F493491
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1377 | 659 | 1263 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0204925|Ga0501043_0204925_520_1389 |
| Length | 289 |
| Sequence | LRDIDAPPGGTMIMLPVLVFSFIVRRHLASGDQRGDQRMTSVLLITGGASGIGAETARRAASRGYSVALNYRTRDTEAKKVVADVEAKGAKAVAIKADMARETDIVRMFEETTQALGPVTHLLNSAGISRQMRVADYDASVLTTLFATNVTGLMLCCREAVKRMSTKHGGKGGAIVNVSSLAATLGGRQGSSAYAATKGAVDSFTRGFAREVAGEGIRVNTLRPGMVLTEMTEKRLGDAVFRNHIQSSIPMGRVGKAGEIADAALWLLSDEAAFITGAMLDAAGGGYNI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 4 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 5 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 6 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 7 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 8 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 9 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 10 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 11 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 14 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 15 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 16 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 17 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 18 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 19 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 20 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 21 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 22 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 23 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 24 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 25 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 26 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 27 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 28 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 29 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 30 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 31 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 32 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 33 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 34 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 35 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 36 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 37 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 38 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 39 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 40 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 41 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 42 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 43 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 44 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 45 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 46 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 47 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 48 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 49 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 50 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 51 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 52 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 53 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 54 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 55 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 56 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 57 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 58 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 59 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 60 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 61 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 62 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 63 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 64 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 65 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 66 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 67 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 68 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 69 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 70 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 71 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 72 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 73 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 74 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 75 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 76 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 77 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 78 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 79 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 80 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 81 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 82 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 83 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 84 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 85 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 86 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 87 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 88 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 89 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 90 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 91 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 92 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 93 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 94 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 95 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 96 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 97 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 98 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 99 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 100 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 101 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 102 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 103 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 104 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 105 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 107 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 108 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 110 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 111 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 112 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 113 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 114 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 115 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 116 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 117 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 118 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 119 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 120 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 121 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 122 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 123 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 124 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 125 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 126 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 127 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 128 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 129 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 130 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 132 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 137 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 140 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 144 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 146 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 157 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 175 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 177 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 178 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 181 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 189 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 191 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 192 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 193 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 195 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 196 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 197 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 198 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 199 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 200 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 201 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 202 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 203 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 204 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 205 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 206 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 207 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 209 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 210 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 211 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 215 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 216 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 217 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 218 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 220 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 221 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 222 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 223 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 224 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 225 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 226 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 227 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 228 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 230 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 246 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 264 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 265 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 267 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 