F493524
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1382 | 397 | 2764 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300035119|Ga0373956_0031293|Ga0373956_0031293_380_1345 |
| Length | 321 |
| Sequence | MRGGRFRHANVFCFPERRPMRTARCVDAVAKQNIGFGSRLFEEGDALQHGEVHMPKVKANGITLNYEQQGTGEPLVLIPYLAADNACYAFQVGEYAKHFTCISVDPRGAGESDKPAGPYSMELFADDVAAFMQAIGVERAHVSGLSLGAATGLWVAGKYPQRVKSLSLHSGWTKSDPFLKAVLEGWRTIAKGLDSVTEMIIQGIFPWCFTPELYAAKPDYIDQLAAFVRGRPKQPLDAFMSQSSAVINHDGLSALAQIKAPTQITFGRHDQVTSTRFADAMKNGIKGSELAIFETCAHAPIYESVAEFNEKTLAFLTRQSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 264 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 271 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 272 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 273 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 274 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 275 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 276 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 279 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 280 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 340 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 358 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 361 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 1.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.18 |
| Rhizosphere | 89.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373956_0031293 | 3300035119 | Bacteria | 2331 |
| 2 | JGI24743J22301_10040505 | 3300001991 | Bacteria | 935 |
| 3 | JGI24750J21931_1014997 | 3300002070 | Bacteria | 1045 |
| 4 | JGI24738J21930_10003487 | 3300002075 | Bacteria | 3957 |
| 5 | JGI24751J29686_10035804 | 3300002459 | Unclassified | 1029 |
| 6 | JGI25406J46586_10068999 | 3300003203 | Bacteria | 1115 |
| 7 | rootL2_10273141 | 3300003322 | Unclassified | 2590 |
| 8 | Ga0058862_10214684 | 3300004803 | Bacteria | 1572 |
| 9 | Ga0065704_10100409 | 3300005289 | Bacteria | 2274 |
| 10 | Ga0065704_10102409 | 3300005289 | Bacteria | 2206 |
| 11 | Ga0065715_10012192 | 3300005293 | Unclassified | 2027 |
| 12 | Ga0065715_10188816 | 3300005293 | Bacteria | 1428 |
| 13 | Ga0065707_10159697 | 3300005295 | Unclassified | 1575 |
| 14 | Ga0070658_10064461 | 3300005327 | Bacteria | 2988 |
| 15 | Ga0070658_10069838 | 3300005327 | Bacteria | 2874 |
| 16 | Ga0070658_10424169 | 3300005327 | Bacteria | 1144 |
| 17 | Ga0070676_10034513 | 3300005328 | Bacteria | 2905 |
| 18 | Ga0070676_10051251 | 3300005328 | Unclassified | 2423 |
| 19 | Ga0070683_100001985 | 3300005329 | Bacteria | 16032 |
| 20 | Ga0070683_100032232 | 3300005329 | Bacteria | 4772 |
| 21 | Ga0070683_100036741 | 3300005329 | Bacteria | 4483 |
| 22 | Ga0070683_100042978 | 3300005329 | Bacteria | 4163 |
| 23 | Ga0070683_100119553 | 3300005329 | Bacteria | 2488 |
| 24 | Ga0070683_100309229 | 3300005329 | Bacteria | 1504 |
| 25 | Ga0070690_100026680 | 3300005330 | Bacteria | 3565 |
| 26 | Ga0070690_100038277 | 3300005330 | Bacteria | 3026 |
| 27 | Ga0070670_100022499 | 3300005331 | Bacteria | 5425 |
| 28 | Ga0070670_100035300 | 3300005331 | Bacteria | 4306 |
| 29 | Ga0070670_100380037 | 3300005331 | Unclassified | 1244 |
| 30 | Ga0070670_100388663 | 3300005331 | Unclassified | 1230 |
| 31 | Ga0070670_100666036 | 3300005331 | Unclassified | 934 |
| 32 | Ga0070677_10025372 | 3300005333 | Unclassified | 2213 |
| 33 | Ga0070677_10076398 | 3300005333 | Unclassified | 1422 |
| 34 | Ga0068869_100002717 | 3300005334 | Bacteria | 10707 |
| 35 | Ga0068869_100090876 | 3300005334 | Bacteria | 2296 |
| 36 | Ga0068869_100344016 | 3300005334 | Bacteria | 1214 |
| 37 | Ga0070666_10002239 | 3300005335 | Bacteria | 11687 |
| 38 | Ga0070666_10134591 | 3300005335 | Bacteria | 1719 |
| 39 | Ga0070666_10262931 | 3300005335 | Bacteria | 1224 |
| 40 | Ga0070680_100068859 | 3300005336 | Bacteria | 2905 |
| 41 | Ga0070680_100111413 | 3300005336 | Bacteria | 2278 |
| 42 | Ga0070680_100250482 | 3300005336 | Bacteria | 1497 |
| 43 | Ga0070680_100257122 | 3300005336 | Unclassified | 1477 |
| 44 | Ga0070680_100326268 | 3300005336 | Bacteria | 1303 |
| 45 | Ga0070680_100419310 | 3300005336 | Unclassified | 1142 |
| 46 | Ga0070682_100004789 | 3300005337 | Bacteria | 7519 |
| 47 | Ga0070682_100028783 | 3300005337 | Bacteria | 3343 |
| 48 | Ga0070682_100034164 | 3300005337 | Bacteria | 3095 |
| 49 | Ga0070682_100433264 | 3300005337 | Bacteria | 1003 |
| 50 | Ga0068868_100040289 | 3300005338 | Bacteria | 3635 |
| 51 | Ga0068868_100042490 | 3300005338 | Unclassified | 3548 |
| 52 | Ga0068868_100075739 | 3300005338 | Bacteria | 2689 |
| 53 | Ga0068868_100346241 | 3300005338 | Unclassified | 1272 |
| 54 | Ga0068868_100472317 | 3300005338 | Unclassified | 1094 |
| 55 | Ga0070660_100003025 | 3300005339 | Bacteria | 11572 |
| 56 | Ga0070660_100012448 | 3300005339 | Bacteria | 6074 |
| 57 | Ga0070660_100017775 | 3300005339 | Bacteria | 5186 |
| 58 | Ga0070660_100076988 | 3300005339 | Bacteria | 2613 |
| 59 | Ga0070660_100116432 | 3300005339 | Bacteria | 2131 |
| 60 | Ga0070660_100260648 | 3300005339 | Unclassified | 1415 |
| 61 | Ga0070689_100009235 | 3300005340 | Bacteria | 6982 |
| 62 | Ga0070689_100170417 | 3300005340 | Bacteria | 1764 |
| 63 | Ga0070691_10033532 | 3300005341 | Bacteria | 2416 |
| 64 | Ga0070691_10117724 | 3300005341 | Bacteria | 1335 |
| 65 | Ga0070687_100026669 | 3300005343 | Bacteria | 2784 |
| 66 | Ga0070687_100149062 | 3300005343 | Bacteria | 1371 |
| 67 | Ga0070661_100005517 | 3300005344 | Bacteria | 8717 |
| 68 | Ga0070661_100006707 | 3300005344 | Bacteria | 7942 |
| 69 | Ga0070661_100057996 | 3300005344 | Bacteria | 2837 |
| 70 | Ga0070661_100076417 | 3300005344 | Bacteria | 2468 |
| 71 | Ga0070661_100115017 | 3300005344 | Unclassified | 2011 |
| 72 | Ga0070661_100118955 | 3300005344 | Bacteria | 1977 |
| 73 | Ga0070661_100121043 | 3300005344 | Bacteria | 1961 |
| 74 | Ga0070661_100136703 | 3300005344 | Unclassified | 1845 |
| 75 | Ga0070661_100272459 | 3300005344 | Bacteria | 1311 |
| 76 | Ga0070692_10004094 | 3300005345 | Bacteria | 6030 |
| 77 | Ga0070692_10058153 | 3300005345 | Bacteria | 2030 |
| 78 | Ga0070692_10183068 | 3300005345 | Bacteria | 1215 |
| 79 | Ga0070692_10190235 | 3300005345 | Bacteria | 1195 |
| 80 | Ga0070692_10291300 | 3300005345 | Unclassified | 993 |
| 81 | Ga0070668_100115775 | 3300005347 | Bacteria | 2137 |
| 82 | Ga0070668_100566290 | 3300005347 | Unclassified | 990 |
| 83 | Ga0070669_100033667 | 3300005353 | Bacteria | 3707 |
| 84 | Ga0070669_100049248 | 3300005353 | Bacteria | 3076 |
| 85 | Ga0070669_100338690 | 3300005353 | Unclassified | 1218 |
| 86 | Ga0070669_100710671 | 3300005353 | Unclassified | 849 |
| 87 | Ga0070675_100011830 | 3300005354 | Bacteria | 6838 |
| 88 | Ga0070675_100018221 | 3300005354 | Bacteria | 5589 |
| 89 | Ga0070675_100024902 | 3300005354 | Bacteria | 4796 |
| 90 | Ga0070675_100033519 | 3300005354 | Bacteria | 4164 |
| 91 | Ga0070675_100064160 | 3300005354 | Bacteria | 3037 |
| 92 | Ga0070675_100206357 | 3300005354 | Unclassified | 1707 |
| 93 | Ga0070671_100007805 | 3300005355 | Bacteria | 8549 |
| 94 | Ga0070671_100013553 | 3300005355 | Bacteria | 6573 |
| 95 | Ga0070671_100026503 | 3300005355 | Bacteria | 4764 |
| 96 | Ga0070671_100657245 | 3300005355 | Bacteria | 908 |
| 97 | Ga0070674_100021404 | 3300005356 | Bacteria | 4151 |
| 98 | Ga0070674_100163372 | 3300005356 | Unclassified | 1691 |
| 99 | Ga0070674_100314980 | 3300005356 | Unclassified | 1252 |
| 100 | Ga0070673_100031909 | 3300005364 | Bacteria | 3959 |
| 101 | Ga0070673_100065588 | 3300005364 | Bacteria | 2897 |
| 102 | Ga0070673_100326527 | 3300005364 | Bacteria | 1356 |
| 103 | Ga0070673_100341560 | 3300005364 | Unclassified | 1327 |
| 104 | Ga0070673_100360021 | 3300005364 | Bacteria | 1293 |
| 105 | Ga0070688_100001997 | 3300005365 | Bacteria | 10282 |
| 106 | Ga0070688_100005496 | 3300005365 | Bacteria | 6681 |
| 107 | Ga0070659_100005288 | 3300005366 | Bacteria | 9261 |
| 108 | Ga0070659_100035019 | 3300005366 | Bacteria | 3907 |
| 109 | Ga0070659_100068732 | 3300005366 | Bacteria | 2810 |
| 110 | Ga0070659_100087168 | 3300005366 | Bacteria | 2499 |
| 111 | Ga0070659_100186917 | 3300005366 | Bacteria | 1702 |
| 112 | Ga0070659_100220430 | 3300005366 | Bacteria | 1565 |
| 113 | Ga0070659_100257956 | 3300005366 | Bacteria | 1446 |
| 114 | Ga0070659_100311421 | 3300005366 | Bacteria | 1315 |
| 115 | Ga0070659_100588443 | 3300005366 | Unclassified | 955 |
| 116 | Ga0070667_100001361 | 3300005367 | Bacteria | 21918 |
| 117 | Ga0070667_100028039 | 3300005367 | Bacteria | 4687 |
| 118 | Ga0070667_100054042 | 3300005367 | Unclassified | 3391 |
| 119 | Ga0070667_100081078 | 3300005367 | Bacteria | 2776 |
| 120 | Ga0070667_100412302 | 3300005367 | Bacteria | 1231 |
| 121 | Ga0070703_10002696 | 3300005406 | Bacteria | 5095 |
| 122 | Ga0070703_10049871 | 3300005406 | Bacteria | 1334 |
| 123 | Ga0070709_10065320 | 3300005434 | Bacteria | 2329 |
| 124 | Ga0070709_10477112 | 3300005434 | Unclassified | 944 |
| 125 | Ga0070714_100030854 | 3300005435 | Bacteria | 4466 |
| 126 | Ga0070714_100049139 | 3300005435 | Bacteria | 3590 |
| 127 | Ga0070714_100074272 | 3300005435 | Unclassified | 2947 |
| 128 | Ga0070714_100214309 | 3300005435 | Unclassified | 1767 |
| 129 | Ga0070714_100304388 | 3300005435 | Bacteria | 1487 |
| 130 | Ga0070714_100502471 | 3300005435 | Bacteria | 1156 |
| 131 | Ga0070713_100011585 | 3300005436 | Bacteria | 6429 |
| 132 | Ga0070713_100037719 | 3300005436 | Bacteria | 3908 |
| 133 | Ga0070713_100048076 | 3300005436 | Bacteria | 3510 |
| 134 | Ga0070713_100114824 | 3300005436 | Bacteria | 2353 |
| 135 | Ga0070713_100148943 | 3300005436 | Bacteria | 2080 |
| 136 | Ga0070713_100217841 | 3300005436 | Unclassified | 1731 |
| 137 | Ga0070713_100379586 | 3300005436 | Bacteria | 1317 |
| 138 | Ga0070713_100647947 | 3300005436 | Bacteria | 1006 |
| 139 | Ga0070710_10192306 | 3300005437 | Unclassified | 1284 |
| 140 | Ga0070701_10001416 | 3300005438 | Bacteria | 8881 |
| 141 | Ga0070701_10154350 | 3300005438 | Bacteria | 1325 |
| 142 | Ga0070701_10159930 | 3300005438 | Bacteria | 1304 |
| 143 | Ga0070701_10273181 | 3300005438 | Unclassified | 1029 |
| 144 | Ga0070711_100016426 | 3300005439 | Bacteria | 4702 |
| 145 | Ga0070711_100447135 | 3300005439 | Bacteria | 1057 |
| 146 | Ga0070705_100009697 | 3300005440 | Bacteria | 4796 |
| 147 | Ga0070705_100010632 | 3300005440 | Bacteria | 4614 |
| 148 | Ga0070700_100004166 | 3300005441 | Bacteria | 7537 |
| 149 | Ga0070700_100019998 | 3300005441 | Bacteria | 3872 |
| 150 | Ga0070700_100144939 | 3300005441 | Bacteria | 1618 |
| 151 | Ga0070700_100325479 | 3300005441 | Unclassified | 1131 |
| 152 | Ga0070694_100004850 | 3300005444 | Bacteria | 8101 |
| 153 | Ga0070694_100031865 | 3300005444 | Bacteria | 3458 |
| 154 | Ga0070694_100036004 | 3300005444 | Bacteria | 3276 |
| 155 | Ga0070694_100044859 | 3300005444 | Bacteria | 2960 |
| 156 | Ga0070694_100070387 | 3300005444 | Bacteria | 2408 |
| 157 | Ga0070694_100634331 | 3300005444 | Unclassified | 863 |
| 158 | Ga0070708_100001882 | 3300005445 | Bacteria | 16102 |
| 159 | Ga0070708_100008313 | 3300005445 | Bacteria | 8334 |
| 160 | Ga0070708_100009507 | 3300005445 | Bacteria | 7838 |
| 161 | Ga0070708_100012874 | 3300005445 | Bacteria | 6836 |
| 162 | Ga0070708_100052993 | 3300005445 | Plasmid | 3599 |
| 163 | Ga0070708_100065468 | 3300005445 | Bacteria | 3259 |
| 164 | Ga0070708_100074336 | 3300005445 | Bacteria | 3065 |
| 165 | Ga0070708_100382469 | 3300005445 | Bacteria | 1327 |
| 166 | Ga0070663_100004923 | 3300005455 | Bacteria | 7885 |
| 167 | Ga0070663_100048631 | 3300005455 | Bacteria | 3008 |
| 168 | Ga0070663_100054947 | 3300005455 | Bacteria | 2848 |
| 169 | Ga0070663_100066861 | 3300005455 | Bacteria | 2605 |
| 170 | Ga0070663_100081602 | 3300005455 | Bacteria | 2377 |
| 171 | Ga0070663_100136022 | 3300005455 | Bacteria | 1871 |
| 172 | Ga0070663_100149218 | 3300005455 | Bacteria | 1791 |
| 173 | Ga0070663_100158963 | 3300005455 | Bacteria | 1738 |
| 174 | Ga0070678_100004126 | 3300005456 | Bacteria | 8187 |
| 175 | Ga0070678_100005575 | 3300005456 | Bacteria | 7301 |
| 176 | Ga0070678_100023181 | 3300005456 | Bacteria | 4131 |
| 177 | Ga0070678_100052876 | 3300005456 | Bacteria | 2951 |
| 178 | Ga0070678_100055755 | 3300005456 | Bacteria | 2887 |
| 179 | Ga0070662_100000176 | 3300005457 | Bacteria | 37127 |
| 180 | Ga0070662_100006883 | 3300005457 | Bacteria | 7357 |
| 181 | Ga0070662_100033411 | 3300005457 | Bacteria | 3621 |
| 182 | Ga0070662_100109454 | 3300005457 | Bacteria | 2103 |
| 183 | Ga0070662_100138081 | 3300005457 | Bacteria | 1886 |
| 184 | Ga0070662_100288611 | 3300005457 | Unclassified | 1329 |
| 185 | Ga0070681_10004187 | 3300005458 | Bacteria | 13662 |
| 186 | Ga0070681_10063677 | 3300005458 | Unclassified | 3659 |
| 187 | Ga0070681_10261748 | 3300005458 | Unclassified | 1642 |
| 188 | Ga0070681_10532140 | 3300005458 | Bacteria | 1089 |
| 189 | Ga0068867_100033353 | 3300005459 | Bacteria | 3728 |
| 190 | Ga0068867_100055594 | 3300005459 | Bacteria | 2927 |
| 191 | Ga0068867_100180625 | 3300005459 | Bacteria | 1677 |
| 192 | Ga0068867_100328184 | 3300005459 | Unclassified | 1270 |
| 193 | Ga0068867_100460109 | 3300005459 | Unclassified | 1086 |
| 194 | Ga0070685_10001387 | 3300005466 | Bacteria | 12719 |
| 195 | Ga0070685_10033481 | 3300005466 | Bacteria | 2887 |
| 196 | Ga0070706_100014082 | 3300005467 | Bacteria | 7390 |
| 197 | Ga0070706_100044612 | 3300005467 | Bacteria | 4095 |
| 198 | Ga0070706_100061987 | 3300005467 | Unclassified | 3454 |
| 199 | Ga0070706_100157005 | 3300005467 | Unclassified | 2123 |
| 200 | Ga0070706_100157622 | 3300005467 | Bacteria | 2119 |
| 201 | Ga0070706_100264867 | 3300005467 | Bacteria | 1604 |
| 202 | Ga0070706_100478801 | 3300005467 | Bacteria | 1158 |
| 203 | Ga0070706_100487900 | 3300005467 | Unclassified | 1146 |
| 204 | Ga0070707_100044064 | 3300005468 | Unclassified | 4271 |
| 205 | Ga0070707_100048986 | 3300005468 | Bacteria | 4049 |
| 206 | Ga0070707_100088178 | 3300005468 | Unclassified | 3001 |
| 207 | Ga0070707_100103425 | 3300005468 | Bacteria | 2760 |
| 208 | Ga0070707_100131936 | 3300005468 | Unclassified | 2429 |
| 209 | Ga0070707_100253548 | 3300005468 | Bacteria | 1712 |
| 210 | Ga0070707_100290020 | 3300005468 | Bacteria | 1590 |
| 211 | Ga0070707_100358176 | 3300005468 | Bacteria | 1417 |
| 212 | Ga0070707_100390678 | 3300005468 | Unclassified | 1351 |
| 213 | Ga0070698_100002074 | 3300005471 | Bacteria | 22276 |
| 214 | Ga0070698_100002913 | 3300005471 | Bacteria | 18838 |
| 215 | Ga0070698_100031205 | 3300005471 | Bacteria | 5525 |
| 216 | Ga0070698_100046210 | 3300005471 | Bacteria | 4452 |
| 217 | Ga0070698_100072865 | 3300005471 | Bacteria | 3442 |
| 218 | Ga0070698_100251875 | 3300005471 | Bacteria | 1698 |
| 219 | Ga0070699_100029971 | 3300005518 | Bacteria | 4694 |
| 220 | Ga0070699_100045831 | 3300005518 | Bacteria | 3784 |
| 221 | Ga0070699_100113805 | 3300005518 | Bacteria | 2377 |
| 222 | Ga0070699_100358146 | 3300005518 | Bacteria | 1315 |
| 223 | Ga0070699_100418508 | 3300005518 | Bacteria | 1213 |
| 224 | Ga0070699_100456453 | 3300005518 | Unclassified | 1159 |
| 225 | Ga0070699_100574626 | 3300005518 | Bacteria | 1027 |
| 226 | Ga0070679_100001701 | 3300005530 | Bacteria | 19818 |
| 227 | Ga0070679_100010428 | 3300005530 | Bacteria | 8814 |
| 228 | Ga0070679_100011511 | 3300005530 | Bacteria | 8433 |
| 229 | Ga0070679_100036858 | 3300005530 | Bacteria | 4855 |
| 230 | Ga0070679_100100303 | 3300005530 | Unclassified | 2882 |
| 231 | Ga0070679_100447429 | 3300005530 | Bacteria | 1236 |
| 232 | Ga0070679_100624728 | 3300005530 | Bacteria | 1020 |
| 233 | Ga0070684_100006596 | 3300005535 | Bacteria | 8990 |
| 234 | Ga0070684_100052144 | 3300005535 | Bacteria | 3556 |
| 235 | Ga0070684_100058902 | 3300005535 | Bacteria | 3357 |
| 236 | Ga0070684_100147863 | 3300005535 | Bacteria | 2127 |
| 237 | Ga0070684_100656046 | 3300005535 | Bacteria | 977 |
| 238 | Ga0070697_100018594 | 3300005536 | Bacteria | 5479 |
| 239 | Ga0070697_100030860 | 3300005536 | Bacteria | 4307 |
| 240 | Ga0070697_100094002 | 3300005536 | Unclassified | 2483 |
| 241 | Ga0070697_100273452 | 3300005536 | Bacteria | 1448 |
| 242 | Ga0070697_100531507 | 3300005536 | Unclassified | 1030 |
| 243 | Ga0068853_100011199 | 3300005539 | Bacteria | 7278 |
| 244 | Ga0068853_100023406 | 3300005539 | Bacteria | 5170 |
| 245 | Ga0068853_100107243 | 3300005539 | Bacteria | 2477 |
| 246 | Ga0068853_100357271 | 3300005539 | Bacteria | 1360 |
| 247 | Ga0068853_100407658 | 3300005539 | Bacteria | 1273 |
| 248 | Ga0070672_100004194 | 3300005543 | Bacteria | 9414 |
| 249 | Ga0070672_100005387 | 3300005543 | Bacteria | 8476 |
| 250 | Ga0070672_100017283 | 3300005543 | Bacteria | 5187 |
| 251 | Ga0070672_100025338 | 3300005543 | Bacteria | 4397 |
