048906 Bacteria 9943
956 Ga0496104_0000901 3300048907 Bacteria 25549
957 Ga0496104_0045619 3300048907 Bacteria 4123
958 Ga0496104_0120206 3300048907 Bacteria 2522
959 Ga0496105_0005680 3300048908 Bacteria 9494
960 Ga0496105_0019626 3300048908 Bacteria 5453
961 Ga0496105_0080533 3300048908 Bacteria 2690
962 Ga0496105_0109255 3300048908 Bacteria 2283
963 Ga0496105_0148506 3300048908 Bacteria 1927
964 Ga0496106_0000089 3300048909 Bacteria 72356
965 Ga0496106_0003051 3300048909 Bacteria 12482
966 Ga0496106_0010892 3300048909 Bacteria 6718
967 Ga0496106_0045700 3300048909 Bacteria 3290
968 Ga0496106_0139939 3300048909 Bacteria 1903
969 Ga0496107_0002731 3300048910 Bacteria 11588
970 Ga0496107_0123607 3300048910 Bacteria 1907
971 Ga0496108_0037533 3300048911 Bacteria 4036
972 Ga0496112_0011516 3300048915 Bacteria 8081
973 Ga0496112_0013309 3300048915 Bacteria 7595
974 Ga0496112_0016390 3300048915 Bacteria 6941
975 Ga0496113_0002808 3300048916 Bacteria 10255
976 Ga0496113_0074199 3300048916 Bacteria 2593
977 Ga0496113_0107728 3300048916 Bacteria 2165
978 Ga0496114_0003191 3300048917 Bacteria 12572
979 Ga0496115_0019931 3300048918 Bacteria 5168
980 Ga0496115_0028876 3300048918 Bacteria 4350
981 Ga0496116_0000054 3300048919 Bacteria 289010
982 Ga0496116_0000404 3300048919 Bacteria 62080
983 Ga0496116_0000563 3300048919 Bacteria 49675
984 Ga0496116_0000656 3300048919 Bacteria 45209
985 Ga0496116_0018056 3300048919 Bacteria 5452
986 Ga0496116_0020601 3300048919 Bacteria 5003
987 Ga0496116_0047659 3300048919 Bacteria 2883
988 Ga0496116_0083492 3300048919 Bacteria 1971
989 Ga0496117_0000589 3300048920 Bacteria 59852
990 Ga0496117_0002070 3300048920 Bacteria 26530
991 Ga0496117_0002132 3300048920 Bacteria 25882
992 Ga0496117_0004572 3300048920 Bacteria 15145
993 Ga0496117_0010642 3300048920 Bacteria 8342
994 Ga0496117_0017617 3300048920 Bacteria 5959
995 Ga0496117_0020400 3300048920 Bacteria 5403
996 Ga0496117_0028584 3300048920 Bacteria 4315
997 Ga0496117_0031106 3300048920 Bacteria 4081
998 Ga0496118_0000542 3300048921 Bacteria 62176
999 Ga0496118_0000760 3300048921 Bacteria 52060
1000 Ga0496118_0002012 3300048921 Bacteria 28785
1001 Ga0496118_0002453 3300048921 Bacteria 24974
1002 Ga0496118_0003100 3300048921 Bacteria 21318
1003 Ga0496118_0007960 3300048921 Bacteria 11083
1004 Ga0496118_0008138 3300048921 Bacteria 10919
1005 Ga0496118_0011717 3300048921 Bacteria 8523
1006 Ga0496118_0026170 3300048921 Bacteria 4977
1007 Ga0496118_0026741 3300048921 Bacteria 4905
1008 Ga0496118_0046051 3300048921 Bacteria 3397
1009 Ga0496118_0072634 3300048921 Bacteria 2470
1010 Ga0496118_0149331 3300048921 Bacteria 1465
1011 Ga0496119_0000013 3300048922 Bacteria 323820
1012 Ga0496119_0000487 3300048922 Bacteria 54233
1013 Ga0496119_0002421 3300048922 Bacteria 20486
1014 Ga0496119_0006876 3300048922 Bacteria 10387
1015 Ga0496119_0011580 3300048922 Bacteria 7277
1016 Ga0496119_0016388 3300048922 Bacteria 5642
1017 Ga0496119_0041896 3300048922 Bacteria 2909
1018 Ga0496120_0000127 3300048923 Bacteria 128189
1019 Ga0496120_0001247 3300048923 Bacteria 32027
1020 Ga0496120_0001743 3300048923 Bacteria 24718
1021 Ga0496120_0002433 3300048923 Bacteria 18837
1022 Ga0496120_0002439 3300048923 Bacteria 18822
1023 Ga0496120_0002997 3300048923 Bacteria 16036
1024 Ga0496120_0010817 3300048923 Bacteria 6322
1025 Ga0496120_0011643 3300048923 Bacteria 6036
1026 Ga0496120_0023862 3300048923 Bacteria 3823
1027 Ga0496121_0002823 3300048924 Bacteria 25686
1028 Ga0496121_0002856 3300048924 Bacteria 25463
1029 Ga0496121_0003030 3300048924 Bacteria 24396
1030 Ga0496121_0006525 3300048924 Bacteria 14424
1031 Ga0496121_0011222 3300048924 Bacteria 9983
1032 Ga0496121_0013134 3300048924 Bacteria 8933
1033 Ga0496121_0020308 3300048924 Bacteria 6585
1034 Ga0496121_0036376 3300048924 Bacteria 4388
1035 Ga0496121_0071177 3300048924 Bacteria 2798
1036 Ga0496121_0121576 3300048924 Bacteria 1971
1037 Ga0496121_0164691 3300048924 Bacteria 1617
1038 Ga0496122_0000003 3300048925 Bacteria 645810
1039 Ga0496122_0000013 3300048925 Bacteria 501039
1040 Ga0496122_0000531 3300048925 Bacteria 79144
1041 Ga0496122_0001786 3300048925 Bacteria 32964
1042 Ga0496122_0002190 3300048925 Bacteria 28574
1043 Ga0496122_0004133 3300048925 Bacteria 18347
1044 Ga0496122_0006638 3300048925 Bacteria 13197
1045 Ga0496122_0009302 3300048925 Bacteria 10386
1046 Ga0496122_0016118 3300048925 Bacteria 7099
1047 Ga0496123_0000010 3300048926 Bacteria 501039
1048 Ga0496123_0000012 3300048926 Bacteria 458760
1049 Ga0496123_0000108 3300048926 Bacteria 166102
1050 Ga0496123_0001302 3300048926 Bacteria 35523
1051 Ga0496123_0003521 3300048926 Bacteria 17440
1052 Ga0496123_0003666 3300048926 Bacteria 16946
1053 Ga0496123_0003877 3300048926 Bacteria 16271
1054 Ga0496123_0005221 3300048926 Bacteria 13197
1055 Ga0496123_0006294 3300048926 Bacteria 11543
1056 Ga0496123_0015896 3300048926 Bacteria 6141
1057 Ga0496124_0000010 3300048927 Bacteria 595157
1058 Ga0496124_0000060 3300048927 Bacteria 239933
1059 Ga0496124_0000086 3300048927 Bacteria 202844
1060 Ga0496124_0001326 3300048927 Bacteria 37257
1061 Ga0496124_0003926 3300048927 Bacteria 17760
1062 Ga0496124_0006620 3300048927 Bacteria 12580
1063 Ga0496124_0015626 3300048927 Bacteria 7266
1064 Ga0496124_0015885 3300048927 Bacteria 7191
1065 Ga0496124_0018274 3300048927 Bacteria 6571
1066 Ga0496124_0058546 3300048927 Bacteria 3239
1067 Ga0496124_0143629 3300048927 Bacteria 1880
1068 Ga0496125_0000019 3300048928 Bacteria 474989
1069 Ga0496125_0000580 3300048928 Bacteria 62643
1070 Ga0496125_0002767 3300048928 Bacteria 22197
1071 Ga0496125_0014233 3300048928 Bacteria 7756
1072 Ga0496125_0017865 3300048928 Bacteria 6749
1073 Ga0496125_0038117 3300048928 Bacteria 4166
1074 Ga0496125_0234540 3300048928 Bacteria 1170
1075 Ga0496126_0000031 3300048929 Bacteria 373371
1076 Ga0496126_0004481 3300048929 Bacteria 16666
1077 Ga0496126_0005728 3300048929 Bacteria 14067
1078 Ga0496126_0100890 3300048929 Bacteria 2525
1079 Ga0496126_0108480 3300048929 Bacteria 2420
1080 Ga0496126_0162075 3300048929 Bacteria 1910
1081 Ga0496126_0165372 3300048929 Bacteria 1888
1082 Ga0496126_0314450 3300048929 Bacteria 1289
1083 Ga0495678_000493 3300049459 Bacteria 39034
1084 Ga0495678_014271 3300049459 Bacteria 3700
1085 Ga0495678_024387 3300049459 Bacteria 2612
1086 Ga0495682_0000011 3300049460 Bacteria 278474
1087 Ga0501043_0000027 3300049579 Bacteria 144685
1088 Ga0501046_0000034 3300049580 Bacteria 173742
1089 Ga0501047_0000042 3300049581 Bacteria 176603
1090 Ga0501048_0013088 3300049582 Bacteria 6159
1091 Ga0501071_0250800 3300049587 Bacteria 1336
1092 Ga0501075_0116164 3300049591 Bacteria 2034
1093 Ga0501076_0027391 3300049592 Bacteria 4420
1094 Ga0501077_0049598 3300049593 Bacteria 2667
1095 Ga0501198_000015 3300049649 Bacteria 102945
1096 Ga0501222_000045 3300049662 Bacteria 46767
1097 Ga0501079_0032488 3300049741 Bacteria 4012
1098 Ga0501081_0003459 3300049743 Bacteria 10081
1099 Ga0501045_0095237 3300049824 Bacteria 2202
1100 nmdc:mga03683_45402_c1 3300050489 Bacteria 1818
1101 nmdc:mga03683_8078_c2 3300050489 Bacteria 2310
1102 nmdc:mga03n38_12496_c1 3300050490 Bacteria 3198
1103 nmdc:mga00v17_103309_c1 3300050491 Bacteria 1801
1104 nmdc:mga00v17_14361_c1 3300050491 Bacteria 4418
1105 nmdc:mga00v17_99563_c1 3300050491 Bacteria 1834
1106 nmdc:mga0yw44_60814_c1 3300050492 Bacteria 2315
1107 nmdc:mga0k408_1919_c1 3300050493 Bacteria 11132
1108 nmdc:mga0k408_22567_c1 3300050493 Bacteria 3544
1109 nmdc:mga0k408_27503_c1 3300050493 Bacteria 3230
1110 nmdc:mga0k408_4870_c1 3300050493 Bacteria 7118
1111 nmdc:mga0k408_62313_c1 3300050493 Bacteria 2169
1112 nmdc:mga0k408_654_c1 3300050493 Bacteria 18954
1113 nmdc:mga0k408_808_c1 3300050493 Bacteria 17249
1114 nmdc:mga07m45_14574_c1 3300050496 Bacteria 4192
1115 nmdc:mga07m45_3667_c1 3300050496 Bacteria 7421
1116 nmdc:mga07m45_37537_c1 3300050496 Bacteria 2702
1117 nmdc:mga07m45_6216_c1 3300050496 Bacteria 6028
1118 nmdc:mga08y16_94066_c1 3300050511 Bacteria 3122
1119 nmdc:mga0sz30_14199_c1 3300050516 Bacteria 3131
1120 Ga0500610_0029190 3300053079 Bacteria 2785
1121 Ga0500578_0000115 3300053086 Bacteria 95966
1122 Ga0500644_0007072 3300053088 Bacteria 2907
1123 Ga0500644_0011777 3300053088 Bacteria 2400
1124 Ga0500593_000286 3300053117 Bacteria 20561
1125 Ga0500593_013547 3300053117 Bacteria 3483
1126 Ga0500593_016746 3300053117 Bacteria 3178
1127 Ga0500618_010284 3300053125 Bacteria 2515
1128 Ga0500621_000005 3300053126 Bacteria 320383
1129 Ga0500628_014995 3300053129 Bacteria 1474
1130 Ga0500652_000329 3300053131 Bacteria 17029
1131 Ga0500652_000434 3300053131 Bacteria 14795
1132 Ga0500652_034037 3300053131 Bacteria 2017
1133 Ga0500658_0006032 3300053134 Bacteria 4504
1134 Ga0500559_0000017 3300053136 Bacteria 143646
1135 Ga0500568_0024978 3300053139 Bacteria 2525
1136 Ga0500590_024949 3300053148 Bacteria 3105
1137 Ga0500622_0000205 3300053156 Bacteria 62937
1138 Ga0500622_0001272 3300053156 Bacteria 20575
1139 Ga0500622_0002775 3300053156 Bacteria 12319
1140 Ga0500634_0025524 3300053161 Bacteria 3216
1141 Ga0501084_0045276 3300054114 Bacteria 3684
1142 Ga0590075_010397 3300059424 Bacteria 2240
1143 Ga0501082_0034504 3300060353 Bacteria 4361
1144 Ga0466962_0000311 3300061719 Bacteria 20821
1145 Ga0466962_0008657 3300061719 Bacteria 4879
1146 Ga0466962_0028734 3300061719 Bacteria 2663
1147 Ga0466962_0063885 3300061719 Bacteria 1758
1148 Ga0530510_0148123 3300061734 Bacteria 1732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0135188 Ga0495654_0135188_15_1016 333
2 3300003784 Ga0055534_1001506 Ga0055534_10015069 347
3 3300031456 Ga0307513_10018375 Ga0307513_100183754 349
4 3300005262 Ga0065165_1000995 Ga0065165_10009958 350
5 3300003187 JGI25151J46595_10011762 JGI25151J46595_100117624 351
6 3300003771 Ga0055526_1022565 Ga0055526_10225653 351
7 3300003773 Ga0055537_1006004 Ga0055537_10060044 351
8 3300003775 Ga0055524_1001692 Ga0055524_10016924 351
9 3300003784 Ga0055534_1005936 Ga0055534_10059364 351
10 3300025263 Ga0209565_1000021 Ga0209565_1000021263 351
11 3300025291 Ga0209675_1001200 Ga0209675_10012008 351
12 3300025294 Ga0209025_1000522 Ga0209025_100052229 351
13 3300025295 Ga0209564_1000455 Ga0209564_100045543 351
14 3300025297 Ga0209758_1011374 Ga0209758_10113742 351
15 3300025299 Ga0209256_1000625 Ga0209256_100062514 351
16 3300044693 Ga0466961_0035146 Ga0466961_0035146_1432_2583 351
17 3300001989 JGI24739J22299_10019743 JGI24739J22299_100197432 352
18 3300005367 Ga0070667_100000372 Ga0070667_1000003728 352
19 3300009011 Ga0105251_10001354 Ga0105251_100013543 352
20 3300013308 Ga0157375_10037300 Ga0157375_100373003 352
21 3300015262 Ga0182007_10000581 Ga0182007_100005817 352
22 3300025735 Ga0207713_1002028 Ga0207713_10020281 352
23 3300025986 Ga0207658_10001495 Ga0207658_100014958 352
24 3300048921 Ga0496118_0002012 Ga0496118_0002012_13135_14274 352
25 3300046471 Ga0495650_0042066 Ga0495650_0042066_718_1797 354
26 3300046518 Ga0495631_0019888 Ga0495631_0019888_843_1979 354
27 3300025294 Ga0209025_1001239 Ga0209025_100123916 358
28 3300025299 Ga0209256_1000280 Ga0209256_100028023 358
29 3300045051 Ga0451576_0015852 Ga0451576_0015852_1150_2295 362
30 3300033180 Ga0307510_10045807 Ga0307510_100458073 364
31 3300053131 Ga0500652_034037 Ga0500652_034037_764_1915 364
32 3300005344 Ga0070661_100113362 Ga0070661_1001133623 365
33 3300001989 JGI24739J22299_10009567 JGI24739J22299_100095672 367
34 3300005327 Ga0070658_10003785 Ga0070658_100037854 367
35 3300005339 Ga0070660_100000046 Ga0070660_10000004668 367
36 3300005366 Ga0070659_100020442 Ga0070659_1000204424 367