275 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 356 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 360 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 361 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 362 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 363 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 364 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 365 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 366 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 367 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 368 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 369 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 370 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 371 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 372 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 373 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 374 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 375 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 376 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 377 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 378 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 379 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 380 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 381 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 382 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 383 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 384 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 385 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 386 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 387 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 388 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 389 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 390 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 391 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 392 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 393 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 394 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 395 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 396 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 397 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 398 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 399 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 400 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 402 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 403 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 404 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 405 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 406 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 407 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 408 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 409 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 412 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 413 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 414 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 415 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 416 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 417 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 418 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 419 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 420 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 421 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 422 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 423 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 424 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 425 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 426 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 427 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 428 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 429 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 430 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 431 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 432 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 433 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 434 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 435 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 436 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 437 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 438 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 439 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 440 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 441 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 442 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 443 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 444 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 445 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 446 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 447 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 448 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 449 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 450 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 451 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 452 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 453 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 454 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 455 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 456 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 457 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 458 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 459 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 460 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 461 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 462 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 551 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 552 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 553 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 554 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 555 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 556 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 557 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 558 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 559 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 560 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 561 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 562 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 563 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 564 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 565 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 566 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 567 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 568 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 569 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 570 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 571 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 572 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 573 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 600 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 601 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 605 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 606 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 607 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 608 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 623 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 625 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 626 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 627 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 628 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 629 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 630 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 631 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 632 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 633 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 634 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 635 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 636 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 637 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 638 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 639 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 640 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 641 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 642 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 643 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 644 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 645 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 646 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 648 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 649 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 650 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 651 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 652 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 653 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 654 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 655 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 656 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 657 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 658 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 659 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.58 |
| Metatranscriptomes | 0.15 |
| Isolates | 8.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.03 |
| Nodule | 6.75 |
| Rhizoplane | 4.07 |
| Rhizosphere | 80.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3421311 | 2162886007 | Bacteria | 1335 |
| 2 | 2214772983 | 2209111006 | Bacteria | 12374 |
| 3 | ARcpr5oldR_c000140 | 3300000041 | Bacteria | 12413 |
| 4 | ARcpr5oldR_c007944 | 3300000041 | Bacteria | 900 |
| 5 | ARSoilYngRDRAFT_c00234 | 3300000042 | Bacteria | 8859 |
| 6 | ARSoilOldRDRAFT_c000126 | 3300000044 | Bacteria | 13655 |
| 7 | ARCol0oldRDRAFT_c00368 | 3300000045 | Bacteria | 4373 |
| 8 | ARCol0yngRDRAFT_1001388 | 3300000652 | Bacteria | 1988 |