| 252 | Ga0070672_100055170 | 3300005543 | Bacteria | 3112 |
| 253 | Ga0070672_100151341 | 3300005543 | Unclassified | 1919 |
| 254 | Ga0070672_100307944 | 3300005543 | Bacteria | 1344 |
| 255 | Ga0070672_100329520 | 3300005543 | Bacteria | 1299 |
| 256 | Ga0070686_100002957 | 3300005544 | Bacteria | 9323 |
| 257 | Ga0070686_100061618 | 3300005544 | Bacteria | 2425 |
| 258 | Ga0070686_100068464 | 3300005544 | Bacteria | 2315 |
| 259 | Ga0070686_100407372 | 3300005544 | Bacteria | 1036 |
| 260 | Ga0070695_100010936 | 3300005545 | Bacteria | 5423 |
| 261 | Ga0070695_100243483 | 3300005545 | Bacteria | 1306 |
| 262 | Ga0070695_100268969 | 3300005545 | Bacteria | 1248 |
| 263 | Ga0070695_100284669 | 3300005545 | Unclassified | 1216 |
| 264 | Ga0070695_100368940 | 3300005545 | Unclassified | 1080 |
| 265 | Ga0070695_100372857 | 3300005545 | Bacteria | 1075 |
| 266 | Ga0070696_100004472 | 3300005546 | Bacteria | 9335 |
| 267 | Ga0070696_100008735 | 3300005546 | Bacteria | 6780 |
| 268 | Ga0070696_100132145 | 3300005546 | Bacteria | 1817 |
| 269 | Ga0070696_100136880 | 3300005546 | Bacteria | 1786 |
| 270 | Ga0070696_100482493 | 3300005546 | Bacteria | 983 |
| 271 | Ga0070693_100000020 | 3300005547 | Bacteria | 59763 |
| 272 | Ga0070693_100001032 | 3300005547 | Bacteria | 12425 |
| 273 | Ga0070693_100016413 | 3300005547 | Unclassified | 3833 |
| 274 | Ga0070693_100048537 | 3300005547 | Bacteria | 2418 |
| 275 | Ga0070693_100191673 | 3300005547 | Unclassified | 1322 |
| 276 | Ga0070665_100090040 | 3300005548 | Plasmid | 3074 |
| 277 | Ga0070665_100094505 | 3300005548 | Bacteria | 2994 |
| 278 | Ga0070665_100233531 | 3300005548 | Unclassified | 1839 |
| 279 | Ga0070704_100034988 | 3300005549 | Bacteria | 3411 |
| 280 | Ga0070704_100044902 | 3300005549 | Bacteria | 3073 |
| 281 | Ga0070704_100051733 | 3300005549 | Bacteria | 2894 |
| 282 | Ga0070704_100073510 | 3300005549 | Bacteria | 2491 |
| 283 | Ga0070704_100435210 | 3300005549 | Bacteria | 1126 |
| 284 | Ga0068855_100000851 | 3300005563 | Bacteria | 37847 |
| 285 | Ga0068855_100415329 | 3300005563 | Bacteria | 1472 |
| 286 | Ga0070664_100008272 | 3300005564 | Bacteria | 8414 |
| 287 | Ga0070664_100012432 | 3300005564 | Bacteria | 6918 |
| 288 | Ga0070664_100013494 | 3300005564 | Bacteria | 6656 |
| 289 | Ga0070664_100016938 | 3300005564 | Bacteria | 5980 |
| 290 | Ga0070664_100017540 | 3300005564 | Bacteria | 5880 |
| 291 | Ga0070664_100153417 | 3300005564 | Bacteria | 2034 |
| 292 | Ga0070664_100447629 | 3300005564 | Bacteria | 1185 |
| 293 | Ga0068857_100111843 | 3300005577 | Bacteria | 2455 |
| 294 | Ga0068857_100522827 | 3300005577 | Bacteria | 1115 |
| 295 | Ga0068857_100533118 | 3300005577 | Bacteria | 1104 |
| 296 | Ga0068854_100028423 | 3300005578 | Bacteria | 3864 |
| 297 | Ga0068854_100080260 | 3300005578 | Bacteria | 2407 |
| 298 | Ga0068854_100088052 | 3300005578 | Bacteria | 2305 |
| 299 | Ga0068854_100090916 | 3300005578 | Bacteria | 2271 |
| 300 | Ga0068854_100094255 | 3300005578 | Bacteria | 2233 |
| 301 | Ga0068854_100146364 | 3300005578 | Bacteria | 1818 |
| 302 | Ga0068854_100188103 | 3300005578 | Bacteria | 1617 |
| 303 | Ga0068854_100409739 | 3300005578 | Unclassified | 1123 |
| 304 | Ga0068856_100001266 | 3300005614 | Bacteria | 26611 |
| 305 | Ga0068856_100007738 | 3300005614 | Bacteria | 10494 |
| 306 | Ga0068856_100021420 | 3300005614 | Bacteria | 6284 |
| 307 | Ga0068856_100041410 | 3300005614 | Bacteria | 4527 |
| 308 | Ga0068856_100043966 | 3300005614 | Bacteria | 4394 |
| 309 | Ga0068856_100113986 | 3300005614 | Bacteria | 2702 |
| 310 | Ga0068856_100150562 | 3300005614 | Bacteria | 2336 |
| 311 | Ga0070702_100004287 | 3300005615 | Bacteria | 6499 |
| 312 | Ga0070702_100045925 | 3300005615 | Bacteria | 2473 |
| 313 | Ga0070702_100173108 | 3300005615 | Unclassified | 1406 |
| 314 | Ga0068852_100004780 | 3300005616 | Bacteria | 9621 |
| 315 | Ga0068852_100009135 | 3300005616 | Bacteria | 7341 |
| 316 | Ga0068852_100030395 | 3300005616 | Bacteria | 4446 |
| 317 | Ga0068852_100052395 | 3300005616 | Bacteria | 3507 |
| 318 | Ga0068852_100193103 | 3300005616 | Bacteria | 1922 |
| 319 | Ga0068852_100232831 | 3300005616 | Bacteria | 1757 |
| 320 | Ga0068852_100349430 | 3300005616 | Bacteria | 1443 |
| 321 | Ga0068852_100414311 | 3300005616 | Unclassified | 1328 |
| 322 | Ga0068852_100448636 | 3300005616 | Unclassified | 1277 |
| 323 | Ga0068852_100503609 | 3300005616 | Bacteria | 1206 |
| 324 | Ga0068852_100658458 | 3300005616 | Bacteria | 1055 |
| 325 | Ga0068859_100010506 | 3300005617 | Bacteria | 9316 |
| 326 | Ga0068859_100025290 | 3300005617 | Bacteria | 5955 |
| 327 | Ga0068859_100093632 | 3300005617 | Bacteria | 3056 |
| 328 | Ga0068859_100119061 | 3300005617 | Bacteria | 2707 |
| 329 | Ga0068859_100120162 | 3300005617 | Bacteria | 2694 |
| 330 | Ga0068859_100218864 | 3300005617 | Bacteria | 1992 |
| 331 | Ga0068859_100260891 | 3300005617 | Unclassified | 1824 |
| 332 | Ga0068859_100292957 | 3300005617 | Unclassified | 1720 |
| 333 | Ga0068859_100383412 | 3300005617 | Unclassified | 1501 |
| 334 | Ga0068859_100839202 | 3300005617 | Bacteria | 1005 |
| 335 | Ga0068864_100013432 | 3300005618 | Bacteria | 6789 |
| 336 | Ga0068864_100013484 | 3300005618 | Bacteria | 6776 |
| 337 | Ga0068864_100027347 | 3300005618 | Unclassified | 4817 |
| 338 | Ga0068864_100054025 | 3300005618 | Bacteria | 3466 |
| 339 | Ga0068864_100069208 | 3300005618 | Bacteria | 3069 |
| 340 | Ga0068864_100238938 | 3300005618 | Bacteria | 1683 |
| 341 | Ga0068864_100314510 | 3300005618 | Bacteria | 1469 |
| 342 | Ga0068864_100366340 | 3300005618 | Bacteria | 1363 |
| 343 | Ga0068864_100776172 | 3300005618 | Archaea | 940 |
| 344 | Ga0068866_10096240 | 3300005718 | Unclassified | 1623 |
| 345 | Ga0068861_100001185 | 3300005719 | Bacteria | 16225 |
| 346 | Ga0068861_100008374 | 3300005719 | Bacteria | 7116 |
| 347 | Ga0068861_100051497 | 3300005719 | Bacteria | 3126 |
| 348 | Ga0068861_100075287 | 3300005719 | Unclassified | 2627 |
| 349 | Ga0068861_100098338 | 3300005719 | Bacteria | 2323 |
| 350 | Ga0068861_100288461 | 3300005719 | Unclassified | 1416 |
| 351 | Ga0068861_100349298 | 3300005719 | Bacteria | 1297 |
| 352 | Ga0068851_10002188 | 3300005834 | Bacteria | 8599 |
| 353 | Ga0068851_10005121 | 3300005834 | Bacteria | 5944 |
| 354 | Ga0068851_10016172 | 3300005834 | Bacteria | 3566 |
| 355 | Ga0068851_10042656 | 3300005834 | Unclassified | 2284 |
| 356 | Ga0068851_10144268 | 3300005834 | Bacteria | 1297 |
| 357 | Ga0068851_10210458 | 3300005834 | Bacteria | 1089 |
| 358 | Ga0068870_10001106 | 3300005840 | Bacteria | 10727 |
| 359 | Ga0068870_10006234 | 3300005840 | Bacteria | 5246 |
| 360 | Ga0068870_10018178 | 3300005840 | Bacteria | 3390 |
| 361 | Ga0068870_10024092 | 3300005840 | Bacteria | 3010 |
| 362 | Ga0068870_10134997 | 3300005840 | Bacteria | 1437 |
| 363 | Ga0068870_10254068 | 3300005840 | Bacteria | 1091 |
| 364 | Ga0068863_100025558 | 3300005841 | Bacteria | 5630 |
| 365 | Ga0068863_100032342 | 3300005841 | Bacteria | 4986 |
| 366 | Ga0068858_100009740 | 3300005842 | Bacteria | 9152 |
| 367 | Ga0068858_100010516 | 3300005842 | Bacteria | 8763 |
| 368 | Ga0068858_100085192 | 3300005842 | Bacteria | 2940 |
| 369 | Ga0068858_100560235 | 3300005842 | Bacteria | 1107 |
| 370 | Ga0068860_100043329 | 3300005843 | Unclassified | 4294 |
| 371 | Ga0068860_100106048 | 3300005843 | Unclassified | 2684 |
| 372 | Ga0068860_100122410 | 3300005843 | Bacteria | 2492 |
| 373 | Ga0068860_100432137 | 3300005843 | Bacteria | 1307 |
| 374 | Ga0068862_100045271 | 3300005844 | Bacteria | 3754 |
| 375 | Ga0068862_100093709 | 3300005844 | Bacteria | 2619 |
| 376 | Ga0068862_100113818 | 3300005844 | Bacteria | 2377 |
| 377 | Ga0068862_100477121 | 3300005844 | Bacteria | 1180 |
| 378 | Ga0081455_10001901 | 3300005937 | Bacteria | 25135 |
| 379 | Ga0081455_10006052 | 3300005937 | Bacteria | 13088 |
| 380 | Ga0081455_10141741 | 3300005937 | Bacteria | 1866 |
| 381 | Ga0081455_10183882 | 3300005937 | Bacteria | 1580 |
| 382 | Ga0081540_1000499 | 3300005983 | Bacteria | 38575 |
| 383 | Ga0081539_10002686 | 3300005985 | Bacteria | 24187 |
| 384 | Ga0070717_10013106 | 3300006028 | Bacteria | 6337 |
| 385 | Ga0070717_10029645 | 3300006028 | Unclassified | 4392 |
| 386 | Ga0070717_10040442 | 3300006028 | Bacteria | 3797 |
| 387 | Ga0070717_10061612 | 3300006028 | Bacteria | 3109 |
| 388 | Ga0070717_10118052 | 3300006028 | Bacteria | 2269 |
| 389 | Ga0070717_10137318 | 3300006028 | Bacteria | 2107 |
| 390 | Ga0070717_10207298 | 3300006028 | Bacteria | 1719 |
| 391 | Ga0070717_10333040 | 3300006028 | Unclassified | 1354 |
| 392 | Ga0075432_10013971 | 3300006058 | Bacteria | 2733 |
| 393 | Ga0075432_10024263 | 3300006058 | Unclassified | 2078 |
| 394 | Ga0075432_10112316 | 3300006058 | Unclassified | 1016 |
| 395 | Ga0070715_10171457 | 3300006163 | Bacteria | 1081 |
| 396 | Ga0070715_10172583 | 3300006163 | Bacteria | 1078 |
| 397 | Ga0070716_100006100 | 3300006173 | Bacteria | 5876 |
| 398 | Ga0070716_100201999 | 3300006173 | Bacteria | 1322 |
| 399 | Ga0070716_100221858 | 3300006173 | Unclassified | 1271 |
| 400 | Ga0070712_100002098 | 3300006175 | Bacteria | 12245 |
| 401 | Ga0070712_100009698 | 3300006175 | Bacteria | 6068 |
| 402 | Ga0070712_100111890 | 3300006175 | Bacteria | 2039 |
| 403 | Ga0070712_100353551 | 3300006175 | Bacteria | 1203 |
| 404 | Ga0097621_100010871 | 3300006237 | Bacteria | 6679 |
| 405 | Ga0097621_100041881 | 3300006237 | Bacteria | 3688 |
| 406 | Ga0097621_100063774 | 3300006237 | Bacteria | 3029 |
| 407 | Ga0097621_100205267 | 3300006237 | Bacteria | 1712 |
| 408 | Ga0097621_100220002 | 3300006237 | Bacteria | 1654 |
| 409 | Ga0068871_100000503 | 3300006358 | Bacteria | 26698 |
| 410 | Ga0068871_100337067 | 3300006358 | Bacteria | 1331 |
| 411 | Ga0068871_100720802 | 3300006358 | Bacteria | 915 |
| 412 | Ga0075428_100061616 | 3300006844 | Bacteria | 4108 |
| 413 | Ga0075428_100098505 | 3300006844 | Bacteria | 3187 |
| 414 | Ga0075428_100218493 | 3300006844 | Bacteria | 2058 |
| 415 | Ga0075428_100411589 | 3300006844 | Bacteria | 1449 |
| 416 | Ga0075431_100035033 | 3300006847 | Bacteria | 5171 |
| 417 | Ga0075431_100185807 | 3300006847 | Bacteria | 2131 |
| 418 | Ga0075431_100372254 | 3300006847 | Unclassified | 1433 |
| 419 | Ga0075431_100425991 | 3300006847 | Bacteria | 1326 |
| 420 | Ga0075433_10009011 | 3300006852 | Bacteria | 7969 |
| 421 | Ga0075433_10516784 | 3300006852 | Bacteria | 1051 |
| 422 | Ga0075429_100077019 | 3300006880 | Unclassified | 2905 |
| 423 | Ga0075429_100157047 | 3300006880 | Unclassified | 1992 |
| 424 | Ga0068865_100021426 | 3300006881 | Bacteria | 4202 |
| 425 | Ga0068865_100160437 | 3300006881 | Unclassified | 1715 |
| 426 | Ga0075436_100018394 | 3300006914 | Bacteria | 4784 |
| 427 | Ga0075436_100039010 | 3300006914 | Bacteria | 3277 |
| 428 | Ga0075436_100041079 | 3300006914 | Bacteria | 3191 |
| 429 | Ga0075436_100056795 | 3300006914 | Bacteria | 2703 |
| 430 | Ga0075436_100061857 | 3300006914 | Bacteria | 2587 |
| 431 | Ga0075436_100080953 | 3300006914 | Bacteria | 2251 |
| 432 | Ga0075436_100096775 | 3300006914 | Bacteria | 2053 |
| 433 | Ga0075436_100124483 | 3300006914 | Bacteria | 1806 |
| 434 | Ga0097620_100010506 | 3300006931 | Bacteria | 9316 |
| 435 | Ga0097620_100025291 | 3300006931 | Bacteria | 5955 |
| 436 | Ga0097620_100093630 | 3300006931 | Bacteria | 3056 |
| 437 | Ga0097620_100119061 | 3300006931 | Bacteria | 2707 |
| 438 | Ga0097620_100120160 | 3300006931 | Bacteria | 2694 |
| 439 | Ga0097620_100218865 | 3300006931 | Bacteria | 1992 |
| 440 | Ga0097620_100260924 | 3300006931 | Unclassified | 1824 |
| 441 | Ga0097620_100292945 | 3300006931 | Unclassified | 1720 |
| 442 | Ga0097620_100383410 | 3300006931 | Unclassified | 1501 |
| 443 | Ga0097620_100562806 | 3300006931 | Bacteria | 1234 |
| 444 | Ga0097620_100839097 | 3300006931 | Bacteria | 1005 |
| 445 | Ga0075435_100047027 | 3300007076 | Unclassified | 3463 |
| 446 | Ga0075435_100113345 | 3300007076 | Bacteria | 2256 |
| 447 | Ga0075435_100138981 | 3300007076 | Bacteria | 2037 |
| 448 | Ga0105251_10118073 | 3300009011 | Bacteria | 1205 |
| 449 | Ga0105240_10013856 | 3300009093 | Bacteria | 11041 |
| 450 | Ga0105240_10023373 | 3300009093 | Bacteria | 8176 |
| 451 | Ga0105240_10064011 | 3300009093 | Unclassified | 4571 |
| 452 | Ga0105240_10082932 | 3300009093 | Bacteria | 3936 |
| 453 | Ga0105240_10216004 | 3300009093 | Bacteria | 2237 |
| 454 | Ga0111539_10000064 | 3300009094 | Bacteria | 106969 |
| 455 | Ga0111539_10087725 | 3300009094 | Bacteria | 3655 |
| 456 | Ga0111539_10105113 | 3300009094 | Unclassified | 3312 |
| 457 | Ga0111539_10109990 | 3300009094 | Bacteria | 3234 |
| 458 | Ga0111539_10193567 | 3300009094 | Bacteria | 2372 |
| 459 | Ga0111539_10251428 | 3300009094 | Unclassified | 2058 |
| 460 | Ga0111539_10499752 | 3300009094 | Bacteria | 1416 |
| 461 | Ga0111539_10573670 | 3300009094 | Bacteria | 1314 |
| 462 | Ga0111539_10785322 | 3300009094 | Bacteria | 1108 |
| 463 | Ga0105245_10010595 | 3300009098 | Bacteria | 8021 |
| 464 | Ga0105245_10020855 | 3300009098 | Bacteria | 5745 |
| 465 | Ga0105245_10036803 | 3300009098 | Bacteria | 4349 |
| 466 | Ga0105245_10150274 | 3300009098 | Unclassified | 2201 |
| 467 | Ga0105245_10232560 | 3300009098 | Bacteria | 1783 |
| 468 | Ga0105245_10373585 | 3300009098 | Bacteria | 1418 |
| 469 | Ga0105245_10391207 | 3300009098 | Bacteria | 1387 |
| 470 | Ga0105247_10311170 | 3300009101 | Bacteria | 1096 |
| 471 | Ga0105247_10533706 | 3300009101 | Bacteria | 860 |
| 472 | Ga0114129_10001880 | 3300009147 | Bacteria | 28626 |
| 473 | Ga0114129_10017058 | 3300009147 | Bacteria | 10338 |
| 474 | Ga0114129_10075791 | 3300009147 | Unclassified | 4683 |
| 475 | Ga0114129_10112210 | 3300009147 | Bacteria | 3760 |
| 476 | Ga0114129_10128554 | 3300009147 | Bacteria | 3482 |
| 477 | Ga0114129_10155526 | 3300009147 | Bacteria | 3127 |
| 478 | Ga0114129_10358897 | 3300009147 | Unclassified | 1929 |
| 479 | Ga0114129_10481199 | 3300009147 | Unclassified | 1624 |
| 480 | Ga0114129_10522370 | 3300009147 | Bacteria | 1547 |
| 481 | Ga0114129_10574998 | 3300009147 | Bacteria | 1463 |
| 482 | Ga0105243_10014576 | 3300009148 | Bacteria | 5947 |
| 483 | Ga0105243_10236995 | 3300009148 | Bacteria | 1622 |
| 484 | Ga0105243_10272518 | 3300009148 | Bacteria | 1520 |
| 485 | Ga0105243_10551563 | 3300009148 | Unclassified | 1101 |
| 486 | Ga0105241_10004349 | 3300009174 | Bacteria | 10473 |
| 487 | Ga0105241_10051464 | 3300009174 | Bacteria | 3141 |
| 488 | Ga0105241_10054458 | 3300009174 | Bacteria | 3062 |
| 489 | Ga0105241_10199737 | 3300009174 | Bacteria | 1669 |
| 490 | Ga0105242_10025734 | 3300009176 | Bacteria | 4659 |
| 491 | Ga0105242_10037405 | 3300009176 | Bacteria | 3898 |
| 492 | Ga0105242_10074548 | 3300009176 | Bacteria | 2824 |
| 493 | Ga0105242_10570486 | 3300009176 | Bacteria | 1088 |
| 494 | Ga0105248_10012169 | 3300009177 | Bacteria | 9490 |
| 495 | Ga0105248_10015081 | 3300009177 | Bacteria | 8510 |
| 496 | Ga0105248_10017339 | 3300009177 | Bacteria | 7936 |
| 497 | Ga0105248_10039915 | 3300009177 | Bacteria | 5262 |
| 498 | Ga0105248_10090666 | 3300009177 | Bacteria | 3442 |
| 499 | Ga0105248_10190483 | 3300009177 | Bacteria | 2311 |
| 500 | Ga0105248_10209939 | 3300009177 | Bacteria | 2194 |
| 501 | Ga0105248_10251477 | 3300009177 | Unclassified | 1989 |
| 502 | Ga0105248_10324944 | 3300009177 | Bacteria | 1733 |
| 503 | Ga0105248_10385056 | 3300009177 | Bacteria | 1579 |
| 504 | Ga0105237_10162851 | 3300009545 | Bacteria | 2229 |
| 505 | Ga0105237_10284011 | 3300009545 | Unclassified | 1658 |
| 506 | Ga0105238_10004461 | 3300009551 | Bacteria | 13874 |
| 507 | Ga0105238_10034540 | 3300009551 | Bacteria | 5144 |
| 508 | Ga0105238_10100715 | 3300009551 | Bacteria | 2872 |
| 509 | Ga0105238_10159977 | 3300009551 | Bacteria | 2227 |
| 510 | Ga0105238_10206992 | 3300009551 | Unclassified | 1938 |
| 511 | Ga0105238_10349827 | 3300009551 | Bacteria | 1467 |
| 512 | Ga0105238_10518029 | 3300009551 | Bacteria | 1195 |
| 513 | Ga0105238_10732782 | 3300009551 | Bacteria | 1002 |
| 514 | Ga0105238_10845560 | 3300009551 | Bacteria | 932 |
| 515 | Ga0105249_10066462 | 3300009553 | Bacteria | 3320 |
| 516 | Ga0105249_10257660 | 3300009553 | Bacteria | 1732 |
| 517 | Ga0105249_10546180 | 3300009553 | Unclassified | 1209 |
| 518 | Ga0105249_10552456 | 3300009553 | Bacteria | 1202 |
| 519 | Ga0105239_10065721 | 3300010375 | Bacteria | 3984 |
| 520 | Ga0105239_10149643 | 3300010375 | Bacteria | 2605 |
| 521 | Ga0105239_10276220 | 3300010375 | Unclassified | 1890 |
| 522 | Ga0105239_10319235 | 3300010375 | Bacteria | 1751 |
| 523 | Ga0105239_10387234 | 3300010375 | Bacteria | 1581 |
| 524 | Ga0105239_10396290 | 3300010375 | Bacteria | 1562 |
| 525 | Ga0105239_10640255 | 3300010375 | Unclassified | 1214 |