37 3300005563 Ga0068855_100039740 Ga0068855_1000397404 367
38 3300005564 Ga0070664_100072980 Ga0070664_1000729803 367
39 3300009545 Ga0105237_10173035 Ga0105237_101730351 367
40 3300009551 Ga0105238_10001497 Ga0105238_100014973 367
41 3300010375 Ga0105239_10022568 Ga0105239_100225684 367
42 3300025228 Ga0209672_100023 Ga0209672_100023202 367
43 3300025229 Ga0209147_100094 Ga0209147_100094140 367
44 3300025242 Ga0209258_100142 Ga0209258_100142129 367
45 3300025256 Ga0209759_1001844 Ga0209759_10018447 367
46 3300025904 Ga0207647_10000498 Ga0207647_100004982 367
47 3300025909 Ga0207705_10033405 Ga0207705_100334053 367
48 3300025919 Ga0207657_10000004 Ga0207657_1000000453 367
49 3300025932 Ga0207690_10000102 Ga0207690_1000010267 367
50 3300025945 Ga0207679_10116150 Ga0207679_101161502 367
51 3300025949 Ga0207667_10011537 Ga0207667_100115377 367
52 3300026142 Ga0207698_10028347 Ga0207698_100283473 367
53 iso_pu_bacteria 2511231003 2511247734 367
54 iso_pu_bacteria 2588253510 2588293529 367
55 iso_pu_bacteria 2643221592 2643971622 367
56 iso_pu_bacteria 2643221625 2644141865 367
57 iso_pu_bacteria 2643221648 2644275799 367
58 3300009093 Ga0105240_10265739 Ga0105240_102657392 368
59 3300039437 Ga0436365_1914962 Ga0436365_1914962_2388_3554 368
60 3300048907 Ga0496104_0120206 Ga0496104_0120206_1257_2417 368
61 3300048908 Ga0496105_0080533 Ga0496105_0080533_978_2138 368
62 3300048910 Ga0496107_0123607 Ga0496107_0123607_678_1838 368
63 3300031665 Ga0316575_10025677 Ga0316575_100256771 369
64 3300049591 Ga0501075_0116164 Ga0501075_0116164_871_2022 369
65 3300049592 Ga0501076_0027391 Ga0501076_0027391_3076_4227 369
66 3300049593 Ga0501077_0049598 Ga0501077_0049598_1215_2366 369
67 3300049741 Ga0501079_0032488 Ga0501079_0032488_1457_2608 369
68 3300049743 Ga0501081_0003459 Ga0501081_0003459_7978_9129 369
69 3300053131 Ga0500652_000434 Ga0500652_000434_2853_4019 369
70 3300054114 Ga0501084_0045276 Ga0501084_0045276_1235_2386 369
71 3300060353 Ga0501082_0034504 Ga0501082_0034504_1923_3074 369
72 3300061734 Ga0530510_0148123 Ga0530510_0148123_251_1402 369
73 iso_pu_bacteria 2585428057 2587729186 369
74 iso_pu_bacteria 2585428058 2587734741 369
75 iso_pu_bacteria 2846033681 2846037725 369
76 iso_pu_bacteria 2846037992 2846040515 369
77 iso_pu_bacteria 2895511927 2895514973 369
78 3300039437 Ga0436365_0181312 Ga0436365_0181312_411_1577 370
79 iso_pu_bacteria 2501025501 2501070268 370
80 iso_pu_bacteria 2501025502 2501080631 370
81 iso_pu_bacteria 2501025504 2501410654 370
82 iso_pu_bacteria 2508501125 2509131234 370
83 iso_pu_bacteria 2510065045 2510251397 370
84 iso_pu_bacteria 2510917013 2511086916 370
85 iso_pu_bacteria 2510917014 2511096884 370
86 iso_pu_bacteria 2510917015 2511103693 370
87 iso_pu_bacteria 2511231002 2511245904 370
88 iso_pu_bacteria 2512047030 2512345666 370
89 iso_pu_bacteria 2513237082 2513553845 370
90 iso_pu_bacteria 2513237083 2513564792 370
91 iso_pu_bacteria 2513237151 2513961948 370
92 iso_pu_bacteria 2513237166 2514051839 370
93 iso_pu_bacteria 2515154122 2515680934 370
94 iso_pu_bacteria 2515154123 2515689924 370
95 iso_pu_bacteria 2515154189 2516019361 370
96 iso_pu_bacteria 2519103095 2519459077 370
97 iso_pu_bacteria 2526164713 2527075362 370
98 iso_pu_bacteria 2562617112 2563058723 370
99 iso_pu_bacteria 2582581311 2585291406 370
100 iso_pu_bacteria 2596583598 2597028532 370
101 iso_pu_bacteria 2599185239 2599736679 370
102 iso_pu_bacteria 2599185240 2599744734 370
103 iso_pu_bacteria 2599185355 2600205905 370
104 iso_pu_bacteria 2600255067 2600809441 370
105 iso_pu_bacteria 2643221654 2644305186 370
106 iso_pu_bacteria 2675903129 2676742860 370
107 iso_pu_bacteria 2711768613 2713476628 370
108 iso_pu_bacteria 2718217991 2719640512 370
109 iso_pu_bacteria 2738541296 2738818427 370
110 iso_pu_bacteria 2738541298 2738831416 370
111 iso_pu_bacteria 2738541306 2738872944 370
112 iso_pu_bacteria 2738543002 2739184574 370
113 iso_pu_bacteria 2738543008 2739219543 370
114 iso_pu_bacteria 2744054900 2746085787 370
115 iso_pu_bacteria 2744054901 2746096225 370
116 iso_pu_bacteria 2751185846 2753566564 370
117 iso_pu_bacteria 2791355137 2792835965 370
118 iso_pu_bacteria 2808606384 2808972417 370
119 iso_pu_bacteria 2808606390 2809007246 370
120 iso_pu_bacteria 2808606391 2809014384 370
121 iso_pu_bacteria 2816332253 2817261365 370
122 iso_pu_bacteria 2816332256 2817279042 370
123 iso_pu_bacteria 2816332286 2817451234 370
124 iso_pu_bacteria 2818991450 2819622793 370
125 iso_pu_bacteria 2818991452 2819631163 370
126 iso_pu_bacteria 2842324504 2842327927 370
127 iso_pu_bacteria 2842348783 2842352244 370
128 iso_pu_bacteria 2842454564 2842458601 370
129 iso_pu_bacteria 2856287931 2856294320 370
130 iso_pu_bacteria 2857357740 2857367577 370
131 iso_pu_bacteria 2858688981 2858699866 370
132 iso_pu_bacteria 2863421361 2863424735 370
133 iso_pu_bacteria 2870068957 2870070971 370
134 iso_pu_bacteria 2883087390 2883092955 370
135 iso_pu_bacteria 2885266251 2885267122 370
136 iso_pu_bacteria 2885270888 2885275448 370
137 iso_pu_bacteria 2900634093 2900634369 370
138 iso_pu_bacteria 2902682994 2902683610 370
139 iso_pu_bacteria 2904483920 2904484680 370
140 iso_pu_bacteria 2904564687 2904571543 370
141 iso_pu_bacteria 2904571731 2904575986 370
142 iso_pu_bacteria 2904615490 2904624098 370
143 iso_pu_bacteria 2919527303 2919531358 370
144 iso_pu_bacteria 2921643360 2921649579 370
145 iso_pu_bacteria 2928108538 2928113319 370
146 iso_pu_bacteria 2928135762 2928140478 370
147 iso_pu_bacteria 2928157003 2928162995 370
148 iso_pu_bacteria 2928163908 2928169657 370
149 iso_pu_bacteria 2928170801 2928171719 370
150 iso_pu_bacteria 2928503688 2928507439 370
151 iso_pu_bacteria 2928536128 2928539875 370
152 iso_pu_bacteria 2945909444 2945911684 370
153 iso_pu_bacteria 2945934425 2945937138 370
154 iso_pu_bacteria 2945984333 2945986020 370
155 iso_pu_bacteria 2981990288 2981994810 370
156 iso_pu_bacteria 2990703756 2990706127 370
157 iso_pu_bacteria 641736151 642427333 370
158 iso_pu_bacteria 641736154 642420215 370
159 iso_pu_bacteria 642555112 642593128 370
160 iso_pu_bacteria 642555113 642622023 370
161 iso_pu_bacteria 8002392321 8002393928 370
162 iso_pu_bacteria 8003955200 8003961198 370
163 iso_pu_bacteria 8018845410 8018851359 370
164 iso_pu_bacteria 8020807995 8020810209 370
165 iso_pu_bacteria 8020938398 8020945013 370
166 iso_pu_bacteria 8020945358 8020951407 370
167 iso_pu_bacteria 8020953355 8020956950 370
168 iso_pu_bacteria 8021120328 8021122196 370
169 iso_pu_bacteria 8039098773 8039102559 370
170 iso_pu_bacteria 8040167225 8040168786 370
171 iso_pu_bacteria 8040173305 8040174712 370
172 iso_pu_bacteria 8055266321 8055267640 370
173 iso_pu_bacteria 8055301274 8055302203 370
174 3300021388 Ga0213875_10001769 Ga0213875_100017692 371
175 3300037853 Ga0436364_1329714 Ga0436364_1329714_210_1394 371
176 3300039437 Ga0436365_0380661 Ga0436365_0380661_47_1237 371
177 3300046473 Ga0495582_0115445 Ga0495582_0115445_181_1317 371
178 3300046499 Ga0495594_0032831 Ga0495594_0032831_1458_2609 371
179 3300046507 Ga0495606_0003649 Ga0495606_0003649_10579_11715 371
180 3300046528 Ga0495642_0019634 Ga0495642_0019634_370_1506 371
181 3300046529 Ga0495652_0063919 Ga0495652_0063919_1213_2349 371
182 3300046531 Ga0495665_0046983 Ga0495665_0046983_50_1207 371
183 3300046535 Ga0495586_0065834 Ga0495586_0065834_40_1191 371
184 3300046542 Ga0495597_0000354 Ga0495597_0000354_15641_16783 371
185 3300046557 Ga0495622_0010729 Ga0495622_0010729_2144_3301 371
186 3300046559 Ga0495667_0125064 Ga0495667_0125064_61_1197 371
187 3300046616 Ga0495668_0022906 Ga0495668_0022906_1826_2962 371
188 3300046660 Ga0495625_0017124 Ga0495625_0017124_2698_3834 371
189 3300046665 Ga0495661_0093070 Ga0495661_0093070_67_1203 371
190 3300046674 Ga0495588_0004132 Ga0495588_0004132_212_1363 371
191 3300046674 Ga0495588_0018457 Ga0495588_0018457_1450_2598 371
192 3300046690 Ga0495624_0013999 Ga0495624_0013999_1785_2942 371
193 3300047315 Ga0495581_0026657 Ga0495581_0026657_1011_2168 371
194 3300047315 Ga0495581_0059180 Ga0495581_0059180_380_1516 371
195 3300047315 Ga0495581_0087182 Ga0495581_0087182_312_1463 371
196 3300047317 Ga0495604_0051054 Ga0495604_0051054_2019_3155 371
197 3300047318 Ga0495636_0033949 Ga0495636_0033949_298_1449 371
198 3300047319 Ga0495674_0003612 Ga0495674_0003612_2297_3439 371
199 3300047321 Ga0495676_0052435 Ga0495676_0052435_238_1380 371
200 3300047444 Ga0495675_0023932 Ga0495675_0023932_954_2105 371
201 3300048091 Ga0495626_0004577 Ga0495626_0004577_6577_7746 371
202 3300048918 Ga0496115_0028876 Ga0496115_0028876_811_1962 371
203 3300048924 Ga0496121_0071177 Ga0496121_0071177_408_1535 371
204 iso_pu_bacteria 2511231025 2511381713 371
205 iso_pu_bacteria 2511231035 2511432692 371
206 iso_pu_bacteria 2537561728 2538428412 371
207 iso_pu_bacteria 2547132181 2547697679 371
208 iso_pu_bacteria 2554235234 2555259993 371
209 iso_pu_bacteria 2561511199 2562463761 371
210 iso_pu_bacteria 2585427591 2585826825 371
211 iso_pu_bacteria 2585427592 2585831249 371
212 iso_pu_bacteria 2599185169 2599412626 371
213 iso_pu_bacteria 2600255254 2601524142 371
214 iso_pu_bacteria 2600255255 2601529296 371
215 iso_pu_bacteria 2600255256 2601535337 371
216 iso_pu_bacteria 2600255257 2601539894 371
217 iso_pu_bacteria 2600255280 2601616130 371
218 iso_pu_bacteria 2600255281 2601620855 371
219 iso_pu_bacteria 2600255287 2601644197 371
220 iso_pu_bacteria 2600255288 2601649252 371
221 iso_pu_bacteria 2600255289 2601654179 371
222 iso_pu_bacteria 2600255290 2601659601 371
223 iso_pu_bacteria 2600255291 2601664022 371
224 iso_pu_bacteria 2600255298 2601696979 371
225 iso_pu_bacteria 2600255299 2601702028 371
226 iso_pu_bacteria 2600255300 2601706923 371
227 iso_pu_bacteria 2600255301 2601712126 371
228 iso_pu_bacteria 2600255302 2601717440 371
229 iso_pu_bacteria 2600255303 2601722292 371
230 iso_pu_bacteria 2600255304 2601727368 371
231 iso_pu_bacteria 2600255305 2601732567 371
232 iso_pu_bacteria 2600255306 2601736918 371
233 iso_pu_bacteria 2600255307 2601743129 371
234 iso_pu_bacteria 2600255309 2601753923 371
235 iso_pu_bacteria 2600255310 2601758518 371
236 iso_pu_bacteria 2600255311 2601764629 371
237 iso_pu_bacteria 2600255392 2602021017 371
238 iso_pu_bacteria 2602042046 2603636680 371
239 iso_pu_bacteria 2602042047 2603645526 371
240 iso_pu_bacteria 2602042052 2603662180 371
241 iso_pu_bacteria 2602042053 2603667079 371
242 iso_pu_bacteria 2602042066 2603699454 371
243 iso_pu_bacteria 2602042067 2603705503 371
244 iso_pu_bacteria 2602042103 2603839792 371
245 iso_pu_bacteria 2602042104 2603844866 371
246 iso_pu_bacteria 2602042105 2603850127 371
247 iso_pu_bacteria 2602042106 2603855009 371
248 iso_pu_bacteria 2602042109 2603867757 371
249 iso_pu_bacteria 2602042110 2603872585 371
250 iso_pu_bacteria 2602042111 2603877891 371
251 iso_pu_bacteria 2603880178 2606049954 371
252 iso_pu_bacteria 2603880184 2606071616 371
253 iso_pu_bacteria 2603880202 2606147453 371
254 iso_pu_bacteria 2603880211 2606177846 371
255 iso_pu_bacteria 2609459761 2609909482 371
256 iso_pu_bacteria 2636415599 2637223941 371
257 iso_pu_bacteria 2643221660 2644337905 371
258 iso_pu_bacteria 2667528172 2671105519 371
259 iso_pu_bacteria 2667528173 2671108340 371
260 iso_pu_bacteria 2671180115 2671588664 371
261 iso_pu_bacteria 2675903046 2676405369 371
262 iso_pu_bacteria 2681812866 2681996087 371
263 iso_pu_bacteria 2681812869 2682006558 371
264 iso_pu_bacteria 2706794495 2707099893 371
265 iso_pu_bacteria 2711768156 2712472891 371
266 iso_pu_bacteria 2739367655 2739612899 371
267 iso_pu_bacteria 2751185917 2753857034 371