| 9 | JGI24752J21851_1002485 | 3300001976 | Bacteria | 2455 |
| 10 | JGI24739J22299_10014140 | 3300001989 | Bacteria | 2905 |
| 11 | JGI24737J22298_10000960 | 3300001990 | Bacteria | 10240 |
| 12 | JGI24737J22298_10007118 | 3300001990 | Bacteria | 3790 |
| 13 | JGI24745J21846_1000099 | 3300002073 | Bacteria | 6492 |
| 14 | JGI24738J21930_10000223 | 3300002075 | Bacteria | 15332 |
| 15 | JGI24034J26672_10000557 | 3300002239 | Bacteria | 4762 |
| 16 | JGI24742J22300_10000264 | 3300002244 | Bacteria | 7810 |
| 17 | JGI24751J29686_10014205 | 3300002459 | Bacteria | 1644 |
| 18 | JGI25156J39149_1007168 | 3300002705 | Bacteria | 2962 |
| 19 | JGI25162J39368_1000996 | 3300002737 | Bacteria | 17861 |
| 20 | JGI25157J39369_1002448 | 3300002741 | Bacteria | 4619 |
| 21 | JGI25152J39213_1003754 | 3300002773 | Bacteria | 5065 |
| 22 | JGI25151J46595_10011807 | 3300003187 | Bacteria | 4001 |
| 23 | JGI25151J46595_10044197 | 3300003187 | Bacteria | 1585 |
| 24 | JGI25165J46597_1000052 | 3300003214 | Bacteria | 236064 |
| 25 | JGI25165J46597_1000819 | 3300003214 | Bacteria | 23374 |
| 26 | JGI25165J46597_1001228 | 3300003214 | Bacteria | 15275 |
| 27 | rootL2_10099291 | 3300003322 | Bacteria | 1779 |
| 28 | Ga0055536_1004740 | 3300003781 | Bacteria | 6836 |
| 29 | Ga0055536_1008523 | 3300003781 | Bacteria | 4394 |
| 30 | Ga0055534_1000464 | 3300003784 | Bacteria | 23141 |
| 31 | Ga0055528_1005404 | 3300003790 | Bacteria | 5956 |
| 32 | Ga0055531_10001782 | 3300003794 | Bacteria | 15294 |
| 33 | JGI25405J52794_10016886 | 3300003911 | Bacteria | 1445 |
| 34 | Ga0065704_10074561 | 3300005289 | Bacteria | 6184 |
| 35 | Ga0065712_10070835 | 3300005290 | Bacteria | 5657 |
| 36 | Ga0065712_10074294 | 3300005290 | Bacteria | 4134 |
| 37 | Ga0065715_10003522 | 3300005293 | Bacteria | 3983 |
| 38 | Ga0070658_10007004 | 3300005327 | Bacteria | 9104 |
| 39 | Ga0070658_10038546 | 3300005327 | Bacteria | 3853 |
| 40 | Ga0070658_10068898 | 3300005327 | Bacteria | 2893 |
| 41 | Ga0070658_10073399 | 3300005327 | Bacteria | 2805 |
| 42 | Ga0070658_10121287 | 3300005327 | Bacteria | 2172 |
| 43 | Ga0070676_10000012 | 3300005328 | Bacteria | 58061 |
| 44 | Ga0070676_10103970 | 3300005328 | Bacteria | 1759 |
| 45 | Ga0070676_10275987 | 3300005328 | Bacteria | 1131 |
| 46 | Ga0070683_100000139 | 3300005329 | Bacteria | 46987 |
| 47 | Ga0070683_100028063 | 3300005329 | Bacteria | 5084 |
| 48 | Ga0070690_100005164 | 3300005330 | Bacteria | 7309 |
| 49 | Ga0070690_100005412 | 3300005330 | Bacteria | 7168 |
| 50 | Ga0070670_100028821 | 3300005331 | Bacteria | 4779 |
| 51 | Ga0070670_100103508 | 3300005331 | Bacteria | 2452 |
| 52 | Ga0070670_100158033 | 3300005331 | Bacteria | 1964 |
| 53 | Ga0070670_100321229 | 3300005331 | Bacteria | 1356 |
| 54 | Ga0070677_10000125 | 3300005333 | Bacteria | 25491 |
| 55 | Ga0070677_10010258 | 3300005333 | Bacteria | 3200 |
| 56 | Ga0068869_100000605 | 3300005334 | Bacteria | 20215 |
| 57 | Ga0068869_100087083 | 3300005334 | Bacteria | 2343 |
| 58 | Ga0070666_10017025 | 3300005335 | Bacteria | 4656 |
| 59 | Ga0070666_10030551 | 3300005335 | Bacteria | 3550 |
| 60 | Ga0070680_100000179 | 3300005336 | Bacteria | 40975 |
| 61 | Ga0070680_100004099 | 3300005336 | Bacteria | 10914 |
| 62 | Ga0070680_100014505 | 3300005336 | Bacteria | 6165 |
| 63 | Ga0070680_100099250 | 3300005336 | Bacteria | 2416 |
| 64 | Ga0070680_100117098 | 3300005336 | Bacteria | 2221 |
| 65 | Ga0070680_100264523 | 3300005336 | Bacteria | 1455 |
| 66 | Ga0070680_100378803 | 3300005336 | Bacteria | 1204 |
| 67 | Ga0070682_100000319 | 3300005337 | Bacteria | 33197 |
| 68 | Ga0070682_100016170 | 3300005337 | Bacteria | 4335 |
| 69 | Ga0068868_100000593 | 3300005338 | Bacteria | 24375 |
| 70 | Ga0068868_100060491 | 3300005338 | Bacteria | 2999 |
| 71 | Ga0070660_100001605 | 3300005339 | Bacteria | 15534 |
| 72 | Ga0070660_100004143 | 3300005339 | Bacteria | 10011 |
| 73 | Ga0070660_100143095 | 3300005339 | Bacteria | 1920 |
| 74 | Ga0070660_100227297 | 3300005339 | Bacteria | 1518 |
| 75 | Ga0070689_100004685 | 3300005340 | Bacteria | 9267 |
| 76 | Ga0070689_100062016 | 3300005340 | Bacteria | 2908 |
| 77 | Ga0070689_100341791 | 3300005340 | Bacteria | 1253 |
| 78 | Ga0070691_10001565 | 3300005341 | Bacteria | 9871 |
| 79 | Ga0070691_10010361 | 3300005341 | Bacteria | 4252 |
| 80 | Ga0070687_100003572 | 3300005343 | Bacteria | 6061 |
| 81 | Ga0070661_100001455 | 3300005344 | Bacteria | 16432 |
| 82 | Ga0070661_100130814 | 3300005344 | Bacteria | 1885 |
| 83 | Ga0070661_100153007 | 3300005344 | Bacteria | 1744 |
| 84 | Ga0070661_100171662 | 3300005344 | Bacteria | 1647 |
| 85 | Ga0070692_10000434 | 3300005345 | Bacteria | 12695 |
| 86 | Ga0070692_10002195 | 3300005345 | Bacteria | 7472 |
| 87 | Ga0070668_100004423 | 3300005347 | Bacteria | 10433 |
| 88 | Ga0070668_100535252 | 3300005347 | Bacteria | 1018 |
| 89 | Ga0070669_100000409 | 3300005353 | Bacteria | 32911 |
| 90 | Ga0070675_100000166 | 3300005354 | Bacteria | 40573 |
| 91 | Ga0070675_100043171 | 3300005354 | Bacteria | 3684 |
| 92 | Ga0070675_100053571 | 3300005354 | Bacteria | 3318 |
| 93 | Ga0070675_100246730 | 3300005354 | Bacteria | 1561 |
| 94 | Ga0070671_100005938 | 3300005355 | Bacteria | 9730 |
| 95 | Ga0070671_100006280 | 3300005355 | Bacteria | 9470 |
| 96 | Ga0070671_100094656 | 3300005355 | Bacteria | 2504 |
| 97 | Ga0070671_100197434 | 3300005355 | Bacteria | 1706 |
| 98 | Ga0070671_100231824 | 3300005355 | Bacteria | 1567 |
| 99 | Ga0070674_100000644 | 3300005356 | Bacteria | 17586 |
| 100 | Ga0070674_100012815 | 3300005356 | Bacteria | 5160 |
| 101 | Ga0070674_100029715 | 3300005356 | Bacteria | 3605 |
| 102 | Ga0070674_100317081 | 3300005356 | Bacteria | 1249 |
| 103 | Ga0070673_100000041 | 3300005364 | Bacteria | 54096 |
| 104 | Ga0070673_100057607 | 3300005364 | Bacteria | 3070 |
| 105 | Ga0070673_100058559 | 3300005364 | Bacteria | 3046 |
| 106 | Ga0070688_100000180 | 3300005365 | Bacteria | 33887 |
| 107 | Ga0070688_100011831 | 3300005365 | Bacteria | 4866 |
| 108 | Ga0070688_100049523 | 3300005365 | Bacteria | 2615 |
| 109 | Ga0070659_100000752 | 3300005366 | Bacteria | 23551 |
| 110 | Ga0070659_100007504 | 3300005366 | Bacteria | 7924 |
| 111 | Ga0070659_100107888 | 3300005366 | Bacteria | 2246 |
| 112 | Ga0070667_100000365 | 3300005367 | Bacteria | 49335 |
| 113 | Ga0070667_100209204 | 3300005367 | Bacteria | 1733 |
| 114 | Ga0070667_100515964 | 3300005367 | Bacteria | 1096 |
| 115 | Ga0070703_10003914 | 3300005406 | Bacteria | 4219 |
| 116 | Ga0070703_10012992 | 3300005406 | Bacteria | 2360 |
| 117 | Ga0070709_10003137 | 3300005434 | Bacteria | 8867 |
| 118 | Ga0070709_10019500 | 3300005434 | Bacteria | 3922 |
| 119 | Ga0070709_10236320 | 3300005434 | Bacteria | 1310 |
| 120 | Ga0070709_10304704 | 3300005434 | Bacteria | 1164 |
| 121 | Ga0070714_100045790 | 3300005435 | Bacteria | 3709 |
| 122 | Ga0070714_100098674 | 3300005435 | Bacteria | 2570 |
| 123 | Ga0070714_100110282 | 3300005435 | Bacteria | 2436 |
| 124 | Ga0070713_100034352 | 3300005436 | Bacteria | 4072 |
| 125 | Ga0070710_10005022 | 3300005437 | Bacteria | 6261 |
| 126 | Ga0070710_10044400 | 3300005437 | Bacteria | 2466 |
| 127 | Ga0070701_10000493 | 3300005438 | Bacteria | 13517 |
| 128 | Ga0070701_10012908 | 3300005438 | Bacteria | 3784 |
| 129 | Ga0070701_10133855 | 3300005438 | Unclassified | 1411 |
| 130 | Ga0070701_10411171 | 3300005438 | Bacteria | 860 |
| 131 | Ga0070711_100015744 | 3300005439 | Bacteria | 4789 |
| 132 | Ga0070711_100030851 | 3300005439 | Bacteria | 3553 |
| 133 | Ga0070711_100054801 | 3300005439 | Bacteria | 2753 |
| 134 | Ga0070705_100002314 | 3300005440 | Bacteria | 9618 |
| 135 | Ga0070705_100148366 | 3300005440 | Bacteria | 1553 |
| 136 | Ga0070700_100000467 | 3300005441 | Bacteria | 20231 |
| 137 | Ga0070694_100000065 | 3300005444 | Bacteria | 49515 |
| 138 | Ga0070694_100029375 | 3300005444 | Bacteria | 3587 |
| 139 | Ga0070694_100116812 | 3300005444 | Bacteria | 1909 |
| 140 | Ga0070708_100113795 | 3300005445 | Bacteria | 2489 |
| 141 | Ga0070708_100267667 | 3300005445 | Bacteria | 1607 |
| 142 | Ga0070663_100000473 | 3300005455 | Bacteria | 21137 |
| 143 | Ga0070663_100019373 | 3300005455 | Bacteria | 4483 |
| 144 | Ga0070663_100054747 | 3300005455 | Bacteria | 2853 |
| 145 | Ga0070678_100000091 | 3300005456 | Bacteria | 34559 |
| 146 | Ga0070678_100007141 | 3300005456 | Bacteria | 6603 |
| 147 | Ga0070678_100018286 | 3300005456 | Bacteria | 4542 |
| 148 | Ga0070678_100034927 | 3300005456 | Bacteria | 3505 |
| 149 | Ga0070678_100479335 | 3300005456 | Bacteria | 1094 |
| 150 | Ga0070662_100006535 | 3300005457 | Bacteria | 7521 |
| 151 | Ga0070662_100043231 | 3300005457 | Bacteria | 3222 |
| 152 | Ga0070662_100128907 | 3300005457 | Bacteria | 1948 |
| 153 | Ga0070662_100165636 | 3300005457 | Bacteria | 1732 |
| 154 | Ga0070681_10010003 | 3300005458 | Bacteria | 9350 |
| 155 | Ga0070681_10092484 | 3300005458 | Bacteria | 2973 |
| 156 | Ga0070681_10092722 | 3300005458 | Bacteria | 2969 |
| 157 | Ga0068867_100000859 | 3300005459 | Bacteria | 20487 |
| 158 | Ga0068867_100017280 | 3300005459 | Bacteria | 5123 |
| 159 | Ga0068867_100349822 | 3300005459 | Bacteria | 1233 |
| 160 | Ga0068867_100489759 | 3300005459 | Bacteria | 1055 |
| 161 | Ga0070685_10001731 | 3300005466 | Bacteria | 11442 |
| 162 | Ga0070685_10015115 | 3300005466 | Bacteria | 4096 |
| 163 | Ga0070685_10041755 | 3300005466 | Bacteria | 2615 |
| 164 | Ga0074259_12095147 | 3300005507 | Bacteria | 2029 |
| 165 | Ga0070679_100006957 | 3300005530 | Bacteria | 10555 |
| 166 | Ga0070679_100009091 | 3300005530 | Bacteria | 9377 |
| 167 | Ga0070679_100012754 | 3300005530 | Bacteria | 8038 |
| 168 | Ga0070679_100097400 | 3300005530 | Bacteria | 2929 |
| 169 | Ga0070679_100236656 | 3300005530 | Bacteria | 1785 |
| 170 | Ga0070679_100265204 | 3300005530 | Bacteria | 1672 |
| 171 | Ga0070679_100784827 | 3300005530 | Bacteria | 896 |
| 172 | Ga0070684_100000219 | 3300005535 | Bacteria | 39995 |
| 173 | Ga0070684_100228069 | 3300005535 | Bacteria | 1700 |
| 174 | Ga0070697_100534991 | 3300005536 | Bacteria | 1027 |
| 175 | Ga0068853_100000600 | 3300005539 | Bacteria | 24713 |
| 176 | Ga0068853_100005223 | 3300005539 | Bacteria | 10160 |
| 177 | Ga0068853_100185112 | 3300005539 | Bacteria | 1890 |
| 178 | Ga0068853_100232654 | 3300005539 | Bacteria | 1686 |