| 526 | Ga0105239_10670263 | 3300010375 | Bacteria | 1185 |
| 527 | Ga0105246_10085614 | 3300011119 | Bacteria | 2257 |
| 528 | Ga0105246_10123792 | 3300011119 | Bacteria | 1920 |
| 529 | Ga0105246_10211656 | 3300011119 | Bacteria | 1514 |
| 530 | Ga0105246_10285190 | 3300011119 | Unclassified | 1327 |
| 531 | Ga0105246_10297590 | 3300011119 | Bacteria | 1301 |
| 532 | Ga0157373_10004676 | 3300013100 | Bacteria | 10292 |
| 533 | Ga0157373_10048687 | 3300013100 | Bacteria | 3022 |
| 534 | Ga0157373_10084418 | 3300013100 | Unclassified | 2239 |
| 535 | Ga0157373_10101315 | 3300013100 | Unclassified | 2026 |
| 536 | Ga0157373_10112835 | 3300013100 | Bacteria | 1910 |
| 537 | Ga0157373_10239014 | 3300013100 | Bacteria | 1284 |
| 538 | Ga0157371_10000194 | 3300013102 | Bacteria | 90011 |
| 539 | Ga0157371_10007173 | 3300013102 | Bacteria | 9055 |
| 540 | Ga0157371_10022374 | 3300013102 | Bacteria | 4634 |
| 541 | Ga0157371_10199607 | 3300013102 | Unclassified | 1434 |
| 542 | Ga0157371_10390261 | 3300013102 | Bacteria | 1017 |
| 543 | Ga0157370_10035098 | 3300013104 | Bacteria | 4878 |
| 544 | Ga0157370_10328290 | 3300013104 | Unclassified | 1411 |
| 545 | Ga0157370_10423534 | 3300013104 | Bacteria | 1225 |
| 546 | Ga0157369_10045171 | 3300013105 | Bacteria | 4793 |
| 547 | Ga0157369_10052573 | 3300013105 | Bacteria | 4407 |
| 548 | Ga0157369_10053167 | 3300013105 | Bacteria | 4378 |
| 549 | Ga0157369_10123392 | 3300013105 | Bacteria | 2748 |
| 550 | Ga0157369_10225131 | 3300013105 | Bacteria | 1962 |
| 551 | Ga0157369_10229383 | 3300013105 | Bacteria | 1942 |
| 552 | Ga0157369_10431840 | 3300013105 | Unclassified | 1365 |
| 553 | Ga0157369_10519487 | 3300013105 | Bacteria | 1232 |
| 554 | Ga0157374_10004523 | 3300013296 | Bacteria | 11678 |
| 555 | Ga0157374_10014228 | 3300013296 | Bacteria | 6959 |
| 556 | Ga0157374_10065424 | 3300013296 | Bacteria | 3414 |
| 557 | Ga0157374_10442221 | 3300013296 | Unclassified | 1301 |
| 558 | Ga0157378_10000096 | 3300013297 | Bacteria | 83922 |
| 559 | Ga0157378_10016168 | 3300013297 | Bacteria | 6534 |
| 560 | Ga0157378_10016974 | 3300013297 | Bacteria | 6383 |
| 561 | Ga0157378_10019706 | 3300013297 | Bacteria | 5931 |
| 562 | Ga0157378_10022660 | 3300013297 | Bacteria | 5528 |
| 563 | Ga0157378_10084570 | 3300013297 | Bacteria | 2873 |
| 564 | Ga0157378_10114668 | 3300013297 | Bacteria | 2475 |
| 565 | Ga0157378_10192438 | 3300013297 | Bacteria | 1925 |
| 566 | Ga0163162_10059603 | 3300013306 | Unclassified | 3849 |
| 567 | Ga0163162_10155929 | 3300013306 | Bacteria | 2403 |
| 568 | Ga0163162_10160601 | 3300013306 | Unclassified | 2369 |
| 569 | Ga0163162_10360207 | 3300013306 | Unclassified | 1587 |
| 570 | Ga0163162_10477105 | 3300013306 | Bacteria | 1378 |
| 571 | Ga0163162_10962083 | 3300013306 | Unclassified | 964 |
| 572 | Ga0157372_10001272 | 3300013307 | Bacteria | 27282 |
| 573 | Ga0157372_10009986 | 3300013307 | Bacteria | 10098 |
| 574 | Ga0157372_10019275 | 3300013307 | Bacteria | 7346 |
| 575 | Ga0157372_10028514 | 3300013307 | Bacteria | 6093 |
| 576 | Ga0157372_10068101 | 3300013307 | Bacteria | 4002 |
| 577 | Ga0157372_10114423 | 3300013307 | Bacteria | 3092 |
| 578 | Ga0157372_10125338 | 3300013307 | Bacteria | 2953 |
| 579 | Ga0157372_10315415 | 3300013307 | Bacteria | 1820 |
| 580 | Ga0157372_10322663 | 3300013307 | Bacteria | 1798 |
| 581 | Ga0157372_10822693 | 3300013307 | Bacteria | 1079 |
| 582 | Ga0157375_10042774 | 3300013308 | Bacteria | 4388 |
| 583 | Ga0157375_10051146 | 3300013308 | Bacteria | 4056 |
| 584 | Ga0157375_10073165 | 3300013308 | Bacteria | 3446 |
| 585 | Ga0157375_10111831 | 3300013308 | Bacteria | 2831 |
| 586 | Ga0157375_10114372 | 3300013308 | Bacteria | 2800 |
| 587 | Ga0157375_10169154 | 3300013308 | Bacteria | 2332 |
| 588 | Ga0157375_10177250 | 3300013308 | Bacteria | 2282 |
| 589 | Ga0157375_10194534 | 3300013308 | Bacteria | 2183 |
| 590 | Ga0157375_10217965 | 3300013308 | Bacteria | 2066 |
| 591 | Ga0157375_10257326 | 3300013308 | Bacteria | 1907 |
| 592 | Ga0157375_10541603 | 3300013308 | Bacteria | 1326 |
| 593 | Ga0157375_10771302 | 3300013308 | Bacteria | 1112 |
| 594 | Ga0163163_10008169 | 3300014325 | Bacteria | 9282 |
| 595 | Ga0163163_10013554 | 3300014325 | Bacteria | 7467 |
| 596 | Ga0163163_10067373 | 3300014325 | Bacteria | 3559 |
| 597 | Ga0163163_10071464 | 3300014325 | Unclassified | 3458 |
| 598 | Ga0163163_10093890 | 3300014325 | Unclassified | 3017 |
| 599 | Ga0163163_10140102 | 3300014325 | Unclassified | 2461 |
| 600 | Ga0163163_10206871 | 3300014325 | Bacteria | 2011 |
| 601 | Ga0163163_10212223 | 3300014325 | Bacteria | 1985 |
| 602 | Ga0163163_10229777 | 3300014325 | Bacteria | 1904 |
| 603 | Ga0163163_10298226 | 3300014325 | Bacteria | 1664 |
| 604 | Ga0163163_10323661 | 3300014325 | Bacteria | 1595 |
| 605 | Ga0163163_10406279 | 3300014325 | Unclassified | 1420 |
| 606 | Ga0157380_10008632 | 3300014326 | Bacteria | 7283 |
| 607 | Ga0157380_10049281 | 3300014326 | Bacteria | 3321 |
| 608 | Ga0157380_10079554 | 3300014326 | Bacteria | 2677 |
| 609 | Ga0157380_10121576 | 3300014326 | Bacteria | 2212 |
| 610 | Ga0157380_10169000 | 3300014326 | Unclassified | 1908 |
| 611 | Ga0157380_10198969 | 3300014326 | Bacteria | 1776 |
| 612 | Ga0157380_10291691 | 3300014326 | Bacteria | 1498 |
| 613 | Ga0157380_10387488 | 3300014326 | Bacteria | 1321 |
| 614 | Ga0157377_10007616 | 3300014745 | Bacteria | 5240 |
| 615 | Ga0157379_10039304 | 3300014968 | Bacteria | 4221 |
| 616 | Ga0157379_10092681 | 3300014968 | Bacteria | 2710 |
| 617 | Ga0157376_10001459 | 3300014969 | Bacteria | 15573 |
| 618 | Ga0157376_10010041 | 3300014969 | Bacteria | 6910 |
| 619 | Ga0157376_10047502 | 3300014969 | Bacteria | 3544 |
| 620 | Ga0157376_10094566 | 3300014969 | Bacteria | 2597 |
| 621 | Ga0157376_10188986 | 3300014969 | Bacteria | 1888 |
| 622 | Ga0157376_10401165 | 3300014969 | Bacteria | 1326 |
| 623 | Ga0182007_10060079 | 3300015262 | Unclassified | 1246 |
| 624 | Ga0182005_1055489 | 3300015265 | Unclassified | 1080 |
| 625 | Ga0163161_10107775 | 3300017792 | Unclassified | 2080 |
| 626 | Ga0163161_10118357 | 3300017792 | Bacteria | 1988 |
| 627 | Ga0206352_11224960 | 3300020078 | Bacteria | 1918 |
| 628 | Ga0206354_10113735 | 3300020081 | Bacteria | 2618 |
| 629 | Ga0206353_11903863 | 3300020082 | Unclassified | 2244 |
| 630 | Ga0213872_10003146 | 3300021361 | Bacteria | 9268 |
| 631 | Ga0213872_10006882 | 3300021361 | Bacteria | 5659 |
| 632 | Ga0213874_10001575 | 3300021377 | Bacteria | 4766 |
| 633 | Ga0213876_10009276 | 3300021384 | Bacteria | 5300 |
| 634 | Ga0213876_10014758 | 3300021384 | Bacteria | 4140 |
| 635 | Ga0213876_10021751 | 3300021384 | Unclassified | 3392 |
| 636 | Ga0213876_10042629 | 3300021384 | Bacteria | 2398 |
| 637 | Ga0213875_10003698 | 3300021388 | Bacteria | 8625 |
| 638 | Ga0213871_10020999 | 3300021441 | Bacteria | 1624 |
| 639 | Ga0224712_10000571 | 3300022467 | Bacteria | 7489 |
| 640 | Ga0224712_10019352 | 3300022467 | Bacteria | 2294 |
| 641 | Ga0207666_1006966 | 3300025271 | Bacteria | 1478 |
| 642 | Ga0207697_10011126 | 3300025315 | Bacteria | 3814 |
| 643 | Ga0207697_10027077 | 3300025315 | Bacteria | 2344 |
| 644 | Ga0207656_10000669 | 3300025321 | Bacteria | 11222 |
| 645 | Ga0207656_10172577 | 3300025321 | Bacteria | 1034 |
| 646 | Ga0207653_10000681 | 3300025885 | Bacteria | 11658 |
| 647 | Ga0207653_10021398 | 3300025885 | Bacteria | 2051 |
| 648 | Ga0207653_10080051 | 3300025885 | Unclassified | 1130 |
| 649 | Ga0207682_10000951 | 3300025893 | Bacteria | 13438 |
| 650 | Ga0207692_10165265 | 3300025898 | Bacteria | 1278 |
| 651 | Ga0207692_10206572 | 3300025898 | Unclassified | 1157 |
| 652 | Ga0207642_10009353 | 3300025899 | Bacteria | 3405 |
| 653 | Ga0207642_10146300 | 3300025899 | Unclassified | 1252 |
| 654 | Ga0207710_10160670 | 3300025900 | Unclassified | 1094 |
| 655 | Ga0207688_10002506 | 3300025901 | Bacteria | 9897 |
| 656 | Ga0207688_10003208 | 3300025901 | Bacteria | 8931 |
| 657 | Ga0207688_10010851 | 3300025901 | Bacteria | 4956 |
| 658 | Ga0207680_10141475 | 3300025903 | Bacteria | 1595 |
| 659 | Ga0207680_10223271 | 3300025903 | Bacteria | 1292 |
| 660 | Ga0207680_10305813 | 3300025903 | Unclassified | 1109 |
| 661 | Ga0207647_10094678 | 3300025904 | Bacteria | 1779 |
| 662 | Ga0207699_10333113 | 3300025906 | Unclassified | 1067 |
| 663 | Ga0207699_10449587 | 3300025906 | Bacteria | 924 |
| 664 | Ga0207645_10002561 | 3300025907 | Bacteria | 14210 |
| 665 | Ga0207645_10054141 | 3300025907 | Bacteria | 2563 |
| 666 | Ga0207645_10071901 | 3300025907 | Bacteria | 2214 |
| 667 | Ga0207643_10004055 | 3300025908 | Bacteria | 7880 |
| 668 | Ga0207643_10017572 | 3300025908 | Bacteria | 3912 |
| 669 | Ga0207643_10062639 | 3300025908 | Bacteria | 2125 |
| 670 | Ga0207705_10007592 | 3300025909 | Bacteria | 7971 |
| 671 | Ga0207705_10009381 | 3300025909 | Bacteria | 7116 |
| 672 | Ga0207705_10037871 | 3300025909 | Bacteria | 3451 |
| 673 | Ga0207705_10316038 | 3300025909 | Unclassified | 1200 |
| 674 | Ga0207684_10008782 | 3300025910 | Bacteria | 8971 |
| 675 | Ga0207684_10014738 | 3300025910 | Bacteria | 6732 |
| 676 | Ga0207684_10020971 | 3300025910 | Bacteria | 5581 |
| 677 | Ga0207684_10185181 | 3300025910 | Bacteria | 1795 |
| 678 | Ga0207684_10293830 | 3300025910 | Unclassified | 1401 |
| 679 | Ga0207684_10383681 | 3300025910 | Bacteria | 1208 |
| 680 | Ga0207684_10426998 | 3300025910 | Unclassified | 1138 |
| 681 | Ga0207684_10431684 | 3300025910 | Unclassified | 1132 |
| 682 | Ga0207654_10084207 | 3300025911 | Unclassified | 1922 |
| 683 | Ga0207654_10154384 | 3300025911 | Bacteria | 1477 |
| 684 | Ga0207654_10244332 | 3300025911 | Unclassified | 1201 |
| 685 | Ga0207707_10000024 | 3300025912 | Bacteria | 183501 |
| 686 | Ga0207707_10007680 | 3300025912 | Bacteria | 9394 |
| 687 | Ga0207707_10172286 | 3300025912 | Bacteria | 1891 |
| 688 | Ga0207707_10389918 | 3300025912 | Unclassified | 1197 |
| 689 | Ga0207695_10112408 | 3300025913 | Bacteria | 2701 |
| 690 | Ga0207695_10114157 | 3300025913 | Bacteria | 2677 |
| 691 | Ga0207695_10120895 | 3300025913 | Bacteria | 2587 |
| 692 | Ga0207671_10044166 | 3300025914 | Bacteria | 3295 |
| 693 | Ga0207671_10166602 | 3300025914 | Unclassified | 1709 |
| 694 | Ga0207693_10020388 | 3300025915 | Bacteria | 5274 |
| 695 | Ga0207693_10080439 | 3300025915 | Bacteria | 2551 |
| 696 | Ga0207693_10162870 | 3300025915 | Bacteria | 1755 |
| 697 | Ga0207693_10205575 | 3300025915 | Bacteria | 1548 |
| 698 | Ga0207693_10318137 | 3300025915 | Bacteria | 1218 |
| 699 | Ga0207693_10352847 | 3300025915 | Bacteria | 1151 |
| 700 | Ga0207663_10010896 | 3300025916 | Bacteria | 4857 |
| 701 | Ga0207660_10007323 | 3300025917 | Bacteria | 7141 |
| 702 | Ga0207660_10061398 | 3300025917 | Bacteria | 2705 |
| 703 | Ga0207660_10208374 | 3300025917 | Bacteria | 1530 |
| 704 | Ga0207660_10361734 | 3300025917 | Unclassified | 1164 |
| 705 | Ga0207660_10389267 | 3300025917 | Unclassified | 1121 |
| 706 | Ga0207662_10031058 | 3300025918 | Bacteria | 3103 |
| 707 | Ga0207657_10000191 | 3300025919 | Bacteria | 63991 |
| 708 | Ga0207657_10000803 | 3300025919 | Bacteria | 33281 |
| 709 | Ga0207657_10012467 | 3300025919 | Bacteria | 8391 |
| 710 | Ga0207657_10018905 | 3300025919 | Bacteria | 6559 |
| 711 | Ga0207657_10024271 | 3300025919 | Bacteria | 5622 |
| 712 | Ga0207657_10043567 | 3300025919 | Bacteria | 3951 |
| 713 | Ga0207657_10088183 | 3300025919 | Bacteria | 2594 |
| 714 | Ga0207657_10328667 | 3300025919 | Bacteria | 1208 |
| 715 | Ga0207649_10027777 | 3300025920 | Bacteria | 3325 |
| 716 | Ga0207649_10064981 | 3300025920 | Bacteria | 2309 |
| 717 | Ga0207649_10182667 | 3300025920 | Bacteria | 1469 |
| 718 | Ga0207649_10257153 | 3300025920 | Unclassified | 1260 |
| 719 | Ga0207649_10385887 | 3300025920 | Unclassified | 1045 |
| 720 | Ga0207649_10491336 | 3300025920 | Bacteria | 932 |
| 721 | Ga0207652_10001822 | 3300025921 | Bacteria | 18473 |
| 722 | Ga0207652_10107768 | 3300025921 | Unclassified | 2468 |
| 723 | Ga0207652_10189236 | 3300025921 | Bacteria | 1851 |
| 724 | Ga0207652_10240146 | 3300025921 | Bacteria | 1633 |
| 725 | Ga0207652_10291978 | 3300025921 | Bacteria | 1471 |
| 726 | Ga0207646_10009261 | 3300025922 | Bacteria | 9750 |
| 727 | Ga0207646_10009438 | 3300025922 | Bacteria | 9645 |
| 728 | Ga0207646_10028389 | 3300025922 | Bacteria | 5094 |
| 729 | Ga0207646_10030548 | 3300025922 | Bacteria | 4882 |
| 730 | Ga0207646_10052096 | 3300025922 | Unclassified | 3662 |
| 731 | Ga0207646_10076645 | 3300025922 | Bacteria | 2988 |
| 732 | Ga0207646_10245995 | 3300025922 | Unclassified | 1615 |
| 733 | Ga0207646_10253573 | 3300025922 | Bacteria | 1590 |
| 734 | Ga0207646_10256642 | 3300025922 | Unclassified | 1580 |
| 735 | Ga0207681_10136932 | 3300025923 | Unclassified | 1818 |
| 736 | Ga0207681_10165680 | 3300025923 | Unclassified | 1670 |
| 737 | Ga0207681_10347823 | 3300025923 | Bacteria | 1186 |
| 738 | Ga0207694_10108310 | 3300025924 | Unclassified | 2208 |
| 739 | Ga0207694_10230572 | 3300025924 | Unclassified | 1512 |
| 740 | Ga0207694_10602688 | 3300025924 | Bacteria | 924 |
| 741 | Ga0207650_10012392 | 3300025925 | Bacteria | 5886 |
| 742 | Ga0207650_10013106 | 3300025925 | Bacteria | 5735 |
| 743 | Ga0207650_10059914 | 3300025925 | Bacteria | 2839 |
| 744 | Ga0207650_10085709 | 3300025925 | Bacteria | 2397 |
| 745 | Ga0207650_10165861 | 3300025925 | Bacteria | 1753 |
| 746 | Ga0207650_10222563 | 3300025925 | Unclassified | 1519 |
| 747 | Ga0207650_10256947 | 3300025925 | Bacteria | 1416 |
| 748 | Ga0207659_10005593 | 3300025926 | Bacteria | 7631 |
| 749 | Ga0207659_10021384 | 3300025926 | Bacteria | 4293 |
| 750 | Ga0207659_10118097 | 3300025926 | Unclassified | 2028 |
| 751 | Ga0207659_10121055 | 3300025926 | Bacteria | 2006 |
| 752 | Ga0207687_10069604 | 3300025927 | Unclassified | 2510 |
| 753 | Ga0207687_10069930 | 3300025927 | Bacteria | 2505 |
| 754 | Ga0207687_10078773 | 3300025927 | Unclassified | 2373 |
| 755 | Ga0207687_10250474 | 3300025927 | Unclassified | 1408 |
| 756 | Ga0207687_10269532 | 3300025927 | Bacteria | 1360 |
| 757 | Ga0207687_10418557 | 3300025927 | Unclassified | 1105 |
| 758 | Ga0207700_10005462 | 3300025928 | Bacteria | 7614 |
| 759 | Ga0207700_10017762 | 3300025928 | Bacteria | 4759 |
| 760 | Ga0207700_10029744 | 3300025928 | Bacteria | 3859 |
| 761 | Ga0207700_10170441 | 3300025928 | Bacteria | 1816 |
| 762 | Ga0207664_10094512 | 3300025929 | Unclassified | 2457 |
| 763 | Ga0207664_10137071 | 3300025929 | Bacteria | 2066 |
| 764 | Ga0207664_10216400 | 3300025929 | Unclassified | 1660 |
| 765 | Ga0207664_10461285 | 3300025929 | Bacteria | 1135 |
| 766 | Ga0207644_10152814 | 3300025931 | Bacteria | 1788 |
| 767 | Ga0207644_10203583 | 3300025931 | Bacteria | 1562 |
| 768 | Ga0207644_10231024 | 3300025931 | Unclassified | 1470 |
| 769 | Ga0207690_10004965 | 3300025932 | Bacteria | 7853 |
| 770 | Ga0207690_10013002 | 3300025932 | Bacteria | 4992 |
| 771 | Ga0207690_10068233 | 3300025932 | Bacteria | 2442 |
| 772 | Ga0207690_10092202 | 3300025932 | Bacteria | 2143 |
| 773 | Ga0207690_10308460 | 3300025932 | Bacteria | 1240 |
| 774 | Ga0207690_10379832 | 3300025932 | Bacteria | 1122 |
| 775 | Ga0207690_10499436 | 3300025932 | Bacteria | 984 |
| 776 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 777 | Ga0207706_10006191 | 3300025933 | Bacteria | 11114 |
| 778 | Ga0207706_10011470 | 3300025933 | Bacteria | 8071 |
| 779 | Ga0207706_10074276 | 3300025933 | Bacteria | 2990 |
| 780 | Ga0207706_10288162 | 3300025933 | Unclassified | 1432 |
| 781 | Ga0207706_10458213 | 3300025933 | Bacteria | 1103 |
| 782 | Ga0207686_10019257 | 3300025934 | Bacteria | 3878 |
| 783 | Ga0207686_10612703 | 3300025934 | Unclassified | 858 |
| 784 | Ga0207709_10053901 | 3300025935 | Bacteria | 2477 |
| 785 | Ga0207709_10261787 | 3300025935 | Bacteria | 1269 |
| 786 | Ga0207709_10408573 | 3300025935 | Bacteria | 1040 |
| 787 | Ga0207670_10003005 | 3300025936 | Bacteria | 8901 |
| 788 | Ga0207670_10004638 | 3300025936 | Bacteria | 7446 |
| 789 | Ga0207669_10208666 | 3300025937 | Unclassified | 1424 |
| 790 | Ga0207669_10526474 | 3300025937 | Unclassified | 950 |
| 791 | Ga0207704_10018445 | 3300025938 | Bacteria | 3642 |
| 792 | Ga0207704_10099933 | 3300025938 | Viruses | 1931 |
| 793 | Ga0207704_10135165 | 3300025938 | Unclassified | 1715 |
| 794 | Ga0207704_10167238 | 3300025938 | Bacteria | 1572 |
| 795 | Ga0207665_10041860 | 3300025939 | Bacteria | 3061 |
| 796 | Ga0207665_10118883 | 3300025939 | Bacteria | 1865 |
| 797 | Ga0207665_10223344 | 3300025939 | Bacteria | 1381 |
| 798 | Ga0207665_10262673 | 3300025939 | Unclassified | 1279 |
| 799 | Ga0207665_10373071 | 3300025939 | Unclassified | 1081 |
| 800 | Ga0207665_10404587 | 3300025939 | Bacteria | 1040 |
| 801 | Ga0207691_10007193 | 3300025940 | Bacteria | 10739 |