268 iso_pu_bacteria 2765235842 2765590137 371
269 iso_pu_bacteria 2775506706 2775541183 371
270 iso_pu_bacteria 2775507074 2777023257 371
271 iso_pu_bacteria 2791354903 2791922600 371
272 iso_pu_bacteria 2791355010 2792311868 371
273 iso_pu_bacteria 2791355275 2793404650 371
274 iso_pu_bacteria 2811995292 2813727689 371
275 iso_pu_bacteria 2814123068 2814695237 371
276 iso_pu_bacteria 2821118458 2821121175 371
277 iso_pu_bacteria 2823373977 2823375790 371
278 iso_pu_bacteria 2831864461 2831869910 371
279 iso_pu_bacteria 2844425489 2844428479 371
280 iso_pu_bacteria 2852103415 2852107185 371
281 iso_pu_bacteria 2854601825 2854602728 371
282 iso_pu_bacteria 2855195626 2855197475 371
283 iso_pu_bacteria 2858466076 2858470025 371
284 iso_pu_bacteria 2871272651 2871277250 371
285 iso_pu_bacteria 2871282230 2871286753 371
286 iso_pu_bacteria 2876601092 2876603114 371
287 iso_pu_bacteria 2884086401 2884087720 371
288 iso_pu_bacteria 2886848708 2886854167 371
289 iso_pu_bacteria 2891670763 2891675377 371
290 iso_pu_bacteria 2900051742 2900054163 371
291 iso_pu_bacteria 2900051742 2900055829 371
292 iso_pu_bacteria 2904474040 2904474988 371
293 iso_pu_bacteria 2904504865 2904506606 371
294 iso_pu_bacteria 2904513164 2904517810 371
295 iso_pu_bacteria 2919108558 2919111109 371
296 iso_pu_bacteria 2919150387 2919151334 371
297 iso_pu_bacteria 2923634449 2923636032 371
298 iso_pu_bacteria 2927143783 2927146208 371
299 iso_pu_bacteria 2927833300 2927837476 371
300 iso_pu_bacteria 2932406140 2932409300 371
301 iso_pu_bacteria 2935625433 2935625562 371
302 iso_pu_bacteria 2937539931 2937542309 371
303 iso_pu_bacteria 2939568625 2939570149 371
304 iso_pu_bacteria 2939573065 2939575522 371
305 iso_pu_bacteria 2939577877 2939580754 371
306 iso_pu_bacteria 2939602548 2939604405 371
307 iso_pu_bacteria 2939607340 2939608552 371
308 iso_pu_bacteria 2939617950 2939618688 371
309 iso_pu_bacteria 2939642701 2939642808 371
310 iso_pu_bacteria 2945874760 2945876672 371
311 iso_pu_bacteria 2969079654 2969080955 371
312 iso_pu_bacteria 2971820967 2971822357 371
313 iso_pu_bacteria 2974310843 2974310974 371
314 iso_pu_bacteria 2974435778 2974439498 371
315 iso_pu_bacteria 2984559226 2984563422 371
316 iso_pu_bacteria 2984595703 2984596157 371
317 iso_pu_bacteria 3000376612 3000378224 371
318 iso_pu_bacteria 8016733728 8016734911 371
319 iso_pu_bacteria 8018221730 8018222497 371
320 iso_pu_bacteria 8018405270 8018409124 371
321 iso_pu_bacteria 8019499862 8019501603 371
322 iso_pu_bacteria 8019504834 8019504974 371
323 iso_pu_bacteria 8054844752 8054846772 371
324 iso_pu_bacteria 8054849141 8054852116 371
325 iso_pu_bacteria 8055087960 8055089933 371
326 iso_pu_bacteria 8055092621 8055095635 371
327 iso_pu_bacteria 8055097453 8055100325 371
328 iso_pu_bacteria 8055693939 8055697012 371
329 iso_pu_bacteria 8057304971 8057306648 371
330 3300005262 Ga0065165_1002021 Ga0065165_10020216 372
331 3300002773 JGI25152J39213_1006266 JGI25152J39213_10062663 373
332 3300002987 JGI25159J45721_1000296 JGI25159J45721_100029622 373
333 3300003215 JGI25153J46596_10000871 JGI25153J46596_1000087115 373
334 3300003215 JGI25153J46596_10003388 JGI25153J46596_100033885 373
335 3300003354 JGI25160J50197_1000123 JGI25160J50197_10001234 373
336 3300003374 JGI25161J50226_1000032 JGI25161J50226_100003271 373
337 3300004625 Ga0055543_1000405 Ga0055543_100040528 373
338 3300005262 Ga0065165_1023112 Ga0065165_10231121 373
339 3300005333 Ga0070677_10020938 Ga0070677_100209382 373
340 3300005353 Ga0070669_100009144 Ga0070669_1000091443 373
341 3300005354 Ga0070675_100001690 Ga0070675_1000016905 373
342 3300005355 Ga0070671_100025777 Ga0070671_1000257773 373
343 3300005364 Ga0070673_100005484 Ga0070673_1000054845 373
344 3300005456 Ga0070678_100053616 Ga0070678_1000536162 373
345 3300005459 Ga0068867_100003992 Ga0068867_1000039924 373
346 3300005543 Ga0070672_100000338 Ga0070672_1000003382 373
347 3300005618 Ga0068864_100155989 Ga0068864_1001559891 373
348 3300005843 Ga0068860_100207568 Ga0068860_1002075683 373
349 3300006048 Ga0075363_100130373 Ga0075363_1001303732 373
350 3300006195 Ga0075366_10018201 Ga0075366_100182013 373
351 3300006237 Ga0097621_100040483 Ga0097621_1000404832 373
352 3300006353 Ga0075370_10023309 Ga0075370_100233092 373
353 3300006358 Ga0068871_100079338 Ga0068871_1000793382 373
354 3300009094 Ga0111539_10110214 Ga0111539_101102146 373
355 3300009094 Ga0111539_10333289 Ga0111539_103332892 373
356 3300014969 Ga0157376_10211793 Ga0157376_102117932 373
357 3300017792 Ga0163161_10206594 Ga0163161_102065942 373
358 3300025258 Ga0209129_1000200 Ga0209129_100020011 373
359 3300025284 Ga0209130_1000094 Ga0209130_100009419 373
360 3300025292 Ga0209676_1007000 Ga0209676_10070003 373
361 3300025294 Ga0209025_1005993 Ga0209025_10059932 373
362 3300025295 Ga0209564_1000046 Ga0209564_100004631 373
363 3300025297 Ga0209758_1000096 Ga0209758_1000096141 373
364 3300025297 Ga0209758_1000285 Ga0209758_100028570 373
365 3300025302 Ga0207426_1000071 Ga0207426_10000715 373
366 3300025304 Ga0209257_1005482 Ga0209257_10054828 373
367 3300025304 Ga0209257_1008179 Ga0209257_10081792 373
368 3300025315 Ga0207697_10018314 Ga0207697_100183143 373
369 3300025893 Ga0207682_10000222 Ga0207682_1000022220 373
370 3300025926 Ga0207659_10001462 Ga0207659_100014628 373
371 3300025931 Ga0207644_10034065 Ga0207644_100340653 373
372 3300025937 Ga0207669_10037250 Ga0207669_100372502 373
373 3300025938 Ga0207704_10005743 Ga0207704_100057433 373
374 3300025940 Ga0207691_10001693 Ga0207691_100016936 373
375 3300026023 Ga0207677_10030713 Ga0207677_100307133 373
376 3300026089 Ga0207648_10012028 Ga0207648_100120288 373
377 3300026118 Ga0207675_100100637 Ga0207675_1001006372 373
378 3300026121 Ga0207683_10082750 Ga0207683_100827502 373
379 3300026142 Ga0207698_10084969 Ga0207698_100849692 373
380 3300027717 Ga0209998_10010904 Ga0209998_100109042 373
381 3300027876 Ga0209974_10001532 Ga0209974_100015326 373
382 3300027907 Ga0207428_10179220 Ga0207428_101792202 373
383 3300028381 Ga0268264_10149949 Ga0268264_101499492 373
384 3300029957 Ga0265324_10048243 Ga0265324_100482432 373
385 3300031239 Ga0265328_10000121 Ga0265328_1000012113 373
386 3300031250 Ga0265331_10000055 Ga0265331_1000005571 373
387 3300031250 Ga0265331_10087229 Ga0265331_100872292 373
388 3300031251 Ga0265327_10000045 Ga0265327_10000045173 373
389 3300031251 Ga0265327_10003428 Ga0265327_1000342818 373
390 3300031251 Ga0265327_10019994 Ga0265327_100199943 373
391 3300031548 Ga0307408_100138087 Ga0307408_1001380872 373
392 3300031731 Ga0307405_10049022 Ga0307405_100490222 373
393 3300031824 Ga0307413_10016262 Ga0307413_100162623 373
394 3300031995 Ga0307409_100012184 Ga0307409_1000121844 373
395 3300032002 Ga0307416_100014376 Ga0307416_1000143764 373
396 3300032005 Ga0307411_10055503 Ga0307411_100555032 373
397 3300032126 Ga0307415_100180022 Ga0307415_1001800221 373
398 3300041443 Ga0451789_1242607 Ga0451789_1242607_402_1571 373
399 3300042436 Ga0439435_0003906 Ga0439435_0003906_1095_2222 373
400 3300042876 Ga0451577_0010348 Ga0451577_0010348_1771_2901 373
401 3300044658 Ga0466972_0036679 Ga0466972_0036679_393_1535 373
402 3300044712 Ga0453684_0001126 Ga0453684_0001126_66327_67454 373
403 3300045051 Ga0451576_0001379 Ga0451576_0001379_21775_22905 373
404 3300048905 Ga0496102_0056284 Ga0496102_0056284_928_2073 373
405 3300048921 Ga0496118_0072634 Ga0496118_0072634_268_1410 373
406 3300048924 Ga0496121_0036376 Ga0496121_0036376_148_1290 373
407 3300048927 Ga0496124_0000086 Ga0496124_0000086_195978_197120 373
408 3300048928 Ga0496125_0017865 Ga0496125_0017865_287_1429 373
409 3300049587 Ga0501071_0250800 Ga0501071_0250800_48_1175 373
410 3300050511 nmdc:mga08y16_94066_c1 nmdc:mga08y16_94066_c1_1746_2873 373
411 3300053117 Ga0500593_000286 Ga0500593_000286_17972_19117 373
412 3300053129 Ga0500628_014995 Ga0500628_014995_61_1230 373
413 3300053131 Ga0500652_000329 Ga0500652_000329_1524_2693 373
414 3300053156 Ga0500622_0000205 Ga0500622_0000205_15054_16223 373
415 iso_pu_bacteria 2599185178 2599444551 373
416 3300001915 JGI24741J21665_1002292 JGI24741J21665_10022925 374
417 3300001979 JGI24740J21852_10000707 JGI24740J21852_100007074 374
418 3300001979 JGI24740J21852_10001478 JGI24740J21852_100014784 374
419 3300002067 JGI24735J21928_10000304 JGI24735J21928_100003048 374
420 3300002067 JGI24735J21928_10000392 JGI24735J21928_1000039213 374
421 3300002067 JGI24735J21928_10000462 JGI24735J21928_1000046210 374
422 3300002067 JGI24735J21928_10003854 JGI24735J21928_100038543 374
423 3300002067 JGI24735J21928_10028720 JGI24735J21928_100287202 374
424 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000255 374
425 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003250 374
426 3300002705 JGI25156J39149_1000913 JGI25156J39149_10009137 374
427 3300002705 JGI25156J39149_1001040 JGI25156J39149_10010406 374
428 3300002705 JGI25156J39149_1001634 JGI25156J39149_10016344 374
429 3300002705 JGI25156J39149_1010984 JGI25156J39149_10109843 374
430 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000955 374
431 3300002738 JGI25154J39366_1000362 JGI25154J39366_100036214 374
432 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000255 374
433 3300002774 JGI25150J39212_1003024 JGI25150J39212_10030243 374
434 3300002987 JGI25159J45721_1003417 JGI25159J45721_10034173 374
435 3300003187 JGI25151J46595_10013678 JGI25151J46595_100136784 374
436 3300003187 JGI25151J46595_10032951 JGI25151J46595_100329512 374
437 3300003214 JGI25165J46597_1002348 JGI25165J46597_10023484 374
438 3300003322 rootL2_10113845 rootL2_101138452 374
439 3300003354 JGI25160J50197_1000102 JGI25160J50197_100010213 374
440 3300003751 Ga0055538_1001322 Ga0055538_10013225 374
441 3300003752 Ga0055539_1000100 Ga0055539_100010027 374
442 3300003756 Ga0055533_1000235 Ga0055533_10002356 374
443 3300003756 Ga0055533_1001261 Ga0055533_10012616 374
444 3300003758 Ga0055532_1000001 Ga0055532_1000001235 374
445 3300003758 Ga0055532_1000127 Ga0055532_100012770 374
446 3300003758 Ga0055532_1000944 Ga0055532_10009441 374
447 3300003759 Ga0055525_1000444 Ga0055525_100044410 374
448 3300003759 Ga0055525_1000505 Ga0055525_100050510 374
449 3300003760 Ga0055527_1000002 Ga0055527_1000002524 374
450 3300003761 Ga0055535_1000001 Ga0055535_1000001769 374
451 3300003761 Ga0055535_1000140 Ga0055535_100014070 374
452 3300003762 Ga0055542_1000001 Ga0055542_1000001235 374
453 3300003762 Ga0055542_1001376 Ga0055542_10013766 374
454 3300003763 Ga0055529_1000026 Ga0055529_100002649 374
455 3300003763 Ga0055529_1000230 Ga0055529_100023064 374
456 3300003763 Ga0055529_1001316 Ga0055529_10013165 374
457 3300003771 Ga0055526_1001657 Ga0055526_10016573 374
458 3300003773 Ga0055537_1000079 Ga0055537_100007973 374
459 3300003775 Ga0055524_1000012 Ga0055524_100001288 374
460 3300003781 Ga0055536_1000380 Ga0055536_100038026 374
461 3300003784 Ga0055534_1000670 Ga0055534_10006704 374
462 3300003784 Ga0055534_1001102 Ga0055534_10011029 374
463 3300003784 Ga0055534_1002359 Ga0055534_10023596 374
464 3300003790 Ga0055528_1000563 Ga0055528_100056325 374
465 3300003790 Ga0055528_1003000 Ga0055528_10030005 374
466 3300003791 Ga0055530_10000218 Ga0055530_1000021822 374
467 3300003792 Ga0055540_1000012 Ga0055540_1000012207 374
468 3300003841 Ga0055541_1003952 Ga0055541_10039522 374
469 3300003856 Ga0058692_1007200 Ga0058692_10072003 374
470 3300004625 Ga0055543_1004541 Ga0055543_10045412 374
471 3300005262 Ga0065165_1000848 Ga0065165_100084823 374
472 3300005262 Ga0065165_1001389 Ga0065165_100138920 374
473 3300005262 Ga0065165_1009528 Ga0065165_10095283 374