| 179 | Ga0070672_100000019 | 3300005543 | Bacteria | 69855 |
| 180 | Ga0070672_100065787 | 3300005543 | Bacteria | 2868 |
| 181 | Ga0070672_100108041 | 3300005543 | Bacteria | 2265 |
| 182 | Ga0070672_100625671 | 3300005543 | Unclassified | 939 |
| 183 | Ga0070686_100007875 | 3300005544 | Bacteria | 5955 |
| 184 | Ga0070686_100032042 | 3300005544 | Unclassified | 3220 |
| 185 | Ga0070686_100100051 | 3300005544 | Bacteria | 1957 |
| 186 | Ga0070695_100000474 | 3300005545 | Bacteria | 20848 |
| 187 | Ga0070696_100003100 | 3300005546 | Bacteria | 11055 |
| 188 | Ga0070696_100078891 | 3300005546 | Bacteria | 2329 |
| 189 | Ga0070693_100001868 | 3300005547 | Bacteria | 9623 |
| 190 | Ga0070693_100096721 | 3300005547 | Bacteria | 1790 |
| 191 | Ga0070693_100291868 | 3300005547 | Bacteria | 1096 |
| 192 | Ga0070665_100010015 | 3300005548 | Bacteria | 9588 |
| 193 | Ga0070665_100138556 | 3300005548 | Bacteria | 2436 |
| 194 | Ga0070665_100322171 | 3300005548 | Bacteria | 1550 |
| 195 | Ga0070704_100000252 | 3300005549 | Bacteria | 23218 |
| 196 | Ga0070704_100001606 | 3300005549 | Bacteria | 12238 |
| 197 | Ga0068855_100018421 | 3300005563 | Bacteria | 8389 |
| 198 | Ga0068855_100019721 | 3300005563 | Bacteria | 8099 |
| 199 | Ga0068855_100094398 | 3300005563 | Bacteria | 3449 |
| 200 | Ga0068855_100136866 | 3300005563 | Bacteria | 2794 |
| 201 | Ga0068855_100263165 | 3300005563 | Bacteria | 1920 |
| 202 | Ga0070664_100000819 | 3300005564 | Bacteria | 23927 |
| 203 | Ga0070664_100022255 | 3300005564 | Bacteria | 5227 |
| 204 | Ga0070664_100106972 | 3300005564 | Bacteria | 2438 |
| 205 | Ga0070664_100183771 | 3300005564 | Bacteria | 1860 |
| 206 | Ga0068857_100000768 | 3300005577 | Bacteria | 23872 |
| 207 | Ga0068857_100016644 | 3300005577 | Bacteria | 6441 |
| 208 | Ga0068857_100281877 | 3300005577 | Bacteria | 1529 |
| 209 | Ga0068857_100336134 | 3300005577 | Bacteria | 1397 |
| 210 | Ga0068857_100351722 | 3300005577 | Bacteria | 1364 |
| 211 | Ga0068854_100001736 | 3300005578 | Bacteria | 13299 |
| 212 | Ga0068854_100080315 | 3300005578 | Bacteria | 2406 |
| 213 | Ga0068854_100112791 | 3300005578 | Bacteria | 2053 |
| 214 | Ga0068854_100169225 | 3300005578 | Bacteria | 1699 |
| 215 | Ga0068856_100002295 | 3300005614 | Bacteria | 19718 |
| 216 | Ga0068856_100035175 | 3300005614 | Bacteria | 4908 |
| 217 | Ga0068856_100110986 | 3300005614 | Bacteria | 2739 |
| 218 | Ga0068856_100144924 | 3300005614 | Bacteria | 2383 |
| 219 | Ga0068856_100747445 | 3300005614 | Bacteria | 998 |
| 220 | Ga0070702_100000898 | 3300005615 | Bacteria | 11591 |
| 221 | Ga0070702_100050904 | 3300005615 | Bacteria | 2368 |
| 222 | Ga0068852_100001992 | 3300005616 | Bacteria | 13920 |
| 223 | Ga0068852_100118580 | 3300005616 | Bacteria | 2418 |
| 224 | Ga0068852_100230669 | 3300005616 | Bacteria | 1764 |
| 225 | Ga0068859_100389314 | 3300005617 | Unclassified | 1490 |
| 226 | Ga0068864_100029150 | 3300005618 | Bacteria | 4670 |
| 227 | Ga0068864_100279994 | 3300005618 | Bacteria | 1556 |
| 228 | Ga0068866_10001028 | 3300005718 | Bacteria | 12272 |
| 229 | Ga0068861_100000169 | 3300005719 | Bacteria | 34559 |
| 230 | Ga0068861_100660716 | 3300005719 | Bacteria | 967 |
| 231 | Ga0068851_10038538 | 3300005834 | Bacteria | 2398 |
| 232 | Ga0068870_10000586 | 3300005840 | Bacteria | 13817 |
| 233 | Ga0068863_100000381 | 3300005841 | Bacteria | 45003 |
| 234 | Ga0068863_100198046 | 3300005841 | Bacteria | 1931 |
| 235 | Ga0068863_100396538 | 3300005841 | Bacteria | 1349 |
| 236 | Ga0068858_100009197 | 3300005842 | Bacteria | 9441 |
| 237 | Ga0068858_100348350 | 3300005842 | Bacteria | 1419 |
| 238 | Ga0068860_100001472 | 3300005843 | Bacteria | 25432 |
| 239 | Ga0068860_100081520 | 3300005843 | Bacteria | 3077 |
| 240 | Ga0068862_100001886 | 3300005844 | Bacteria | 19006 |
| 241 | Ga0068862_100065508 | 3300005844 | Bacteria | 3129 |
| 242 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 243 | Ga0081455_10012017 | 3300005937 | Bacteria | 8664 |
| 244 | Ga0081455_10056729 | 3300005937 | Bacteria | 3324 |
| 245 | Ga0081540_1011095 | 3300005983 | Bacteria | 6048 |
| 246 | Ga0081540_1050829 | 3300005983 | Bacteria | 2054 |
| 247 | Ga0070717_10000199 | 3300006028 | Bacteria | 41940 |
| 248 | Ga0070717_10616900 | 3300006028 | Bacteria | 984 |
| 249 | Ga0075365_10062820 | 3300006038 | Bacteria | 2485 |
| 250 | Ga0075365_10101999 | 3300006038 | Bacteria | 1966 |
| 251 | Ga0075365_10304165 | 3300006038 | Bacteria | 1122 |
| 252 | Ga0075363_100001113 | 3300006048 | Bacteria | 9759 |
| 253 | Ga0075363_100096961 | 3300006048 | Bacteria | 1629 |
| 254 | Ga0075432_10000873 | 3300006058 | Bacteria | 9497 |
| 255 | Ga0075432_10083948 | 3300006058 | Bacteria | 1158 |
| 256 | Ga0070715_10049118 | 3300006163 | Bacteria | 1807 |
| 257 | Ga0070716_100002448 | 3300006173 | Bacteria | 8559 |
| 258 | Ga0070712_100120706 | 3300006175 | Bacteria | 1972 |
| 259 | Ga0075362_10000122 | 3300006177 | Bacteria | 21744 |
| 260 | Ga0075367_10004445 | 3300006178 | Bacteria | 6850 |
| 261 | Ga0075367_10034749 | 3300006178 | Bacteria | 2914 |
| 262 | Ga0075369_10205047 | 3300006186 | Bacteria | 910 |
| 263 | Ga0075366_10019342 | 3300006195 | Bacteria | 3939 |
| 264 | Ga0075366_10128560 | 3300006195 | Bacteria | 1528 |
| 265 | Ga0097621_100001234 | 3300006237 | Bacteria | 17707 |
| 266 | Ga0097621_100036113 | 3300006237 | Bacteria | 3952 |
| 267 | Ga0097621_100176973 | 3300006237 | Bacteria | 1842 |
| 268 | Ga0068871_100000068 | 3300006358 | Bacteria | 57531 |
| 269 | Ga0068871_100012500 | 3300006358 | Bacteria | 6262 |
| 270 | Ga0068871_100025352 | 3300006358 | Bacteria | 4612 |
| 271 | Ga0068871_100232041 | 3300006358 | Bacteria | 1602 |
| 272 | Ga0075428_100035558 | 3300006844 | Bacteria | 5491 |
| 273 | Ga0075430_100004696 | 3300006846 | Bacteria | 11490 |
| 274 | Ga0075431_100006639 | 3300006847 | Bacteria | 11490 |
| 275 | Ga0075433_10001599 | 3300006852 | Bacteria | 16784 |
| 276 | Ga0075433_10099038 | 3300006852 | Bacteria | 2581 |
| 277 | Ga0075434_100000576 | 3300006871 | Bacteria | 28251 |
| 278 | Ga0075434_100001666 | 3300006871 | Bacteria | 18944 |
| 279 | Ga0075434_100113294 | 3300006871 | Bacteria | 2724 |
| 280 | Ga0075429_100060828 | 3300006880 | Bacteria | 3289 |
| 281 | Ga0068865_100005133 | 3300006881 | Bacteria | 7927 |
| 282 | Ga0075436_100070922 | 3300006914 | Bacteria | 2409 |
| 283 | Ga0075436_100238776 | 3300006914 | Bacteria | 1292 |
| 284 | Ga0097620_100389303 | 3300006931 | Unclassified | 1490 |
| 285 | Ga0075435_100002716 | 3300007076 | Bacteria | 11816 |
| 286 | Ga0075435_100010036 | 3300007076 | Bacteria | 6904 |
| 287 | Ga0105251_10030580 | 3300009011 | Bacteria | 2702 |
| 288 | Ga0105244_10159346 | 3300009036 | Bacteria | 1078 |
| 289 | Ga0105250_10061706 | 3300009092 | Bacteria | 1508 |
| 290 | Ga0105240_10014101 | 3300009093 | Bacteria | 10923 |
| 291 | Ga0105240_10068510 | 3300009093 | Bacteria | 4394 |
| 292 | Ga0111539_10000082 | 3300009094 | Bacteria | 96811 |
| 293 | Ga0111539_10000503 | 3300009094 | Bacteria | 49808 |
| 294 | Ga0111539_10003417 | 3300009094 | Bacteria | 20918 |
| 295 | Ga0111539_10315126 | 3300009094 | Bacteria | 1820 |
| 296 | Ga0105245_10000780 | 3300009098 | Bacteria | 28901 |
| 297 | Ga0105245_10091423 | 3300009098 | Bacteria | 2801 |
| 298 | Ga0105245_10113448 | 3300009098 | Bacteria | 2523 |
| 299 | Ga0105247_10002726 | 3300009101 | Bacteria | 11844 |
| 300 | Ga0105247_10029759 | 3300009101 | Bacteria | 3310 |
| 301 | Ga0105247_10078113 | 3300009101 | Bacteria | 2081 |
| 302 | Ga0105247_10095825 | 3300009101 | Bacteria | 1890 |
| 303 | Ga0114129_10009008 | 3300009147 | Bacteria | 14232 |
| 304 | Ga0114129_10013874 | 3300009147 | Bacteria | 11481 |
| 305 | Ga0105243_10001083 | 3300009148 | Bacteria | 24917 |
| 306 | Ga0105243_10032306 | 3300009148 | Bacteria | 4043 |
| 307 | Ga0105243_10033088 | 3300009148 | Bacteria | 3996 |
| 308 | Ga0105243_10096320 | 3300009148 | Bacteria | 2448 |
| 309 | Ga0105243_10481400 | 3300009148 | Bacteria | 1171 |
| 310 | Ga0105241_10000760 | 3300009174 | Bacteria | 24503 |
| 311 | Ga0105241_10072064 | 3300009174 | Bacteria | 2684 |
| 312 | Ga0105241_10095627 | 3300009174 | Bacteria | 2352 |
| 313 | Ga0105241_10432246 | 3300009174 | Bacteria | 1161 |
| 314 | Ga0105241_10678471 | 3300009174 | Bacteria | 938 |
| 315 | Ga0105242_10019812 | 3300009176 | Bacteria | 5270 |
| 316 | Ga0105242_10230382 | 3300009176 | Bacteria | 1660 |
| 317 | Ga0105248_10011305 | 3300009177 | Bacteria | 9844 |
| 318 | Ga0105248_10021002 | 3300009177 | Bacteria | 7235 |
| 319 | Ga0105248_10031416 | 3300009177 | Bacteria | 5936 |
| 320 | Ga0105248_10167723 | 3300009177 | Bacteria | 2475 |
| 321 | Ga0105248_10429777 | 3300009177 | Bacteria | 1487 |
| 322 | Ga0105237_10006171 | 3300009545 | Bacteria | 13387 |
| 323 | Ga0105237_10024205 | 3300009545 | Bacteria | 6213 |
| 324 | Ga0105237_10038056 | 3300009545 | Bacteria | 4859 |
| 325 | Ga0105238_10013907 | 3300009551 | Bacteria | 8139 |
| 326 | Ga0105238_10019606 | 3300009551 | Bacteria | 6886 |
| 327 | Ga0105238_10021283 | 3300009551 | Bacteria | 6609 |
| 328 | Ga0105238_10024469 | 3300009551 | Bacteria | 6153 |
| 329 | Ga0105238_10036872 | 3300009551 | Bacteria | 4972 |
| 330 | Ga0105238_10074611 | 3300009551 | Bacteria | 3384 |
| 331 | Ga0105238_10632641 | 3300009551 | Bacteria | 1079 |
| 332 | Ga0105249_10002196 | 3300009553 | Bacteria | 16907 |
| 333 | Ga0105249_10007626 | 3300009553 | Bacteria | 9439 |
| 334 | Ga0105249_10028272 | 3300009553 | Bacteria | 5062 |
| 335 | Ga0105249_10134000 | 3300009553 | Bacteria | 2369 |
| 336 | Ga0105249_10142930 | 3300009553 | Bacteria | 2296 |
| 337 | Ga0105249_10143026 | 3300009553 | Bacteria | 2296 |
| 338 | Ga0123342_1007031 | 3300009766 | Bacteria | 15168 |
| 339 | Ga0105239_10002791 | 3300010375 | Bacteria | 21868 |
| 340 | Ga0105239_10047454 | 3300010375 | Bacteria | 4707 |
| 341 | Ga0105239_10060085 | 3300010375 | Bacteria | 4171 |
| 342 | Ga0105239_10222845 | 3300010375 | Bacteria | 2115 |
| 343 | Ga0105246_10001585 | 3300011119 | Bacteria | 13535 |
| 344 | Ga0105246_10009274 | 3300011119 | Bacteria | 6058 |
| 345 | Ga0105246_10096520 | 3300011119 | Bacteria | 2143 |
| 346 | Ga0105246_10113686 | 3300011119 | Bacteria | 1993 |
| 347 | Ga0157373_10001948 | 3300013100 | Bacteria | 15667 |
| 348 | Ga0157373_10006240 | 3300013100 | Bacteria | 8908 |
| 349 | Ga0157371_10085248 | 3300013102 | Bacteria | 2238 |