| 802 | Ga0207691_10026689 | 3300025940 | Bacteria | 5419 |
| 803 | Ga0207691_10029163 | 3300025940 | Bacteria | 5162 |
| 804 | Ga0207691_10038581 | 3300025940 | Bacteria | 4420 |
| 805 | Ga0207691_10071392 | 3300025940 | Bacteria | 3133 |
| 806 | Ga0207691_10124943 | 3300025940 | Bacteria | 2277 |
| 807 | Ga0207691_10128099 | 3300025940 | Unclassified | 2244 |
| 808 | Ga0207691_10150643 | 3300025940 | Unclassified | 2045 |
| 809 | Ga0207691_10270057 | 3300025940 | Bacteria | 1464 |
| 810 | Ga0207691_10317422 | 3300025940 | Bacteria | 1336 |
| 811 | Ga0207691_10425562 | 3300025940 | Bacteria | 1131 |
| 812 | Ga0207691_10543652 | 3300025940 | Bacteria | 985 |
| 813 | Ga0207711_10010167 | 3300025941 | Bacteria | 7812 |
| 814 | Ga0207711_10015483 | 3300025941 | Bacteria | 6329 |
| 815 | Ga0207711_10044113 | 3300025941 | Unclassified | 3806 |
| 816 | Ga0207711_10119534 | 3300025941 | Unclassified | 2351 |
| 817 | Ga0207711_10215604 | 3300025941 | Bacteria | 1754 |
| 818 | Ga0207711_10275139 | 3300025941 | Bacteria | 1550 |
| 819 | Ga0207711_10398225 | 3300025941 | Bacteria | 1279 |
| 820 | Ga0207689_10005083 | 3300025942 | Bacteria | 11841 |
| 821 | Ga0207689_10077559 | 3300025942 | Bacteria | 2731 |
| 822 | Ga0207689_10087205 | 3300025942 | Bacteria | 2564 |
| 823 | Ga0207689_10112674 | 3300025942 | Bacteria | 2236 |
| 824 | Ga0207689_10542236 | 3300025942 | Bacteria | 977 |
| 825 | Ga0207661_10036657 | 3300025944 | Bacteria | 3830 |
| 826 | Ga0207661_10068496 | 3300025944 | Bacteria | 2890 |
| 827 | Ga0207661_10078014 | 3300025944 | Bacteria | 2725 |
| 828 | Ga0207661_10097050 | 3300025944 | Bacteria | 2467 |
| 829 | Ga0207661_10100043 | 3300025944 | Bacteria | 2433 |
| 830 | Ga0207661_10151586 | 3300025944 | Bacteria | 2004 |
| 831 | Ga0207661_10456623 | 3300025944 | Bacteria | 1164 |
| 832 | Ga0207679_10003822 | 3300025945 | Bacteria | 9332 |
| 833 | Ga0207679_10014208 | 3300025945 | Bacteria | 5230 |
| 834 | Ga0207679_10043237 | 3300025945 | Bacteria | 3243 |
| 835 | Ga0207679_10057148 | 3300025945 | Bacteria | 2884 |
| 836 | Ga0207679_10126304 | 3300025945 | Unclassified | 2044 |
| 837 | Ga0207679_10131726 | 3300025945 | Unclassified | 2007 |
| 838 | Ga0207679_10146487 | 3300025945 | Bacteria | 1916 |
| 839 | Ga0207679_10185965 | 3300025945 | Bacteria | 1723 |
| 840 | Ga0207679_10284444 | 3300025945 | Bacteria | 1419 |
| 841 | Ga0207679_10438611 | 3300025945 | Bacteria | 1156 |
| 842 | Ga0207667_10004418 | 3300025949 | Bacteria | 17209 |
| 843 | Ga0207667_10032823 | 3300025949 | Bacteria | 5589 |
| 844 | Ga0207667_10125393 | 3300025949 | Bacteria | 2645 |
| 845 | Ga0207667_10554825 | 3300025949 | Bacteria | 1162 |
| 846 | Ga0207651_10222915 | 3300025960 | Unclassified | 1525 |
| 847 | Ga0207651_10260811 | 3300025960 | Bacteria | 1423 |
| 848 | Ga0207651_10376249 | 3300025960 | Bacteria | 1202 |
| 849 | Ga0207651_10592555 | 3300025960 | Bacteria | 968 |
| 850 | Ga0207712_10104065 | 3300025961 | Unclassified | 2116 |
| 851 | Ga0207712_10365229 | 3300025961 | Unclassified | 1204 |
| 852 | Ga0207668_10015109 | 3300025972 | Unclassified | 4792 |
| 853 | Ga0207668_10028317 | 3300025972 | Unclassified | 3662 |
| 854 | Ga0207668_10413543 | 3300025972 | Bacteria | 1143 |
| 855 | Ga0207640_10003940 | 3300025981 | Bacteria | 8008 |
| 856 | Ga0207640_10077123 | 3300025981 | Bacteria | 2264 |
| 857 | Ga0207640_10096946 | 3300025981 | Bacteria | 2057 |
| 858 | Ga0207640_10107304 | 3300025981 | Bacteria | 1971 |
| 859 | Ga0207640_10130501 | 3300025981 | Bacteria | 1816 |
| 860 | Ga0207640_10205395 | 3300025981 | Unclassified | 1496 |
| 861 | Ga0207658_10003234 | 3300025986 | Bacteria | 11576 |
| 862 | Ga0207658_10012835 | 3300025986 | Bacteria | 5721 |
| 863 | Ga0207658_10021191 | 3300025986 | Bacteria | 4508 |
| 864 | Ga0207677_10124996 | 3300026023 | Bacteria | 1942 |
| 865 | Ga0207677_10300163 | 3300026023 | Unclassified | 1326 |
| 866 | Ga0207703_10006708 | 3300026035 | Bacteria | 9186 |
| 867 | Ga0207703_10012469 | 3300026035 | Bacteria | 6627 |
| 868 | Ga0207703_10041654 | 3300026035 | Bacteria | 3681 |
| 869 | Ga0207639_10073154 | 3300026041 | Bacteria | 2686 |
| 870 | Ga0207639_10082277 | 3300026041 | Bacteria | 2552 |
| 871 | Ga0207639_10379412 | 3300026041 | Bacteria | 1269 |
| 872 | Ga0207678_10001320 | 3300026067 | Bacteria | 22902 |
| 873 | Ga0207678_10003238 | 3300026067 | Bacteria | 14705 |
| 874 | Ga0207678_10032776 | 3300026067 | Bacteria | 4528 |
| 875 | Ga0207678_10048524 | 3300026067 | Bacteria | 3670 |
| 876 | Ga0207678_10050560 | 3300026067 | Bacteria | 3591 |
| 877 | Ga0207678_10099332 | 3300026067 | Bacteria | 2486 |
| 878 | Ga0207678_10104617 | 3300026067 | Bacteria | 2416 |
| 879 | Ga0207678_10150771 | 3300026067 | Bacteria | 1985 |
| 880 | Ga0207678_10266111 | 3300026067 | Bacteria | 1470 |
| 881 | Ga0207678_10358445 | 3300026067 | Unclassified | 1258 |
| 882 | Ga0207708_10000332 | 3300026075 | Bacteria | 37179 |
| 883 | Ga0207708_10016548 | 3300026075 | Bacteria | 5547 |
| 884 | Ga0207708_10022953 | 3300026075 | Bacteria | 4713 |
| 885 | Ga0207708_10074229 | 3300026075 | Bacteria | 2607 |
| 886 | Ga0207708_10224845 | 3300026075 | Bacteria | 1505 |
| 887 | Ga0207702_10005409 | 3300026078 | Bacteria | 11176 |
| 888 | Ga0207702_10027005 | 3300026078 | Bacteria | 4767 |
| 889 | Ga0207702_10222523 | 3300026078 | Unclassified | 1759 |
| 890 | Ga0207702_10227971 | 3300026078 | Bacteria | 1739 |
| 891 | Ga0207702_10433196 | 3300026078 | Bacteria | 1273 |
| 892 | Ga0207702_10462682 | 3300026078 | Bacteria | 1232 |
| 893 | Ga0207702_10674004 | 3300026078 | Unclassified | 1018 |
| 894 | Ga0207641_10045539 | 3300026088 | Bacteria | 3694 |
| 895 | Ga0207641_10078799 | 3300026088 | Bacteria | 2855 |
| 896 | Ga0207641_10208854 | 3300026088 | Bacteria | 1804 |
| 897 | Ga0207641_10259086 | 3300026088 | Bacteria | 1627 |
| 898 | Ga0207648_10067087 | 3300026089 | Bacteria | 3129 |
| 899 | Ga0207648_10203294 | 3300026089 | Bacteria | 1757 |
| 900 | Ga0207648_10365815 | 3300026089 | Bacteria | 1302 |
| 901 | Ga0207648_10840789 | 3300026089 | Unclassified | 856 |
| 902 | Ga0207676_10001360 | 3300026095 | Bacteria | 18186 |
| 903 | Ga0207676_10012318 | 3300026095 | Bacteria | 6124 |
| 904 | Ga0207676_10042208 | 3300026095 | Unclassified | 3507 |
| 905 | Ga0207676_10197728 | 3300026095 | Bacteria | 1774 |
| 906 | Ga0207676_10525322 | 3300026095 | Bacteria | 1127 |
| 907 | Ga0207674_10000448 | 3300026116 | Bacteria | 53696 |
| 908 | Ga0207674_10003819 | 3300026116 | Bacteria | 18359 |
| 909 | Ga0207674_10326795 | 3300026116 | Bacteria | 1483 |
| 910 | Ga0207675_100009102 | 3300026118 | Bacteria | 9318 |
| 911 | Ga0207675_100060836 | 3300026118 | Bacteria | 3526 |
| 912 | Ga0207675_100084655 | 3300026118 | Bacteria | 2975 |
| 913 | Ga0207675_100107813 | 3300026118 | Unclassified | 2627 |
| 914 | Ga0207675_100242167 | 3300026118 | Bacteria | 1743 |
| 915 | Ga0207675_100331889 | 3300026118 | Bacteria | 1487 |
| 916 | Ga0207675_100333430 | 3300026118 | Bacteria | 1483 |
| 917 | Ga0207675_100415353 | 3300026118 | Unclassified | 1328 |
| 918 | Ga0207675_100618792 | 3300026118 | Unclassified | 1087 |
| 919 | Ga0207683_10000149 | 3300026121 | Bacteria | 57867 |
| 920 | Ga0207683_10009678 | 3300026121 | Bacteria | 8216 |
| 921 | Ga0207683_10065683 | 3300026121 | Bacteria | 3199 |
| 922 | Ga0207683_10600696 | 3300026121 | Bacteria | 1018 |
| 923 | Ga0207698_10003598 | 3300026142 | Bacteria | 9356 |
| 924 | Ga0207698_10038132 | 3300026142 | Bacteria | 3548 |
| 925 | Ga0207698_10185303 | 3300026142 | Unclassified | 1848 |
| 926 | Ga0207698_10352826 | 3300026142 | Unclassified | 1390 |
| 927 | Ga0207698_10368580 | 3300026142 | Unclassified | 1362 |
| 928 | Ga0207698_10588917 | 3300026142 | Bacteria | 1095 |
| 929 | Ga0207698_10804740 | 3300026142 | Unclassified | 942 |
| 930 | Ga0209967_1008467 | 3300027364 | Bacteria | 1417 |
| 931 | Ga0209974_10012565 | 3300027876 | Bacteria | 2830 |
| 932 | Ga0209974_10027239 | 3300027876 | Bacteria | 1890 |
| 933 | Ga0207428_10000072 | 3300027907 | Bacteria | 143629 |
| 934 | Ga0207428_10002698 | 3300027907 | Bacteria | 17692 |
| 935 | Ga0207428_10020431 | 3300027907 | Bacteria | 5626 |
| 936 | Ga0207428_10065860 | 3300027907 | Unclassified | 2856 |
| 937 | Ga0207428_10085201 | 3300027907 | Bacteria | 2461 |
| 938 | Ga0268266_10029805 | 3300028379 | Bacteria | 4636 |
| 939 | Ga0268266_10044294 | 3300028379 | Bacteria | 3804 |
| 940 | Ga0268266_10324979 | 3300028379 | Bacteria | 1441 |
| 941 | Ga0268266_10586022 | 3300028379 | Bacteria | 1070 |
| 942 | Ga0268265_10110263 | 3300028380 | Bacteria | 2245 |
| 943 | Ga0268265_10377869 | 3300028380 | Unclassified | 1302 |
| 944 | Ga0268265_10472137 | 3300028380 | Bacteria | 1176 |
| 945 | Ga0268265_10496649 | 3300028380 | Bacteria | 1149 |
| 946 | Ga0268264_10050173 | 3300028381 | Bacteria | 3474 |
| 947 | Ga0265760_10081849 | 3300031090 | Unclassified | 1001 |
| 948 | Ga0265325_10094975 | 3300031241 | Unclassified | 1466 |
| 949 | Ga0265331_10002707 | 3300031250 | Bacteria | 11807 |
| 950 | Ga0307408_100033591 | 3300031548 | Bacteria | 3586 |
| 951 | Ga0307408_100054596 | 3300031548 | Bacteria | 2889 |
| 952 | Ga0307408_100076424 | 3300031548 | Bacteria | 2491 |
| 953 | Ga0307408_100470870 | 3300031548 | Unclassified | 1094 |
| 954 | Ga0265313_10005718 | 3300031595 | Bacteria | 9057 |
| 955 | Ga0307405_10011596 | 3300031731 | Bacteria | 4630 |
| 956 | Ga0307405_10043442 | 3300031731 | Bacteria | 2742 |
| 957 | Ga0307413_10012971 | 3300031824 | Bacteria | 4170 |
| 958 | Ga0307410_10013832 | 3300031852 | Bacteria | 4724 |
| 959 | Ga0307410_10072835 | 3300031852 | Bacteria | 2387 |
| 960 | Ga0307406_10006760 | 3300031901 | Bacteria | 6343 |
| 961 | Ga0307406_10056972 | 3300031901 | Bacteria | 2505 |
| 962 | Ga0307409_100025562 | 3300031995 | Bacteria | 4144 |
| 963 | Ga0307416_100031445 | 3300032002 | Bacteria | 3996 |
| 964 | Ga0307416_100120964 | 3300032002 | Bacteria | 2333 |
| 965 | Ga0307416_100239094 | 3300032002 | Bacteria | 1758 |
| 966 | Ga0307416_101179138 | 3300032002 | Bacteria | 871 |
| 967 | Ga0307414_10137439 | 3300032004 | Bacteria | 1908 |
| 968 | Ga0307411_10051894 | 3300032005 | Bacteria | 2678 |
| 969 | Ga0307415_100055138 | 3300032126 | Bacteria | 2718 |
| 970 | Ga0373959_0013323 | 3300034820 | Bacteria | 1481 |
| 971 | Ga0373940_0102513 | 3300035088 | Bacteria | 870 |
| 972 | Ga0373944_0018814 | 3300035089 | Unclassified | 1976 |
| 973 | Ga0373923_0019300 | 3300035111 | Bacteria | 2638 |
| 974 | Ga0373923_0032591 | 3300035111 | Unclassified | 2105 |
| 975 | Ga0373923_0039117 | 3300035111 | Bacteria | 1946 |
| 976 | Ga0373945_0001361 | 3300035116 | Bacteria | 7430 |
| 977 | Ga0373953_0018456 | 3300035117 | Plasmid | 2582 |
| 978 | Ga0373953_0065816 | 3300035117 | Bacteria | 1488 |
| 979 | Ga0373953_0160012 | 3300035117 | Bacteria | 968 |
| 980 | Ga0373954_0001017 | 3300035118 | Bacteria | 11102 |
| 981 | Ga0373954_0059817 | 3300035118 | Unclassified | 1796 |
| 982 | Ga0373954_0094919 | 3300035118 | Bacteria | 1436 |
| 983 | Ga0373956_0028285 | 3300035119 | Unclassified | 2438 |
| 984 | Ga0373957_0044664 | 3300035120 | Unclassified | 1677 |
| 985 | Ga0373957_0068011 | 3300035120 | Bacteria | 1389 |
| 986 | Ga0373960_0031871 | 3300035121 | Bacteria | 1477 |
| 987 | Ga0373943_0001535 | 3300035170 | Bacteria | 10452 |
| 988 | Ga0373943_0063938 | 3300035170 | Bacteria | 1846 |
| 989 | Ga0373943_0142379 | 3300035170 | Bacteria | 1293 |
| 990 | Ga0373955_0001468 | 3300035172 | Bacteria | 10009 |
| 991 | Ga0373955_0100296 | 3300035172 | Bacteria | 1661 |
| 992 | Ga0373924_0031294 | 3300035410 | Bacteria | 2139 |
| 993 | Ga0373924_0034660 | 3300035410 | Unclassified | 2044 |
| 994 | Ga0373924_0041991 | 3300035410 | Unclassified | 1875 |
| 995 | Ga0373935_0001935 | 3300035692 | Bacteria | 11641 |
| 996 | Ga0373935_0089076 | 3300035692 | Bacteria | 2017 |
| 997 | Ga0373935_0361388 | 3300035692 | Unclassified | 1037 |
| 998 | Ga0373927_0000183 | 3300035695 | Bacteria | 49509 |
| 999 | Ga0373933_0011413 | 3300035724 | Bacteria | 4895 |
| 1000 | Ga0373933_0021584 | 3300035724 | Bacteria | 3659 |
| 1001 | Ga0373933_0065213 | 3300035724 | Bacteria | 2205 |
| 1002 | Ga0373933_0147475 | 3300035724 | Bacteria | 1488 |
| 1003 | Ga0373947_0032445 | 3300035725 | Bacteria | 3078 |
| 1004 | Ga0373947_0040547 | 3300035725 | Unclassified | 2773 |
| 1005 | Ga0373947_0094710 | 3300035725 | Bacteria | 1868 |
| 1006 | Ga0373937_0000322 | 3300036401 | Bacteria | 45481 |
| 1007 | Ga0373937_0007114 | 3300036401 | Bacteria | 9667 |
| 1008 | Ga0373937_0080739 | 3300036401 | Unclassified | 3008 |
| 1009 | Ga0373937_0366777 | 3300036401 | Bacteria | 1365 |
| 1010 | Ga0373937_0735545 | 3300036401 | Unclassified | 934 |
| 1011 | Ga0373925_0000968 | 3300037068 | Bacteria | 26095 |
| 1012 | Ga0373925_0035583 | 3300037068 | Bacteria | 3675 |
| 1013 | Ga0373925_0394747 | 3300037068 | Unclassified | 1128 |
| 1014 | Ga0395899_0084152 | 3300037312 | Bacteria | 2312 |
| 1015 | Ga0395899_0333801 | 3300037312 | Bacteria | 1018 |
| 1016 | Ga0395900_0052741 | 3300037418 | Bacteria | 4186 |
| 1017 | Ga0395900_0187296 | 3300037418 | Bacteria | 2100 |
| 1018 | Ga0395900_0238073 | 3300037418 | Bacteria | 1827 |
| 1019 | Ga0395900_0361118 | 3300037418 | Bacteria | 1424 |
| 1020 | Ga0395898_0076360 | 3300037466 | Bacteria | 3235 |
| 1021 | Ga0395898_0125826 | 3300037466 | Bacteria | 2455 |
| 1022 | Ga0395898_0247412 | 3300037466 | Bacteria | 1700 |
| 1023 | Ga0395898_0353600 | 3300037466 | Bacteria | 1401 |
| 1024 | Ga0395898_0662208 | 3300037466 | Bacteria | 986 |
| 1025 | Ga0395905_0018238 | 3300037471 | Bacteria | 6662 |
| 1026 | Ga0395905_0128966 | 3300037471 | Bacteria | 2378 |
| 1027 | Ga0395905_0194279 | 3300037471 | Bacteria | 1903 |
| 1028 | Ga0395905_0261798 | 3300037471 | Bacteria | 1615 |
| 1029 | Ga0395905_0460205 | 3300037471 | Bacteria | 1170 |
| 1030 | Ga0436364_0544449 | 3300037853 | Unclassified | 1468 |
| 1031 | Ga0436364_1013023 | 3300037853 | Bacteria | 2484 |
| 1032 | Ga0395901_0065895 | 3300038443 | Bacteria | 3772 |
| 1033 | Ga0395901_0066500 | 3300038443 | Bacteria | 3754 |
| 1034 | Ga0395901_0175999 | 3300038443 | Bacteria | 2244 |
| 1035 | Ga0395901_0348274 | 3300038443 | Bacteria | 1529 |
| 1036 | Ga0242420_039130 | 3300038996 | Unclassified | 902 |
| 1037 | Ga0436365_0094208 | 3300039437 | Bacteria | 7110 |
| 1038 | Ga0436365_0191952 | 3300039437 | Bacteria | 9583 |
| 1039 | Ga0436365_0880151 | 3300039437 | Bacteria | 1134 |
| 1040 | Ga0436365_1346676 | 3300039437 | Bacteria | 18900 |
| 1041 | Ga0436360_0058232 | 3300039438 | Bacteria | 7261 |
| 1042 | Ga0436360_0783882 | 3300039438 | Unclassified | 3604 |
| 1043 | Ga0436360_1179520 | 3300039438 | Bacteria | 2435 |
| 1044 | Ga0436360_1321134 | 3300039438 | Bacteria | 1329 |
| 1045 | Ga0436361_0261014 | 3300039447 | Bacteria | 8387 |
| 1046 | Ga0436361_0454886 | 3300039447 | Bacteria | 2490 |
| 1047 | Ga0436361_0525774 | 3300039447 | Unclassified | 1336 |
| 1048 | Ga0436361_0706873 | 3300039447 | Bacteria | 4790 |
| 1049 | Ga0436361_0848238 | 3300039447 | Bacteria | 13562 |
| 1050 | Ga0436363_0288618 | 3300039450 | Bacteria | 2266 |
| 1051 | Ga0436363_1183006 | 3300039450 | Unclassified | 2757 |
| 1052 | Ga0436363_1684541 | 3300039450 | Bacteria | 1422 |
| 1053 | Ga0436362_0679855 | 3300039453 | Unclassified | 1303 |
| 1054 | Ga0436362_0833669 | 3300039453 | Bacteria | 3447 |
| 1055 | Ga0451793_1662783 | 3300041452 | Unclassified | 1432 |
| 1056 | Ga0451797_0072722 | 3300041453 | Unclassified | 1247 |
| 1057 | Ga0451798_0072560 | 3300041458 | Unclassified | 1356 |
| 1058 | Ga0451802_1305020 | 3300041460 | Bacteria | 1254 |
| 1059 | Ga0451804_0228842 | 3300041463 | Bacteria | 1480 |
| 1060 | Ga0451807_0712184 | 3300041486 | Archaea | 1708 |
| 1061 | Ga0451833_0043459 | 3300041491 | Unclassified | 1100 |
| 1062 | Ga0451835_0080592 | 3300041492 | Bacteria | 2031 |
| 1063 | Ga0451839_0448670 | 3300041496 | Unclassified | 1485 |
| 1064 | Ga0451839_1605409 | 3300041496 | Unclassified | 1046 |
| 1065 | Ga0451841_0873514 | 3300041498 | Bacteria | 1512 |
| 1066 | Ga0451845_0486646 | 3300041501 | Bacteria | 1704 |
| 1067 | Ga0451847_0251987 | 3300041503 | Bacteria | 1281 |
| 1068 | Ga0451851_0137226 | 3300041507 | Bacteria | 1621 |
| 1069 | Ga0451853_0418015 | 3300041512 | Bacteria | 1447 |
| 1070 | Ga0451853_1821962 | 3300041512 | Bacteria | 1121 |
| 1071 | Ga0450923_005780 | 3300042125 | Bacteria | 2017 |
| 1072 | Ga0450905_012760 | 3300042142 | Bacteria | 1186 |
| 1073 | Ga0439458_0017600 | 3300042157 | Bacteria | 1634 |
| 1074 | Ga0453683_0069608 | 3300044673 | Bacteria | 2200 |
| 1075 | Ga0466963_0197579 | 3300044694 | Unclassified | 1406 |
| 1076 | Ga0466963_0380790 | 3300044694 | Bacteria | 994 |
| 1077 | Ga0466957_0199330 | 3300044842 | Bacteria | 1314 |
| 1078 | Ga0466960_0136832 | 3300044901 | Unclassified | 1298 |