474 3300005262 Ga0065165_1024685 Ga0065165_10246852 374
475 3300005262 Ga0065165_1041329 Ga0065165_10413291 374
476 3300005295 Ga0065707_10124464 Ga0065707_101244642 374
477 3300005327 Ga0070658_10003021 Ga0070658_100030217 374
478 3300005334 Ga0068869_100047431 Ga0068869_1000474312 374
479 3300005335 Ga0070666_10026070 Ga0070666_100260704 374
480 3300005337 Ga0070682_100069419 Ga0070682_1000694191 374
481 3300005338 Ga0068868_100051963 Ga0068868_1000519633 374
482 3300005339 Ga0070660_100010130 Ga0070660_1000101305 374
483 3300005344 Ga0070661_100000057 Ga0070661_10000005744 374
484 3300005353 Ga0070669_100012088 Ga0070669_1000120882 374
485 3300005353 Ga0070669_100014256 Ga0070669_1000142568 374
486 3300005353 Ga0070669_100017532 Ga0070669_1000175326 374
487 3300005354 Ga0070675_100094704 Ga0070675_1000947042 374
488 3300005355 Ga0070671_100005306 Ga0070671_1000053064 374
489 3300005355 Ga0070671_100036625 Ga0070671_1000366253 374
490 3300005355 Ga0070671_100150550 Ga0070671_1001505502 374
491 3300005355 Ga0070671_100203348 Ga0070671_1002033482 374
492 3300005356 Ga0070674_100164252 Ga0070674_1001642522 374
493 3300005364 Ga0070673_100002697 Ga0070673_1000026978 374
494 3300005366 Ga0070659_100000510 Ga0070659_10000051011 374
495 3300005366 Ga0070659_100030772 Ga0070659_1000307721 374
496 3300005441 Ga0070700_100001032 Ga0070700_1000010329 374
497 3300005441 Ga0070700_100006423 Ga0070700_1000064233 374
498 3300005455 Ga0070663_100000105 Ga0070663_10000010514 374
499 3300005455 Ga0070663_100002402 Ga0070663_1000024023 374
500 3300005455 Ga0070663_100005278 Ga0070663_1000052782 374
501 3300005455 Ga0070663_100156409 Ga0070663_1001564092 374
502 3300005457 Ga0070662_100001379 Ga0070662_1000013798 374
503 3300005457 Ga0070662_100020685 Ga0070662_1000206853 374
504 3300005459 Ga0068867_100003272 Ga0068867_1000032728 374
505 3300005459 Ga0068867_100006509 Ga0068867_1000065093 374
506 3300005459 Ga0068867_100090294 Ga0068867_1000902942 374
507 3300005459 Ga0068867_100163460 Ga0068867_1001634601 374
508 3300005539 Ga0068853_100025283 Ga0068853_1000252833 374
509 3300005543 Ga0070672_100001803 Ga0070672_1000018039 374
510 3300005543 Ga0070672_100292362 Ga0070672_1002923621 374
511 3300005548 Ga0070665_100026204 Ga0070665_1000262042 374
512 3300005563 Ga0068855_100003042 Ga0068855_1000030425 374
513 3300005563 Ga0068855_100007312 Ga0068855_1000073129 374
514 3300005564 Ga0070664_100000008 Ga0070664_100000008106 374
515 3300005564 Ga0070664_100204982 Ga0070664_1002049822 374
516 3300005577 Ga0068857_100135934 Ga0068857_1001359342 374
517 3300005577 Ga0068857_100187637 Ga0068857_1001876372 374
518 3300005578 Ga0068854_100000072 Ga0068854_10000007217 374
519 3300005614 Ga0068856_100000009 Ga0068856_100000009139 374
520 3300005614 Ga0068856_100031125 Ga0068856_1000311256 374
521 3300005616 Ga0068852_100289532 Ga0068852_1002895322 374
522 3300005618 Ga0068864_100021723 Ga0068864_1000217233 374
523 3300005719 Ga0068861_100008083 Ga0068861_1000080832 374
524 3300005834 Ga0068851_10028395 Ga0068851_100283952 374
525 3300005840 Ga0068870_10083323 Ga0068870_100833232 374
526 3300005841 Ga0068863_100059509 Ga0068863_1000595094 374
527 3300005842 Ga0068858_100308478 Ga0068858_1003084782 374
528 3300005844 Ga0068862_100021669 Ga0068862_1000216692 374
529 3300005844 Ga0068862_100064649 Ga0068862_1000646494 374
530 3300006042 Ga0075368_10003139 Ga0075368_100031393 374
531 3300006048 Ga0075363_100006667 Ga0075363_1000066672 374
532 3300006051 Ga0075364_10050921 Ga0075364_100509212 374
533 3300006177 Ga0075362_10022906 Ga0075362_100229062 374
534 3300006178 Ga0075367_10007819 Ga0075367_100078196 374
535 3300006195 Ga0075366_10000464 Ga0075366_100004645 374
536 3300006195 Ga0075366_10001059 Ga0075366_100010595 374
537 3300006195 Ga0075366_10008134 Ga0075366_100081342 374
538 3300006237 Ga0097621_100020144 Ga0097621_1000201443 374
539 3300006353 Ga0075370_10017106 Ga0075370_100171062 374
540 3300006353 Ga0075370_10077002 Ga0075370_100770021 374
541 3300006353 Ga0075370_10133028 Ga0075370_101330282 374
542 3300006358 Ga0068871_100003474 Ga0068871_1000034748 374
543 3300006948 Ga0099826_10000012 Ga0099826_10000012146 374
544 3300009011 Ga0105251_10003968 Ga0105251_100039683 374
545 3300009093 Ga0105240_10002341 Ga0105240_1000234126 374
546 3300009093 Ga0105240_10054612 Ga0105240_100546125 374
547 3300009093 Ga0105240_10212526 Ga0105240_102125262 374
548 3300009098 Ga0105245_10062771 Ga0105245_100627713 374
549 3300009098 Ga0105245_10073785 Ga0105245_100737852 374
550 3300009148 Ga0105243_10027102 Ga0105243_100271024 374
551 3300009174 Ga0105241_10067401 Ga0105241_100674013 374
552 3300009177 Ga0105248_10007653 Ga0105248_100076532 374
553 3300009177 Ga0105248_10026509 Ga0105248_100265096 374
554 3300009545 Ga0105237_10018302 Ga0105237_100183022 374
555 3300009545 Ga0105237_10039588 Ga0105237_100395885 374
556 3300009551 Ga0105238_10010153 Ga0105238_1001015310 374
557 3300010375 Ga0105239_10068680 Ga0105239_100686802 374
558 3300011119 Ga0105246_10050782 Ga0105246_100507822 374
559 3300012513 Ga0157326_1000943 Ga0157326_10009432 374
560 3300013100 Ga0157373_10009043 Ga0157373_100090434 374
561 3300013100 Ga0157373_10073707 Ga0157373_100737072 374
562 3300013102 Ga0157371_10000068 Ga0157371_10000068144 374
563 3300013102 Ga0157371_10013847 Ga0157371_100138472 374
564 3300013104 Ga0157370_10000200 Ga0157370_1000020016 374
565 3300013104 Ga0157370_10001346 Ga0157370_1000134613 374
566 3300013104 Ga0157370_10003399 Ga0157370_1000339910 374
567 3300013104 Ga0157370_10094701 Ga0157370_100947013 374
568 3300013105 Ga0157369_10000511 Ga0157369_1000051135 374
569 3300013105 Ga0157369_10000806 Ga0157369_1000080628 374
570 3300013105 Ga0157369_10000979 Ga0157369_100009792 374
571 3300013105 Ga0157369_10005782 Ga0157369_100057824 374
572 3300013105 Ga0157369_10009691 Ga0157369_100096917 374
573 3300013105 Ga0157369_10022155 Ga0157369_100221552 374
574 3300013105 Ga0157369_10047494 Ga0157369_100474944 374
575 3300013105 Ga0157369_10419267 Ga0157369_104192671 374
576 3300013296 Ga0157374_10000107 Ga0157374_100001075 374
577 3300013296 Ga0157374_10052257 Ga0157374_100522572 374
578 3300013296 Ga0157374_10167192 Ga0157374_101671922 374
579 3300013306 Ga0163162_10008076 Ga0163162_100080765 374
580 3300013306 Ga0163162_10012861 Ga0163162_100128616 374
581 3300013306 Ga0163162_10051090 Ga0163162_100510903 374
582 3300013307 Ga0157372_10000142 Ga0157372_1000014269 374
583 3300013307 Ga0157372_10004539 Ga0157372_100045397 374
584 3300013307 Ga0157372_10193418 Ga0157372_101934183 374
585 3300013308 Ga0157375_10617514 Ga0157375_106175141 374
586 3300014326 Ga0157380_10038519 Ga0157380_100385192 374
587 3300014745 Ga0157377_10006681 Ga0157377_100066814 374
588 3300014745 Ga0157377_10145171 Ga0157377_101451712 374
589 3300014968 Ga0157379_10083111 Ga0157379_100831112 374
590 3300014969 Ga0157376_10006346 Ga0157376_100063463 374
591 3300015261 Ga0182006_1031181 Ga0182006_10311812 374
592 3300015262 Ga0182007_10010832 Ga0182007_100108323 374
593 3300016635 Ga0183361_10006 Ga0183361_10006179 374
594 3300017792 Ga0163161_10020133 Ga0163161_100201333 374
595 3300017792 Ga0163161_10097655 Ga0163161_100976552 374
596 3300020077 Ga0206351_10197686 Ga0206351_101976864 374
597 3300020610 Ga0154015_1570145 Ga0154015_15701456 374
598 3300021361 Ga0213872_10000090 Ga0213872_1000009040 374
599 3300021361 Ga0213872_10001577 Ga0213872_1000157713 374
600 3300022467 Ga0224712_10001924 Ga0224712_100019244 374
601 3300025206 Ga0209435_100001 Ga0209435_100001661 374
602 3300025206 Ga0209435_104850 Ga0209435_1048501 374
603 3300025224 Ga0209784_100003 Ga0209784_100003932 374
604 3300025224 Ga0209784_100815 Ga0209784_1008157 374
605 3300025224 Ga0209784_101192 Ga0209784_1011923 374
606 3300025225 Ga0209566_100002 Ga0209566_1000021886 374
607 3300025225 Ga0209566_100421 Ga0209566_10042122 374
608 3300025225 Ga0209566_100504 Ga0209566_1005048 374
609 3300025225 Ga0209566_102138 Ga0209566_1021385 374
610 3300025226 Ga0209674_100005 Ga0209674_100005605 374
611 3300025226 Ga0209674_100008 Ga0209674_100008299 374
612 3300025226 Ga0209674_100161 Ga0209674_10016114 374
613 3300025226 Ga0209674_100267 Ga0209674_10026724 374
614 3300025226 Ga0209674_101381 Ga0209674_1013815 374
615 3300025228 Ga0209672_100001 Ga0209672_1000011067 374
616 3300025228 Ga0209672_100014 Ga0209672_100014166 374
617 3300025228 Ga0209672_100530 Ga0209672_1005306 374
618 3300025228 Ga0209672_100934 Ga0209672_1009347 374
619 3300025228 Ga0209672_100935 Ga0209672_1009357 374
620 3300025229 Ga0209147_100001 Ga0209147_1000011067 374
621 3300025229 Ga0209147_100002 Ga0209147_1000021483 374
622 3300025229 Ga0209147_100104 Ga0209147_100104115 374
623 3300025229 Ga0209147_101244 Ga0209147_1012448 374
624 3300025230 Ga0209563_100004 Ga0209563_1000041303 374
625 3300025230 Ga0209563_100468 Ga0209563_1004686 374
626 3300025231 Ga0207427_102517 Ga0207427_1025174 374
627 3300025242 Ga0209258_100001 Ga0209258_1000011067 374
628 3300025242 Ga0209258_100002 Ga0209258_1000021483 374
629 3300025242 Ga0209258_100040 Ga0209258_100040339 374
630 3300025246 Ga0209646_1000001 Ga0209646_10000011030 374
631 3300025246 Ga0209646_1000059 Ga0209646_1000059155 374
632 3300025250 Ga0209026_1000003 Ga0209026_1000003661 374
633 3300025253 Ga0209677_100009 Ga0209677_100009329 374
634 3300025254 Ga0209148_1000003 Ga0209148_10000031067 374
635 3300025254 Ga0209148_1000021 Ga0209148_1000021145 374
636 3300025254 Ga0209148_1000035 Ga0209148_1000035339 374
637 3300025256 Ga0209759_1000001 Ga0209759_1000001661 374
638 3300025256 Ga0209759_1000029 Ga0209759_1000029226 374
639 3300025256 Ga0209759_1000030 Ga0209759_100003070 374
640 3300025256 Ga0209759_1000260 Ga0209759_100026049 374
641 3300025256 Ga0209759_1003073 Ga0209759_10030735 374
642 3300025256 Ga0209759_1012730 Ga0209759_10127302 374
643 3300025256 Ga0209759_1020056 Ga0209759_10200562 374
644 3300025258 Ga0209129_1005824 Ga0209129_10058242 374
645 3300025261 Ga0209233_1000016 Ga0209233_100001627 374
646 3300025263 Ga0209565_1000004 Ga0209565_1000004547 374
647 3300025263 Ga0209565_1011180 Ga0209565_10111801 374
648 3300025272 Ga0209455_1000001 Ga0209455_10000011067 374
649 3300025272 Ga0209455_1000021 Ga0209455_100002170 374
650 3300025272 Ga0209455_1000072 Ga0209455_1000072113 374
651 3300025273 Ga0209673_1000140 Ga0209673_10001405 374
652 3300025284 Ga0209130_1000082 Ga0209130_100008277 374
653 3300025284 Ga0209130_1007922 Ga0209130_10079223 374
654 3300025291 Ga0209675_1000061 Ga0209675_1000061147 374
655 3300025291 Ga0209675_1000149 Ga0209675_100014956 374
656 3300025291 Ga0209675_1002449 Ga0209675_10024496 374
657 3300025292 Ga0209676_1000014 Ga0209676_1000014709 374
658 3300025292 Ga0209676_1000029 Ga0209676_1000029356 374
659 3300025292 Ga0209676_1008263 Ga0209676_10082634 374
660 3300025294 Ga0209025_1001542 Ga0209025_10015428 374
661 3300025294 Ga0209025_1009504 Ga0209025_10095045 374
662 3300025294 Ga0209025_1024163 Ga0209025_10241632 374
663 3300025295 Ga0209564_1000979 Ga0209564_100097920 374
664 3300025295 Ga0209564_1001045 Ga0209564_10010454 374
665 3300025295 Ga0209564_1001145 Ga0209564_100114513 374
666 3300025295 Ga0209564_1002205 Ga0209564_10022054 374
667 3300025295 Ga0209564_1024894 Ga0209564_10248942 374
668 3300025297 Ga0209758_1015813 Ga0209758_10158132 374
669 3300025298 Ga0209050_1000003 Ga0209050_1000003418 374
670 3300025298 Ga0209050_1003867 Ga0209050_10038677 374
671 3300025298 Ga0209050_1032394 Ga0209050_10323942 374
672 3300025299 Ga0209256_1000001 Ga0209256_1000001420 374
673 3300025302 Ga0207426_1000125 Ga0207426_1000125138 374