| 350 | Ga0157371_10085742 | 3300013102 | Bacteria | 2231 |
| 351 | Ga0157371_10443528 | 3300013102 | Bacteria | 954 |
| 352 | Ga0157370_10092033 | 3300013104 | Bacteria | 2846 |
| 353 | Ga0157370_10103800 | 3300013104 | Bacteria | 2660 |
| 354 | Ga0157370_10344776 | 3300013104 | Bacteria | 1373 |
| 355 | Ga0157370_10649341 | 3300013104 | Bacteria | 964 |
| 356 | Ga0157369_10269257 | 3300013105 | Bacteria | 1775 |
| 357 | Ga0157369_10959270 | 3300013105 | Bacteria | 876 |
| 358 | Ga0157374_10001691 | 3300013296 | Bacteria | 18474 |
| 359 | Ga0157374_10141327 | 3300013296 | Bacteria | 2337 |
| 360 | Ga0157378_10001445 | 3300013297 | Bacteria | 21386 |
| 361 | Ga0157378_10052925 | 3300013297 | Bacteria | 3612 |
| 362 | Ga0157378_10127916 | 3300013297 | Bacteria | 2348 |
| 363 | Ga0163162_10000790 | 3300013306 | Bacteria | 29412 |
| 364 | Ga0163162_10018394 | 3300013306 | Bacteria | 6847 |
| 365 | Ga0163162_10093404 | 3300013306 | Bacteria | 3093 |
| 366 | Ga0163162_10134911 | 3300013306 | Bacteria | 2579 |
| 367 | Ga0163162_10327920 | 3300013306 | Unclassified | 1663 |
| 368 | Ga0163162_10756418 | 3300013306 | Bacteria | 1091 |
| 369 | Ga0157372_10009037 | 3300013307 | Bacteria | 10590 |
| 370 | Ga0157372_10023483 | 3300013307 | Bacteria | 6685 |
| 371 | Ga0157372_10232691 | 3300013307 | Bacteria | 2136 |
| 372 | Ga0157372_10515578 | 3300013307 | Bacteria | 1394 |
| 373 | Ga0157372_11143932 | 3300013307 | Unclassified | 900 |
| 374 | Ga0157375_10000468 | 3300013308 | Bacteria | 36848 |
| 375 | Ga0157375_10078898 | 3300013308 | Bacteria | 3327 |
| 376 | Ga0163163_10003322 | 3300014325 | Bacteria | 13641 |
| 377 | Ga0163163_10020189 | 3300014325 | Bacteria | 6270 |
| 378 | Ga0163163_10032174 | 3300014325 | Bacteria | 5066 |
| 379 | Ga0163163_10134668 | 3300014325 | Bacteria | 2511 |
| 380 | Ga0163163_10148371 | 3300014325 | Bacteria | 2389 |
| 381 | Ga0157380_10002913 | 3300014326 | Bacteria | 11638 |
| 382 | Ga0157380_10009719 | 3300014326 | Bacteria | 6903 |
| 383 | Ga0157380_10630896 | 3300014326 | Bacteria | 1065 |
| 384 | Ga0157377_10000276 | 3300014745 | Bacteria | 24762 |
| 385 | Ga0157379_10002285 | 3300014968 | Bacteria | 15975 |
| 386 | Ga0157379_10063216 | 3300014968 | Bacteria | 3310 |
| 387 | Ga0157379_10110590 | 3300014968 | Bacteria | 2467 |
| 388 | Ga0157379_10147615 | 3300014968 | Bacteria | 2121 |
| 389 | Ga0157379_10147731 | 3300014968 | Bacteria | 2120 |
| 390 | Ga0157376_10000692 | 3300014969 | Bacteria | 21811 |
| 391 | Ga0157376_10153359 | 3300014969 | Unclassified | 2080 |
| 392 | Ga0163161_10000384 | 3300017792 | Bacteria | 37040 |
| 393 | Ga0163161_10047076 | 3300017792 | Bacteria | 3114 |
| 394 | Ga0163161_10362314 | 3300017792 | Unclassified | 1155 |
| 395 | Ga0206356_10010133 | 3300020070 | Bacteria | 1965 |
| 396 | Ga0206353_11031164 | 3300020082 | Bacteria | 1360 |
| 397 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 398 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 399 | Ga0209759_1000142 | 3300025256 | Bacteria | 124090 |
| 400 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 401 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 402 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 403 | Ga0207666_1000097 | 3300025271 | Bacteria | 13853 |
| 404 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 405 | Ga0209130_1001541 | 3300025284 | Bacteria | 14695 |
| 406 | Ga0209130_1025592 | 3300025284 | Bacteria | 1276 |
| 407 | Ga0207673_1000201 | 3300025290 | Bacteria | 5994 |
| 408 | Ga0209675_1002318 | 3300025291 | Bacteria | 9845 |
| 409 | Ga0209676_1011115 | 3300025292 | Bacteria | 3667 |
| 410 | Ga0209676_1013366 | 3300025292 | Bacteria | 3161 |
| 411 | Ga0209025_1000617 | 3300025294 | Bacteria | 63860 |
| 412 | Ga0209025_1041288 | 3300025294 | Bacteria | 1978 |
| 413 | Ga0209564_1012515 | 3300025295 | Bacteria | 3692 |
| 414 | Ga0209758_1040778 | 3300025297 | Bacteria | 1746 |
| 415 | Ga0209050_1037713 | 3300025298 | Bacteria | 1389 |
| 416 | Ga0209256_1007611 | 3300025299 | Bacteria | 5281 |
| 417 | Ga0209051_1001617 | 3300025303 | Bacteria | 18379 |
| 418 | Ga0209051_1007087 | 3300025303 | Bacteria | 6199 |
| 419 | Ga0209257_1002499 | 3300025304 | Bacteria | 18154 |
| 420 | Ga0209257_1021446 | 3300025304 | Bacteria | 2345 |
| 421 | Ga0207697_10000550 | 3300025315 | Bacteria | 21243 |
| 422 | Ga0207697_10013264 | 3300025315 | Bacteria | 3440 |
| 423 | Ga0207656_10262794 | 3300025321 | Bacteria | 848 |
| 424 | Ga0207653_10010851 | 3300025885 | Bacteria | 2843 |
| 425 | Ga0207653_10018054 | 3300025885 | Bacteria | 2223 |
| 426 | Ga0207682_10000088 | 3300025893 | Bacteria | 41732 |
| 427 | Ga0207682_10000521 | 3300025893 | Bacteria | 17673 |
| 428 | Ga0207692_10000876 | 3300025898 | Bacteria | 10871 |
| 429 | Ga0207692_10001966 | 3300025898 | Bacteria | 7840 |
| 430 | Ga0207692_10271610 | 3300025898 | Unclassified | 1023 |
| 431 | Ga0207642_10000381 | 3300025899 | Bacteria | 13280 |
| 432 | Ga0207710_10001324 | 3300025900 | Bacteria | 12473 |
| 433 | Ga0207710_10001609 | 3300025900 | Bacteria | 11050 |
| 434 | Ga0207710_10032716 | 3300025900 | Bacteria | 2278 |
| 435 | Ga0207710_10142784 | 3300025900 | Bacteria | 1157 |
| 436 | Ga0207688_10001203 | 3300025901 | Bacteria | 13390 |
| 437 | Ga0207688_10021688 | 3300025901 | Bacteria | 3513 |
| 438 | Ga0207688_10059462 | 3300025901 | Bacteria | 2153 |
| 439 | Ga0207680_10009047 | 3300025903 | Bacteria | 4921 |
| 440 | Ga0207680_10151416 | 3300025903 | Bacteria | 1547 |
| 441 | Ga0207680_10223472 | 3300025903 | Bacteria | 1292 |
| 442 | Ga0207647_10002714 | 3300025904 | Bacteria | 13370 |
| 443 | Ga0207699_10002088 | 3300025906 | Bacteria | 9440 |
| 444 | Ga0207645_10000140 | 3300025907 | Bacteria | 55845 |
| 445 | Ga0207645_10035558 | 3300025907 | Bacteria | 3198 |
| 446 | Ga0207645_10069729 | 3300025907 | Bacteria | 2249 |
| 447 | Ga0207643_10000083 | 3300025908 | Bacteria | 62116 |
| 448 | Ga0207643_10016129 | 3300025908 | Bacteria | 4072 |
| 449 | Ga0207705_10008972 | 3300025909 | Bacteria | 7285 |
| 450 | Ga0207705_10049472 | 3300025909 | Bacteria | 3025 |
| 451 | Ga0207705_10098196 | 3300025909 | Bacteria | 2151 |
| 452 | Ga0207684_10423987 | 3300025910 | Bacteria | 1143 |
| 453 | Ga0207654_10002699 | 3300025911 | Bacteria | 9011 |
| 454 | Ga0207654_10025064 | 3300025911 | Bacteria | 3213 |
| 455 | Ga0207707_10001464 | 3300025912 | Bacteria | 21829 |
| 456 | Ga0207707_10020854 | 3300025912 | Bacteria | 5724 |
| 457 | Ga0207707_10122457 | 3300025912 | Bacteria | 2274 |
| 458 | Ga0207707_10226903 | 3300025912 | Bacteria | 1625 |
| 459 | Ga0207707_10271360 | 3300025912 | Bacteria | 1470 |
| 460 | Ga0207695_10390519 | 3300025913 | Bacteria | 1276 |
| 461 | Ga0207671_10004533 | 3300025914 | Bacteria | 13203 |
| 462 | Ga0207671_10063500 | 3300025914 | Bacteria | 2744 |
| 463 | Ga0207671_10138535 | 3300025914 | Bacteria | 1873 |
| 464 | Ga0207693_10007304 | 3300025915 | Bacteria | 9091 |
| 465 | Ga0207693_10021626 | 3300025915 | Bacteria | 5112 |
| 466 | Ga0207663_10021132 | 3300025916 | Bacteria | 3700 |
| 467 | Ga0207663_10113170 | 3300025916 | Bacteria | 1845 |
| 468 | Ga0207663_10126218 | 3300025916 | Unclassified | 1760 |
| 469 | Ga0207663_10232610 | 3300025916 | Bacteria | 1347 |
| 470 | Ga0207660_10000073 | 3300025917 | Bacteria | 51871 |
| 471 | Ga0207660_10006940 | 3300025917 | Bacteria | 7334 |
| 472 | Ga0207660_10346099 | 3300025917 | Bacteria | 1191 |
| 473 | Ga0207662_10000964 | 3300025918 | Bacteria | 13368 |
| 474 | Ga0207662_10019591 | 3300025918 | Bacteria | 3853 |
| 475 | Ga0207662_10037630 | 3300025918 | Bacteria | 2832 |
| 476 | Ga0207657_10005395 | 3300025919 | Bacteria | 13362 |
| 477 | Ga0207657_10007647 | 3300025919 | Bacteria | 11057 |
| 478 | Ga0207657_10020125 | 3300025919 | Bacteria | 6315 |
| 479 | Ga0207657_10068436 | 3300025919 | Bacteria | 3016 |
| 480 | Ga0207657_10072526 | 3300025919 | Bacteria | 2913 |
| 481 | Ga0207657_10077205 | 3300025919 | Bacteria | 2808 |
| 482 | Ga0207649_10000450 | 3300025920 | Bacteria | 29604 |
| 483 | Ga0207649_10020627 | 3300025920 | Bacteria | 3781 |
| 484 | Ga0207649_10026888 | 3300025920 | Bacteria | 3371 |
| 485 | Ga0207649_10101143 | 3300025920 | Bacteria | 1908 |
| 486 | Ga0207649_10163391 | 3300025920 | Bacteria | 1545 |
| 487 | Ga0207649_10368929 | 3300025920 | Bacteria | 1067 |
| 488 | Ga0207652_10008726 | 3300025921 | Bacteria | 8158 |
| 489 | Ga0207652_10016838 | 3300025921 | Bacteria | 5974 |
| 490 | Ga0207652_10028066 | 3300025921 | Bacteria | 4693 |
| 491 | Ga0207652_10075123 | 3300025921 | Bacteria | 2944 |
| 492 | Ga0207652_10157189 | 3300025921 | Bacteria | 2037 |
| 493 | Ga0207652_10595059 | 3300025921 | Bacteria | 992 |
| 494 | Ga0207646_10296809 | 3300025922 | Bacteria | 1460 |
| 495 | Ga0207681_10000097 | 3300025923 | Bacteria | 73836 |
| 496 | Ga0207681_10065126 | 3300025923 | Bacteria | 2518 |
| 497 | Ga0207694_10011454 | 3300025924 | Bacteria | 6692 |
| 498 | Ga0207694_10024241 | 3300025924 | Bacteria | 4606 |
| 499 | Ga0207694_10059954 | 3300025924 | Bacteria | 2961 |
| 500 | Ga0207694_10059980 | 3300025924 | Bacteria | 2960 |
| 501 | Ga0207694_10159147 | 3300025924 | Bacteria | 1823 |
| 502 | Ga0207659_10000092 | 3300025926 | Bacteria | 52642 |
| 503 | Ga0207659_10045065 | 3300025926 | Bacteria | 3107 |
| 504 | Ga0207659_10066522 | 3300025926 | Bacteria | 2616 |
| 505 | Ga0207687_10000219 | 3300025927 | Bacteria | 38995 |
| 506 | Ga0207687_10027744 | 3300025927 | Bacteria | 3801 |
| 507 | Ga0207687_10029871 | 3300025927 | Bacteria | 3669 |
| 508 | Ga0207700_10002485 | 3300025928 | Bacteria | 10567 |
| 509 | Ga0207700_10064607 | 3300025928 | Bacteria | 2788 |
| 510 | Ga0207700_10115487 | 3300025928 | Bacteria | 2168 |
| 511 | Ga0207664_10005574 | 3300025929 | Bacteria | 8618 |
| 512 | Ga0207664_10060581 | 3300025929 | Bacteria | 3017 |
| 513 | Ga0207664_10430438 | 3300025929 | Bacteria | 1176 |
| 514 | Ga0207664_10484029 | 3300025929 | Bacteria | 1107 |
| 515 | Ga0207644_10005083 | 3300025931 | Bacteria | 8591 |
| 516 | Ga0207644_10007663 | 3300025931 | Bacteria | 7040 |
| 517 | Ga0207644_10079676 | 3300025931 | Bacteria | 2417 |
| 518 | Ga0207690_10003312 | 3300025932 | Bacteria | 9636 |
| 519 | Ga0207706_10004310 | 3300025933 | Bacteria | 13370 |
| 520 | Ga0207706_10008823 | 3300025933 | Bacteria | 9280 |