| 1079 | Ga0466960_0162547 | 3300044901 | Bacteria | 1200 |
| 1080 | Ga0466959_0313486 | 3300045049 | Unclassified | 1073 |
| 1081 | Ga0466958_0060342 | 3300045836 | Bacteria | 2309 |
| 1082 | Ga0466958_0084573 | 3300045836 | Bacteria | 1957 |
| 1083 | Ga0466967_0017190 | 3300045976 | Bacteria | 5734 |
| 1084 | Ga0466967_0044835 | 3300045976 | Bacteria | 3839 |
| 1085 | Ga0466967_0065667 | 3300045976 | Bacteria | 3230 |
| 1086 | Ga0466967_0067893 | 3300045976 | Bacteria | 3181 |
| 1087 | Ga0466967_0118335 | 3300045976 | Unclassified | 2444 |
| 1088 | Ga0466967_0204227 | 3300045976 | Bacteria | 1872 |
| 1089 | Ga0466967_0273701 | 3300045976 | Bacteria | 1618 |
| 1090 | Ga0466967_0309901 | 3300045976 | Bacteria | 1520 |
| 1091 | Ga0495592_0066955 | 3300046454 | Bacteria | 2626 |
| 1092 | Ga0495629_0021945 | 3300046459 | Bacteria | 4555 |
| 1093 | Ga0495641_0025443 | 3300046461 | Bacteria | 2906 |
| 1094 | Ga0495651_0004356 | 3300046462 | Bacteria | 10829 |
| 1095 | Ga0495651_0306927 | 3300046462 | Unclassified | 1062 |
| 1096 | Ga0495653_0017170 | 3300046463 | Bacteria | 5886 |
| 1097 | Ga0495653_0125549 | 3300046463 | Bacteria | 1823 |
| 1098 | Ga0495653_0209583 | 3300046463 | Unclassified | 1317 |
| 1099 | Ga0495580_0000500 | 3300046472 | Bacteria | 32899 |
| 1100 | Ga0495580_0001068 | 3300046472 | Bacteria | 24085 |
| 1101 | Ga0495580_0087508 | 3300046472 | Bacteria | 2170 |
| 1102 | Ga0495580_0300703 | 3300046472 | Bacteria | 1093 |
| 1103 | Ga0495582_0033871 | 3300046473 | Bacteria | 2809 |
| 1104 | Ga0495594_0105739 | 3300046499 | Unclassified | 1585 |
| 1105 | Ga0495608_0004624 | 3300046511 | Bacteria | 9830 |
| 1106 | Ga0495608_0056468 | 3300046511 | Bacteria | 2593 |
| 1107 | Ga0495608_0130020 | 3300046511 | Bacteria | 1612 |
| 1108 | Ga0495608_0140686 | 3300046511 | Unclassified | 1540 |
| 1109 | Ga0495618_0033235 | 3300046514 | Bacteria | 3233 |
| 1110 | Ga0495628_0293026 | 3300046516 | Bacteria | 1206 |
| 1111 | Ga0495630_0096180 | 3300046517 | Unclassified | 2239 |
| 1112 | Ga0495652_0006523 | 3300046529 | Bacteria | 10849 |
| 1113 | Ga0495652_0330965 | 3300046529 | Bacteria | 1097 |
| 1114 | Ga0495640_0007963 | 3300046533 | Bacteria | 8333 |
| 1115 | Ga0495587_0003574 | 3300046536 | Bacteria | 10359 |
| 1116 | Ga0495587_0006332 | 3300046536 | Bacteria | 7720 |
| 1117 | Ga0495598_0056569 | 3300046537 | Bacteria | 1198 |
| 1118 | Ga0495645_0036219 | 3300046543 | Bacteria | 3597 |
| 1119 | Ga0495667_0003750 | 3300046559 | Bacteria | 10218 |
| 1120 | Ga0495634_0023432 | 3300046642 | Bacteria | 4339 |
| 1121 | Ga0495634_0214320 | 3300046642 | Bacteria | 1191 |
| 1122 | Ga0495635_0058796 | 3300046663 | Bacteria | 2644 |
| 1123 | Ga0495635_0130605 | 3300046663 | Unclassified | 1712 |
| 1124 | Ga0495657_0016434 | 3300046675 | Bacteria | 5393 |
| 1125 | Ga0495599_0030437 | 3300046678 | Bacteria | 3386 |
| 1126 | Ga0495599_0111974 | 3300046678 | Unclassified | 1700 |
| 1127 | Ga0495623_0043834 | 3300046679 | Bacteria | 2845 |
| 1128 | Ga0495623_0046024 | 3300046679 | Bacteria | 2769 |
| 1129 | Ga0495646_0043718 | 3300046680 | Bacteria | 2741 |
| 1130 | Ga0495646_0050605 | 3300046680 | Bacteria | 2518 |
| 1131 | Ga0495658_0004476 | 3300046683 | Bacteria | 6875 |
| 1132 | Ga0495600_0026000 | 3300046809 | Bacteria | 3775 |
| 1133 | Ga0495581_0198312 | 3300047315 | Unclassified | 1174 |
| 1134 | Ga0495604_0000783 | 3300047317 | Bacteria | 26772 |
| 1135 | Ga0495604_0003938 | 3300047317 | Bacteria | 11828 |
| 1136 | Ga0495674_0004090 | 3300047319 | Bacteria | 14104 |
| 1137 | Ga0495674_0016598 | 3300047319 | Bacteria | 6871 |
| 1138 | Ga0495674_0060299 | 3300047319 | Bacteria | 3311 |
| 1139 | Ga0495676_0109881 | 3300047321 | Bacteria | 2025 |
| 1140 | Ga0495676_0247941 | 3300047321 | Unclassified | 1216 |
| 1141 | Ga0495680_0015221 | 3300047322 | Bacteria | 6641 |
| 1142 | Ga0495680_0074607 | 3300047322 | Bacteria | 2576 |
| 1143 | Ga0495684_0008401 | 3300047471 | Bacteria | 7997 |
| 1144 | Ga0495684_0037640 | 3300047471 | Bacteria | 3711 |
| 1145 | Ga0495684_0053231 | 3300047471 | Bacteria | 3088 |
| 1146 | Ga0495684_0497683 | 3300047471 | Bacteria | 839 |
| 1147 | Ga0495593_0009656 | 3300047673 | Bacteria | 5599 |
| 1148 | Ga0495593_0029170 | 3300047673 | Bacteria | 3027 |
| 1149 | Ga0495602_0002020 | 3300048088 | Bacteria | 20411 |
| 1150 | Ga0495602_0178268 | 3300048088 | Bacteria | 1642 |
| 1151 | Ga0495602_0294028 | 3300048088 | Bacteria | 1191 |
| 1152 | Ga0495602_0406497 | 3300048088 | Bacteria | 970 |
| 1153 | Ga0496100_0018281 | 3300048903 | Bacteria | 4155 |
| 1154 | Ga0496100_0028439 | 3300048903 | Bacteria | 3448 |
| 1155 | Ga0496100_0061623 | 3300048903 | Bacteria | 2472 |
| 1156 | Ga0496100_0200326 | 3300048903 | Unclassified | 1455 |
| 1157 | Ga0496100_0264156 | 3300048903 | Bacteria | 1277 |
| 1158 | Ga0496100_0503855 | 3300048903 | Bacteria | 933 |
| 1159 | Ga0496100_0508098 | 3300048903 | Unclassified | 929 |
| 1160 | Ga0496101_0003818 | 3300048904 | Bacteria | 9414 |
| 1161 | Ga0496101_0004247 | 3300048904 | Bacteria | 8986 |
| 1162 | Ga0496101_0014478 | 3300048904 | Bacteria | 5302 |
| 1163 | Ga0496101_0112399 | 3300048904 | Bacteria | 2052 |
| 1164 | Ga0496101_0120422 | 3300048904 | Bacteria | 1984 |
| 1165 | Ga0496101_0195094 | 3300048904 | Bacteria | 1564 |
| 1166 | Ga0496101_0458852 | 3300048904 | Bacteria | 1005 |
| 1167 | Ga0496102_0029077 | 3300048905 | Plasmid | 4941 |
| 1168 | Ga0496102_0098744 | 3300048905 | Bacteria | 2710 |
| 1169 | Ga0496102_0102267 | 3300048905 | Bacteria | 2663 |
| 1170 | Ga0496102_0104152 | 3300048905 | Bacteria | 2639 |
| 1171 | Ga0496102_0241893 | 3300048905 | Unclassified | 1702 |
| 1172 | Ga0496102_0273683 | 3300048905 | Unclassified | 1592 |
| 1173 | Ga0496102_0390968 | 3300048905 | Bacteria | 1308 |
| 1174 | Ga0496102_0472061 | 3300048905 | Bacteria | 1176 |
| 1175 | Ga0496102_0490820 | 3300048905 | Unclassified | 1150 |
| 1176 | Ga0496102_0578357 | 3300048905 | Bacteria | 1046 |
| 1177 | Ga0496102_0591351 | 3300048905 | Bacteria | 1033 |
| 1178 | Ga0496103_0048201 | 3300048906 | Bacteria | 2632 |
| 1179 | Ga0496103_0078178 | 3300048906 | Bacteria | 2078 |
| 1180 | Ga0496104_0000167 | 3300048907 | Bacteria | 58367 |
| 1181 | Ga0496104_0028614 | 3300048907 | Bacteria | 5165 |
| 1182 | Ga0496104_0031553 | 3300048907 | Bacteria | 4928 |
| 1183 | Ga0496104_0039204 | 3300048907 | Bacteria | 4435 |
| 1184 | Ga0496104_0108221 | 3300048907 | Unclassified | 2664 |
| 1185 | Ga0496104_0149854 | 3300048907 | Unclassified | 2240 |
| 1186 | Ga0496104_0154013 | 3300048907 | Bacteria | 2206 |
| 1187 | Ga0496104_0327573 | 3300048907 | Bacteria | 1445 |
| 1188 | Ga0496104_0675385 | 3300048907 | Unclassified | 941 |
| 1189 | Ga0496105_0000083 | 3300048908 | Bacteria | 68995 |
| 1190 | Ga0496105_0007382 | 3300048908 | Bacteria | 8509 |
| 1191 | Ga0496105_0019383 | 3300048908 | Bacteria | 5487 |
| 1192 | Ga0496105_0045210 | 3300048908 | Bacteria | 3633 |
| 1193 | Ga0496105_0051397 | 3300048908 | Bacteria | 3405 |
| 1194 | Ga0496106_0006055 | 3300048909 | Bacteria | 8953 |
| 1195 | Ga0496106_0029260 | 3300048909 | Bacteria | 4105 |
| 1196 | Ga0496106_0060991 | 3300048909 | Unclassified | 2860 |
| 1197 | Ga0496107_0006330 | 3300048910 | Bacteria | 8138 |
| 1198 | Ga0496107_0022244 | 3300048910 | Bacteria | 4481 |
| 1199 | Ga0496107_0026519 | 3300048910 | Bacteria | 4109 |
| 1200 | Ga0496107_0033001 | 3300048910 | Bacteria | 3702 |
| 1201 | Ga0496107_0295853 | 3300048910 | Unclassified | 1205 |
| 1202 | Ga0496108_0002129 | 3300048911 | Bacteria | 15863 |
| 1203 | Ga0496108_0004679 | 3300048911 | Bacteria | 11034 |
| 1204 | Ga0496108_0033434 | 3300048911 | Bacteria | 4272 |
| 1205 | Ga0496108_0057046 | 3300048911 | Bacteria | 3282 |
| 1206 | Ga0496108_0189008 | 3300048911 | Bacteria | 1785 |
| 1207 | Ga0496108_0338428 | 3300048911 | Bacteria | 1313 |
| 1208 | Ga0496109_0000623 | 3300048912 | Bacteria | 29549 |
| 1209 | Ga0496109_0001231 | 3300048912 | Bacteria | 21278 |
| 1210 | Ga0496109_0007631 | 3300048912 | Bacteria | 9173 |
| 1211 | Ga0496109_0009484 | 3300048912 | Bacteria | 8299 |
| 1212 | Ga0496109_0012320 | 3300048912 | Bacteria | 7382 |
| 1213 | Ga0496109_0172317 | 3300048912 | Bacteria | 2031 |
| 1214 | Ga0496109_0260413 | 3300048912 | Bacteria | 1634 |
| 1215 | Ga0496109_0280776 | 3300048912 | Bacteria | 1569 |
| 1216 | Ga0496109_0376987 | 3300048912 | Bacteria | 1340 |
| 1217 | Ga0496109_0520416 | 3300048912 | Unclassified | 1123 |
| 1218 | Ga0496110_0001030 | 3300048913 | Bacteria | 19604 |
| 1219 | Ga0496110_0002179 | 3300048913 | Bacteria | 14634 |
| 1220 | Ga0496110_0006144 | 3300048913 | Bacteria | 9470 |
| 1221 | Ga0496110_0007632 | 3300048913 | Bacteria | 8652 |
| 1222 | Ga0496110_0029683 | 3300048913 | Bacteria | 4709 |
| 1223 | Ga0496110_0110284 | 3300048913 | Bacteria | 2472 |
| 1224 | Ga0496110_0217518 | 3300048913 | Bacteria | 1737 |
| 1225 | Ga0496110_0387730 | 3300048913 | Unclassified | 1273 |
| 1226 | Ga0496110_0392012 | 3300048913 | Unclassified | 1266 |
| 1227 | Ga0496110_0498448 | 3300048913 | Bacteria | 1109 |
| 1228 | Ga0496110_0517527 | 3300048913 | Unclassified | 1086 |
| 1229 | Ga0496111_0000921 | 3300048914 | Bacteria | 16046 |
| 1230 | Ga0496111_0041077 | 3300048914 | Bacteria | 3318 |
| 1231 | Ga0496111_0053922 | 3300048914 | Bacteria | 2905 |
| 1232 | Ga0496111_0054806 | 3300048914 | Unclassified | 2883 |
| 1233 | Ga0496111_0073485 | 3300048914 | Bacteria | 2490 |
| 1234 | Ga0496111_0301635 | 3300048914 | Bacteria | 1187 |
| 1235 | Ga0496112_0001502 | 3300048915 | Bacteria | 17962 |
| 1236 | Ga0496112_0058936 | 3300048915 | Bacteria | 3782 |
| 1237 | Ga0496112_0061440 | 3300048915 | Bacteria | 3704 |
| 1238 | Ga0496112_0100065 | 3300048915 | Bacteria | 2869 |
| 1239 | Ga0496112_0100329 | 3300048915 | Unclassified | 2864 |
| 1240 | Ga0496112_0224555 | 3300048915 | Bacteria | 1834 |
| 1241 | Ga0496112_0497772 | 3300048915 | Unclassified | 1154 |
| 1242 | Ga0496112_0782169 | 3300048915 | Bacteria | 880 |
| 1243 | Ga0496113_0004075 | 3300048916 | Bacteria | 8901 |
| 1244 | Ga0496113_0028499 | 3300048916 | Bacteria | 4017 |
| 1245 | Ga0496113_0056375 | 3300048916 | Bacteria | 2950 |
| 1246 | Ga0496113_0332993 | 3300048916 | Unclassified | 1217 |
| 1247 | Ga0496113_0366608 | 3300048916 | Unclassified | 1156 |
| 1248 | Ga0496114_0001254 | 3300048917 | Bacteria | 19212 |
| 1249 | Ga0496114_0013086 | 3300048917 | Bacteria | 6646 |
| 1250 | Ga0496114_0135628 | 3300048917 | Unclassified | 2128 |
| 1251 | Ga0496114_0256704 | 3300048917 | Unclassified | 1538 |
| 1252 | Ga0496114_0271856 | 3300048917 | Unclassified | 1493 |
| 1253 | Ga0496114_0282652 | 3300048917 | Unclassified | 1463 |
| 1254 | Ga0496114_0387347 | 3300048917 | Bacteria | 1238 |
| 1255 | Ga0496115_0083173 | 3300048918 | Bacteria | 2609 |
| 1256 | Ga0496115_0114929 | 3300048918 | Unclassified | 2213 |
| 1257 | Ga0496115_0150903 | 3300048918 | Bacteria | 1919 |
| 1258 | Ga0496115_0305010 | 3300048918 | Unclassified | 1304 |
| 1259 | Ga0496115_0422601 | 3300048918 | Bacteria | 1080 |
| 1260 | Ga0496126_0021743 | 3300048929 | Bacteria | 6257 |
| 1261 | Ga0501296_006066 | 3300049519 | Bacteria | 1361 |
| 1262 | Ga0501298_002123 | 3300049521 | Bacteria | 2976 |
| 1263 | Ga0501298_005037 | 3300049521 | Bacteria | 2104 |
| 1264 | Ga0501299_002377 | 3300049522 | Unclassified | 2599 |
| 1265 | Ga0501036_0069978 | 3300049572 | Bacteria | 2967 |
| 1266 | Ga0501038_0092144 | 3300049574 | Bacteria | 2538 |
| 1267 | Ga0501039_0081199 | 3300049575 | Bacteria | 2524 |
| 1268 | Ga0501039_0231411 | 3300049575 | Bacteria | 1453 |
| 1269 | Ga0501040_0023928 | 3300049576 | Bacteria | 4097 |
| 1270 | Ga0501040_0029582 | 3300049576 | Bacteria | 3699 |
| 1271 | Ga0501040_0064763 | 3300049576 | Bacteria | 2517 |
| 1272 | Ga0501041_0219371 | 3300049577 | Unclassified | 1193 |
| 1273 | Ga0501042_0025812 | 3300049578 | Unclassified | 4129 |
| 1274 | Ga0501042_0050846 | 3300049578 | Bacteria | 2956 |
| 1275 | Ga0501048_0016407 | 3300049582 | Bacteria | 5458 |
| 1276 | Ga0501048_0048218 | 3300049582 | Bacteria | 3039 |
| 1277 | Ga0501048_0220282 | 3300049582 | Unclassified | 1346 |
| 1278 | Ga0501067_0024971 | 3300049583 | Bacteria | 3314 |
| 1279 | Ga0501069_0108195 | 3300049585 | Bacteria | 1582 |
| 1280 | Ga0501071_0040920 | 3300049587 | Unclassified | 3318 |
| 1281 | Ga0501072_0023273 | 3300049588 | Unclassified | 4811 |
| 1282 | Ga0501072_0027653 | 3300049588 | Bacteria | 4424 |
| 1283 | Ga0501072_0053504 | 3300049588 | Bacteria | 3179 |
| 1284 | Ga0501074_0102484 | 3300049590 | Unclassified | 2049 |
| 1285 | Ga0501075_0045199 | 3300049591 | Bacteria | 3305 |
| 1286 | Ga0501075_0049291 | 3300049591 | Bacteria | 3165 |
| 1287 | Ga0501075_0094335 | 3300049591 | Unclassified | 2272 |
| 1288 | Ga0501076_0001759 | 3300049592 | Bacteria | 14649 |
| 1289 | Ga0501076_0014191 | 3300049592 | Bacteria | 5995 |
| 1290 | Ga0501076_0114164 | 3300049592 | Bacteria | 2185 |
| 1291 | Ga0501076_0130486 | 3300049592 | Unclassified | 2038 |
| 1292 | Ga0501076_0243851 | 3300049592 | Bacteria | 1470 |
| 1293 | Ga0501077_0025123 | 3300049593 | Unclassified | 3784 |
| 1294 | Ga0501077_0062273 | 3300049593 | Bacteria | 2367 |
| 1295 | Ga0501202_042048 | 3300049652 | Unclassified | 990 |
| 1296 | Ga0501223_023385 | 3300049663 | Unclassified | 1205 |
| 1297 | Ga0501235_004711 | 3300049669 | Bacteria | 2949 |
| 1298 | Ga0501249_025916 | 3300049679 | Bacteria | 1294 |
| 1299 | Ga0501257_019313 | 3300049686 | Bacteria | 1594 |
| 1300 | Ga0501079_0009208 | 3300049741 | Bacteria | 7480 |
| 1301 | Ga0501079_0094543 | 3300049741 | Bacteria | 2316 |
| 1302 | Ga0501080_0014423 | 3300049742 | Bacteria | 7278 |
| 1303 | Ga0501081_0035110 | 3300049743 | Unclassified | 3413 |
| 1304 | Ga0501081_0036738 | 3300049743 | Bacteria | 3340 |
| 1305 | Ga0501265_014461 | 3300049762 | Bacteria | 1004 |
| 1306 | Ga0501045_0060367 | 3300049824 | Unclassified | 2779 |
| 1307 | nmdc:mga05p37_106118_c1 | 3300050507 | Bacteria | 3455 |
| 1308 | nmdc:mga05p37_14213_c1 | 3300050507 | Bacteria | 9558 |
| 1309 | nmdc:mga05p37_162828_c1 | 3300050507 | Bacteria | 2724 |
| 1310 | nmdc:mga05p37_26968_c1 | 3300050507 | Bacteria | 6990 |
| 1311 | nmdc:mga05p37_434924_c1 | 3300050507 | Unclassified | 1523 |
| 1312 | nmdc:mga05p37_58622_c1 | 3300050507 | Bacteria | 4742 |
| 1313 | nmdc:mga05p37_78300_c1 | 3300050507 | Unclassified | 4070 |
| 1314 | nmdc:mga05p37_866452_c1 | 3300050507 | Bacteria | 979 |
| 1315 | nmdc:mga09592_23571_c1 | 3300050508 | Bacteria | 5084 |
| 1316 | nmdc:mga09592_556577_c1 | 3300050508 | Bacteria | 985 |
| 1317 | nmdc:mga06r32_144309_c1 | 3300050510 | Unclassified | 2358 |
| 1318 | nmdc:mga06r32_25643_c1 | 3300050510 | Bacteria | 5487 |
| 1319 | nmdc:mga06r32_496061_c1 | 3300050510 | Bacteria | 1198 |
| 1320 | nmdc:mga06r32_642745_c1 | 3300050510 | Unclassified | 1029 |
| 1321 | nmdc:mga08y16_138580_c1 | 3300050511 | Bacteria | 2529 |
| 1322 | nmdc:mga08y16_179387_c1 | 3300050511 | Bacteria | 2199 |
| 1323 | nmdc:mga08y16_18658_c1 | 3300050511 | Bacteria | 7307 |
| 1324 | nmdc:mga08y16_197053_c1 | 3300050511 | Bacteria | 2088 |
| 1325 | nmdc:mga08y16_209478_c1 | 3300050511 | Bacteria | 2019 |
| 1326 | nmdc:mga08y16_214296_c1 | 3300050511 | Bacteria | 1994 |
| 1327 | nmdc:mga08y16_38_c1 | 3300050511 | Bacteria | 135093 |
| 1328 | nmdc:mga08y16_497981_c1 | 3300050511 | Bacteria | 1238 |
| 1329 | nmdc:mga08y16_675516_c1 | 3300050511 | Bacteria | 1035 |
| 1330 | nmdc:mga0n895_186385_c1 | 3300050512 | Bacteria | 2106 |
| 1331 | nmdc:mga0n895_355263_c1 | 3300050512 | Bacteria | 1484 |
| 1332 | nmdc:mga0n895_58672_c1 | 3300050512 | Unclassified | 3795 |
| 1333 | nmdc:mga0n895_75415_c1 | 3300050512 | Plasmid | 3353 |
| 1334 | nmdc:mga0rr50_105029_c1 | 3300050513 | Bacteria | 2226 |
| 1335 | nmdc:mga0rr50_175720_c1 | 3300050513 | Unclassified | 1748 |
| 1336 | nmdc:mga0rr50_423418_c1 | 3300050513 | Bacteria | 1126 |
| 1337 | nmdc:mga0rr50_7295_c1 | 3300050513 | Bacteria | 6802 |
| 1338 | nmdc:mga0rr50_96220_c1 | 3300050513 | Bacteria | 2316 |
| 1339 | nmdc:mga08x19_11338_c1 | 3300050514 | Bacteria | 5365 |
| 1340 | nmdc:mga08x19_178239_c1 | 3300050514 | Bacteria | 1450 |
| 1341 | nmdc:mga08x19_8975_c1 | 3300050514 | Bacteria | 5967 |
| 1342 | nmdc:mga0a205_187043_c1 | 3300050515 | Unclassified | 1964 |
| 1343 | nmdc:mga0a205_217968_c1 | 3300050515 | Unclassified | 1795 |
| 1344 | nmdc:mga0a205_39466_c1 | 3300050515 | Bacteria | 4544 |
| 1345 | nmdc:mga0a205_456043_c1 | 3300050515 | Bacteria | 1138 |
| 1346 | nmdc:mga0a205_486710_c1 | 3300050515 | Bacteria | 1091 |
| 1347 | Ga0495601_0004962 | 3300053077 | Bacteria | 7719 |
| 1348 | Ga0495601_0014415 | 3300053077 | Bacteria | 4763 |
| 1349 | Ga0495612_0001144 | 3300053078 | Bacteria | 10899 |
| 1350 | Ga0495612_0066922 | 3300053078 | Bacteria | 1494 |
| 1351 | Ga0495595_0002877 | 3300053084 | Bacteria | 6786 |