674 3300025302 Ga0207426_1005035 Ga0207426_10050354 374
675 3300025303 Ga0209051_1000003 Ga0209051_1000003418 374
676 3300025304 Ga0209257_1000018 Ga0209257_1000018418 374
677 3300025321 Ga0207656_10014406 Ga0207656_100144063 374
678 3300025735 Ga0207713_1000864 Ga0207713_10008646 374
679 3300025893 Ga0207682_10073981 Ga0207682_100739812 374
680 3300025901 Ga0207688_10079126 Ga0207688_100791262 374
681 3300025903 Ga0207680_10126860 Ga0207680_101268602 374
682 3300025904 Ga0207647_10000605 Ga0207647_100006059 374
683 3300025904 Ga0207647_10025613 Ga0207647_100256133 374
684 3300025907 Ga0207645_10000759 Ga0207645_1000075929 374
685 3300025907 Ga0207645_10035427 Ga0207645_100354272 374
686 3300025907 Ga0207645_10087465 Ga0207645_100874651 374
687 3300025908 Ga0207643_10056938 Ga0207643_100569383 374
688 3300025908 Ga0207643_10059306 Ga0207643_100593063 374
689 3300025909 Ga0207705_10004376 Ga0207705_100043766 374
690 3300025913 Ga0207695_10000729 Ga0207695_1000072950 374
691 3300025913 Ga0207695_10024266 Ga0207695_100242665 374
692 3300025914 Ga0207671_10042198 Ga0207671_100421981 374
693 3300025914 Ga0207671_10052362 Ga0207671_100523622 374
694 3300025918 Ga0207662_10105412 Ga0207662_101054122 374
695 3300025919 Ga0207657_10004856 Ga0207657_100048566 374
696 3300025919 Ga0207657_10042471 Ga0207657_100424713 374
697 3300025920 Ga0207649_10000138 Ga0207649_1000013837 374
698 3300025920 Ga0207649_10031701 Ga0207649_100317012 374
699 3300025923 Ga0207681_10001252 Ga0207681_100012523 374
700 3300025923 Ga0207681_10006080 Ga0207681_100060802 374
701 3300025923 Ga0207681_10021178 Ga0207681_100211783 374
702 3300025925 Ga0207650_10057624 Ga0207650_100576242 374
703 3300025926 Ga0207659_10010366 Ga0207659_100103664 374
704 3300025926 Ga0207659_10043760 Ga0207659_100437603 374
705 3300025927 Ga0207687_10105337 Ga0207687_101053372 374
706 3300025932 Ga0207690_10001152 Ga0207690_1000115213 374
707 3300025933 Ga0207706_10001019 Ga0207706_1000101923 374
708 3300025933 Ga0207706_10032233 Ga0207706_100322332 374
709 3300025935 Ga0207709_10008663 Ga0207709_100086633 374
710 3300025937 Ga0207669_10137037 Ga0207669_101370372 374
711 3300025940 Ga0207691_10039764 Ga0207691_100397643 374
712 3300025940 Ga0207691_10051960 Ga0207691_100519602 374
713 3300025940 Ga0207691_10287108 Ga0207691_102871081 374
714 3300025942 Ga0207689_10000267 Ga0207689_1000026722 374
715 3300025942 Ga0207689_10054721 Ga0207689_100547212 374
716 3300025944 Ga0207661_10182666 Ga0207661_101826662 374
717 3300025945 Ga0207679_10000001 Ga0207679_1000000170 374
718 3300025949 Ga0207667_10001214 Ga0207667_1000121410 374
719 3300025949 Ga0207667_10002775 Ga0207667_100027758 374
720 3300025949 Ga0207667_10099085 Ga0207667_100990852 374
721 3300025960 Ga0207651_10012381 Ga0207651_100123812 374
722 3300025960 Ga0207651_10127341 Ga0207651_101273412 374
723 3300025961 Ga0207712_10109232 Ga0207712_101092322 374
724 3300025981 Ga0207640_10000088 Ga0207640_1000008852 374
725 3300025986 Ga0207658_10027495 Ga0207658_100274954 374
726 3300026023 Ga0207677_10219457 Ga0207677_102194572 374
727 3300026041 Ga0207639_10047798 Ga0207639_100477983 374
728 3300026067 Ga0207678_10000001 Ga0207678_10000001361 374
729 3300026067 Ga0207678_10000738 Ga0207678_100007385 374
730 3300026067 Ga0207678_10002867 Ga0207678_100028672 374
731 3300026067 Ga0207678_10126758 Ga0207678_101267582 374
732 3300026075 Ga0207708_10002428 Ga0207708_100024289 374
733 3300026075 Ga0207708_10031194 Ga0207708_100311946 374
734 3300026075 Ga0207708_10198009 Ga0207708_101980092 374
735 3300026078 Ga0207702_10000024 Ga0207702_1000002452 374
736 3300026089 Ga0207648_10004977 Ga0207648_100049778 374
737 3300026089 Ga0207648_10024696 Ga0207648_100246963 374
738 3300026089 Ga0207648_10194466 Ga0207648_101944662 374
739 3300026089 Ga0207648_10210298 Ga0207648_102102982 374
740 3300026089 Ga0207648_10286475 Ga0207648_102864752 374
741 3300026116 Ga0207674_10016539 Ga0207674_100165394 374
742 3300026116 Ga0207674_10090360 Ga0207674_100903603 374
743 3300026118 Ga0207675_100000232 Ga0207675_10000023243 374
744 3300026118 Ga0207675_100006634 Ga0207675_1000066346 374
745 3300026118 Ga0207675_100221991 Ga0207675_1002219912 374
746 3300026121 Ga0207683_10065916 Ga0207683_100659162 374
747 3300026142 Ga0207698_10005724 Ga0207698_100057246 374
748 3300027312 Ga0209371_1000079 Ga0209371_100007987 374
749 3300027312 Ga0209371_1006594 Ga0209371_10065943 374
750 3300027666 Ga0209282_1000028 Ga0209282_100002888 374
751 3300027907 Ga0207428_10075761 Ga0207428_100757612 374
752 3300028379 Ga0268266_10120795 Ga0268266_101207952 374
753 3300028380 Ga0268265_10004824 Ga0268265_100048246 374
754 3300028381 Ga0268264_10381187 Ga0268264_103811872 374
755 3300028786 Ga0307517_10003248 Ga0307517_1000324812 374
756 3300028794 Ga0307515_10000041 Ga0307515_1000004132 374
757 3300028794 Ga0307515_10025544 Ga0307515_100255447 374
758 3300028794 Ga0307515_10088677 Ga0307515_100886773 374
759 3300028794 Ga0307515_10265181 Ga0307515_102651812 374
760 3300028800 Ga0265338_10000028 Ga0265338_10000028129 374
761 3300028800 Ga0265338_10000741 Ga0265338_1000074144 374
762 3300030500 Ga0268256_1000090 Ga0268256_100009090 374
763 3300030500 Ga0268256_1008862 Ga0268256_10088623 374
764 3300030522 Ga0307512_10097523 Ga0307512_100975232 374
765 3300031238 Ga0265332_10007434 Ga0265332_100074343 374
766 3300031456 Ga0307513_10156513 Ga0307513_101565132 374
767 3300031456 Ga0307513_10221232 Ga0307513_102212322 374
768 3300031507 Ga0307509_10000092 Ga0307509_1000009273 374
769 3300031507 Ga0307509_10002037 Ga0307509_1000203726 374
770 3300031507 Ga0307509_10014105 Ga0307509_100141052 374
771 3300031507 Ga0307509_10053226 Ga0307509_100532262 374
772 3300031548 Ga0307408_100004785 Ga0307408_1000047852 374
773 3300031548 Ga0307408_100005566 Ga0307408_1000055662 374
774 3300031548 Ga0307408_100042193 Ga0307408_1000421932 374
775 3300031616 Ga0307508_10000594 Ga0307508_1000059430 374
776 3300031616 Ga0307508_10007413 Ga0307508_100074133 374
777 3300031616 Ga0307508_10098622 Ga0307508_100986222 374
778 3300031649 Ga0307514_10098011 Ga0307514_100980112 374
779 3300031649 Ga0307514_10115888 Ga0307514_101158882 374
780 3300031824 Ga0307413_10062062 Ga0307413_100620621 374
781 3300031911 Ga0307412_10000021 Ga0307412_10000021172 374
782 3300031911 Ga0307412_10121659 Ga0307412_101216592 374
783 3300033179 Ga0307507_10053322 Ga0307507_100533222 374
784 3300033180 Ga0307510_10012482 Ga0307510_100124824 374
785 3300033180 Ga0307510_10090271 Ga0307510_100902713 374
786 3300035691 Ga0373931_0001546 Ga0373931_0001546_6882_8042 374
787 3300037312 Ga0395899_0000007 Ga0395899_0000007_334045_335184 374
788 3300037312 Ga0395899_0057002 Ga0395899_0057002_895_2034 374
789 3300037312 Ga0395899_0061163 Ga0395899_0061163_1353_2492 374
790 3300037312 Ga0395899_0076329 Ga0395899_0076329_1283_2422 374
791 3300037418 Ga0395900_0000026 Ga0395900_0000026_18386_19525 374
792 3300037418 Ga0395900_0001159 Ga0395900_0001159_28741_29880 374
793 3300037418 Ga0395900_0031653 Ga0395900_0031653_3020_4180 374
794 3300037418 Ga0395900_0069818 Ga0395900_0069818_1290_2528 374
795 3300037418 Ga0395900_0182491 Ga0395900_0182491_665_1804 374
796 3300037466 Ga0395898_0000497 Ga0395898_0000497_23853_24992 374
797 3300037466 Ga0395898_0000784 Ga0395898_0000784_45861_47000 374
798 3300037466 Ga0395898_0124764 Ga0395898_0124764_18_1178 374
799 3300037471 Ga0395905_0000459 Ga0395905_0000459_13025_14164 374
800 3300037471 Ga0395905_0003226 Ga0395905_0003226_93_1241 374
801 3300037471 Ga0395905_0039423 Ga0395905_0039423_424_1560 374
802 3300037471 Ga0395905_0069175 Ga0395905_0069175_1487_2632 374
803 3300037471 Ga0395905_0208172 Ga0395905_0208172_356_1516 374
804 3300038443 Ga0395901_0000077 Ga0395901_0000077_82935_84074 374
805 3300038443 Ga0395901_0000296 Ga0395901_0000296_32694_33833 374
806 3300038443 Ga0395901_0003986 Ga0395901_0003986_1904_3142 374
807 3300039447 Ga0436361_0624331 Ga0436361_0624331_2979_4118 374
808 3300039447 Ga0436361_0692684 Ga0436361_0692684_91366_92514 374
809 3300039447 Ga0436361_0734074 Ga0436361_0734074_21899_23029 374
810 3300042005 Ga0439448_0000988 Ga0439448_0000988_5125_6264 374
811 3300042439 Ga0439464_0019621 Ga0439464_0019621_147_1298 374
812 3300042876 Ga0451577_0069143 Ga0451577_0069143_1860_2996 374
813 3300044656 Ga0466969_0007486 Ga0466969_0007486_3186_4325 374
814 3300044656 Ga0466969_0033304 Ga0466969_0033304_936_2087 374
815 3300044658 Ga0466972_0037298 Ga0466972_0037298_366_1517 374
816 3300044658 Ga0466972_0052572 Ga0466972_0052572_801_1940 374
817 3300044673 Ga0453683_0143402 Ga0453683_0143402_82_1236 374
818 3300044683 Ga0466965_0018895 Ga0466965_0018895_2030_3169 374
819 3300044683 Ga0466965_0048207 Ga0466965_0048207_454_1602 374
820 3300044684 Ga0466966_0000084 Ga0466966_0000084_12957_14096 374
821 3300044684 Ga0466966_0000362 Ga0466966_0000362_9271_10410 374
822 3300044684 Ga0466966_0004483 Ga0466966_0004483_7660_8799 374
823 3300044684 Ga0466966_0005728 Ga0466966_0005728_2551_3690 374
824 3300044693 Ga0466961_0000427 Ga0466961_0000427_3073_4293 374
825 3300044693 Ga0466961_0000544 Ga0466961_0000544_21230_22369 374
826 3300044693 Ga0466961_0001445 Ga0466961_0001445_12427_13578 374
827 3300044693 Ga0466961_0023009 Ga0466961_0023009_2696_3835 374
828 3300044694 Ga0466963_0005199 Ga0466963_0005199_1073_2293 374
829 3300044694 Ga0466963_0026351 Ga0466963_0026351_1751_2890 374
830 3300044706 Ga0466964_0002299 Ga0466964_0002299_3549_4688 374
831 3300044706 Ga0466964_0036045 Ga0466964_0036045_416_1567 374
832 3300044712 Ga0453684_0003805 Ga0453684_0003805_1616_2764 374
833 3300044712 Ga0453684_0320019 Ga0453684_0320019_516_1664 374
834 3300044719 Ga0466971_0002907 Ga0466971_0002907_809_1948 374
835 3300044719 Ga0466971_0083903 Ga0466971_0083903_157_1296 374
836 3300044765 Ga0466970_0012108 Ga0466970_0012108_257_1411 374
837 3300044842 Ga0466957_0009283 Ga0466957_0009283_3328_4467 374
838 3300044842 Ga0466957_0037239 Ga0466957_0037239_918_2069 374
839 3300045049 Ga0466959_0006868 Ga0466959_0006868_4839_5978 374
840 3300045049 Ga0466959_0007452 Ga0466959_0007452_1172_2311 374
841 3300045049 Ga0466959_0013229 Ga0466959_0013229_764_1903 374
842 3300045051 Ga0451576_0056029 Ga0451576_0056029_2254_3399 374
843 3300045051 Ga0451576_0324705 Ga0451576_0324705_101_1255 374
844 3300045836 Ga0466958_0001681 Ga0466958_0001681_5347_6486 374
845 3300045836 Ga0466958_0005145 Ga0466958_0005145_2338_3477 374
846 3300045836 Ga0466958_0014545 Ga0466958_0014545_2187_3326 374
847 3300045836 Ga0466958_0107075 Ga0466958_0107075_81_1220 374
848 3300046454 Ga0495592_0000413 Ga0495592_0000413_30169_31320 374
849 3300046454 Ga0495592_0010535 Ga0495592_0010535_3989_5209 374
850 3300046455 Ga0495603_0006170 Ga0495603_0006170_5029_6168 374
851 3300046457 Ga0495590_0005435 Ga0495590_0005435_937_2073 374
852 3300046458 Ga0495591_006822 Ga0495591_006822_3029_4249 374
853 3300046459 Ga0495629_0000172 Ga0495629_0000172_14455_15675 374
854 3300046459 Ga0495629_0000506 Ga0495629_0000506_20040_21179 374
855 3300046459 Ga0495629_0002744 Ga0495629_0002744_10358_11578 374
856 3300046459 Ga0495629_0057883 Ga0495629_0057883_1065_2204 374
857 3300046459 Ga0495629_0100044 Ga0495629_0100044_498_1637 374
858 3300046460 Ga0495638_0015989 Ga0495638_0015989_954_2093 374
859 3300046462 Ga0495651_0017252 Ga0495651_0017252_1605_2825 374
860 3300046463 Ga0495653_0019400 Ga0495653_0019400_2765_3970 374
861 3300046463 Ga0495653_0019791 Ga0495653_0019791_964_2103 374
862 3300046463 Ga0495653_0022992 Ga0495653_0022992_391_1611 374