| 521 | Ga0207706_10035694 | 3300025933 | Bacteria | 4419 |
| 522 | Ga0207706_10256446 | 3300025933 | Bacteria | 1527 |
| 523 | Ga0207686_10000796 | 3300025934 | Bacteria | 19364 |
| 524 | Ga0207686_10007990 | 3300025934 | Bacteria | 5703 |
| 525 | Ga0207686_10062208 | 3300025934 | Bacteria | 2369 |
| 526 | Ga0207686_10449951 | 3300025934 | Bacteria | 990 |
| 527 | Ga0207709_10000362 | 3300025935 | Bacteria | 45886 |
| 528 | Ga0207709_10220374 | 3300025935 | Bacteria | 1368 |
| 529 | Ga0207670_10002375 | 3300025936 | Bacteria | 9862 |
| 530 | Ga0207669_10000350 | 3300025937 | Bacteria | 20966 |
| 531 | Ga0207669_10041720 | 3300025937 | Bacteria | 2673 |
| 532 | Ga0207669_10055748 | 3300025937 | Bacteria | 2395 |
| 533 | Ga0207669_10165114 | 3300025937 | Bacteria | 1569 |
| 534 | Ga0207704_10000479 | 3300025938 | Bacteria | 17812 |
| 535 | Ga0207704_10098385 | 3300025938 | Bacteria | 1943 |
| 536 | Ga0207704_10112038 | 3300025938 | Bacteria | 1847 |
| 537 | Ga0207704_10317554 | 3300025938 | Unclassified | 1200 |
| 538 | Ga0207665_10001702 | 3300025939 | Bacteria | 14793 |
| 539 | Ga0207665_10089990 | 3300025939 | Unclassified | 2126 |
| 540 | Ga0207665_10491370 | 3300025939 | Bacteria | 947 |
| 541 | Ga0207691_10000283 | 3300025940 | Bacteria | 50040 |
| 542 | Ga0207691_10070775 | 3300025940 | Bacteria | 3149 |
| 543 | Ga0207691_10129322 | 3300025940 | Bacteria | 2232 |
| 544 | Ga0207691_10509947 | 3300025940 | Unclassified | 1021 |
| 545 | Ga0207711_10005310 | 3300025941 | Bacteria | 10924 |
| 546 | Ga0207711_10009170 | 3300025941 | Bacteria | 8267 |
| 547 | Ga0207711_10009675 | 3300025941 | Bacteria | 8032 |
| 548 | Ga0207711_10471013 | 3300025941 | Bacteria | 1170 |
| 549 | Ga0207689_10000085 | 3300025942 | Bacteria | 75467 |
| 550 | Ga0207661_10000464 | 3300025944 | Bacteria | 26194 |
| 551 | Ga0207661_10272418 | 3300025944 | Bacteria | 1511 |
| 552 | Ga0207661_10495672 | 3300025944 | Unclassified | 1116 |
| 553 | Ga0207661_10595864 | 3300025944 | Bacteria | 1014 |
| 554 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 555 | Ga0207679_10095656 | 3300025945 | Bacteria | 2309 |
| 556 | Ga0207679_10414830 | 3300025945 | Bacteria | 1187 |
| 557 | Ga0207679_10441453 | 3300025945 | Bacteria | 1152 |
| 558 | Ga0207667_10021184 | 3300025949 | Bacteria | 7208 |
| 559 | Ga0207667_10024372 | 3300025949 | Bacteria | 6643 |
| 560 | Ga0207667_10047002 | 3300025949 | Bacteria | 4570 |
| 561 | Ga0207667_10105591 | 3300025949 | Bacteria | 2906 |
| 562 | Ga0207667_10106876 | 3300025949 | Bacteria | 2887 |
| 563 | Ga0207667_10339117 | 3300025949 | Bacteria | 1534 |
| 564 | Ga0207651_10000422 | 3300025960 | Bacteria | 18024 |
| 565 | Ga0207651_10039537 | 3300025960 | Bacteria | 3111 |
| 566 | Ga0207651_10114169 | 3300025960 | Bacteria | 2034 |
| 567 | Ga0207651_10116032 | 3300025960 | Bacteria | 2020 |
| 568 | Ga0207651_10327355 | 3300025960 | Unclassified | 1283 |
| 569 | Ga0207712_10004682 | 3300025961 | Bacteria | 8649 |
| 570 | Ga0207712_10024382 | 3300025961 | Bacteria | 4004 |
| 571 | Ga0207712_10346974 | 3300025961 | Bacteria | 1233 |
| 572 | Ga0207668_10000114 | 3300025972 | Bacteria | 57323 |
| 573 | Ga0207668_10035290 | 3300025972 | Bacteria | 3328 |
| 574 | Ga0207668_10303789 | 3300025972 | Bacteria | 1318 |
| 575 | Ga0207668_10550177 | 3300025972 | Bacteria | 1000 |
| 576 | Ga0207640_10000141 | 3300025981 | Bacteria | 52638 |
| 577 | Ga0207640_10035965 | 3300025981 | Bacteria | 3104 |
| 578 | Ga0207640_10096880 | 3300025981 | Bacteria | 2058 |
| 579 | Ga0207658_10155178 | 3300025986 | Bacteria | 1870 |
| 580 | Ga0207658_10494495 | 3300025986 | Bacteria | 1089 |
| 581 | Ga0207658_10782989 | 3300025986 | Bacteria | 865 |
| 582 | Ga0207677_10001776 | 3300026023 | Bacteria | 11384 |
| 583 | Ga0207677_10021038 | 3300026023 | Bacteria | 3977 |
| 584 | Ga0207703_10000983 | 3300026035 | Bacteria | 27443 |
| 585 | Ga0207703_10043709 | 3300026035 | Bacteria | 3597 |
| 586 | Ga0207639_10000305 | 3300026041 | Bacteria | 34869 |
| 587 | Ga0207639_10097689 | 3300026041 | Bacteria | 2366 |
| 588 | Ga0207639_10165221 | 3300026041 | Bacteria | 1869 |
| 589 | Ga0207639_10341225 | 3300026041 | Bacteria | 1335 |
| 590 | Ga0207678_10000125 | 3300026067 | Bacteria | 63817 |
| 591 | Ga0207678_10026095 | 3300026067 | Bacteria | 5097 |
| 592 | Ga0207678_10032760 | 3300026067 | Bacteria | 4529 |
| 593 | Ga0207678_10197514 | 3300026067 | Unclassified | 1719 |
| 594 | Ga0207678_10500729 | 3300026067 | Bacteria | 1059 |
| 595 | Ga0207708_10000187 | 3300026075 | Bacteria | 48792 |
| 596 | Ga0207708_10014918 | 3300026075 | Bacteria | 5818 |
| 597 | Ga0207708_10099362 | 3300026075 | Bacteria | 2251 |
| 598 | Ga0207702_10005437 | 3300026078 | Bacteria | 11146 |
| 599 | Ga0207702_10054512 | 3300026078 | Bacteria | 3388 |
| 600 | Ga0207702_10058876 | 3300026078 | Bacteria | 3270 |
| 601 | Ga0207702_10128627 | 3300026078 | Bacteria | 2276 |
| 602 | Ga0207702_10324710 | 3300026078 | Bacteria | 1467 |
| 603 | Ga0207702_10496893 | 3300026078 | Bacteria | 1189 |
| 604 | Ga0207702_10720177 | 3300026078 | Unclassified | 984 |
| 605 | Ga0207641_10003649 | 3300026088 | Bacteria | 13575 |
| 606 | Ga0207641_10055119 | 3300026088 | Bacteria | 3376 |
| 607 | Ga0207641_10141916 | 3300026088 | Bacteria | 2168 |
| 608 | Ga0207648_10002168 | 3300026089 | Bacteria | 21342 |
| 609 | Ga0207648_10008536 | 3300026089 | Bacteria | 9913 |
| 610 | Ga0207648_10136180 | 3300026089 | Bacteria | 2163 |
| 611 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 612 | Ga0207676_10019580 | 3300026095 | Bacteria | 4939 |
| 613 | Ga0207676_10236705 | 3300026095 | Bacteria | 1635 |
| 614 | Ga0207674_10002501 | 3300026116 | Bacteria | 23186 |
| 615 | Ga0207674_10009631 | 3300026116 | Bacteria | 11019 |
| 616 | Ga0207674_10276142 | 3300026116 | Bacteria | 1628 |
| 617 | Ga0207675_100004556 | 3300026118 | Bacteria | 13370 |
| 618 | Ga0207675_100169240 | 3300026118 | Bacteria | 2088 |
| 619 | Ga0207675_100312265 | 3300026118 | Bacteria | 1533 |
| 620 | Ga0207683_10000014 | 3300026121 | Bacteria | 128817 |
| 621 | Ga0207683_10002066 | 3300026121 | Bacteria | 17758 |
| 622 | Ga0207683_10003999 | 3300026121 | Bacteria | 12769 |
| 623 | Ga0207683_10005254 | 3300026121 | Bacteria | 11113 |
| 624 | Ga0207683_10351552 | 3300026121 | Bacteria | 1353 |
| 625 | Ga0207698_10001242 | 3300026142 | Bacteria | 14899 |
| 626 | Ga0207698_10070852 | 3300026142 | Bacteria | 2764 |
| 627 | Ga0207698_10308641 | 3300026142 | Bacteria | 1476 |
| 628 | Ga0209973_1008250 | 3300027252 | Bacteria | 1184 |
| 629 | Ga0209970_1005489 | 3300027614 | Bacteria | 2092 |
| 630 | Ga0209983_1006800 | 3300027665 | Bacteria | 2347 |
| 631 | Ga0209966_1006091 | 3300027695 | Bacteria | 2087 |
| 632 | Ga0209998_10000361 | 3300027717 | Bacteria | 13355 |
| 633 | Ga0209998_10001516 | 3300027717 | Bacteria | 5583 |
| 634 | Ga0209974_10002250 | 3300027876 | Bacteria | 7018 |
| 635 | Ga0209974_10012895 | 3300027876 | Bacteria | 2790 |
| 636 | Ga0207428_10000114 | 3300027907 | Bacteria | 109533 |
| 637 | Ga0207428_10000467 | 3300027907 | Bacteria | 48756 |
| 638 | Ga0207428_10011322 | 3300027907 | Bacteria | 7891 |
| 639 | Ga0268266_10034656 | 3300028379 | Bacteria | 4293 |
| 640 | Ga0268266_10041670 | 3300028379 | Bacteria | 3919 |
| 641 | Ga0268266_10104379 | 3300028379 | Bacteria | 2502 |
| 642 | Ga0268266_10201484 | 3300028379 | Bacteria | 1822 |
| 643 | Ga0268266_10235503 | 3300028379 | Bacteria | 1688 |
| 644 | Ga0268266_10502461 | 3300028379 | Bacteria | 1158 |
| 645 | Ga0268265_10001371 | 3300028380 | Bacteria | 20700 |
| 646 | Ga0268265_10337188 | 3300028380 | Bacteria | 1371 |
| 647 | Ga0268264_10000469 | 3300028381 | Bacteria | 54801 |
| 648 | Ga0268264_10016375 | 3300028381 | Bacteria | 6070 |
| 649 | Ga0268264_10679750 | 3300028381 | Bacteria | 1021 |
| 650 | Ga0265337_1008317 | 3300028556 | Bacteria | 3784 |
| 651 | Ga0265318_10012048 | 3300028577 | Bacteria | 3694 |
| 652 | Ga0265338_10137794 | 3300028800 | Bacteria | 1915 |
| 653 | Ga0265330_10029569 | 3300031235 | Bacteria | 2463 |
| 654 | Ga0265330_10030972 | 3300031235 | Bacteria | 2398 |
| 655 | Ga0265332_10134827 | 3300031238 | Bacteria | 1035 |
| 656 | Ga0265328_10020279 | 3300031239 | Bacteria | 2546 |
| 657 | Ga0265320_10021158 | 3300031240 | Bacteria | 3505 |
| 658 | Ga0265325_10000423 | 3300031241 | Bacteria | 30296 |
| 659 | Ga0265325_10068734 | 3300031241 | Bacteria | 1782 |
| 660 | Ga0265329_10096506 | 3300031242 | Bacteria | 939 |
| 661 | Ga0265340_10001277 | 3300031247 | Bacteria | 14437 |
| 662 | Ga0265340_10096324 | 3300031247 | Bacteria | 1379 |
| 663 | Ga0265339_10026539 | 3300031249 | Bacteria | 3316 |
| 664 | Ga0265339_10099784 | 3300031249 | Bacteria | 1513 |
| 665 | Ga0265331_10001870 | 3300031250 | Bacteria | 14848 |
| 666 | Ga0265331_10022567 | 3300031250 | Bacteria | 3210 |
| 667 | Ga0265327_10002224 | 3300031251 | Bacteria | 21112 |
| 668 | Ga0265316_10010284 | 3300031344 | Bacteria | 8533 |
| 669 | Ga0265316_10048508 | 3300031344 | Bacteria | 3351 |
| 670 | Ga0265316_10149979 | 3300031344 | Bacteria | 1747 |
| 671 | Ga0265316_10161738 | 3300031344 | Bacteria | 1673 |
| 672 | Ga0307513_10261468 | 3300031456 | Bacteria | 1520 |
| 673 | Ga0307513_10300298 | 3300031456 | Bacteria | 1373 |
| 674 | Ga0307513_10350860 | 3300031456 | Bacteria | 1223 |
| 675 | Ga0307408_100054991 | 3300031548 | Bacteria | 2880 |
| 676 | Ga0265313_10000448 | 3300031595 | Bacteria | 43625 |
| 677 | Ga0265313_10004127 | 3300031595 | Bacteria | 11295 |
| 678 | Ga0265313_10016322 | 3300031595 | Bacteria | 4274 |
| 679 | Ga0265313_10034290 | 3300031595 | Bacteria | 2568 |
| 680 | Ga0265313_10053271 | 3300031595 | Bacteria | 1926 |
| 681 | Ga0307508_10124354 | 3300031616 | Bacteria | 2181 |
| 682 | Ga0307514_10002390 | 3300031649 | Bacteria | 19631 |
| 683 | Ga0265314_10005122 | 3300031711 | Bacteria | 11925 |
| 684 | Ga0265314_10027436 | 3300031711 | Bacteria | 4263 |
| 685 | Ga0265314_10105082 | 3300031711 | Bacteria | 1806 |
| 686 | Ga0265342_10000763 | 3300031712 | Bacteria | 32827 |
| 687 | Ga0265342_10004375 | 3300031712 | Bacteria | 11163 |
| 688 | Ga0265342_10010728 | 3300031712 | Bacteria | 6327 |
| 689 | Ga0265342_10038340 | 3300031712 | Bacteria | 2918 |
| 690 | Ga0265342_10052084 | 3300031712 | Bacteria | 2440 |
| 691 | Ga0265342_10056611 | 3300031712 | Bacteria | 2323 |
| 692 | Ga0307405_10000665 | 3300031731 | Bacteria | 13278 |