| 1352 | Ga0495595_0021393 | 3300053084 | Bacteria | 2826 |
| 1353 | Ga0495595_0238156 | 3300053084 | Unclassified | 910 |
| 1354 | Ga0495619_0050037 | 3300053085 | Bacteria | 2757 |
| 1355 | Ga0495619_0121493 | 3300053085 | Bacteria | 1791 |
| 1356 | Ga0501084_0044422 | 3300054114 | Bacteria | 3720 |
| 1357 | Ga0501084_0082603 | 3300054114 | Bacteria | 2696 |
| 1358 | Ga0501084_0201099 | 3300054114 | Bacteria | 1681 |
| 1359 | Ga0590071_000260 | 3300059421 | Bacteria | 15395 |
| 1360 | Ga0590077_002003 | 3300059426 | Bacteria | 4478 |
| 1361 | Ga0587066_016689 | 3300059490 | Bacteria | 1160 |
| 1362 | Ga0587070_037393 | 3300059491 | Bacteria | 912 |
| 1363 | Ga0587073_0004438 | 3300059492 | Bacteria | 2016 |
| 1364 | Ga0587077_005903 | 3300059493 | Bacteria | 1704 |
| 1365 | Ga0587082_024639 | 3300059504 | Bacteria | 1006 |
| 1366 | Ga0587083_0019546 | 3300059505 | Bacteria | 1238 |
| 1367 | Ga0587088_003851 | 3300059508 | Bacteria | 1856 |
| 1368 | Ga0587090_030405 | 3300059510 | Bacteria | 900 |
| 1369 | Ga0587094_003692 | 3300059513 | Bacteria | 1689 |
| 1370 | Ga0587101_022744 | 3300059623 | Bacteria | 917 |
| 1371 | Ga0587067_017334 | 3300059640 | Bacteria | 1194 |
| 1372 | Ga0587069_004623 | 3300059642 | Bacteria | 1561 |
| 1373 | Ga0587071_024378 | 3300060344 | Bacteria | 1129 |
| 1374 | Ga0587111_0019825 | 3300060346 | Bacteria | 1280 |
| 1375 | Ga0501082_0069661 | 3300060353 | Plasmid | 3029 |
| 1376 | Ga0501082_0078051 | 3300060353 | Bacteria | 2856 |
| 1377 | Ga0501082_0140393 | 3300060353 | Bacteria | 2097 |
| 1378 | Ga0501082_0172508 | 3300060353 | Bacteria | 1880 |
| 1379 | Ga0530510_0018597 | 3300061734 | Bacteria | 4927 |
| 1380 | Ga0530510_0035953 | 3300061734 | Bacteria | 3570 |
| 1381 | Ga0530510_0184051 | 3300061734 | Unclassified | 1549 |
| 1382 | Ga0530510_0244295 | 3300061734 | Bacteria | 1337 |
| 1383 | Ga0373956_0031293 | |||
| 1384 | JGI24743J22301_10040505 | |||
| 1385 | JGI24750J21931_1014997 | |||
| 1386 | JGI24738J21930_10003487 | |||
| 1387 | JGI24751J29686_10035804 | |||
| 1388 | JGI25406J46586_10068999 | |||
| 1389 | rootL2_10273141 | |||
| 1390 | Ga0058862_10214684 | |||
| 1391 | Ga0065704_10100409 | |||
| 1392 | Ga0065704_10102409 | |||
| 1393 | Ga0065715_10012192 | |||
| 1394 | Ga0065715_10188816 | |||
| 1395 | Ga0065707_10159697 | |||
| 1396 | Ga0070658_10064461 | |||
| 1397 | Ga0070658_10069838 | |||
| 1398 | Ga0070658_10424169 | |||
| 1399 | Ga0070676_10034513 | |||
| 1400 | Ga0070676_10051251 | |||
| 1401 | Ga0070683_100001985 | |||
| 1402 | Ga0070683_100032232 | |||
| 1403 | Ga0070683_100036741 | |||
| 1404 | Ga0070683_100042978 | |||
| 1405 | Ga0070683_100119553 | |||
| 1406 | Ga0070683_100309229 | |||
| 1407 | Ga0070690_100026680 | |||
| 1408 | Ga0070690_100038277 | |||
| 1409 | Ga0070670_100022499 | |||
| 1410 | Ga0070670_100035300 | |||
| 1411 | Ga0070670_100380037 | |||
| 1412 | Ga0070670_100388663 | |||
| 1413 | Ga0070670_100666036 | |||
| 1414 | Ga0070677_10025372 | |||
| 1415 | Ga0070677_10076398 | |||
| 1416 | Ga0068869_100002717 | |||
| 1417 | Ga0068869_100090876 | |||
| 1418 | Ga0068869_100344016 | |||
| 1419 | Ga0070666_10002239 | |||
| 1420 | Ga0070666_10134591 | |||
| 1421 | Ga0070666_10262931 | |||
| 1422 | Ga0070680_100068859 | |||
| 1423 | Ga0070680_100111413 | |||
| 1424 | Ga0070680_100250482 | |||
| 1425 | Ga0070680_100257122 | |||
| 1426 | Ga0070680_100326268 | |||
| 1427 | Ga0070680_100419310 | |||
| 1428 | Ga0070682_100004789 | |||
| 1429 | Ga0070682_100028783 | |||
| 1430 | Ga0070682_100034164 | |||
| 1431 | Ga0070682_100433264 | |||
| 1432 | Ga0068868_100040289 | |||
| 1433 | Ga0068868_100042490 | |||
| 1434 | Ga0068868_100075739 | |||
| 1435 | Ga0068868_100346241 | |||
| 1436 | Ga0068868_100472317 | |||
| 1437 | Ga0070660_100003025 | |||
| 1438 | Ga0070660_100012448 | |||
| 1439 | Ga0070660_100017775 | |||
| 1440 | Ga0070660_100076988 | |||
| 1441 | Ga0070660_100116432 | |||
| 1442 | Ga0070660_100260648 | |||
| 1443 | Ga0070689_100009235 | |||
| 1444 | Ga0070689_100170417 | |||
| 1445 | Ga0070691_10033532 | |||
| 1446 | Ga0070691_10117724 | |||
| 1447 | Ga0070687_100026669 | |||
| 1448 | Ga0070687_100149062 | |||
| 1449 | Ga0070661_100005517 | |||
| 1450 | Ga0070661_100006707 | |||
| 1451 | Ga0070661_100057996 | |||
| 1452 | Ga0070661_100076417 | |||
| 1453 | Ga0070661_100115017 | |||
| 1454 | Ga0070661_100118955 | |||
| 1455 | Ga0070661_100121043 | |||
| 1456 | Ga0070661_100136703 | |||
| 1457 | Ga0070661_100272459 | |||
| 1458 | Ga0070692_10004094 | |||
| 1459 | Ga0070692_10058153 | |||
| 1460 | Ga0070692_10183068 | |||
| 1461 | Ga0070692_10190235 | |||
| 1462 | Ga0070692_10291300 | |||
| 1463 | Ga0070668_100115775 | |||
| 1464 | Ga0070668_100566290 | |||
| 1465 | Ga0070669_100033667 | |||
| 1466 | Ga0070669_100049248 | |||
| 1467 | Ga0070669_100338690 | |||
| 1468 | Ga0070669_100710671 | |||
| 1469 | Ga0070675_100011830 | |||
| 1470 | Ga0070675_100018221 | |||
| 1471 | Ga0070675_100024902 | |||
| 1472 | Ga0070675_100033519 | |||
| 1473 | Ga0070675_100064160 | |||
| 1474 | Ga0070675_100206357 | |||
| 1475 | Ga0070671_100007805 | |||
| 1476 | Ga0070671_100013553 | |||
| 1477 | Ga0070671_100026503 | |||
| 1478 | Ga0070671_100657245 | |||
| 1479 | Ga0070674_100021404 | |||
| 1480 | Ga0070674_100163372 | |||
| 1481 | Ga0070674_100314980 | |||
| 1482 | Ga0070673_100031909 | |||
| 1483 | Ga0070673_100065588 | |||
| 1484 | Ga0070673_100326527 | |||
| 1485 | Ga0070673_100341560 | |||
| 1486 | Ga0070673_100360021 | |||
| 1487 | Ga0070688_100001997 | |||
| 1488 | Ga0070688_100005496 | |||
| 1489 | Ga0070659_100005288 | |||
| 1490 | Ga0070659_100035019 | |||
| 1491 | Ga0070659_100068732 | |||
| 1492 | Ga0070659_100087168 | |||
| 1493 | Ga0070659_100186917 | |||
| 1494 | Ga0070659_100220430 | |||
| 1495 | Ga0070659_100257956 | |||
| 1496 | Ga0070659_100311421 | |||
| 1497 | Ga0070659_100588443 | |||
| 1498 | Ga0070667_100001361 | |||
| 1499 | Ga0070667_100028039 | |||
| 1500 | Ga0070667_100054042 | |||
| 1501 | Ga0070667_100081078 | |||
| 1502 | Ga0070667_100412302 | |||
| 1503 | Ga0070703_10002696 | |||
| 1504 | Ga0070703_10049871 | |||
| 1505 | Ga0070709_10065320 | |||
| 1506 | Ga0070709_10477112 | |||
| 1507 | Ga0070714_100030854 | |||
| 1508 | Ga0070714_100049139 | |||
| 1509 | Ga0070714_100074272 | |||
| 1510 | Ga0070714_100214309 | |||
| 1511 | Ga0070714_100304388 | |||
| 1512 | Ga0070714_100502471 | |||
| 1513 | Ga0070713_100011585 | |||
| 1514 | Ga0070713_100037719 | |||
| 1515 | Ga0070713_100048076 | |||
| 1516 | Ga0070713_100114824 | |||
| 1517 | Ga0070713_100148943 | |||
| 1518 | Ga0070713_100217841 | |||
| 1519 | Ga0070713_100379586 | |||
| 1520 | Ga0070713_100647947 | |||
| 1521 | Ga0070710_10192306 | |||
| 1522 | Ga0070701_10001416 | |||
| 1523 | Ga0070701_10154350 | |||
| 1524 | Ga0070701_10159930 | |||
| 1525 | Ga0070701_10273181 | |||
| 1526 | Ga0070711_100016426 | |||
| 1527 | Ga0070711_100447135 | |||
| 1528 | Ga0070705_100009697 | |||
| 1529 | Ga0070705_100010632 | |||
| 1530 | Ga0070700_100004166 | |||
| 1531 | Ga0070700_100019998 | |||
| 1532 | Ga0070700_100144939 | |||
| 1533 | Ga0070700_100325479 | |||
| 1534 | Ga0070694_100004850 | |||
| 1535 | Ga0070694_100031865 | |||
| 1536 | Ga0070694_100036004 | |||
| 1537 | Ga0070694_100044859 | |||
| 1538 | Ga0070694_100070387 | |||
| 1539 | Ga0070694_100634331 | |||
| 1540 | Ga0070708_100001882 | |||
| 1541 | Ga0070708_100008313 | |||
| 1542 | Ga0070708_100009507 | |||
| 1543 | Ga0070708_100012874 | |||
| 1544 | Ga0070708_100052993 | |||
| 1545 | Ga0070708_100065468 | |||
| 1546 | Ga0070708_100074336 | |||
| 1547 | Ga0070708_100382469 | |||
| 1548 | Ga0070663_100004923 | |||
| 1549 | Ga0070663_100048631 | |||
| 1550 | Ga0070663_100054947 | |||
| 1551 | Ga0070663_100066861 | |||
| 1552 | Ga0070663_100081602 | |||
| 1553 | Ga0070663_100136022 | |||
| 1554 | Ga0070663_100149218 | |||
| 1555 | Ga0070663_100158963 | |||
| 1556 | Ga0070678_100004126 | |||
| 1557 | Ga0070678_100005575 | |||
| 1558 | Ga0070678_100023181 | |||
| 1559 | Ga0070678_100052876 | |||
| 1560 | Ga0070678_100055755 | |||
| 1561 | Ga0070662_100000176 | |||
| 1562 | Ga0070662_100006883 | |||
| 1563 | Ga0070662_100033411 | |||
| 1564 | Ga0070662_100109454 | |||
| 1565 | Ga0070662_100138081 | |||
| 1566 | Ga0070662_100288611 | |||
| 1567 | Ga0070681_10004187 | |||
| 1568 | Ga0070681_10063677 | |||
| 1569 | Ga0070681_10261748 | |||
| 1570 | Ga0070681_10532140 | |||
| 1571 | Ga0068867_100033353 | |||
| 1572 | Ga0068867_100055594 | |||
| 1573 | Ga0068867_100180625 | |||
| 1574 | Ga0068867_100328184 | |||
| 1575 | Ga0068867_100460109 | |||
| 1576 | Ga0070685_10001387 | |||
| 1577 | Ga0070685_10033481 | |||
| 1578 | Ga0070706_100014082 | |||
| 1579 | Ga0070706_100044612 | |||
| 1580 | Ga0070706_100061987 | |||
| 1581 | Ga0070706_100157005 | |||
| 1582 | Ga0070706_100157622 | |||
| 1583 | Ga0070706_100264867 | |||
| 1584 | Ga0070706_100478801 | |||
| 1585 | Ga0070706_100487900 | |||
| 1586 | Ga0070707_100044064 | |||
| 1587 | Ga0070707_100048986 | |||
| 1588 | Ga0070707_100088178 | |||
| 1589 | Ga0070707_100103425 | |||
| 1590 | Ga0070707_100131936 | |||
| 1591 | Ga0070707_100253548 | |||
| 1592 | Ga0070707_100290020 | |||
| 1593 | Ga0070707_100358176 | |||
| 1594 | Ga0070707_100390678 | |||
| 1595 | Ga0070698_100002074 | |||
| 1596 | Ga0070698_100002913 | |||
| 1597 | Ga0070698_100031205 | |||
| 1598 | Ga0070698_100046210 | |||
| 1599 | Ga0070698_100072865 | |||
| 1600 | Ga0070698_100251875 | |||
| 1601 | Ga0070699_100029971 | |||
| 1602 | Ga0070699_100045831 | |||
| 1603 | Ga0070699_100113805 | |||
| 1604 | Ga0070699_100358146 | |||
| 1605 | Ga0070699_100418508 | |||
| 1606 | Ga0070699_100456453 | |||
| 1607 | Ga0070699_100574626 | |||
| 1608 | Ga0070679_100001701 | |||
| 1609 | Ga0070679_100010428 | |||
| 1610 | Ga0070679_100011511 | |||
| 1611 | Ga0070679_100036858 | |||
| 1612 | Ga0070679_100100303 | |||
| 1613 | Ga0070679_100447429 | |||
| 1614 | Ga0070679_100624728 | |||
| 1615 | Ga0070684_100006596 | |||
| 1616 | Ga0070684_100052144 | |||
| 1617 | Ga0070684_100058902 | |||
| 1618 | Ga0070684_100147863 | |||
| 1619 | Ga0070684_100656046 | |||
| 1620 | Ga0070697_100018594 | |||
| 1621 | Ga0070697_100030860 | |||
| 1622 | Ga0070697_100094002 | |||
| 1623 | Ga0070697_100273452 | |||
| 1624 | Ga0070697_100531507 | |||
| 1625 | Ga0068853_100011199 | |||
| 1626 | Ga0068853_100023406 | |||
| 1627 | Ga0068853_100107243 | |||
| 1628 | Ga0068853_100357271 | |||
| 1629 | Ga0068853_100407658 | |||
| 1630 | Ga0070672_100004194 | |||
| 1631 | Ga0070672_100005387 | |||
| 1632 | Ga0070672_100017283 | |||
| 1633 | Ga0070672_100025338 | |||
| 1634 | Ga0070672_100055170 | |||
| 1635 | Ga0070672_100151341 | |||
| 1636 | Ga0070672_100307944 | |||
| 1637 | Ga0070672_100329520 | |||
| 1638 | Ga0070686_100002957 | |||
| 1639 | Ga0070686_100061618 | |||
| 1640 | Ga0070686_100068464 | |||
| 1641 | Ga0070686_100407372 | |||
| 1642 | Ga0070695_100010936 | |||
| 1643 | Ga0070695_100243483 | |||
| 1644 | Ga0070695_100268969 | |||
| 1645 | Ga0070695_100284669 | |||
| 1646 | Ga0070695_100368940 | |||
| 1647 | Ga0070695_100372857 | |||
| 1648 | Ga0070696_100004472 | |||
| 1649 | Ga0070696_100008735 | |||
| 1650 | Ga0070696_100132145 | |||
| 1651 | Ga0070696_100136880 | |||
| 1652 | Ga0070696_100482493 | |||
| 1653 | Ga0070693_100000020 | |||
| 1654 | Ga0070693_100001032 | |||
| 1655 | Ga0070693_100016413 | |||
| 1656 | Ga0070693_100048537 | |||
| 1657 | Ga0070693_100191673 | |||
| 1658 | Ga0070665_100090040 | |||
| 1659 | Ga0070665_100094505 | |||
| 1660 | Ga0070665_100233531 | |||
| 1661 | Ga0070704_100034988 | |||
| 1662 | Ga0070704_100044902 | |||
| 1663 | Ga0070704_100051733 | |||
| 1664 | Ga0070704_100073510 | |||
| 1665 | Ga0070704_100435210 | |||
| 1666 | Ga0068855_100000851 | |||
| 1667 | Ga0068855_100415329 | |||
| 1668 | Ga0070664_100008272 | |||
| 1669 | Ga0070664_100012432 | |||
| 1670 | Ga0070664_100013494 | |||
| 1671 | Ga0070664_100016938 | |||
| 1672 | Ga0070664_100017540 | |||
| 1673 | Ga0070664_100153417 | |||
| 1674 | Ga0070664_100447629 | |||
| 1675 | Ga0068857_100111843 | |||
| 1676 | Ga0068857_100522827 | |||
| 1677 | Ga0068857_100533118 | |||
| 1678 | Ga0068854_100028423 | |||
| 1679 | Ga0068854_100080260 | |||
| 1680 | Ga0068854_100088052 | |||
| 1681 | Ga0068854_100090916 | |||
| 1682 | Ga0068854_100094255 | |||
| 1683 | Ga0068854_100146364 | |||
| 1684 | Ga0068854_100188103 | |||
| 1685 | Ga0068854_100409739 | |||
| 1686 | Ga0068856_100001266 | |||
| 1687 | Ga0068856_100007738 | |||
| 1688 | Ga0068856_100021420 | |||
| 1689 | Ga0068856_100041410 | |||
| 1690 | Ga0068856_100043966 | |||
| 1691 | Ga0068856_100113986 | |||
| 1692 | Ga0068856_100150562 | |||
| 1693 | Ga0070702_100004287 | |||
| 1694 | Ga0070702_100045925 | |||
| 1695 | Ga0070702_100173108 | |||
| 1696 | Ga0068852_100004780 | |||
| 1697 | Ga0068852_100009135 | |||
| 1698 | Ga0068852_100030395 | |||
| 1699 | Ga0068852_100052395 | |||
| 1700 | Ga0068852_100193103 | |||
| 1701 | Ga0068852_100232831 | |||
| 1702 | Ga0068852_100349430 | |||
| 1703 | Ga0068852_100414311 | |||
| 1704 | Ga0068852_100448636 | |||
| 1705 | Ga0068852_100503609 | |||
| 1706 | Ga0068852_100658458 | |||
| 1707 | Ga0068859_100010506 | |||
| 1708 | Ga0068859_100025290 | |||
| 1709 | Ga0068859_100093632 | |||
| 1710 | Ga0068859_100119061 | |||
| 1711 | Ga0068859_100120162 | |||
| 1712 | Ga0068859_100218864 | |||
| 1713 | Ga0068859_100260891 | |||
| 1714 | Ga0068859_100292957 | |||
| 1715 | Ga0068859_100383412 | |||
| 1716 | Ga0068859_100839202 | |||
| 1717 | Ga0068864_100013432 | |||
| 1718 | Ga0068864_100013484 | |||
| 1719 | Ga0068864_100027347 | |||
| 1720 | Ga0068864_100054025 | |||
| 1721 | Ga0068864_100069208 | |||
| 1722 | Ga0068864_100238938 | |||
| 1723 | Ga0068864_100314510 | |||
| 1724 | Ga0068864_100366340 | |||
| 1725 | Ga0068864_100776172 | |||
| 1726 | Ga0068866_10096240 | |||
| 1727 | Ga0068861_100001185 | |||
| 1728 | Ga0068861_100008374 | |||
| 1729 | Ga0068861_100051497 | |||
| 1730 | Ga0068861_100075287 | |||
| 1731 | Ga0068861_100098338 | |||
| 1732 | Ga0068861_100288461 | |||
| 1733 | Ga0068861_100349298 | |||
| 1734 | Ga0068851_10002188 | |||
| 1735 | Ga0068851_10005121 | |||
| 1736 | Ga0068851_10016172 | |||
| 1737 | Ga0068851_10042656 | |||
| 1738 | Ga0068851_10144268 | |||
| 1739 | Ga0068851_10210458 | |||
| 1740 | Ga0068870_10001106 | |||
| 1741 | Ga0068870_10006234 | |||
| 1742 | Ga0068870_10018178 | |||
| 1743 | Ga0068870_10024092 | |||
| 1744 | Ga0068870_10134997 | |||
| 1745 | Ga0068870_10254068 | |||
| 1746 | Ga0068863_100025558 | |||
| 1747 | Ga0068863_100032342 | |||
| 1748 | Ga0068858_100009740 | |||
| 1749 | Ga0068858_100010516 | |||
| 1750 | Ga0068858_100085192 | |||
| 1751 | Ga0068858_100560235 | |||
| 1752 | Ga0068860_100043329 | |||
| 1753 | Ga0068860_100106048 | |||
| 1754 | Ga0068860_100122410 | |||
| 1755 | Ga0068860_100432137 | |||
| 1756 | Ga0068862_100045271 | |||
| 1757 | Ga0068862_100093709 | |||
| 1758 | Ga0068862_100113818 | |||
| 1759 | Ga0068862_100477121 | |||
| 1760 | Ga0081455_10001901 | |||
| 1761 | Ga0081455_10006052 | |||
| 1762 | Ga0081455_10141741 | |||
| 1763 | Ga0081455_10183882 | |||
| 1764 | Ga0081540_1000499 | |||
| 1765 | Ga0081539_10002686 | |||
| 1766 | Ga0070717_10013106 | |||
| 1767 | Ga0070717_10029645 | |||
| 1768 | Ga0070717_10040442 | |||
| 1769 | Ga0070717_10061612 | |||
| 1770 | Ga0070717_10118052 | |||
| 1771 | Ga0070717_10137318 | |||
| 1772 | Ga0070717_10207298 | |||
| 1773 | Ga0070717_10333040 | |||
| 1774 | Ga0075432_10013971 | |||
| 1775 | Ga0075432_10024263 | |||
| 1776 | Ga0075432_10112316 | |||
| 1777 | Ga0070715_10171457 | |||
| 1778 | Ga0070715_10172583 | |||
| 1779 | Ga0070716_100006100 | |||
| 1780 | Ga0070716_100201999 | |||
| 1781 | Ga0070716_100221858 | |||
| 1782 | Ga0070712_100002098 | |||
| 1783 | Ga0070712_100009698 | |||
| 1784 | Ga0070712_100111890 | |||
| 1785 | Ga0070712_100353551 | |||
| 1786 | Ga0097621_100010871 | |||
| 1787 | Ga0097621_100041881 | |||
| 1788 | Ga0097621_100063774 | |||
| 1789 | Ga0097621_100205267 | |||
| 1790 | Ga0097621_100220002 | |||
| 1791 | Ga0068871_100000503 | |||
| 1792 | Ga0068871_100337067 | |||
| 1793 | Ga0068871_100720802 | |||
| 1794 | Ga0075428_100061616 | |||
| 1795 | Ga0075428_100098505 | |||
| 1796 | Ga0075428_100218493 | |||
| 1797 | Ga0075428_100411589 | |||
| 1798 | Ga0075431_100035033 | |||
| 1799 | Ga0075431_100185807 | |||
| 1800 | Ga0075431_100372254 | |||
| 1801 | Ga0075431_100425991 | |||
| 1802 | Ga0075433_10009011 | |||
| 1803 | Ga0075433_10516784 | |||
| 1804 | Ga0075429_100077019 | |||
| 1805 | Ga0075429_100157047 | |||
| 1806 | Ga0068865_100021426 | |||
| 1807 | Ga0068865_100160437 | |||
| 1808 | Ga0075436_100018394 | |||
| 1809 | Ga0075436_100039010 | |||
| 1810 | Ga0075436_100041079 | |||
| 1811 | Ga0075436_100056795 | |||