863 3300046463 Ga0495653_0030155 Ga0495653_0030155_1907_3043 374
864 3300046463 Ga0495653_0043631 Ga0495653_0043631_2009_3229 374
865 3300046463 Ga0495653_0073444 Ga0495653_0073444_1024_2229 374
866 3300046471 Ga0495650_0006200 Ga0495650_0006200_664_1803 374
867 3300046471 Ga0495650_0007870 Ga0495650_0007870_1675_2814 374
868 3300046471 Ga0495650_0011447 Ga0495650_0011447_3312_4451 374
869 3300046472 Ga0495580_0002910 Ga0495580_0002910_4705_5844 374
870 3300046472 Ga0495580_0006463 Ga0495580_0006463_513_1733 374
871 3300046472 Ga0495580_0018014 Ga0495580_0018014_2290_3429 374
872 3300046472 Ga0495580_0059891 Ga0495580_0059891_1339_2478 374
873 3300046472 Ga0495580_0093406 Ga0495580_0093406_772_1992 374
874 3300046473 Ga0495582_0001714 Ga0495582_0001714_10620_11759 374
875 3300046473 Ga0495582_0132145 Ga0495582_0132145_161_1297 374
876 3300046474 Ga0495605_0002724 Ga0495605_0002724_8862_10013 374
877 3300046474 Ga0495605_0003771 Ga0495605_0003771_1493_2632 374
878 3300046474 Ga0495605_0011246 Ga0495605_0011246_1038_2177 374
879 3300046474 Ga0495605_0064509 Ga0495605_0064509_171_1310 374
880 3300046477 Ga0495664_0001580 Ga0495664_0001580_10370_11509 374
881 3300046477 Ga0495664_0021769 Ga0495664_0021769_1725_2861 374
882 3300046477 Ga0495664_0047901 Ga0495664_0047901_373_1593 374
883 3300046477 Ga0495664_0049736 Ga0495664_0049736_589_1824 374
884 3300046500 Ga0495596_0000464 Ga0495596_0000464_23793_24944 374
885 3300046500 Ga0495596_0012405 Ga0495596_0012405_1749_2969 374
886 3300046500 Ga0495596_0013080 Ga0495596_0013080_1236_2375 374
887 3300046500 Ga0495596_0033012 Ga0495596_0033012_81_1220 374
888 3300046501 Ga0495607_0036436 Ga0495607_0036436_973_2124 374
889 3300046506 Ga0495583_0009682 Ga0495583_0009682_1228_2367 374
890 3300046506 Ga0495583_0012014 Ga0495583_0012014_2355_3494 374
891 3300046507 Ga0495606_0005502 Ga0495606_0005502_1569_2708 374
892 3300046507 Ga0495606_0006216 Ga0495606_0006216_9224_10363 374
893 3300046507 Ga0495606_0025325 Ga0495606_0025325_904_2043 374
894 3300046511 Ga0495608_0000972 Ga0495608_0000972_756_1976 374
895 3300046511 Ga0495608_0006938 Ga0495608_0006938_3693_4898 374
896 3300046512 Ga0495610_0001926 Ga0495610_0001926_15558_16709 374
897 3300046512 Ga0495610_0001938 Ga0495610_0001938_10693_11832 374
898 3300046513 Ga0495616_0003931 Ga0495616_0003931_809_1960 374
899 3300046514 Ga0495618_0003662 Ga0495618_0003662_7353_8573 374
900 3300046514 Ga0495618_0012834 Ga0495618_0012834_461_1600 374
901 3300046514 Ga0495618_0043358 Ga0495618_0043358_725_1930 374
902 3300046515 Ga0495620_0008055 Ga0495620_0008055_616_1752 374
903 3300046516 Ga0495628_0012653 Ga0495628_0012653_3082_4221 374
904 3300046516 Ga0495628_0063088 Ga0495628_0063088_882_2102 374
905 3300046517 Ga0495630_0032279 Ga0495630_0032279_1470_2690 374
906 3300046517 Ga0495630_0066106 Ga0495630_0066106_1557_2696 374
907 3300046520 Ga0495637_0003212 Ga0495637_0003212_3337_4512 374
908 3300046522 Ga0495643_0027330 Ga0495643_0027330_1151_2290 374
909 3300046524 Ga0495648_0084740 Ga0495648_0084740_322_1542 374
910 3300046524 Ga0495648_0086599 Ga0495648_0086599_372_1592 374
911 3300046526 Ga0495666_0001321 Ga0495666_0001321_9875_11080 374
912 3300046526 Ga0495666_0004894 Ga0495666_0004894_4341_5546 374
913 3300046528 Ga0495642_0065478 Ga0495642_0065478_77_1216 374
914 3300046529 Ga0495652_0023493 Ga0495652_0023493_851_2071 374
915 3300046529 Ga0495652_0043262 Ga0495652_0043262_1241_2446 374
916 3300046529 Ga0495652_0068546 Ga0495652_0068546_1798_2937 374
917 3300046529 Ga0495652_0115701 Ga0495652_0115701_422_1558 374
918 3300046530 Ga0495654_0035205 Ga0495654_0035205_254_1393 374
919 3300046531 Ga0495665_0003857 Ga0495665_0003857_476_1612 374
920 3300046531 Ga0495665_0018084 Ga0495665_0018084_2047_3267 374
921 3300046531 Ga0495665_0057008 Ga0495665_0057008_860_1999 374
922 3300046531 Ga0495665_0124720 Ga0495665_0124720_35_1174 374
923 3300046533 Ga0495640_0069191 Ga0495640_0069191_1050_2255 374
924 3300046535 Ga0495586_0004311 Ga0495586_0004311_1926_3065 374
925 3300046536 Ga0495587_0019557 Ga0495587_0019557_657_1796 374
926 3300046538 Ga0495609_0001831 Ga0495609_0001831_11389_12540 374
927 3300046539 Ga0495621_0045583 Ga0495621_0045583_207_1379 374
928 3300046542 Ga0495597_0003154 Ga0495597_0003154_4358_5494 374
929 3300046543 Ga0495645_0000357 Ga0495645_0000357_23696_24835 374
930 3300046543 Ga0495645_0009233 Ga0495645_0009233_470_1609 374
931 3300046557 Ga0495622_0000551 Ga0495622_0000551_1928_3067 374
932 3300046557 Ga0495622_0036110 Ga0495622_0036110_572_1711 374
933 3300046616 Ga0495668_0020606 Ga0495668_0020606_124_1275 374
934 3300046616 Ga0495668_0067009 Ga0495668_0067009_738_1889 374
935 3300046642 Ga0495634_0029934 Ga0495634_0029934_717_1937 374
936 3300046642 Ga0495634_0055984 Ga0495634_0055984_241_1446 374
937 3300046660 Ga0495625_0041262 Ga0495625_0041262_1036_2175 374
938 3300046663 Ga0495635_0005954 Ga0495635_0005954_1849_3069 374
939 3300046663 Ga0495635_0030228 Ga0495635_0030228_1126_2331 374
940 3300046665 Ga0495661_0008523 Ga0495661_0008523_921_2060 374
941 3300046665 Ga0495661_0054035 Ga0495661_0054035_955_2175 374
942 3300046674 Ga0495588_0013181 Ga0495588_0013181_321_1460 374
943 3300046678 Ga0495599_0040071 Ga0495599_0040071_463_1776 374
944 3300046679 Ga0495623_0008552 Ga0495623_0008552_414_1634 374
945 3300046679 Ga0495623_0010914 Ga0495623_0010914_3926_5239 374
946 3300046680 Ga0495646_0025935 Ga0495646_0025935_618_1757 374
947 3300046680 Ga0495646_0037729 Ga0495646_0037729_466_1686 374
948 3300046680 Ga0495646_0054746 Ga0495646_0054746_214_1434 374
949 3300046680 Ga0495646_0057937 Ga0495646_0057937_464_1600 374
950 3300046684 Ga0495669_0026341 Ga0495669_0026341_1057_2196 374
951 3300046689 Ga0495613_0003580 Ga0495613_0003580_9189_10409 374
952 3300046689 Ga0495613_0013703 Ga0495613_0013703_979_2118 374
953 3300046689 Ga0495613_0070594 Ga0495613_0070594_912_2051 374
954 3300046690 Ga0495624_0031318 Ga0495624_0031318_2286_3425 374
955 3300046690 Ga0495624_0054625 Ga0495624_0054625_86_1306 374
956 3300046691 Ga0495670_0026371 Ga0495670_0026371_894_2033 374
957 3300046692 Ga0495671_0017632 Ga0495671_0017632_861_2036 374
958 3300046694 Ga0495649_0006663 Ga0495649_0006663_581_1786 374
959 3300046694 Ga0495649_0028670 Ga0495649_0028670_1408_2559 374
960 3300046794 Ga0495589_0011136 Ga0495589_0011136_2569_3789 374
961 3300046794 Ga0495589_0012497 Ga0495589_0012497_744_1883 374
962 3300046794 Ga0495589_0013954 Ga0495589_0013954_374_1513 374
963 3300046809 Ga0495600_0003827 Ga0495600_0003827_6530_7735 374
964 3300046810 Ga0495660_0047842 Ga0495660_0047842_141_1292 374
965 3300046810 Ga0495660_0078528 Ga0495660_0078528_257_1396 374
966 3300047315 Ga0495581_0005000 Ga0495581_0005000_910_2115 374
967 3300047315 Ga0495581_0017429 Ga0495581_0017429_2212_3351 374
968 3300047315 Ga0495581_0022055 Ga0495581_0022055_520_1740 374
969 3300047315 Ga0495581_0032019 Ga0495581_0032019_940_2079 374
970 3300047317 Ga0495604_0038131 Ga0495604_0038131_802_2022 374
971 3300047317 Ga0495604_0067973 Ga0495604_0067973_801_1937 374
972 3300047318 Ga0495636_0056849 Ga0495636_0056849_484_1617 374
973 3300047319 Ga0495674_0008069 Ga0495674_0008069_6818_7957 374
974 3300047319 Ga0495674_0048438 Ga0495674_0048438_86_1306 374
975 3300047319 Ga0495674_0050490 Ga0495674_0050490_614_1753 374
976 3300047319 Ga0495674_0092897 Ga0495674_0092897_1330_2550 374
977 3300047319 Ga0495674_0165473 Ga0495674_0165473_454_1674 374
978 3300047319 Ga0495674_0181119 Ga0495674_0181119_26_1165 374
979 3300047320 Ga0495672_0003268 Ga0495672_0003268_1754_2893 374
980 3300047321 Ga0495676_0022958 Ga0495676_0022958_826_1965 374
981 3300047322 Ga0495680_0018438 Ga0495680_0018438_920_2125 374
982 3300047322 Ga0495680_0024575 Ga0495680_0024575_1008_2147 374
983 3300047322 Ga0495680_0027463 Ga0495680_0027463_903_2123 374
984 3300047322 Ga0495680_0101575 Ga0495680_0101575_708_1844 374
985 3300047323 Ga0495683_0007379 Ga0495683_0007379_538_1674 374
986 3300047323 Ga0495683_0025313 Ga0495683_0025313_651_1790 374
987 3300047323 Ga0495683_0026851 Ga0495683_0026851_1011_2150 374
988 3300047323 Ga0495683_0073432 Ga0495683_0073432_337_1476 374
989 3300047443 Ga0495687_000015 Ga0495687_000015_345280_346515 374
990 3300047443 Ga0495687_000421 Ga0495687_000421_40223_41374 374
991 3300047443 Ga0495687_008170 Ga0495687_008170_2492_3631 374
992 3300047443 Ga0495687_011651 Ga0495687_011651_770_1909 374
993 3300047443 Ga0495687_034108 Ga0495687_034108_696_1847 374
994 3300047443 Ga0495687_039183 Ga0495687_039183_696_1847 374
995 3300047443 Ga0495687_065240 Ga0495687_065240_39_1178 374
996 3300047444 Ga0495675_0019316 Ga0495675_0019316_1330_2550 374
997 3300047446 Ga0495679_000214 Ga0495679_000214_18435_19574 374
998 3300047446 Ga0495679_011957 Ga0495679_011957_1430_2650 374
999 3300047447 Ga0495685_017388 Ga0495685_017388_1151_2302 374
1000 3300047469 Ga0495673_0022497 Ga0495673_0022497_874_2013 374
1001 3300047469 Ga0495673_0055471 Ga0495673_0055471_452_1591 374
1002 3300047472 Ga0495686_0000002 Ga0495686_0000002_759493_760632 374
1003 3300047673 Ga0495593_0040336 Ga0495593_0040336_771_1991 374
1004 3300048088 Ga0495602_0016898 Ga0495602_0016898_1847_3052 374
1005 3300048088 Ga0495602_0032598 Ga0495602_0032598_1430_2569 374
1006 3300048088 Ga0495602_0059754 Ga0495602_0059754_322_1542 374
1007 3300048089 Ga0495614_0011687 Ga0495614_0011687_1798_2937 374
1008 3300048903 Ga0496100_0002406 Ga0496100_0002406_4007_5146 374
1009 3300048903 Ga0496100_0077293 Ga0496100_0077293_326_1489 374
1010 3300048904 Ga0496101_0001779 Ga0496101_0001779_2090_3229 374
1011 3300048904 Ga0496101_0001970 Ga0496101_0001970_10683_11819 374
1012 3300048905 Ga0496102_0001049 Ga0496102_0001049_13653_14789 374
1013 3300048905 Ga0496102_0005053 Ga0496102_0005053_7189_8328 374
1014 3300048905 Ga0496102_0018370 Ga0496102_0018370_3968_5131 374
1015 3300048905 Ga0496102_0155584 Ga0496102_0155584_771_1910 374
1016 3300048906 Ga0496103_0002203 Ga0496103_0002203_7065_8201 374
1017 3300048906 Ga0496103_0003261 Ga0496103_0003261_1553_2692 374
1018 3300048907 Ga0496104_0045619 Ga0496104_0045619_2094_3233 374
1019 3300048908 Ga0496105_0019626 Ga0496105_0019626_3729_4868 374
1020 3300048908 Ga0496105_0109255 Ga0496105_0109255_787_1926 374
1021 3300048908 Ga0496105_0148506 Ga0496105_0148506_57_1193 374
1022 3300048909 Ga0496106_0000089 Ga0496106_0000089_59693_60832 374
1023 3300048909 Ga0496106_0003051 Ga0496106_0003051_3787_4923 374
1024 3300048909 Ga0496106_0010892 Ga0496106_0010892_1654_2814 374
1025 3300048909 Ga0496106_0045700 Ga0496106_0045700_408_1559 374
1026 3300048909 Ga0496106_0139939 Ga0496106_0139939_376_1515 374
1027 3300048910 Ga0496107_0002731 Ga0496107_0002731_10442_11578 374
1028 3300048911 Ga0496108_0037533 Ga0496108_0037533_2584_3720 374
1029 3300048915 Ga0496112_0011516 Ga0496112_0011516_6856_7995 374
1030 3300048915 Ga0496112_0013309 Ga0496112_0013309_600_1748 374
1031 3300048915 Ga0496112_0016390 Ga0496112_0016390_3851_4987 374
1032 3300048916 Ga0496113_0002808 Ga0496113_0002808_8342_9478 374
1033 3300048916 Ga0496113_0074199 Ga0496113_0074199_1295_2443 374
1034 3300048916 Ga0496113_0107728 Ga0496113_0107728_422_1561 374
1035 3300048917 Ga0496114_0003191 Ga0496114_0003191_10803_11942 374
1036 3300048918 Ga0496115_0019931 Ga0496115_0019931_877_2016 374
1037 3300048919 Ga0496116_0000563 Ga0496116_0000563_943_2094 374
1038 3300048919 Ga0496116_0018056 Ga0496116_0018056_3524_4675 374
1039 3300048919 Ga0496116_0047659 Ga0496116_0047659_1111_2250 374
1040 3300048920 Ga0496117_0000589 Ga0496117_0000589_24594_25733 374