| 693 | Ga0307413_10301608 | 3300031824 | Bacteria | 1215 |
| 694 | Ga0307413_10381904 | 3300031824 | Bacteria | 1098 |
| 695 | Ga0307410_10005796 | 3300031852 | Bacteria | 6587 |
| 696 | Ga0307406_10042974 | 3300031901 | Bacteria | 2824 |
| 697 | Ga0307407_10016631 | 3300031903 | Bacteria | 3667 |
| 698 | Ga0307412_10261302 | 3300031911 | Bacteria | 1350 |
| 699 | Ga0307409_100026359 | 3300031995 | Bacteria | 4097 |
| 700 | Ga0307409_100868698 | 3300031995 | Bacteria | 914 |
| 701 | Ga0307416_100002531 | 3300032002 | Bacteria | 10519 |
| 702 | Ga0307416_100763014 | 3300032002 | Bacteria | 1061 |
| 703 | Ga0307415_100000759 | 3300032126 | Bacteria | 14559 |
| 704 | Ga0307507_10189955 | 3300033179 | Bacteria | 1446 |
| 705 | Ga0373930_0000150 | 3300034816 | Bacteria | 7874 |
| 706 | Ga0373948_0000307 | 3300034817 | Bacteria | 5896 |
| 707 | Ga0373950_0002075 | 3300034818 | Bacteria | 2717 |
| 708 | Ga0373950_0012337 | 3300034818 | Bacteria | 1409 |
| 709 | Ga0373950_0014391 | 3300034818 | Bacteria | 1330 |
| 710 | Ga0373958_0001702 | 3300034819 | Bacteria | 2986 |
| 711 | Ga0373958_0002841 | 3300034819 | Bacteria | 2464 |
| 712 | Ga0373959_0001657 | 3300034820 | Bacteria | 3542 |
| 713 | Ga0373938_0002852 | 3300034957 | Bacteria | 2790 |
| 714 | Ga0373938_0009646 | 3300034957 | Bacteria | 1755 |
| 715 | Ga0373926_0027180 | 3300035083 | Bacteria | 2003 |
| 716 | Ga0373928_0000222 | 3300035084 | Bacteria | 11055 |
| 717 | Ga0373928_0004477 | 3300035084 | Bacteria | 2663 |
| 718 | Ga0373928_0063198 | 3300035084 | Bacteria | 900 |
| 719 | Ga0373929_0002112 | 3300035085 | Bacteria | 3692 |
| 720 | Ga0373929_0002872 | 3300035085 | Bacteria | 3145 |
| 721 | Ga0373929_0003760 | 3300035085 | Bacteria | 2721 |
| 722 | Ga0373934_0137209 | 3300035086 | Bacteria | 999 |
| 723 | Ga0373940_0012698 | 3300035088 | Bacteria | 2021 |
| 724 | Ga0373940_0026893 | 3300035088 | Bacteria | 1508 |
| 725 | Ga0373944_0001828 | 3300035089 | Bacteria | 5375 |
| 726 | Ga0373944_0080792 | 3300035089 | Unclassified | 1073 |
| 727 | Ga0373949_0001450 | 3300035090 | Bacteria | 6781 |
| 728 | Ga0373949_0006107 | 3300035090 | Bacteria | 2665 |
| 729 | Ga0373949_0050996 | 3300035090 | Bacteria | 1043 |
| 730 | Ga0373951_0011607 | 3300035091 | Bacteria | 1979 |
| 731 | Ga0373952_0000029 | 3300035092 | Bacteria | 16517 |
| 732 | Ga0373923_0038247 | 3300035111 | Bacteria | 1965 |
| 733 | Ga0373932_0001251 | 3300035112 | Bacteria | 7218 |
| 734 | Ga0373932_0001864 | 3300035112 | Bacteria | 5647 |
| 735 | Ga0373936_0006326 | 3300035113 | Bacteria | 4461 |
| 736 | Ga0373936_0033686 | 3300035113 | Bacteria | 2032 |
| 737 | Ga0373936_0332104 | 3300035113 | Unclassified | 690 |
| 738 | Ga0373939_0000339 | 3300035114 | Bacteria | 11943 |
| 739 | Ga0373939_0002855 | 3300035114 | Bacteria | 4058 |
| 740 | Ga0373939_0009371 | 3300035114 | Bacteria | 2426 |
| 741 | Ga0373941_0002285 | 3300035115 | Bacteria | 4194 |
| 742 | Ga0373941_0017574 | 3300035115 | Bacteria | 1962 |
| 743 | Ga0373941_0073329 | 3300035115 | Bacteria | 1141 |
| 744 | Ga0373945_0058939 | 3300035116 | Bacteria | 1428 |
| 745 | Ga0373953_0023666 | 3300035117 | Bacteria | 2327 |
| 746 | Ga0373953_0028414 | 3300035117 | Bacteria | 2156 |
| 747 | Ga0373954_0090293 | 3300035118 | Bacteria | 1471 |
| 748 | Ga0373954_0093987 | 3300035118 | Bacteria | 1442 |
| 749 | Ga0373954_0118861 | 3300035118 | Bacteria | 1282 |
| 750 | Ga0373956_0117071 | 3300035119 | Bacteria | 1243 |
| 751 | Ga0373956_0118830 | 3300035119 | Unclassified | 1234 |
| 752 | Ga0373957_0006384 | 3300035120 | Bacteria | 3712 |
| 753 | Ga0373960_0000372 | 3300035121 | Bacteria | 8658 |
| 754 | Ga0373943_0016793 | 3300035170 | Bacteria | 3344 |
| 755 | Ga0373943_0042125 | 3300035170 | Bacteria | 2211 |
| 756 | Ga0373943_0042928 | 3300035170 | Bacteria | 2193 |
| 757 | Ga0373943_0301588 | 3300035170 | Bacteria | 910 |
| 758 | Ga0373946_0006340 | 3300035171 | Bacteria | 4288 |
| 759 | Ga0373955_0001269 | 3300035172 | Bacteria | 10731 |
| 760 | Ga0373955_0001523 | 3300035172 | Bacteria | 9899 |
| 761 | Ga0373955_0004969 | 3300035172 | Bacteria | 5934 |
| 762 | Ga0373942_0000767 | 3300035207 | Bacteria | 8832 |
| 763 | Ga0373942_0003994 | 3300035207 | Bacteria | 3441 |
| 764 | Ga0373942_0011842 | 3300035207 | Bacteria | 2074 |
| 765 | Ga0373961_0001835 | 3300035241 | Bacteria | 5803 |
| 766 | Ga0373961_0003896 | 3300035241 | Bacteria | 3641 |
| 767 | Ga0373962_0005133 | 3300035242 | Bacteria | 3164 |
| 768 | Ga0373962_0005930 | 3300035242 | Bacteria | 2950 |
| 769 | Ga0373962_0006682 | 3300035242 | Bacteria | 2798 |
| 770 | Ga0373924_0023997 | 3300035410 | Bacteria | 2399 |
| 771 | Ga0373931_0000169 | 3300035691 | Bacteria | 28308 |
| 772 | Ga0373931_0056827 | 3300035691 | Bacteria | 2097 |
| 773 | Ga0373931_0068208 | 3300035691 | Bacteria | 1935 |
| 774 | Ga0373935_0020667 | 3300035692 | Bacteria | 4024 |
| 775 | Ga0373935_0073204 | 3300035692 | Bacteria | 2213 |
| 776 | Ga0373927_0016232 | 3300035695 | Bacteria | 4914 |
| 777 | Ga0373927_0050616 | 3300035695 | Bacteria | 2686 |
| 778 | Ga0373933_0001124 | 3300035724 | Bacteria | 15927 |
| 779 | Ga0373933_0005311 | 3300035724 | Bacteria | 7020 |
| 780 | Ga0373933_0017906 | 3300035724 | Bacteria | 3978 |
| 781 | Ga0373933_0289307 | 3300035724 | Bacteria | 1060 |
| 782 | Ga0373947_0005580 | 3300035725 | Bacteria | 7335 |
| 783 | Ga0373947_0038674 | 3300035725 | Bacteria | 2835 |
| 784 | Ga0373947_0244013 | 3300035725 | Bacteria | 1186 |
| 785 | Ga0373937_0004918 | 3300036401 | Bacteria | 11357 |
| 786 | Ga0373937_0012121 | 3300036401 | Bacteria | 7568 |
| 787 | Ga0373937_0038298 | 3300036401 | Bacteria | 4369 |
| 788 | Ga0373937_0049021 | 3300036401 | Bacteria | 3867 |
| 789 | Ga0373925_0009626 | 3300037068 | Bacteria | 7042 |
| 790 | Ga0373925_0105557 | 3300037068 | Unclassified | 2171 |
| 791 | Ga0373925_0127186 | 3300037068 | Bacteria | 1983 |
| 792 | Ga0373925_0183511 | 3300037068 | Unclassified | 1657 |
| 793 | Ga0395899_0004706 | 3300037312 | Bacteria | 10648 |
| 794 | Ga0395899_0052474 | 3300037312 | Bacteria | 3022 |
| 795 | Ga0395899_0107269 | 3300037312 | Bacteria | 2010 |
| 796 | Ga0395899_0124191 | 3300037312 | Bacteria | 1846 |
| 797 | Ga0395899_0186411 | 3300037312 | Bacteria | 1454 |
| 798 | Ga0395899_0202627 | 3300037312 | Bacteria | 1383 |
| 799 | Ga0395900_0005070 | 3300037418 | Bacteria | 13821 |
| 800 | Ga0395900_0005219 | 3300037418 | Bacteria | 13628 |
| 801 | Ga0395900_0179779 | 3300037418 | Bacteria | 2150 |
| 802 | Ga0395900_0187123 | 3300037418 | Bacteria | 2101 |
| 803 | Ga0395900_0304643 | 3300037418 | Bacteria | 1578 |
| 804 | Ga0395900_0352299 | 3300037418 | Bacteria | 1445 |
| 805 | Ga0395900_0450445 | 3300037418 | Bacteria | 1243 |
| 806 | Ga0395900_1282466 | 3300037418 | Bacteria | 647 |
| 807 | Ga0395898_0000804 | 3300037466 | Bacteria | 52956 |
| 808 | Ga0395898_0003156 | 3300037466 | Bacteria | 18609 |
| 809 | Ga0395898_0011599 | 3300037466 | Bacteria | 9147 |
| 810 | Ga0395898_0014510 | 3300037466 | Bacteria | 8090 |
| 811 | Ga0395898_0086896 | 3300037466 | Bacteria | 3013 |
| 812 | Ga0395898_0123799 | 3300037466 | Bacteria | 2477 |
| 813 | Ga0395898_0135233 | 3300037466 | Bacteria | 2360 |
| 814 | Ga0395905_0035464 | 3300037471 | Bacteria | 4684 |
| 815 | Ga0395905_0036713 | 3300037471 | Bacteria | 4603 |
| 816 | Ga0395905_0051198 | 3300037471 | Bacteria | 3867 |
| 817 | Ga0395905_0062059 | 3300037471 | Bacteria | 3496 |
| 818 | Ga0395905_0070451 | 3300037471 | Bacteria | 3276 |
| 819 | Ga0395905_0090886 | 3300037471 | Bacteria | 2862 |
| 820 | Ga0395905_0362003 | 3300037471 | Bacteria | 1343 |
| 821 | Ga0395905_1086154 | 3300037471 | Bacteria | 703 |
| 822 | Ga0436364_1391236 | 3300037853 | Bacteria | 1997 |
| 823 | Ga0395901_0000593 | 3300038443 | Bacteria | 42246 |
| 824 | Ga0395901_0007281 | 3300038443 | Bacteria | 11166 |
| 825 | Ga0395901_0087898 | 3300038443 | Bacteria | 3250 |
| 826 | Ga0395901_0139381 | 3300038443 | Bacteria | 2549 |
| 827 | Ga0395901_0163403 | 3300038443 | Bacteria | 2338 |
| 828 | Ga0395901_0194575 | 3300038443 | Bacteria | 2126 |
| 829 | Ga0395901_0240297 | 3300038443 | Bacteria | 1889 |
| 830 | Ga0395901_0262468 | 3300038443 | Bacteria | 1797 |
| 831 | Ga0395901_0367986 | 3300038443 | Bacteria | 1481 |
| 832 | Ga0242420_012515 | 3300038996 | Bacteria | 1438 |
| 833 | Ga0439436_0032846 | 3300041404 | Bacteria | 1504 |
| 834 | Ga0439436_0037684 | 3300041404 | Bacteria | 1392 |
| 835 | Ga0439461_0015906 | 3300041410 | Bacteria | 1446 |
| 836 | Ga0439465_0018105 | 3300041413 | Bacteria | 2201 |
| 837 | Ga0439465_0020970 | 3300041413 | Bacteria | 2048 |
| 838 | Ga0439441_003611 | 3300042001 | Bacteria | 2293 |
| 839 | Ga0439441_018364 | 3300042001 | Bacteria | 1264 |
| 840 | Ga0439448_0019150 | 3300042005 | Bacteria | 2105 |
| 841 | Ga0439432_058230 | 3300042006 | Bacteria | 1195 |
| 842 | Ga0439449_0036981 | 3300042007 | Bacteria | 1816 |
| 843 | Ga0439450_006022 | 3300042008 | Bacteria | 2164 |
| 844 | Ga0450897_009908 | 3300042128 | Bacteria | 908 |
| 845 | Ga0450898_005994 | 3300042134 | Bacteria | 1855 |
| 846 | Ga0439458_0065715 | 3300042157 | Bacteria | 910 |
| 847 | Ga0439458_0073289 | 3300042157 | Bacteria | 867 |
| 848 | Ga0439434_0015569 | 3300042435 | Bacteria | 2268 |
| 849 | Ga0439464_0001894 | 3300042439 | Bacteria | 5057 |
| 850 | Ga0439464_0043627 | 3300042439 | Bacteria | 1283 |
| 851 | Ga0439460_0058121 | 3300042461 | Bacteria | 1175 |
| 852 | Ga0466969_0152944 | 3300044656 | Bacteria | 1062 |
| 853 | Ga0466972_0148221 | 3300044658 | Bacteria | 1103 |
| 854 | Ga0453683_0002883 | 3300044673 | Bacteria | 13004 |
| 855 | Ga0466966_0014495 | 3300044684 | Bacteria | 5217 |
| 856 | Ga0466966_0065521 | 3300044684 | Bacteria | 2284 |
| 857 | Ga0466966_0139101 | 3300044684 | Bacteria | 1484 |
| 858 | Ga0453684_0037028 | 3300044712 | Bacteria | 6705 |
| 859 | Ga0466971_0016255 | 3300044719 | Bacteria | 3281 |
| 860 | Ga0466957_0259493 | 3300044842 | Bacteria | 1158 |
| 861 | Ga0466959_0057725 | 3300045049 | Bacteria | 2829 |
| 862 | Ga0451576_0004677 | 3300045051 | Bacteria | 17627 |
| 863 | Ga0451576_0033369 | 3300045051 | Bacteria | 5472 |
| 864 | Ga0466958_0034786 | 3300045836 | Bacteria | 3008 |
| 865 | Ga0466967_0137994 | 3300045976 | Bacteria | 2269 |
| 866 | Ga0495617_000026 | 3300046452 | Bacteria | 157675 |