| 1812 | Ga0075436_100061857 | |||
| 1813 | Ga0075436_100080953 | |||
| 1814 | Ga0075436_100096775 | |||
| 1815 | Ga0075436_100124483 | |||
| 1816 | Ga0097620_100010506 | |||
| 1817 | Ga0097620_100025291 | |||
| 1818 | Ga0097620_100093630 | |||
| 1819 | Ga0097620_100119061 | |||
| 1820 | Ga0097620_100120160 | |||
| 1821 | Ga0097620_100218865 | |||
| 1822 | Ga0097620_100260924 | |||
| 1823 | Ga0097620_100292945 | |||
| 1824 | Ga0097620_100383410 | |||
| 1825 | Ga0097620_100562806 | |||
| 1826 | Ga0097620_100839097 | |||
| 1827 | Ga0075435_100047027 | |||
| 1828 | Ga0075435_100113345 | |||
| 1829 | Ga0075435_100138981 | |||
| 1830 | Ga0105251_10118073 | |||
| 1831 | Ga0105240_10013856 | |||
| 1832 | Ga0105240_10023373 | |||
| 1833 | Ga0105240_10064011 | |||
| 1834 | Ga0105240_10082932 | |||
| 1835 | Ga0105240_10216004 | |||
| 1836 | Ga0111539_10000064 | |||
| 1837 | Ga0111539_10087725 | |||
| 1838 | Ga0111539_10105113 | |||
| 1839 | Ga0111539_10109990 | |||
| 1840 | Ga0111539_10193567 | |||
| 1841 | Ga0111539_10251428 | |||
| 1842 | Ga0111539_10499752 | |||
| 1843 | Ga0111539_10573670 | |||
| 1844 | Ga0111539_10785322 | |||
| 1845 | Ga0105245_10010595 | |||
| 1846 | Ga0105245_10020855 | |||
| 1847 | Ga0105245_10036803 | |||
| 1848 | Ga0105245_10150274 | |||
| 1849 | Ga0105245_10232560 | |||
| 1850 | Ga0105245_10373585 | |||
| 1851 | Ga0105245_10391207 | |||
| 1852 | Ga0105247_10311170 | |||
| 1853 | Ga0105247_10533706 | |||
| 1854 | Ga0114129_10001880 | |||
| 1855 | Ga0114129_10017058 | |||
| 1856 | Ga0114129_10075791 | |||
| 1857 | Ga0114129_10112210 | |||
| 1858 | Ga0114129_10128554 | |||
| 1859 | Ga0114129_10155526 | |||
| 1860 | Ga0114129_10358897 | |||
| 1861 | Ga0114129_10481199 | |||
| 1862 | Ga0114129_10522370 | |||
| 1863 | Ga0114129_10574998 | |||
| 1864 | Ga0105243_10014576 | |||
| 1865 | Ga0105243_10236995 | |||
| 1866 | Ga0105243_10272518 | |||
| 1867 | Ga0105243_10551563 | |||
| 1868 | Ga0105241_10004349 | |||
| 1869 | Ga0105241_10051464 | |||
| 1870 | Ga0105241_10054458 | |||
| 1871 | Ga0105241_10199737 | |||
| 1872 | Ga0105242_10025734 | |||
| 1873 | Ga0105242_10037405 | |||
| 1874 | Ga0105242_10074548 | |||
| 1875 | Ga0105242_10570486 | |||
| 1876 | Ga0105248_10012169 | |||
| 1877 | Ga0105248_10015081 | |||
| 1878 | Ga0105248_10017339 | |||
| 1879 | Ga0105248_10039915 | |||
| 1880 | Ga0105248_10090666 | |||
| 1881 | Ga0105248_10190483 | |||
| 1882 | Ga0105248_10209939 | |||
| 1883 | Ga0105248_10251477 | |||
| 1884 | Ga0105248_10324944 | |||
| 1885 | Ga0105248_10385056 | |||
| 1886 | Ga0105237_10162851 | |||
| 1887 | Ga0105237_10284011 | |||
| 1888 | Ga0105238_10004461 | |||
| 1889 | Ga0105238_10034540 | |||
| 1890 | Ga0105238_10100715 | |||
| 1891 | Ga0105238_10159977 | |||
| 1892 | Ga0105238_10206992 | |||
| 1893 | Ga0105238_10349827 | |||
| 1894 | Ga0105238_10518029 | |||
| 1895 | Ga0105238_10732782 | |||
| 1896 | Ga0105238_10845560 | |||
| 1897 | Ga0105249_10066462 | |||
| 1898 | Ga0105249_10257660 | |||
| 1899 | Ga0105249_10546180 | |||
| 1900 | Ga0105249_10552456 | |||
| 1901 | Ga0105239_10065721 | |||
| 1902 | Ga0105239_10149643 | |||
| 1903 | Ga0105239_10276220 | |||
| 1904 | Ga0105239_10319235 | |||
| 1905 | Ga0105239_10387234 | |||
| 1906 | Ga0105239_10396290 | |||
| 1907 | Ga0105239_10640255 | |||
| 1908 | Ga0105239_10670263 | |||
| 1909 | Ga0105246_10085614 | |||
| 1910 | Ga0105246_10123792 | |||
| 1911 | Ga0105246_10211656 | |||
| 1912 | Ga0105246_10285190 | |||
| 1913 | Ga0105246_10297590 | |||
| 1914 | Ga0157373_10004676 | |||
| 1915 | Ga0157373_10048687 | |||
| 1916 | Ga0157373_10084418 | |||
| 1917 | Ga0157373_10101315 | |||
| 1918 | Ga0157373_10112835 | |||
| 1919 | Ga0157373_10239014 | |||
| 1920 | Ga0157371_10000194 | |||
| 1921 | Ga0157371_10007173 | |||
| 1922 | Ga0157371_10022374 | |||
| 1923 | Ga0157371_10199607 | |||
| 1924 | Ga0157371_10390261 | |||
| 1925 | Ga0157370_10035098 | |||
| 1926 | Ga0157370_10328290 | |||
| 1927 | Ga0157370_10423534 | |||
| 1928 | Ga0157369_10045171 | |||
| 1929 | Ga0157369_10052573 | |||
| 1930 | Ga0157369_10053167 | |||
| 1931 | Ga0157369_10123392 | |||
| 1932 | Ga0157369_10225131 | |||
| 1933 | Ga0157369_10229383 | |||
| 1934 | Ga0157369_10431840 | |||
| 1935 | Ga0157369_10519487 | |||
| 1936 | Ga0157374_10004523 | |||
| 1937 | Ga0157374_10014228 | |||
| 1938 | Ga0157374_10065424 | |||
| 1939 | Ga0157374_10442221 | |||
| 1940 | Ga0157378_10000096 | |||
| 1941 | Ga0157378_10016168 | |||
| 1942 | Ga0157378_10016974 | |||
| 1943 | Ga0157378_10019706 | |||
| 1944 | Ga0157378_10022660 | |||
| 1945 | Ga0157378_10084570 | |||
| 1946 | Ga0157378_10114668 | |||
| 1947 | Ga0157378_10192438 | |||
| 1948 | Ga0163162_10059603 | |||
| 1949 | Ga0163162_10155929 | |||
| 1950 | Ga0163162_10160601 | |||
| 1951 | Ga0163162_10360207 | |||
| 1952 | Ga0163162_10477105 | |||
| 1953 | Ga0163162_10962083 | |||
| 1954 | Ga0157372_10001272 | |||
| 1955 | Ga0157372_10009986 | |||
| 1956 | Ga0157372_10019275 | |||
| 1957 | Ga0157372_10028514 | |||
| 1958 | Ga0157372_10068101 | |||
| 1959 | Ga0157372_10114423 | |||
| 1960 | Ga0157372_10125338 | |||
| 1961 | Ga0157372_10315415 | |||
| 1962 | Ga0157372_10322663 | |||
| 1963 | Ga0157372_10822693 | |||
| 1964 | Ga0157375_10042774 | |||
| 1965 | Ga0157375_10051146 | |||
| 1966 | Ga0157375_10073165 | |||
| 1967 | Ga0157375_10111831 | |||
| 1968 | Ga0157375_10114372 | |||
| 1969 | Ga0157375_10169154 | |||
| 1970 | Ga0157375_10177250 | |||
| 1971 | Ga0157375_10194534 | |||
| 1972 | Ga0157375_10217965 | |||
| 1973 | Ga0157375_10257326 | |||
| 1974 | Ga0157375_10541603 | |||
| 1975 | Ga0157375_10771302 | |||
| 1976 | Ga0163163_10008169 | |||
| 1977 | Ga0163163_10013554 | |||
| 1978 | Ga0163163_10067373 | |||
| 1979 | Ga0163163_10071464 | |||
| 1980 | Ga0163163_10093890 | |||
| 1981 | Ga0163163_10140102 | |||
| 1982 | Ga0163163_10206871 | |||
| 1983 | Ga0163163_10212223 | |||
| 1984 | Ga0163163_10229777 | |||
| 1985 | Ga0163163_10298226 | |||
| 1986 | Ga0163163_10323661 | |||
| 1987 | Ga0163163_10406279 | |||
| 1988 | Ga0157380_10008632 | |||
| 1989 | Ga0157380_10049281 | |||
| 1990 | Ga0157380_10079554 | |||
| 1991 | Ga0157380_10121576 | |||
| 1992 | Ga0157380_10169000 | |||
| 1993 | Ga0157380_10198969 | |||
| 1994 | Ga0157380_10291691 | |||
| 1995 | Ga0157380_10387488 | |||
| 1996 | Ga0157377_10007616 | |||
| 1997 | Ga0157379_10039304 | |||
| 1998 | Ga0157379_10092681 | |||
| 1999 | Ga0157376_10001459 | |||
| 2000 | Ga0157376_10010041 | |||
| 2001 | Ga0157376_10047502 | |||
| 2002 | Ga0157376_10094566 | |||
| 2003 | Ga0157376_10188986 | |||
| 2004 | Ga0157376_10401165 | |||
| 2005 | Ga0182007_10060079 | |||
| 2006 | Ga0182005_1055489 | |||
| 2007 | Ga0163161_10107775 | |||
| 2008 | Ga0163161_10118357 | |||
| 2009 | Ga0206352_11224960 | |||
| 2010 | Ga0206354_10113735 | |||
| 2011 | Ga0206353_11903863 | |||
| 2012 | Ga0213872_10003146 | |||
| 2013 | Ga0213872_10006882 | |||
| 2014 | Ga0213874_10001575 | |||
| 2015 | Ga0213876_10009276 | |||
| 2016 | Ga0213876_10014758 | |||
| 2017 | Ga0213876_10021751 | |||
| 2018 | Ga0213876_10042629 | |||
| 2019 | Ga0213875_10003698 | |||
| 2020 | Ga0213871_10020999 | |||
| 2021 | Ga0224712_10000571 | |||
| 2022 | Ga0224712_10019352 | |||
| 2023 | Ga0207666_1006966 | |||
| 2024 | Ga0207697_10011126 | |||
| 2025 | Ga0207697_10027077 | |||
| 2026 | Ga0207656_10000669 | |||
| 2027 | Ga0207656_10172577 | |||
| 2028 | Ga0207653_10000681 | |||
| 2029 | Ga0207653_10021398 | |||
| 2030 | Ga0207653_10080051 | |||
| 2031 | Ga0207682_10000951 | |||
| 2032 | Ga0207692_10165265 | |||
| 2033 | Ga0207692_10206572 | |||
| 2034 | Ga0207642_10009353 | |||
| 2035 | Ga0207642_10146300 | |||
| 2036 | Ga0207710_10160670 | |||
| 2037 | Ga0207688_10002506 | |||
| 2038 | Ga0207688_10003208 | |||
| 2039 | Ga0207688_10010851 | |||
| 2040 | Ga0207680_10141475 | |||
| 2041 | Ga0207680_10223271 | |||
| 2042 | Ga0207680_10305813 | |||
| 2043 | Ga0207647_10094678 | |||
| 2044 | Ga0207699_10333113 | |||
| 2045 | Ga0207699_10449587 | |||
| 2046 | Ga0207645_10002561 | |||
| 2047 | Ga0207645_10054141 | |||
| 2048 | Ga0207645_10071901 | |||
| 2049 | Ga0207643_10004055 | |||
| 2050 | Ga0207643_10017572 | |||
| 2051 | Ga0207643_10062639 | |||
| 2052 | Ga0207705_10007592 | |||
| 2053 | Ga0207705_10009381 | |||
| 2054 | Ga0207705_10037871 | |||
| 2055 | Ga0207705_10316038 | |||
| 2056 | Ga0207684_10008782 | |||
| 2057 | Ga0207684_10014738 | |||
| 2058 | Ga0207684_10020971 | |||
| 2059 | Ga0207684_10185181 | |||
| 2060 | Ga0207684_10293830 | |||
| 2061 | Ga0207684_10383681 | |||
| 2062 | Ga0207684_10426998 | |||
| 2063 | Ga0207684_10431684 | |||
| 2064 | Ga0207654_10084207 | |||
| 2065 | Ga0207654_10154384 | |||
| 2066 | Ga0207654_10244332 | |||
| 2067 | Ga0207707_10000024 | |||
| 2068 | Ga0207707_10007680 | |||
| 2069 | Ga0207707_10172286 | |||
| 2070 | Ga0207707_10389918 | |||
| 2071 | Ga0207695_10112408 | |||
| 2072 | Ga0207695_10114157 | |||
| 2073 | Ga0207695_10120895 | |||
| 2074 | Ga0207671_10044166 | |||
| 2075 | Ga0207671_10166602 | |||
| 2076 | Ga0207693_10020388 | |||
| 2077 | Ga0207693_10080439 | |||
| 2078 | Ga0207693_10162870 | |||
| 2079 | Ga0207693_10205575 | |||
| 2080 | Ga0207693_10318137 | |||
| 2081 | Ga0207693_10352847 | |||
| 2082 | Ga0207663_10010896 | |||
| 2083 | Ga0207660_10007323 | |||
| 2084 | Ga0207660_10061398 | |||
| 2085 | Ga0207660_10208374 | |||
| 2086 | Ga0207660_10361734 | |||
| 2087 | Ga0207660_10389267 | |||
| 2088 | Ga0207662_10031058 | |||
| 2089 | Ga0207657_10000191 | |||
| 2090 | Ga0207657_10000803 | |||
| 2091 | Ga0207657_10012467 | |||
| 2092 | Ga0207657_10018905 | |||
| 2093 | Ga0207657_10024271 | |||
| 2094 | Ga0207657_10043567 | |||
| 2095 | Ga0207657_10088183 | |||
| 2096 | Ga0207657_10328667 | |||
| 2097 | Ga0207649_10027777 | |||
| 2098 | Ga0207649_10064981 | |||
| 2099 | Ga0207649_10182667 | |||
| 2100 | Ga0207649_10257153 | |||
| 2101 | Ga0207649_10385887 | |||
| 2102 | Ga0207649_10491336 | |||
| 2103 | Ga0207652_10001822 | |||
| 2104 | Ga0207652_10107768 | |||
| 2105 | Ga0207652_10189236 | |||
| 2106 | Ga0207652_10240146 | |||
| 2107 | Ga0207652_10291978 | |||
| 2108 | Ga0207646_10009261 | |||
| 2109 | Ga0207646_10009438 | |||
| 2110 | Ga0207646_10028389 | |||
| 2111 | Ga0207646_10030548 | |||
| 2112 | Ga0207646_10052096 | |||
| 2113 | Ga0207646_10076645 | |||
| 2114 | Ga0207646_10245995 | |||
| 2115 | Ga0207646_10253573 | |||
| 2116 | Ga0207646_10256642 | |||
| 2117 | Ga0207681_10136932 | |||
| 2118 | Ga0207681_10165680 | |||
| 2119 | Ga0207681_10347823 | |||
| 2120 | Ga0207694_10108310 | |||
| 2121 | Ga0207694_10230572 | |||
| 2122 | Ga0207694_10602688 | |||
| 2123 | Ga0207650_10012392 | |||
| 2124 | Ga0207650_10013106 | |||
| 2125 | Ga0207650_10059914 | |||
| 2126 | Ga0207650_10085709 | |||
| 2127 | Ga0207650_10165861 | |||
| 2128 | Ga0207650_10222563 | |||
| 2129 | Ga0207650_10256947 | |||
| 2130 | Ga0207659_10005593 | |||
| 2131 | Ga0207659_10021384 | |||
| 2132 | Ga0207659_10118097 | |||
| 2133 | Ga0207659_10121055 | |||
| 2134 | Ga0207687_10069604 | |||
| 2135 | Ga0207687_10069930 | |||
| 2136 | Ga0207687_10078773 | |||
| 2137 | Ga0207687_10250474 | |||
| 2138 | Ga0207687_10269532 | |||
| 2139 | Ga0207687_10418557 | |||
| 2140 | Ga0207700_10005462 | |||
| 2141 | Ga0207700_10017762 | |||
| 2142 | Ga0207700_10029744 | |||
| 2143 | Ga0207700_10170441 | |||
| 2144 | Ga0207664_10094512 | |||
| 2145 | Ga0207664_10137071 | |||
| 2146 | Ga0207664_10216400 | |||
| 2147 | Ga0207664_10461285 | |||
| 2148 | Ga0207644_10152814 | |||
| 2149 | Ga0207644_10203583 | |||
| 2150 | Ga0207644_10231024 | |||
| 2151 | Ga0207690_10004965 | |||
| 2152 | Ga0207690_10013002 | |||
| 2153 | Ga0207690_10068233 | |||
| 2154 | Ga0207690_10092202 | |||
| 2155 | Ga0207690_10308460 | |||
| 2156 | Ga0207690_10379832 | |||
| 2157 | Ga0207690_10499436 | |||
| 2158 | Ga0207706_10000002 | |||
| 2159 | Ga0207706_10006191 | |||
| 2160 | Ga0207706_10011470 | |||
| 2161 | Ga0207706_10074276 | |||
| 2162 | Ga0207706_10288162 | |||
| 2163 | Ga0207706_10458213 | |||
| 2164 | Ga0207686_10019257 | |||
| 2165 | Ga0207686_10612703 | |||
| 2166 | Ga0207709_10053901 | |||
| 2167 | Ga0207709_10261787 | |||
| 2168 | Ga0207709_10408573 | |||
| 2169 | Ga0207670_10003005 | |||
| 2170 | Ga0207670_10004638 | |||
| 2171 | Ga0207669_10208666 | |||
| 2172 | Ga0207669_10526474 | |||
| 2173 | Ga0207704_10018445 | |||
| 2174 | Ga0207704_10099933 | |||
| 2175 | Ga0207704_10135165 | |||
| 2176 | Ga0207704_10167238 | |||
| 2177 | Ga0207665_10041860 | |||
| 2178 | Ga0207665_10118883 | |||
| 2179 | Ga0207665_10223344 | |||
| 2180 | Ga0207665_10262673 | |||
| 2181 | Ga0207665_10373071 | |||
| 2182 | Ga0207665_10404587 | |||
| 2183 | Ga0207691_10007193 | |||
| 2184 | Ga0207691_10026689 | |||
| 2185 | Ga0207691_10029163 | |||
| 2186 | Ga0207691_10038581 | |||
| 2187 | Ga0207691_10071392 | |||
| 2188 | Ga0207691_10124943 | |||
| 2189 | Ga0207691_10128099 | |||
| 2190 | Ga0207691_10150643 | |||
| 2191 | Ga0207691_10270057 | |||
| 2192 | Ga0207691_10317422 | |||
| 2193 | Ga0207691_10425562 | |||
| 2194 | Ga0207691_10543652 | |||
| 2195 | Ga0207711_10010167 | |||
| 2196 | Ga0207711_10015483 | |||
| 2197 | Ga0207711_10044113 | |||
| 2198 | Ga0207711_10119534 | |||
| 2199 | Ga0207711_10215604 | |||
| 2200 | Ga0207711_10275139 | |||
| 2201 | Ga0207711_10398225 | |||
| 2202 | Ga0207689_10005083 | |||
| 2203 | Ga0207689_10077559 | |||
| 2204 | Ga0207689_10087205 | |||
| 2205 | Ga0207689_10112674 | |||
| 2206 | Ga0207689_10542236 | |||
| 2207 | Ga0207661_10036657 | |||
| 2208 | Ga0207661_10068496 | |||
| 2209 | Ga0207661_10078014 | |||
| 2210 | Ga0207661_10097050 | |||
| 2211 | Ga0207661_10100043 | |||
| 2212 | Ga0207661_10151586 | |||
| 2213 | Ga0207661_10456623 | |||
| 2214 | Ga0207679_10003822 | |||
| 2215 | Ga0207679_10014208 | |||
| 2216 | Ga0207679_10043237 | |||
| 2217 | Ga0207679_10057148 | |||
| 2218 | Ga0207679_10126304 | |||
| 2219 | Ga0207679_10131726 | |||
| 2220 | Ga0207679_10146487 | |||
| 2221 | Ga0207679_10185965 | |||
| 2222 | Ga0207679_10284444 | |||
| 2223 | Ga0207679_10438611 | |||
| 2224 | Ga0207667_10004418 | |||
| 2225 | Ga0207667_10032823 | |||
| 2226 | Ga0207667_10125393 | |||
| 2227 | Ga0207667_10554825 | |||
| 2228 | Ga0207651_10222915 | |||
| 2229 | Ga0207651_10260811 | |||
| 2230 | Ga0207651_10376249 | |||
| 2231 | Ga0207651_10592555 | |||
| 2232 | Ga0207712_10104065 | |||
| 2233 | Ga0207712_10365229 | |||
| 2234 | Ga0207668_10015109 | |||
| 2235 | Ga0207668_10028317 | |||
| 2236 | Ga0207668_10413543 | |||
| 2237 | Ga0207640_10003940 | |||
| 2238 | Ga0207640_10077123 | |||
| 2239 | Ga0207640_10096946 | |||
| 2240 | Ga0207640_10107304 | |||
| 2241 | Ga0207640_10130501 | |||
| 2242 | Ga0207640_10205395 | |||
| 2243 | Ga0207658_10003234 | |||
| 2244 | Ga0207658_10012835 | |||
| 2245 | Ga0207658_10021191 | |||
| 2246 | Ga0207677_10124996 | |||
| 2247 | Ga0207677_10300163 | |||
| 2248 | Ga0207703_10006708 | |||
| 2249 | Ga0207703_10012469 | |||
| 2250 | Ga0207703_10041654 | |||
| 2251 | Ga0207639_10073154 | |||
| 2252 | Ga0207639_10082277 | |||
| 2253 | Ga0207639_10379412 | |||
| 2254 | Ga0207678_10001320 | |||
| 2255 | Ga0207678_10003238 | |||
| 2256 | Ga0207678_10032776 | |||
| 2257 | Ga0207678_10048524 | |||
| 2258 | Ga0207678_10050560 | |||
| 2259 | Ga0207678_10099332 | |||
| 2260 | Ga0207678_10104617 | |||
| 2261 | Ga0207678_10150771 | |||
| 2262 | Ga0207678_10266111 | |||
| 2263 | Ga0207678_10358445 | |||
| 2264 | Ga0207708_10000332 | |||
| 2265 | Ga0207708_10016548 | |||
| 2266 | Ga0207708_10022953 | |||
| 2267 | Ga0207708_10074229 | |||
| 2268 | Ga0207708_10224845 | |||
| 2269 | Ga0207702_10005409 | |||
| 2270 | Ga0207702_10027005 | |||
| 2271 | Ga0207702_10222523 | |||
| 2272 | Ga0207702_10227971 | |||
| 2273 | Ga0207702_10433196 | |||
| 2274 | Ga0207702_10462682 | |||
| 2275 | Ga0207702_10674004 | |||
| 2276 | Ga0207641_10045539 | |||
| 2277 | Ga0207641_10078799 | |||
| 2278 | Ga0207641_10208854 | |||
| 2279 | Ga0207641_10259086 | |||
| 2280 | Ga0207648_10067087 | |||
| 2281 | Ga0207648_10203294 | |||
| 2282 | Ga0207648_10365815 | |||
| 2283 | Ga0207648_10840789 | |||
| 2284 | Ga0207676_10001360 | |||
| 2285 | Ga0207676_10012318 | |||
| 2286 | Ga0207676_10042208 | |||
| 2287 | Ga0207676_10197728 | |||
| 2288 | Ga0207676_10525322 | |||
| 2289 | Ga0207674_10000448 | |||
| 2290 | Ga0207674_10003819 | |||
| 2291 | Ga0207674_10326795 | |||
| 2292 | Ga0207675_100009102 | |||
| 2293 | Ga0207675_100060836 | |||
| 2294 | Ga0207675_100084655 | |||
| 2295 | Ga0207675_100107813 | |||
| 2296 | Ga0207675_100242167 | |||
| 2297 | Ga0207675_100331889 | |||
| 2298 | Ga0207675_100333430 | |||
| 2299 | Ga0207675_100415353 | |||
| 2300 | Ga0207675_100618792 | |||
| 2301 | Ga0207683_10000149 | |||
| 2302 | Ga0207683_10009678 | |||
| 2303 | Ga0207683_10065683 | |||
| 2304 | Ga0207683_10600696 | |||