1041 3300048920 Ga0496117_0004572 Ga0496117_0004572_2841_3980 374
1042 3300048920 Ga0496117_0017617 Ga0496117_0017617_4208_5344 374
1043 3300048920 Ga0496117_0020400 Ga0496117_0020400_245_1465 374
1044 3300048921 Ga0496118_0000760 Ga0496118_0000760_31287_32426 374
1045 3300048921 Ga0496118_0007960 Ga0496118_0007960_797_1936 374
1046 3300048921 Ga0496118_0011717 Ga0496118_0011717_5121_6260 374
1047 3300048921 Ga0496118_0026170 Ga0496118_0026170_2058_3278 374
1048 3300048921 Ga0496118_0046051 Ga0496118_0046051_1601_2737 374
1049 3300048921 Ga0496118_0149331 Ga0496118_0149331_36_1175 374
1050 3300048923 Ga0496120_0023862 Ga0496120_0023862_1868_3007 374
1051 3300048924 Ga0496121_0002856 Ga0496121_0002856_10094_11299 374
1052 3300048924 Ga0496121_0006525 Ga0496121_0006525_7903_9039 374
1053 3300048924 Ga0496121_0013134 Ga0496121_0013134_3462_4601 374
1054 3300048924 Ga0496121_0121576 Ga0496121_0121576_714_1919 374
1055 3300048924 Ga0496121_0164691 Ga0496121_0164691_164_1303 374
1056 3300048925 Ga0496122_0000531 Ga0496122_0000531_65802_66986 374
1057 3300048925 Ga0496122_0002190 Ga0496122_0002190_9152_10288 374
1058 3300048926 Ga0496123_0000108 Ga0496123_0000108_148485_149669 374
1059 3300048926 Ga0496123_0006294 Ga0496123_0006294_430_1566 374
1060 3300048927 Ga0496124_0015885 Ga0496124_0015885_36_1175 374
1061 3300048927 Ga0496124_0018274 Ga0496124_0018274_1984_3120 374
1062 3300048927 Ga0496124_0058546 Ga0496124_0058546_1465_2643 374
1063 3300048928 Ga0496125_0038117 Ga0496125_0038117_1729_2865 374
1064 3300048929 Ga0496126_0000031 Ga0496126_0000031_3393_4532 374
1065 3300048929 Ga0496126_0005728 Ga0496126_0005728_1825_2964 374
1066 3300048929 Ga0496126_0100890 Ga0496126_0100890_491_1630 374
1067 3300048929 Ga0496126_0162075 Ga0496126_0162075_461_1600 374
1068 3300048929 Ga0496126_0165372 Ga0496126_0165372_475_1614 374
1069 3300048929 Ga0496126_0314450 Ga0496126_0314450_30_1169 374
1070 3300049459 Ga0495678_014271 Ga0495678_014271_738_1877 374
1071 3300049459 Ga0495678_024387 Ga0495678_024387_253_1392 374
1072 3300049579 Ga0501043_0000027 Ga0501043_0000027_3632_4780 374
1073 3300049580 Ga0501046_0000034 Ga0501046_0000034_3628_4776 374
1074 3300049581 Ga0501047_0000042 Ga0501047_0000042_171824_172972 374
1075 3300049582 Ga0501048_0013088 Ga0501048_0013088_3091_4239 374
1076 3300049649 Ga0501198_000015 Ga0501198_000015_58827_59978 374
1077 3300049662 Ga0501222_000045 Ga0501222_000045_3100_4251 374
1078 3300049824 Ga0501045_0095237 Ga0501045_0095237_982_2130 374
1079 3300050489 nmdc:mga03683_45402_c1 nmdc:mga03683_45402_c1_571_1722 374
1080 3300050489 nmdc:mga03683_8078_c2 nmdc:mga03683_8078_c2_662_1822 374
1081 3300050490 nmdc:mga03n38_12496_c1 nmdc:mga03n38_12496_c1_1949_3100 374
1082 3300050491 nmdc:mga00v17_103309_c1 nmdc:mga00v17_103309_c1_111_1262 374
1083 3300050492 nmdc:mga0yw44_60814_c1 nmdc:mga0yw44_60814_c1_843_1988 374
1084 3300050493 nmdc:mga0k408_1919_c1 nmdc:mga0k408_1919_c1_9531_10682 374
1085 3300050493 nmdc:mga0k408_22567_c1 nmdc:mga0k408_22567_c1_547_1695 374
1086 3300050493 nmdc:mga0k408_27503_c1 nmdc:mga0k408_27503_c1_294_1445 374
1087 3300050493 nmdc:mga0k408_62313_c1 nmdc:mga0k408_62313_c1_209_1360 374
1088 3300050493 nmdc:mga0k408_654_c1 nmdc:mga0k408_654_c1_4411_5559 374
1089 3300050493 nmdc:mga0k408_808_c1 nmdc:mga0k408_808_c1_10134_11282 374
1090 3300050496 nmdc:mga07m45_14574_c1 nmdc:mga07m45_14574_c1_1616_2767 374
1091 3300050496 nmdc:mga07m45_3667_c1 nmdc:mga07m45_3667_c1_4177_5328 374
1092 3300050496 nmdc:mga07m45_37537_c1 nmdc:mga07m45_37537_c1_135_1286 374
1093 3300050496 nmdc:mga07m45_6216_c1 nmdc:mga07m45_6216_c1_4304_5455 374
1094 3300050516 nmdc:mga0sz30_14199_c1 nmdc:mga0sz30_14199_c1_450_1601 374
1095 3300053079 Ga0500610_0029190 Ga0500610_0029190_75_1250 374
1096 3300053086 Ga0500578_0000115 Ga0500578_0000115_28255_29427 374
1097 3300053088 Ga0500644_0007072 Ga0500644_0007072_281_1432 374
1098 3300053088 Ga0500644_0011777 Ga0500644_0011777_604_1767 374
1099 3300053117 Ga0500593_013547 Ga0500593_013547_557_1732 374
1100 3300053117 Ga0500593_016746 Ga0500593_016746_511_1674 374
1101 3300053125 Ga0500618_010284 Ga0500618_010284_244_1392 374
1102 3300053134 Ga0500658_0006032 Ga0500658_0006032_1970_3121 374
1103 3300053136 Ga0500559_0000017 Ga0500559_0000017_53046_54197 374
1104 3300053139 Ga0500568_0024978 Ga0500568_0024978_280_1431 374
1105 3300053148 Ga0500590_024949 Ga0500590_024949_208_1347 374
1106 3300053156 Ga0500622_0002775 Ga0500622_0002775_5884_7035 374
1107 3300053161 Ga0500634_0025524 Ga0500634_0025524_1692_2867 374
1108 3300059424 Ga0590075_010397 Ga0590075_010397_896_2044 374
1109 3300061719 Ga0466962_0000311 Ga0466962_0000311_8994_10133 374
1110 3300061719 Ga0466962_0008657 Ga0466962_0008657_2251_3390 374
1111 3300061719 Ga0466962_0028734 Ga0466962_0028734_101_1321 374
1112 3300061719 Ga0466962_0063885 Ga0466962_0063885_468_1619 374
1113 iso_pu_bacteria 2834641062 2834642752 374
1114 iso_pu_bacteria 2900577576 2900578692 374
1115 iso_pu_bacteria 2928058823 2928062548 374
1116 2162886007 SwRhRL2b_contig_704441 SwRhRL2b_0165.00001910 375
1117 3300002771 JGI25163J39215_1000065 JGI25163J39215_100006541 375
1118 3300002772 JGI25164J39214_1000014 JGI25164J39214_1000014179 375
1119 3300003322 rootL2_10011738 rootL2_100117382 375
1120 3300003751 Ga0055538_1000005 Ga0055538_1000005328 375
1121 3300003752 Ga0055539_1000007 Ga0055539_1000007328 375
1122 3300003756 Ga0055533_1000009 Ga0055533_1000009328 375
1123 3300003759 Ga0055525_1000010 Ga0055525_1000010328 375
1124 3300003841 Ga0055541_1000005 Ga0055541_1000005237 375
1125 3300003856 Ga0058692_1000303 Ga0058692_100030317 375
1126 3300003856 Ga0058692_1000379 Ga0058692_10003796 375
1127 3300005289 Ga0065704_10000399 Ga0065704_1000039915 375
1128 3300005289 Ga0065704_10001052 Ga0065704_1000105212 375
1129 3300005289 Ga0065704_10001579 Ga0065704_1000157910 375
1130 3300005289 Ga0065704_10076648 Ga0065704_100766483 375
1131 3300005289 Ga0065704_10083775 Ga0065704_100837753 375
1132 3300005543 Ga0070672_100122201 Ga0070672_1001222012 375
1133 3300005548 Ga0070665_100000255 Ga0070665_10000025524 375
1134 3300006051 Ga0075364_10020463 Ga0075364_100204633 375
1135 3300006051 Ga0075364_10082628 Ga0075364_100826282 375
1136 3300006195 Ga0075366_10010331 Ga0075366_100103313 375
1137 3300006195 Ga0075366_10097725 Ga0075366_100977252 375
1138 3300006946 Ga0079104_1000075 Ga0079104_1000075114 375
1139 3300006946 Ga0079104_1000111 Ga0079104_100011117 375
1140 3300006946 Ga0079104_1000258 Ga0079104_100025825 375
1141 3300006946 Ga0079104_1000667 Ga0079104_10006676 375
1142 3300006946 Ga0079104_1000959 Ga0079104_100095912 375
1143 3300006946 Ga0079104_1001574 Ga0079104_10015747 375
1144 3300006946 Ga0079104_1002049 Ga0079104_10020499 375
1145 3300006946 Ga0079104_1002639 Ga0079104_10026393 375
1146 3300009011 Ga0105251_10000738 Ga0105251_1000073816 375
1147 3300009011 Ga0105251_10001810 Ga0105251_100018108 375
1148 3300009011 Ga0105251_10004288 Ga0105251_100042885 375
1149 3300009011 Ga0105251_10005117 Ga0105251_100051179 375
1150 3300009011 Ga0105251_10018972 Ga0105251_100189723 375
1151 3300009011 Ga0105251_10041499 Ga0105251_100414992 375
1152 3300009036 Ga0105244_10000090 Ga0105244_1000009031 375
1153 3300009036 Ga0105244_10000144 Ga0105244_1000014429 375
1154 3300009036 Ga0105244_10000149 Ga0105244_1000014942 375
1155 3300009036 Ga0105244_10000679 Ga0105244_1000067926 375
1156 3300009036 Ga0105244_10002219 Ga0105244_100022199 375
1157 3300009036 Ga0105244_10003061 Ga0105244_100030613 375
1158 3300009036 Ga0105244_10005707 Ga0105244_100057076 375
1159 3300009036 Ga0105244_10007965 Ga0105244_100079656 375
1160 3300009036 Ga0105244_10008326 Ga0105244_100083262 375
1161 3300009036 Ga0105244_10030222 Ga0105244_100302222 375
1162 3300009036 Ga0105244_10047079 Ga0105244_100470792 375
1163 3300009092 Ga0105250_10000011 Ga0105250_10000011251 375
1164 3300009092 Ga0105250_10000105 Ga0105250_100001058 375
1165 3300009092 Ga0105250_10000285 Ga0105250_100002854 375
1166 3300009092 Ga0105250_10001428 Ga0105250_1000142813 375
1167 3300009092 Ga0105250_10019937 Ga0105250_100199373 375
1168 3300009092 Ga0105250_10023443 Ga0105250_100234431 375
1169 3300009093 Ga0105240_10284978 Ga0105240_102849783 375
1170 3300009148 Ga0105243_10005488 Ga0105243_100054889 375
1171 3300013100 Ga0157373_10000788 Ga0157373_100007884 375
1172 3300013102 Ga0157371_10000007 Ga0157371_10000007305 375
1173 3300013102 Ga0157371_10000780 Ga0157371_100007803 375
1174 3300013102 Ga0157371_10002606 Ga0157371_100026069 375
1175 3300013102 Ga0157371_10079796 Ga0157371_100797962 375
1176 3300013104 Ga0157370_10004165 Ga0157370_100041656 375
1177 3300013307 Ga0157372_10001253 Ga0157372_1000125313 375
1178 3300013307 Ga0157372_10012280 Ga0157372_100122809 375
1179 3300013307 Ga0157372_10114919 Ga0157372_101149192 375
1180 3300013307 Ga0157372_10144570 Ga0157372_101445703 375
1181 3300013307 Ga0157372_10176345 Ga0157372_101763452 375
1182 3300014326 Ga0157380_10010968 Ga0157380_100109682 375
1183 3300015261 Ga0182006_1000024 Ga0182006_1000024105 375
1184 3300015679 Ga0183366_1001 Ga0183366_10012549 375
1185 3300015680 Ga0183370_1001 Ga0183370_10012549 375
1186 3300015685 Ga0183369_1001 Ga0183369_10012550 375
1187 3300015687 Ga0183368_1001 Ga0183368_10012549 375
1188 3300021384 Ga0213876_10000079 Ga0213876_1000007971 375
1189 3300025207 Ga0209760_100092 Ga0209760_10009224 375
1190 3300025224 Ga0209784_100001 Ga0209784_100001868 375
1191 3300025225 Ga0209566_100001 Ga0209566_100001868 375
1192 3300025226 Ga0209674_100002 Ga0209674_100002868 375
1193 3300025230 Ga0209563_100008 Ga0209563_100008871 375
1194 3300025231 Ga0207427_100002 Ga0207427_100002407 375
1195 3300025233 Ga0209437_100007 Ga0209437_100007323 375
1196 3300025253 Ga0209677_100004 Ga0209677_100004871 375
1197 3300025258 Ga0209129_1000104 Ga0209129_1000104136 375
1198 3300025261 Ga0209233_1001979 Ga0209233_10019798 375
1199 3300025295 Ga0209564_1000003 Ga0209564_10000031373 375
1200 3300025711 Ga0207696_1000026 Ga0207696_10000269 375
1201 3300025711 Ga0207696_1000035 Ga0207696_100003571 375
1202 3300025711 Ga0207696_1000131 Ga0207696_100013111 375
1203 3300025711 Ga0207696_1000166 Ga0207696_100016620 375
1204 3300025711 Ga0207696_1001091 Ga0207696_100109111 375
1205 3300025711 Ga0207696_1001841 Ga0207696_100184111 375
1206 3300025711 Ga0207696_1006550 Ga0207696_10065503 375
1207 3300025711 Ga0207696_1008073 Ga0207696_10080732 375
1208 3300025711 Ga0207696_1020296 Ga0207696_10202962 375
1209 3300025728 Ga0207655_1000002 Ga0207655_1000002114 375
1210 3300025728 Ga0207655_1000004 Ga0207655_1000004123 375
1211 3300025728 Ga0207655_1000007 Ga0207655_1000007727 375
1212 3300025728 Ga0207655_1000029 Ga0207655_1000029419 375
1213 3300025728 Ga0207655_1000062 Ga0207655_1000062139 375
1214 3300025728 Ga0207655_1000303 Ga0207655_100030341 375
1215 3300025728 Ga0207655_1000621 Ga0207655_10006216 375
1216 3300025728 Ga0207655_1000831 Ga0207655_10008316 375
1217 3300025728 Ga0207655_1008564 Ga0207655_10085643 375
1218 3300025728 Ga0207655_1010391 Ga0207655_10103916 375
1219 3300025728 Ga0207655_1026057 Ga0207655_10260574 375
1220 3300025728 Ga0207655_1035782 Ga0207655_10357822 375
1221 3300025735 Ga0207713_1000052 Ga0207713_1000052113 375
1222 3300025735 Ga0207713_1000069 Ga0207713_100006967 375
1223 3300025735 Ga0207713_1000084 Ga0207713_100008466 375
1224 3300025735 Ga0207713_1000443 Ga0207713_100044318 375
1225 3300025735 Ga0207713_1009216 Ga0207713_10092163 375
1226 3300025935 Ga0207709_10021947 Ga0207709_100219473 375
1227 3300025940 Ga0207691_10009952 Ga0207691_100099528 375
1228 3300026116 Ga0207674_10000214 Ga0207674_1000021466 375
1229 3300027111 Ga0209281_1000004 Ga0209281_1000004104 375
1230 3300027111 Ga0209281_1000014 Ga0209281_1000014210 375
1231 3300027111 Ga0209281_1000079 Ga0209281_100007917 375
1232 3300027111 Ga0209281_1000142 Ga0209281_1000142118 375
1233 3300027111 Ga0209281_1000171 Ga0209281_1000171114 375
1234 3300027111 Ga0209281_1000698 Ga0209281_10006988 375
1235 3300027111 Ga0209281_1000739 Ga0209281_10007396 375
1236 3300027111 Ga0209281_1000906 Ga0209281_10009066 375
1237 3300027111 Ga0209281_1001184 Ga0209281_100118414 375
1238 3300027111 Ga0209281_1001659 Ga0209281_10016597 375
1239 3300027312 Ga0209371_1000001 Ga0209371_10000012500 375
1240 3300027312 Ga0209371_1000015 Ga0209371_1000015484 375
1241 3300027312 Ga0209371_1000084 Ga0209371_1000084143 375
1242 3300027312 Ga0209371_1000190 Ga0209371_100019054 375
1243 3300027312 Ga0209371_1000279 Ga0209371_100027915 375
1244 3300027312 Ga0209371_1000407 Ga0209371_100040733 375
1245 3300027312 Ga0209371_1000659 Ga0209371_100065926 375
1246 3300027312 Ga0209371_1000855 Ga0209371_10008558 375
1247 3300027312 Ga0209371_1001264 Ga0209371_100126411 375
1248 3300027312 Ga0209371_1001382 Ga0209371_100138211 375
1249 3300027312 Ga0209371_1001386 Ga0209371_100138613 375
1250 3300027312 Ga0209371_1005670 Ga0209371_10056703 375
1251 3300027312 Ga0209371_1019801 Ga0209371_10198011 375
1252 3300027695 Ga0209966_1000004 Ga0209966_100000425 375
1253 3300028379 Ga0268266_10000933 Ga0268266_1000093312 375
1254 3300028381 Ga0268264_10021745 Ga0268264_100217453 375
1255 3300028794 Ga0307515_10048148 Ga0307515_100481482 375
1256 3300030500 Ga0268256_1000001 Ga0268256_1000001140 375
1257 3300030500 Ga0268256_1000018 Ga0268256_1000018139 375
1258 3300030500 Ga0268256_1000069 Ga0268256_1000069145 375
1259 3300030500 Ga0268256_1000075 Ga0268256_100007522 375
1260 3300030500 Ga0268256_1000183 Ga0268256_100018334 375
1261 3300030500 Ga0268256_1000531 Ga0268256_10005316 375
1262 3300030500 Ga0268256_1001062 Ga0268256_10010629 375
1263 3300030500 Ga0268256_1001260 Ga0268256_10012604 375
1264 3300030500 Ga0268256_1001426 Ga0268256_10014263 375
1265 3300030500 Ga0268256_1005102 Ga0268256_10051023 375
1266 3300030500 Ga0268256_1012380 Ga0268256_10123803 375
1267 3300030500 Ga0268256_1015612 Ga0268256_10156123 375
1268 3300039437 Ga0436365_1091962 Ga0436365_1091962_85998_87125 375
1269 3300041405 Ga0439438_001562 Ga0439438_001562_5322_6449 375
1270 3300041405 Ga0439438_002218 Ga0439438_002218_4621_5748 375
1271 3300041407 Ga0439447_003440 Ga0439447_003440_741_1868 375
1272 3300041512 Ga0451853_3442227 Ga0451853_3442227_3906_5033 375
1273 3300042010 Ga0439452_000002 Ga0439452_000002_136866_137993 375
1274 3300042010 Ga0439452_000036 Ga0439452_000036_142216_143343 375
1275 3300042010 Ga0439452_000089 Ga0439452_000089_52443_53570 375
1276 3300042010 Ga0439452_000235 Ga0439452_000235_24298_25425 375
1277 3300042010 Ga0439452_000816 Ga0439452_000816_8756_9883 375
1278 3300042136 Ga0450900_006298 Ga0450900_006298_199_1326 375
1279 3300042439 Ga0439464_0003592 Ga0439464_0003592_1271_2398 375
1280 3300044669 Ga0466981_0000019 Ga0466981_0000019_24483_25610 375
1281 3300046458 Ga0495591_000001 Ga0495591_000001_109420_110547 375
1282 3300046458 Ga0495591_000066 Ga0495591_000066_27348_28475 375
1283 3300046458 Ga0495591_008803 Ga0495591_008803_2834_3961 375
1284 3300046460 Ga0495638_0000724 Ga0495638_0000724_17569_18696 375
1285 3300046460 Ga0495638_0157399 Ga0495638_0157399_93_1244 375
1286 3300046471 Ga0495650_0000016 Ga0495650_0000016_347740_348867 375
1287 3300046471 Ga0495650_0000282 Ga0495650_0000282_49662_50789 375
1288 3300046474 Ga0495605_0037059 Ga0495605_0037059_1308_2435 375
1289 3300046507 Ga0495606_0000318 Ga0495606_0000318_31801_32928 375
1290 3300046513 Ga0495616_0038228 Ga0495616_0038228_163_1290 375
1291 3300046515 Ga0495620_0005352 Ga0495620_0005352_3075_4202 375
1292 3300046523 Ga0495644_0008789 Ga0495644_0008789_1188_2315 375
1293 3300046530 Ga0495654_0000033 Ga0495654_0000033_52403_53530 375
1294 3300046530 Ga0495654_0000055 Ga0495654_0000055_131338_132465 375
1295 3300046530 Ga0495654_0003551 Ga0495654_0003551_4053_5180 375
1296 3300046530 Ga0495654_0008618 Ga0495654_0008618_2235_3362 375
1297 3300046542 Ga0495597_0000112 Ga0495597_0000112_5366_6493 375
1298 3300046660 Ga0495625_0044735 Ga0495625_0044735_1171_2298 375
1299 3300046692 Ga0495671_0007138 Ga0495671_0007138_3398_4525 375
1300 3300046694 Ga0495649_0006065 Ga0495649_0006065_4659_5786 375
1301 3300046794 Ga0495589_0004533 Ga0495589_0004533_6061_7188 375
1302 3300046810 Ga0495660_0000007 Ga0495660_0000007_278323_279450 375
1303 3300046810 Ga0495660_0000017 Ga0495660_0000017_180889_182016 375
1304 3300047320 Ga0495672_0000001 Ga0495672_0000001_1313215_1314342 375
1305 3300047320 Ga0495672_0000009 Ga0495672_0000009_11534_12661 375
1306 3300047446 Ga0495679_000032 Ga0495679_000032_161516_162643 375
1307 3300047446 Ga0495679_002722 Ga0495679_002722_7600_8727 375
1308 3300047469 Ga0495673_0000019 Ga0495673_0000019_414694_415821 375
1309 3300047469 Ga0495673_0000071 Ga0495673_0000071_66741_67868 375
1310 3300048903 Ga0496100_0030684 Ga0496100_0030684_1183_2310 375
1311 3300048904 Ga0496101_0003292 Ga0496101_0003292_7697_8824 375
1312 3300048907 Ga0496104_0000901 Ga0496104_0000901_17522_18649 375
1313 3300048908 Ga0496105_0005680 Ga0496105_0005680_363_1490 375
1314 3300048919 Ga0496116_0000054 Ga0496116_0000054_168757_169884 375
1315 3300048919 Ga0496116_0000404 Ga0496116_0000404_12873_14000 375
1316 3300048919 Ga0496116_0000656 Ga0496116_0000656_18288_19415 375
1317 3300048919 Ga0496116_0020601 Ga0496116_0020601_3142_4269 375
1318 3300048919 Ga0496116_0083492 Ga0496116_0083492_714_1841 375
1319 3300048920 Ga0496117_0002070 Ga0496117_0002070_21021_22148 375
1320 3300048920 Ga0496117_0002132 Ga0496117_0002132_15020_16147 375
1321 3300048920 Ga0496117_0010642 Ga0496117_0010642_5137_6264 375
1322 3300048920 Ga0496117_0028584 Ga0496117_0028584_1990_3117 375
1323 3300048920 Ga0496117_0031106 Ga0496117_0031106_1393_2520 375
1324 3300048921 Ga0496118_0000542 Ga0496118_0000542_35254_36381 375
1325 3300048921 Ga0496118_0002453 Ga0496118_0002453_8571_9698 375
1326 3300048921 Ga0496118_0003100 Ga0496118_0003100_3054_4181 375
1327 3300048921 Ga0496118_0008138 Ga0496118_0008138_9320_10447 375
1328 3300048921 Ga0496118_0026741 Ga0496118_0026741_3302_4429 375
1329 3300048922 Ga0496119_0000013 Ga0496119_0000013_181547_182674 375
1330 3300048922 Ga0496119_0000487 Ga0496119_0000487_44687_45814 375
1331 3300048922 Ga0496119_0002421 Ga0496119_0002421_13594_14721 375
1332 3300048922 Ga0496119_0006876 Ga0496119_0006876_426_1553 375
1333 3300048922 Ga0496119_0011580 Ga0496119_0011580_5476_6603 375
1334 3300048922 Ga0496119_0016388 Ga0496119_0016388_2162_3289 375
1335 3300048922 Ga0496119_0041896 Ga0496119_0041896_1150_2277 375
1336 3300048923 Ga0496120_0000127 Ga0496120_0000127_21952_23079 375
1337 3300048923 Ga0496120_0001247 Ga0496120_0001247_26024_27151 375
1338 3300048923 Ga0496120_0001743 Ga0496120_0001743_2856_3983 375
1339 3300048923 Ga0496120_0002433 Ga0496120_0002433_11936_13063 375
1340 3300048923 Ga0496120_0002439 Ga0496120_0002439_4945_6072 375
1341 3300048923 Ga0496120_0002997 Ga0496120_0002997_10413_11540 375
1342 3300048923 Ga0496120_0010817 Ga0496120_0010817_4399_5526 375
1343 3300048923 Ga0496120_0011643 Ga0496120_0011643_3942_5069 375
1344 3300048924 Ga0496121_0002823 Ga0496121_0002823_17421_18548 375
1345 3300048924 Ga0496121_0003030 Ga0496121_0003030_6701_7828 375
1346 3300048924 Ga0496121_0011222 Ga0496121_0011222_7289_8416 375
1347 3300048924 Ga0496121_0020308 Ga0496121_0020308_431_1558 375
1348 3300048925 Ga0496122_0000003 Ga0496122_0000003_604743_605870 375
1349 3300048925 Ga0496122_0000013 Ga0496122_0000013_326251_327378 375
1350 3300048925 Ga0496122_0001786 Ga0496122_0001786_27425_28552 375
1351 3300048925 Ga0496122_0004133 Ga0496122_0004133_13125_14252 375
1352 3300048925 Ga0496122_0006638 Ga0496122_0006638_1739_2866 375
1353 3300048925 Ga0496122_0009302 Ga0496122_0009302_5158_6285 375
1354 3300048925 Ga0496122_0016118 Ga0496122_0016118_4663_5790 375
1355 3300048926 Ga0496123_0000010 Ga0496123_0000010_173662_174789 375
1356 3300048926 Ga0496123_0000012 Ga0496123_0000012_359926_361053 375
1357 3300048926 Ga0496123_0001302 Ga0496123_0001302_26809_27936 375
1358 3300048926 Ga0496123_0003521 Ga0496123_0003521_12270_13397 375
1359 3300048926 Ga0496123_0003666 Ga0496123_0003666_12027_13154 375
1360 3300048926 Ga0496123_0003877 Ga0496123_0003877_14384_15511 375
1361 3300048926 Ga0496123_0005221 Ga0496123_0005221_10332_11459 375
1362 3300048926 Ga0496123_0015896 Ga0496123_0015896_4368_5495 375
1363 3300048927 Ga0496124_0000010 Ga0496124_0000010_109722_110849 375
1364 3300048927 Ga0496124_0000060 Ga0496124_0000060_174357_175484 375
1365 3300048927 Ga0496124_0001326 Ga0496124_0001326_5542_6669 375
1366 3300048927 Ga0496124_0003926 Ga0496124_0003926_346_1473 375
1367 3300048927 Ga0496124_0006620 Ga0496124_0006620_6771_7898 375
1368 3300048927 Ga0496124_0015626 Ga0496124_0015626_4658_5809 375
1369 3300048927 Ga0496124_0143629 Ga0496124_0143629_269_1396 375
1370 3300048928 Ga0496125_0000019 Ga0496125_0000019_267940_269067 375
1371 3300048928 Ga0496125_0000580 Ga0496125_0000580_24920_26047 375
1372 3300048928 Ga0496125_0002767 Ga0496125_0002767_7926_9053 375
1373 3300048928 Ga0496125_0014233 Ga0496125_0014233_1366_2493 375
1374 3300048928 Ga0496125_0234540 Ga0496125_0234540_28_1155 375
1375 3300048929 Ga0496126_0004481 Ga0496126_0004481_4915_6042 375
1376 3300048929 Ga0496126_0108480 Ga0496126_0108480_913_2040 375
1377 3300049459 Ga0495678_000493 Ga0495678_000493_35492_36619 375
1378 3300049460 Ga0495682_0000011 Ga0495682_0000011_155783_156910 375
1379 3300050491 nmdc:mga00v17_14361_c1 nmdc:mga00v17_14361_c1_1320_2447 375
1380 3300050491 nmdc:mga00v17_99563_c1 nmdc:mga00v17_99563_c1_439_1566 375
1381 3300050493 nmdc:mga0k408_4870_c1 nmdc:mga0k408_4870_c1_2076_3203 375
1382 3300053126 Ga0500621_000005 Ga0500621_000005_171403_172530 375
1383 3300053156 Ga0500622_0001272 Ga0500622_0001272_13407_14558 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

124

434

0.98

PF07687

M20_dimer

Peptidase dimerisation domain

237

345

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9784 4 375
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9697 4 373
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9631 4 375
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9611 2 375
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9586 2 375
ID Description Score Start End Superfamily
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9666 3 244 3.40.630.10
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9635 1 373 3.40.630.10
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9627 3 244 3.40.630.10
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9561 1 373 3.40.630.10
af_Q18621_173_267_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9069 184 276 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A3B9JVF5-F1-model_v4 deleted 0.9809 3 148
AF-A0A3B9JVF5-F1-model_v4 deleted 0.9677 3 148
AF-A0A3S4GHQ2-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9526 92 375 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0046872
AF-Q12C18-F1-model_v4 Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) 0.9503 3 373 GO:0006526
GO:0008270
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0050897
AF-A0A3T0L106-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9477 3 371 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map