| 2305 | Ga0207698_10003598 | |||
| 2306 | Ga0207698_10038132 | |||
| 2307 | Ga0207698_10185303 | |||
| 2308 | Ga0207698_10352826 | |||
| 2309 | Ga0207698_10368580 | |||
| 2310 | Ga0207698_10588917 | |||
| 2311 | Ga0207698_10804740 | |||
| 2312 | Ga0209967_1008467 | |||
| 2313 | Ga0209974_10012565 | |||
| 2314 | Ga0209974_10027239 | |||
| 2315 | Ga0207428_10000072 | |||
| 2316 | Ga0207428_10002698 | |||
| 2317 | Ga0207428_10020431 | |||
| 2318 | Ga0207428_10065860 | |||
| 2319 | Ga0207428_10085201 | |||
| 2320 | Ga0268266_10029805 | |||
| 2321 | Ga0268266_10044294 | |||
| 2322 | Ga0268266_10324979 | |||
| 2323 | Ga0268266_10586022 | |||
| 2324 | Ga0268265_10110263 | |||
| 2325 | Ga0268265_10377869 | |||
| 2326 | Ga0268265_10472137 | |||
| 2327 | Ga0268265_10496649 | |||
| 2328 | Ga0268264_10050173 | |||
| 2329 | Ga0265760_10081849 | |||
| 2330 | Ga0265325_10094975 | |||
| 2331 | Ga0265331_10002707 | |||
| 2332 | Ga0307408_100033591 | |||
| 2333 | Ga0307408_100054596 | |||
| 2334 | Ga0307408_100076424 | |||
| 2335 | Ga0307408_100470870 | |||
| 2336 | Ga0265313_10005718 | |||
| 2337 | Ga0307405_10011596 | |||
| 2338 | Ga0307405_10043442 | |||
| 2339 | Ga0307413_10012971 | |||
| 2340 | Ga0307410_10013832 | |||
| 2341 | Ga0307410_10072835 | |||
| 2342 | Ga0307406_10006760 | |||
| 2343 | Ga0307406_10056972 | |||
| 2344 | Ga0307409_100025562 | |||
| 2345 | Ga0307416_100031445 | |||
| 2346 | Ga0307416_100120964 | |||
| 2347 | Ga0307416_100239094 | |||
| 2348 | Ga0307416_101179138 | |||
| 2349 | Ga0307414_10137439 | |||
| 2350 | Ga0307411_10051894 | |||
| 2351 | Ga0307415_100055138 | |||
| 2352 | Ga0373959_0013323 | |||
| 2353 | Ga0373940_0102513 | |||
| 2354 | Ga0373944_0018814 | |||
| 2355 | Ga0373923_0019300 | |||
| 2356 | Ga0373923_0032591 | |||
| 2357 | Ga0373923_0039117 | |||
| 2358 | Ga0373945_0001361 | |||
| 2359 | Ga0373953_0018456 | |||
| 2360 | Ga0373953_0065816 | |||
| 2361 | Ga0373953_0160012 | |||
| 2362 | Ga0373954_0001017 | |||
| 2363 | Ga0373954_0059817 | |||
| 2364 | Ga0373954_0094919 | |||
| 2365 | Ga0373956_0028285 | |||
| 2366 | Ga0373957_0044664 | |||
| 2367 | Ga0373957_0068011 | |||
| 2368 | Ga0373960_0031871 | |||
| 2369 | Ga0373943_0001535 | |||
| 2370 | Ga0373943_0063938 | |||
| 2371 | Ga0373943_0142379 | |||
| 2372 | Ga0373955_0001468 | |||
| 2373 | Ga0373955_0100296 | |||
| 2374 | Ga0373924_0031294 | |||
| 2375 | Ga0373924_0034660 | |||
| 2376 | Ga0373924_0041991 | |||
| 2377 | Ga0373935_0001935 | |||
| 2378 | Ga0373935_0089076 | |||
| 2379 | Ga0373935_0361388 | |||
| 2380 | Ga0373927_0000183 | |||
| 2381 | Ga0373933_0011413 | |||
| 2382 | Ga0373933_0021584 | |||
| 2383 | Ga0373933_0065213 | |||
| 2384 | Ga0373933_0147475 | |||
| 2385 | Ga0373947_0032445 | |||
| 2386 | Ga0373947_0040547 | |||
| 2387 | Ga0373947_0094710 | |||
| 2388 | Ga0373937_0000322 | |||
| 2389 | Ga0373937_0007114 | |||
| 2390 | Ga0373937_0080739 | |||
| 2391 | Ga0373937_0366777 | |||
| 2392 | Ga0373937_0735545 | |||
| 2393 | Ga0373925_0000968 | |||
| 2394 | Ga0373925_0035583 | |||
| 2395 | Ga0373925_0394747 | |||
| 2396 | Ga0395899_0084152 | |||
| 2397 | Ga0395899_0333801 | |||
| 2398 | Ga0395900_0052741 | |||
| 2399 | Ga0395900_0187296 | |||
| 2400 | Ga0395900_0238073 | |||
| 2401 | Ga0395900_0361118 | |||
| 2402 | Ga0395898_0076360 | |||
| 2403 | Ga0395898_0125826 | |||
| 2404 | Ga0395898_0247412 | |||
| 2405 | Ga0395898_0353600 | |||
| 2406 | Ga0395898_0662208 | |||
| 2407 | Ga0395905_0018238 | |||
| 2408 | Ga0395905_0128966 | |||
| 2409 | Ga0395905_0194279 | |||
| 2410 | Ga0395905_0261798 | |||
| 2411 | Ga0395905_0460205 | |||
| 2412 | Ga0436364_0544449 | |||
| 2413 | Ga0436364_1013023 | |||
| 2414 | Ga0395901_0065895 | |||
| 2415 | Ga0395901_0066500 | |||
| 2416 | Ga0395901_0175999 | |||
| 2417 | Ga0395901_0348274 | |||
| 2418 | Ga0242420_039130 | |||
| 2419 | Ga0436365_0094208 | |||
| 2420 | Ga0436365_0191952 | |||
| 2421 | Ga0436365_0880151 | |||
| 2422 | Ga0436365_1346676 | |||
| 2423 | Ga0436360_0058232 | |||
| 2424 | Ga0436360_0783882 | |||
| 2425 | Ga0436360_1179520 | |||
| 2426 | Ga0436360_1321134 | |||
| 2427 | Ga0436361_0261014 | |||
| 2428 | Ga0436361_0454886 | |||
| 2429 | Ga0436361_0525774 | |||
| 2430 | Ga0436361_0706873 | |||
| 2431 | Ga0436361_0848238 | |||
| 2432 | Ga0436363_0288618 | |||
| 2433 | Ga0436363_1183006 | |||
| 2434 | Ga0436363_1684541 | |||
| 2435 | Ga0436362_0679855 | |||
| 2436 | Ga0436362_0833669 | |||
| 2437 | Ga0451793_1662783 | |||
| 2438 | Ga0451797_0072722 | |||
| 2439 | Ga0451798_0072560 | |||
| 2440 | Ga0451802_1305020 | |||
| 2441 | Ga0451804_0228842 | |||
| 2442 | Ga0451807_0712184 | |||
| 2443 | Ga0451833_0043459 | |||
| 2444 | Ga0451835_0080592 | |||
| 2445 | Ga0451839_0448670 | |||
| 2446 | Ga0451839_1605409 | |||
| 2447 | Ga0451841_0873514 | |||
| 2448 | Ga0451845_0486646 | |||
| 2449 | Ga0451847_0251987 | |||
| 2450 | Ga0451851_0137226 | |||
| 2451 | Ga0451853_0418015 | |||
| 2452 | Ga0451853_1821962 | |||
| 2453 | Ga0450923_005780 | |||
| 2454 | Ga0450905_012760 | |||
| 2455 | Ga0439458_0017600 | |||
| 2456 | Ga0453683_0069608 | |||
| 2457 | Ga0466963_0197579 | |||
| 2458 | Ga0466963_0380790 | |||
| 2459 | Ga0466957_0199330 | |||
| 2460 | Ga0466960_0136832 | |||
| 2461 | Ga0466960_0162547 | |||
| 2462 | Ga0466959_0313486 | |||
| 2463 | Ga0466958_0060342 | |||
| 2464 | Ga0466958_0084573 | |||
| 2465 | Ga0466967_0017190 | |||
| 2466 | Ga0466967_0044835 | |||
| 2467 | Ga0466967_0065667 | |||
| 2468 | Ga0466967_0067893 | |||
| 2469 | Ga0466967_0118335 | |||
| 2470 | Ga0466967_0204227 | |||
| 2471 | Ga0466967_0273701 | |||
| 2472 | Ga0466967_0309901 | |||
| 2473 | Ga0495592_0066955 | |||
| 2474 | Ga0495629_0021945 | |||
| 2475 | Ga0495641_0025443 | |||
| 2476 | Ga0495651_0004356 | |||
| 2477 | Ga0495651_0306927 | |||
| 2478 | Ga0495653_0017170 | |||
| 2479 | Ga0495653_0125549 | |||
| 2480 | Ga0495653_0209583 | |||
| 2481 | Ga0495580_0000500 | |||
| 2482 | Ga0495580_0001068 | |||
| 2483 | Ga0495580_0087508 | |||
| 2484 | Ga0495580_0300703 | |||
| 2485 | Ga0495582_0033871 | |||
| 2486 | Ga0495594_0105739 | |||
| 2487 | Ga0495608_0004624 | |||
| 2488 | Ga0495608_0056468 | |||
| 2489 | Ga0495608_0130020 | |||
| 2490 | Ga0495608_0140686 | |||
| 2491 | Ga0495618_0033235 | |||
| 2492 | Ga0495628_0293026 | |||
| 2493 | Ga0495630_0096180 | |||
| 2494 | Ga0495652_0006523 | |||
| 2495 | Ga0495652_0330965 | |||
| 2496 | Ga0495640_0007963 | |||
| 2497 | Ga0495587_0003574 | |||
| 2498 | Ga0495587_0006332 | |||
| 2499 | Ga0495598_0056569 | |||
| 2500 | Ga0495645_0036219 | |||
| 2501 | Ga0495667_0003750 | |||
| 2502 | Ga0495634_0023432 | |||
| 2503 | Ga0495634_0214320 | |||
| 2504 | Ga0495635_0058796 | |||
| 2505 | Ga0495635_0130605 | |||
| 2506 | Ga0495657_0016434 | |||
| 2507 | Ga0495599_0030437 | |||
| 2508 | Ga0495599_0111974 | |||
| 2509 | Ga0495623_0043834 | |||
| 2510 | Ga0495623_0046024 | |||
| 2511 | Ga0495646_0043718 | |||
| 2512 | Ga0495646_0050605 | |||
| 2513 | Ga0495658_0004476 | |||
| 2514 | Ga0495600_0026000 | |||
| 2515 | Ga0495581_0198312 | |||
| 2516 | Ga0495604_0000783 | |||
| 2517 | Ga0495604_0003938 | |||
| 2518 | Ga0495674_0004090 | |||
| 2519 | Ga0495674_0016598 | |||
| 2520 | Ga0495674_0060299 | |||
| 2521 | Ga0495676_0109881 | |||
| 2522 | Ga0495676_0247941 | |||
| 2523 | Ga0495680_0015221 | |||
| 2524 | Ga0495680_0074607 | |||
| 2525 | Ga0495684_0008401 | |||
| 2526 | Ga0495684_0037640 | |||
| 2527 | Ga0495684_0053231 | |||
| 2528 | Ga0495684_0497683 | |||
| 2529 | Ga0495593_0009656 | |||
| 2530 | Ga0495593_0029170 | |||
| 2531 | Ga0495602_0002020 | |||
| 2532 | Ga0495602_0178268 | |||
| 2533 | Ga0495602_0294028 | |||
| 2534 | Ga0495602_0406497 | |||
| 2535 | Ga0496100_0018281 | |||
| 2536 | Ga0496100_0028439 | |||
| 2537 | Ga0496100_0061623 | |||
| 2538 | Ga0496100_0200326 | |||
| 2539 | Ga0496100_0264156 | |||
| 2540 | Ga0496100_0503855 | |||
| 2541 | Ga0496100_0508098 | |||
| 2542 | Ga0496101_0003818 | |||
| 2543 | Ga0496101_0004247 | |||
| 2544 | Ga0496101_0014478 | |||
| 2545 | Ga0496101_0112399 | |||
| 2546 | Ga0496101_0120422 | |||
| 2547 | Ga0496101_0195094 | |||
| 2548 | Ga0496101_0458852 | |||
| 2549 | Ga0496102_0029077 | |||
| 2550 | Ga0496102_0098744 | |||
| 2551 | Ga0496102_0102267 | |||
| 2552 | Ga0496102_0104152 | |||
| 2553 | Ga0496102_0241893 | |||
| 2554 | Ga0496102_0273683 | |||
| 2555 | Ga0496102_0390968 | |||
| 2556 | Ga0496102_0472061 | |||
| 2557 | Ga0496102_0490820 | |||
| 2558 | Ga0496102_0578357 | |||
| 2559 | Ga0496102_0591351 | |||
| 2560 | Ga0496103_0048201 | |||
| 2561 | Ga0496103_0078178 | |||
| 2562 | Ga0496104_0000167 | |||
| 2563 | Ga0496104_0028614 | |||
| 2564 | Ga0496104_0031553 | |||
| 2565 | Ga0496104_0039204 | |||
| 2566 | Ga0496104_0108221 | |||
| 2567 | Ga0496104_0149854 | |||
| 2568 | Ga0496104_0154013 | |||
| 2569 | Ga0496104_0327573 | |||
| 2570 | Ga0496104_0675385 | |||
| 2571 | Ga0496105_0000083 | |||
| 2572 | Ga0496105_0007382 | |||
| 2573 | Ga0496105_0019383 | |||
| 2574 | Ga0496105_0045210 | |||
| 2575 | Ga0496105_0051397 | |||
| 2576 | Ga0496106_0006055 | |||
| 2577 | Ga0496106_0029260 | |||
| 2578 | Ga0496106_0060991 | |||
| 2579 | Ga0496107_0006330 | |||
| 2580 | Ga0496107_0022244 | |||
| 2581 | Ga0496107_0026519 | |||
| 2582 | Ga0496107_0033001 | |||
| 2583 | Ga0496107_0295853 | |||
| 2584 | Ga0496108_0002129 | |||
| 2585 | Ga0496108_0004679 | |||
| 2586 | Ga0496108_0033434 | |||
| 2587 | Ga0496108_0057046 | |||
| 2588 | Ga0496108_0189008 | |||
| 2589 | Ga0496108_0338428 | |||
| 2590 | Ga0496109_0000623 | |||
| 2591 | Ga0496109_0001231 | |||
| 2592 | Ga0496109_0007631 | |||
| 2593 | Ga0496109_0009484 | |||
| 2594 | Ga0496109_0012320 | |||
| 2595 | Ga0496109_0172317 | |||
| 2596 | Ga0496109_0260413 | |||
| 2597 | Ga0496109_0280776 | |||
| 2598 | Ga0496109_0376987 | |||
| 2599 | Ga0496109_0520416 | |||
| 2600 | Ga0496110_0001030 | |||
| 2601 | Ga0496110_0002179 | |||
| 2602 | Ga0496110_0006144 | |||
| 2603 | Ga0496110_0007632 | |||
| 2604 | Ga0496110_0029683 | |||
| 2605 | Ga0496110_0110284 | |||
| 2606 | Ga0496110_0217518 | |||
| 2607 | Ga0496110_0387730 | |||
| 2608 | Ga0496110_0392012 | |||
| 2609 | Ga0496110_0498448 | |||
| 2610 | Ga0496110_0517527 | |||
| 2611 | Ga0496111_0000921 | |||
| 2612 | Ga0496111_0041077 | |||
| 2613 | Ga0496111_0053922 | |||
| 2614 | Ga0496111_0054806 | |||
| 2615 | Ga0496111_0073485 | |||
| 2616 | Ga0496111_0301635 | |||
| 2617 | Ga0496112_0001502 | |||
| 2618 | Ga0496112_0058936 | |||
| 2619 | Ga0496112_0061440 | |||
| 2620 | Ga0496112_0100065 | |||
| 2621 | Ga0496112_0100329 | |||
| 2622 | Ga0496112_0224555 | |||
| 2623 | Ga0496112_0497772 | |||
| 2624 | Ga0496112_0782169 | |||
| 2625 | Ga0496113_0004075 | |||
| 2626 | Ga0496113_0028499 | |||
| 2627 | Ga0496113_0056375 | |||
| 2628 | Ga0496113_0332993 | |||
| 2629 | Ga0496113_0366608 | |||
| 2630 | Ga0496114_0001254 | |||
| 2631 | Ga0496114_0013086 | |||
| 2632 | Ga0496114_0135628 | |||
| 2633 | Ga0496114_0256704 | |||
| 2634 | Ga0496114_0271856 | |||
| 2635 | Ga0496114_0282652 | |||
| 2636 | Ga0496114_0387347 | |||
| 2637 | Ga0496115_0083173 | |||
| 2638 | Ga0496115_0114929 | |||
| 2639 | Ga0496115_0150903 | |||
| 2640 | Ga0496115_0305010 | |||
| 2641 | Ga0496115_0422601 | |||
| 2642 | Ga0496126_0021743 | |||
| 2643 | Ga0501296_006066 | |||
| 2644 | Ga0501298_002123 | |||
| 2645 | Ga0501298_005037 | |||
| 2646 | Ga0501299_002377 | |||
| 2647 | Ga0501036_0069978 | |||
| 2648 | Ga0501038_0092144 | |||
| 2649 | Ga0501039_0081199 | |||
| 2650 | Ga0501039_0231411 | |||
| 2651 | Ga0501040_0023928 | |||
| 2652 | Ga0501040_0029582 | |||
| 2653 | Ga0501040_0064763 | |||
| 2654 | Ga0501041_0219371 | |||
| 2655 | Ga0501042_0025812 | |||
| 2656 | Ga0501042_0050846 | |||
| 2657 | Ga0501048_0016407 | |||
| 2658 | Ga0501048_0048218 | |||
| 2659 | Ga0501048_0220282 | |||
| 2660 | Ga0501067_0024971 | |||
| 2661 | Ga0501069_0108195 | |||
| 2662 | Ga0501071_0040920 | |||
| 2663 | Ga0501072_0023273 | |||
| 2664 | Ga0501072_0027653 | |||
| 2665 | Ga0501072_0053504 | |||
| 2666 | Ga0501074_0102484 | |||
| 2667 | Ga0501075_0045199 | |||
| 2668 | Ga0501075_0049291 | |||
| 2669 | Ga0501075_0094335 | |||
| 2670 | Ga0501076_0001759 | |||
| 2671 | Ga0501076_0014191 | |||
| 2672 | Ga0501076_0114164 | |||
| 2673 | Ga0501076_0130486 | |||
| 2674 | Ga0501076_0243851 | |||
| 2675 | Ga0501077_0025123 | |||
| 2676 | Ga0501077_0062273 | |||
| 2677 | Ga0501202_042048 | |||
| 2678 | Ga0501223_023385 | |||
| 2679 | Ga0501235_004711 | |||
| 2680 | Ga0501249_025916 | |||
| 2681 | Ga0501257_019313 | |||
| 2682 | Ga0501079_0009208 | |||
| 2683 | Ga0501079_0094543 | |||
| 2684 | Ga0501080_0014423 | |||
| 2685 | Ga0501081_0035110 | |||
| 2686 | Ga0501081_0036738 | |||
| 2687 | Ga0501265_014461 | |||
| 2688 | Ga0501045_0060367 | |||
| 2689 | nmdc:mga05p37_106118_c1 | |||
| 2690 | nmdc:mga05p37_14213_c1 | |||
| 2691 | nmdc:mga05p37_162828_c1 | |||
| 2692 | nmdc:mga05p37_26968_c1 | |||
| 2693 | nmdc:mga05p37_434924_c1 | |||
| 2694 | nmdc:mga05p37_58622_c1 | |||
| 2695 | nmdc:mga05p37_78300_c1 | |||
| 2696 | nmdc:mga05p37_866452_c1 | |||
| 2697 | nmdc:mga09592_23571_c1 | |||
| 2698 | nmdc:mga09592_556577_c1 | |||
| 2699 | nmdc:mga06r32_144309_c1 | |||
| 2700 | nmdc:mga06r32_25643_c1 | |||
| 2701 | nmdc:mga06r32_496061_c1 | |||
| 2702 | nmdc:mga06r32_642745_c1 | |||
| 2703 | nmdc:mga08y16_138580_c1 | |||
| 2704 | nmdc:mga08y16_179387_c1 | |||
| 2705 | nmdc:mga08y16_18658_c1 | |||
| 2706 | nmdc:mga08y16_197053_c1 | |||
| 2707 | nmdc:mga08y16_209478_c1 | |||
| 2708 | nmdc:mga08y16_214296_c1 | |||
| 2709 | nmdc:mga08y16_38_c1 | |||
| 2710 | nmdc:mga08y16_497981_c1 | |||
| 2711 | nmdc:mga08y16_675516_c1 | |||
| 2712 | nmdc:mga0n895_186385_c1 | |||
| 2713 | nmdc:mga0n895_355263_c1 | |||
| 2714 | nmdc:mga0n895_58672_c1 | |||
| 2715 | nmdc:mga0n895_75415_c1 | |||
| 2716 | nmdc:mga0rr50_105029_c1 | |||
| 2717 | nmdc:mga0rr50_175720_c1 | |||
| 2718 | nmdc:mga0rr50_423418_c1 | |||
| 2719 | nmdc:mga0rr50_7295_c1 | |||
| 2720 | nmdc:mga0rr50_96220_c1 | |||
| 2721 | nmdc:mga08x19_11338_c1 | |||
| 2722 | nmdc:mga08x19_178239_c1 | |||
| 2723 | nmdc:mga08x19_8975_c1 | |||
| 2724 | nmdc:mga0a205_187043_c1 | |||
| 2725 | nmdc:mga0a205_217968_c1 | |||
| 2726 | nmdc:mga0a205_39466_c1 | |||
| 2727 | nmdc:mga0a205_456043_c1 | |||
| 2728 | nmdc:mga0a205_486710_c1 | |||
| 2729 | Ga0495601_0004962 | |||
| 2730 | Ga0495601_0014415 | |||
| 2731 | Ga0495612_0001144 | |||
| 2732 | Ga0495612_0066922 | |||
| 2733 | Ga0495595_0002877 | |||
| 2734 | Ga0495595_0021393 | |||
| 2735 | Ga0495595_0238156 | |||
| 2736 | Ga0495619_0050037 | |||
| 2737 | Ga0495619_0121493 | |||
| 2738 | Ga0501084_0044422 | |||
| 2739 | Ga0501084_0082603 | |||
| 2740 | Ga0501084_0201099 | |||
| 2741 | Ga0590071_000260 | |||
| 2742 | Ga0590077_002003 | |||
| 2743 | Ga0587066_016689 | |||
| 2744 | Ga0587070_037393 | |||
| 2745 | Ga0587073_0004438 | |||
| 2746 | Ga0587077_005903 | |||
| 2747 | Ga0587082_024639 | |||
| 2748 | Ga0587083_0019546 | |||
| 2749 | Ga0587088_003851 | |||
| 2750 | Ga0587090_030405 | |||
| 2751 | Ga0587094_003692 | |||
| 2752 | Ga0587101_022744 | |||
| 2753 | Ga0587067_017334 | |||
| 2754 | Ga0587069_004623 | |||
| 2755 | Ga0587071_024378 | |||
| 2756 | Ga0587111_0019825 | |||
| 2757 | Ga0501082_0069661 | |||
| 2758 | Ga0501082_0078051 | |||
| 2759 | Ga0501082_0140393 | |||
| 2760 | Ga0501082_0172508 | |||
| 2761 | Ga0530510_0018597 | |||
| 2762 | Ga0530510_0035953 | |||
| 2763 | Ga0530510_0184051 | |||
| 2764 | Ga0530510_0244295 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.9261 | 2 | 264 |
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.9193 | 2 | 264 |
| 4q3l-assembly1.cif.gz_A | crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library | 0.9149 | 2 | 264 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.9135 | 2 | 118 |
| 8b6p-assembly2.cif.gz_B | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.9128 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KMX1_1_216_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9246 | 2 | 115 | 3.40.50.1820 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9178 | 2 | 85 | 3.40.50.12270 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.911 | 2 | 263 | 3.40.50.1820 |
| 4q3lC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9083 | 3 | 262 | 3.40.50.1820 |
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.898 | 2 | 264 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6XQ55-F1-model_v4 | Rhodanese domain-containing protein | 0.9758 | 1 | 118 |
GO:0016787
|
| AF-A0A7W1LDM9-F1-model_v4 | Alpha/beta fold hydrolase | 0.974 | 2 | 111 |
GO:0016787
|
| AF-A0A2V8T9S3-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9673 | 2 | 103 |
GO:0016787
|
| AF-A0A377LX29-F1-model_v4 | Putative hydrolase (EC 3.3.2.10) | 0.9639 | 2 | 118 |
GO:0004301
|
| AF-A0A2E9N5U3-F1-model_v4 | Alpha/beta hydrolase | 0.9606 | 2 | 107 |
GO:0016020
GO:0016787 |