| 867 | Ga0495617_032203 | 3300046452 | Bacteria | 1760 |
| 868 | Ga0495617_070130 | 3300046452 | Bacteria | 1153 |
| 869 | Ga0495627_000043 | 3300046453 | Bacteria | 185855 |
| 870 | Ga0495592_0024186 | 3300046454 | Bacteria | 4617 |
| 871 | Ga0495592_0040848 | 3300046454 | Bacteria | 3479 |
| 872 | Ga0495603_0272938 | 3300046455 | Bacteria | 972 |
| 873 | Ga0495590_0002579 | 3300046457 | Bacteria | 7485 |
| 874 | Ga0495590_0038336 | 3300046457 | Bacteria | 1671 |
| 875 | Ga0495591_067573 | 3300046458 | Bacteria | 935 |
| 876 | Ga0495629_0000535 | 3300046459 | Bacteria | 31312 |
| 877 | Ga0495629_0081599 | 3300046459 | Bacteria | 2257 |
| 878 | Ga0495629_0262307 | 3300046459 | Unclassified | 1187 |
| 879 | Ga0495638_0002787 | 3300046460 | Bacteria | 14034 |
| 880 | Ga0495638_0161544 | 3300046460 | Bacteria | 1292 |
| 881 | Ga0495641_0019259 | 3300046461 | Bacteria | 3497 |
| 882 | Ga0495651_0011021 | 3300046462 | Bacteria | 6956 |
| 883 | Ga0495651_0011844 | 3300046462 | Bacteria | 6706 |
| 884 | Ga0495653_0008326 | 3300046463 | Bacteria | 8500 |
| 885 | Ga0495653_0012564 | 3300046463 | Bacteria | 6915 |
| 886 | Ga0495653_0024311 | 3300046463 | Bacteria | 4884 |
| 887 | Ga0495653_0154948 | 3300046463 | Bacteria | 1597 |
| 888 | Ga0495650_0003986 | 3300046471 | Bacteria | 10374 |
| 889 | Ga0495650_0028303 | 3300046471 | Bacteria | 2576 |
| 890 | Ga0495650_0055124 | 3300046471 | Bacteria | 1619 |
| 891 | Ga0495580_0023721 | 3300046472 | Bacteria | 4499 |
| 892 | Ga0495582_0039312 | 3300046473 | Bacteria | 2604 |
| 893 | Ga0495582_0510306 | 3300046473 | Unclassified | 695 |
| 894 | Ga0495605_0000113 | 3300046474 | Bacteria | 103900 |
| 895 | Ga0495605_0030593 | 3300046474 | Bacteria | 2758 |
| 896 | Ga0495639_0026471 | 3300046475 | Bacteria | 2564 |
| 897 | Ga0495639_0029697 | 3300046475 | Bacteria | 2427 |
| 898 | Ga0495662_0010283 | 3300046476 | Bacteria | 4586 |
| 899 | Ga0495664_0003537 | 3300046477 | Bacteria | 8521 |
| 900 | Ga0495664_0066458 | 3300046477 | Bacteria | 2150 |
| 901 | Ga0495584_0002689 | 3300046491 | Bacteria | 9996 |
| 902 | Ga0495585_0008366 | 3300046492 | Bacteria | 6274 |
| 903 | Ga0495585_0102018 | 3300046492 | Bacteria | 1533 |
| 904 | Ga0495585_0105342 | 3300046492 | Bacteria | 1504 |
| 905 | Ga0495594_0042775 | 3300046499 | Bacteria | 2481 |
| 906 | Ga0495594_0043598 | 3300046499 | Bacteria | 2459 |
| 907 | Ga0495596_0003840 | 3300046500 | Bacteria | 7464 |
| 908 | Ga0495596_0045908 | 3300046500 | Bacteria | 1717 |
| 909 | Ga0495607_0001654 | 3300046501 | Bacteria | 19275 |
| 910 | Ga0495607_0048620 | 3300046501 | Bacteria | 2479 |
| 911 | Ga0495583_0023652 | 3300046506 | Bacteria | 3104 |
| 912 | Ga0495606_0015605 | 3300046507 | Bacteria | 5841 |
| 913 | Ga0495606_0077668 | 3300046507 | Bacteria | 2072 |
| 914 | Ga0495606_0134974 | 3300046507 | Bacteria | 1462 |
| 915 | Ga0495606_0151096 | 3300046507 | Bacteria | 1363 |
| 916 | Ga0495608_0001474 | 3300046511 | Bacteria | 16724 |
| 917 | Ga0495608_0039849 | 3300046511 | Bacteria | 3148 |
| 918 | Ga0495608_0055452 | 3300046511 | Bacteria | 2619 |
| 919 | Ga0495608_0141830 | 3300046511 | Bacteria | 1533 |
| 920 | Ga0495616_0000280 | 3300046513 | Bacteria | 41320 |
| 921 | Ga0495616_0047724 | 3300046513 | Bacteria | 2155 |
| 922 | Ga0495618_0004984 | 3300046514 | Bacteria | 8114 |
| 923 | Ga0495628_0001927 | 3300046516 | Bacteria | 18830 |
| 924 | Ga0495628_0023873 | 3300046516 | Bacteria | 5015 |
| 925 | Ga0495628_0244742 | 3300046516 | Bacteria | 1340 |
| 926 | Ga0495630_0121732 | 3300046517 | Bacteria | 1979 |
| 927 | Ga0495631_0004753 | 3300046518 | Bacteria | 7172 |
| 928 | Ga0495631_0008269 | 3300046518 | Bacteria | 5245 |
| 929 | Ga0495631_0022829 | 3300046518 | Bacteria | 2907 |
| 930 | Ga0495631_0024362 | 3300046518 | Bacteria | 2794 |
| 931 | Ga0495632_0022670 | 3300046519 | Bacteria | 3362 |
| 932 | Ga0495632_0028969 | 3300046519 | Bacteria | 2887 |
| 933 | Ga0495644_0002701 | 3300046523 | Bacteria | 7045 |
| 934 | Ga0495644_0007525 | 3300046523 | Bacteria | 4198 |
| 935 | Ga0495648_0000353 | 3300046524 | Bacteria | 50659 |
| 936 | Ga0495648_0044149 | 3300046524 | Bacteria | 2785 |
| 937 | Ga0495648_0134160 | 3300046524 | Bacteria | 1312 |
| 938 | Ga0495642_0000123 | 3300046528 | Bacteria | 44369 |
| 939 | Ga0495652_0022449 | 3300046529 | Bacteria | 5599 |
| 940 | Ga0495652_0048857 | 3300046529 | Bacteria | 3624 |
| 941 | Ga0495652_0087560 | 3300046529 | Bacteria | 2554 |
| 942 | Ga0495652_0218826 | 3300046529 | Bacteria | 1432 |
| 943 | Ga0495654_0025199 | 3300046530 | Bacteria | 3066 |
| 944 | Ga0495665_0023481 | 3300046531 | Bacteria | 3312 |
| 945 | Ga0495640_0027462 | 3300046533 | Bacteria | 4104 |
| 946 | Ga0495640_0295102 | 3300046533 | Bacteria | 1007 |
| 947 | Ga0495586_0036479 | 3300046535 | Bacteria | 2639 |
| 948 | Ga0495586_0068990 | 3300046535 | Bacteria | 1929 |
| 949 | Ga0495587_0002240 | 3300046536 | Bacteria | 12923 |
| 950 | Ga0495587_0047875 | 3300046536 | Bacteria | 2534 |
| 951 | Ga0495587_0111209 | 3300046536 | Bacteria | 1573 |
| 952 | Ga0495598_0007286 | 3300046537 | Bacteria | 2533 |
| 953 | Ga0495609_0058799 | 3300046538 | Unclassified | 1700 |
| 954 | Ga0495609_0071180 | 3300046538 | Bacteria | 1528 |
| 955 | Ga0495609_0116715 | 3300046538 | Bacteria | 1149 |
| 956 | Ga0495621_0005528 | 3300046539 | Bacteria | 3636 |
| 957 | Ga0495645_0002539 | 3300046543 | Bacteria | 12383 |
| 958 | Ga0495645_0019854 | 3300046543 | Bacteria | 4842 |
| 959 | Ga0495645_0297721 | 3300046543 | Bacteria | 1055 |
| 960 | Ga0495622_0015565 | 3300046557 | Bacteria | 3535 |
| 961 | Ga0495633_0002969 | 3300046558 | Bacteria | 11596 |
| 962 | Ga0495633_0040050 | 3300046558 | Bacteria | 2234 |
| 963 | Ga0495667_0024955 | 3300046559 | Bacteria | 4028 |
| 964 | Ga0495667_0026523 | 3300046559 | Bacteria | 3905 |
| 965 | Ga0495667_0099693 | 3300046559 | Bacteria | 1880 |
| 966 | Ga0495656_0002822 | 3300046615 | Bacteria | 5812 |
| 967 | Ga0495656_0003380 | 3300046615 | Bacteria | 5393 |
| 968 | Ga0495668_0000546 | 3300046616 | Bacteria | 46545 |
| 969 | Ga0495668_0023779 | 3300046616 | Bacteria | 3490 |
| 970 | Ga0495634_0026079 | 3300046642 | Bacteria | 4081 |
| 971 | Ga0495611_0076488 | 3300046648 | Bacteria | 1534 |
| 972 | Ga0495611_0081731 | 3300046648 | Unclassified | 1486 |
| 973 | Ga0495611_0116281 | 3300046648 | Bacteria | 1246 |
| 974 | Ga0495625_0017209 | 3300046660 | Bacteria | 5661 |
| 975 | Ga0495625_0019383 | 3300046660 | Bacteria | 5278 |
| 976 | Ga0495625_0099008 | 3300046660 | Bacteria | 2005 |
| 977 | Ga0495635_0003881 | 3300046663 | Bacteria | 10388 |
| 978 | Ga0495635_0021401 | 3300046663 | Bacteria | 4506 |
| 979 | Ga0495635_0398033 | 3300046663 | Bacteria | 915 |
| 980 | Ga0495659_0001458 | 3300046664 | Bacteria | 8030 |
| 981 | Ga0495659_0057268 | 3300046664 | Bacteria | 1432 |
| 982 | Ga0495661_0000588 | 3300046665 | Bacteria | 37543 |
| 983 | Ga0495661_0042470 | 3300046665 | Bacteria | 2802 |
| 984 | Ga0495661_0044928 | 3300046665 | Bacteria | 2705 |
| 985 | Ga0495661_0066043 | 3300046665 | Bacteria | 2130 |
| 986 | Ga0495588_0000148 | 3300046674 | Bacteria | 100600 |
| 987 | Ga0495588_0009890 | 3300046674 | Bacteria | 4421 |
| 988 | Ga0495588_0045221 | 3300046674 | Bacteria | 2256 |
| 989 | Ga0495657_0010946 | 3300046675 | Bacteria | 6803 |
| 990 | Ga0495599_0004481 | 3300046678 | Bacteria | 8275 |
| 991 | Ga0495599_0017530 | 3300046678 | Bacteria | 4451 |
| 992 | Ga0495623_0000420 | 3300046679 | Bacteria | 27960 |
| 993 | Ga0495623_0007330 | 3300046679 | Bacteria | 7157 |
| 994 | Ga0495646_0020687 | 3300046680 | Bacteria | 4163 |
| 995 | Ga0495647_0024629 | 3300046681 | Bacteria | 2192 |
| 996 | Ga0495658_0000788 | 3300046683 | Bacteria | 17050 |
| 997 | Ga0495658_0006062 | 3300046683 | Bacteria | 5938 |
| 998 | Ga0495658_0009215 | 3300046683 | Bacteria | 4909 |
| 999 | Ga0495669_0031148 | 3300046684 | Bacteria | 2342 |
| 1000 | Ga0495613_0257921 | 3300046689 | Bacteria | 1215 |
| 1001 | Ga0495613_0264446 | 3300046689 | Unclassified | 1197 |
| 1002 | Ga0495624_0026468 | 3300046690 | Unclassified | 3801 |
| 1003 | Ga0495624_0051811 | 3300046690 | Bacteria | 2595 |
| 1004 | Ga0495624_0091076 | 3300046690 | Bacteria | 1881 |
| 1005 | Ga0495670_0000291 | 3300046691 | Bacteria | 23680 |
| 1006 | Ga0495670_0004221 | 3300046691 | Bacteria | 7037 |
| 1007 | Ga0495670_0130511 | 3300046691 | Bacteria | 1309 |
| 1008 | Ga0495671_0000426 | 3300046692 | Bacteria | 33503 |
| 1009 | Ga0495671_0078965 | 3300046692 | Bacteria | 1613 |
| 1010 | Ga0495600_0001326 | 3300046809 | Bacteria | 13661 |
| 1011 | Ga0495600_0011214 | 3300046809 | Bacteria | 5584 |
| 1012 | Ga0495660_0001751 | 3300046810 | Bacteria | 14463 |
| 1013 | Ga0495660_0026320 | 3300046810 | Bacteria | 3298 |
| 1014 | Ga0495581_0049705 | 3300047315 | Bacteria | 2421 |
| 1015 | Ga0495581_0055269 | 3300047315 | Bacteria | 2291 |
| 1016 | Ga0495604_0003891 | 3300047317 | Bacteria | 11887 |
| 1017 | Ga0495604_0009082 | 3300047317 | Bacteria | 7865 |
| 1018 | Ga0495604_0028398 | 3300047317 | Bacteria | 4451 |
| 1019 | Ga0495636_0043692 | 3300047318 | Bacteria | 1865 |
| 1020 | Ga0495636_0122156 | 3300047318 | Bacteria | 1153 |
| 1021 | Ga0495674_0015363 | 3300047319 | Bacteria | 7160 |
| 1022 | Ga0495674_0027169 | 3300047319 | Bacteria | 5232 |
| 1023 | Ga0495674_0069524 | 3300047319 | Unclassified | 3044 |
| 1024 | Ga0495672_0000142 | 3300047320 | Bacteria | 105843 |
| 1025 | Ga0495672_0028555 | 3300047320 | Bacteria | 3528 |
| 1026 | Ga0495676_0076650 | 3300047321 | Bacteria | 2552 |
| 1027 | Ga0495676_0332651 | 3300047321 | Bacteria | 1018 |
| 1028 | Ga0495680_0011254 | 3300047322 | Bacteria | 7932 |
| 1029 | Ga0495680_0012959 | 3300047322 | Bacteria | 7301 |
| 1030 | Ga0495680_0044687 | 3300047322 | Bacteria | 3502 |
| 1031 | Ga0495680_0062737 | 3300047322 | Unclassified | 2856 |
| 1032 | Ga0495680_0088135 | 3300047322 | Bacteria | 2333 |
| 1033 | Ga0495687_000140 | 3300047443 | Bacteria | 109311 |
| 1034 | Ga0495687_000236 | 3300047443 | Bacteria | 76970 |
| 1035 | Ga0495687_046987 | 3300047443 | Bacteria | 1860 |
| 1036 | Ga0495675_0001544 | 3300047444 | Bacteria | 13904 |
| 1037 | Ga0495677_0032250 | 3300047445 | Bacteria | 1908 |
| 1038 | Ga0495677_0048032 | 3300047445 | Bacteria | 1568 |
| 1039 | Ga0495681_0115790 | 3300047470 | Bacteria | 1156 |
| 1040 | Ga0495684_0002087 | 3300047471 | Bacteria | 16070 |
| 1041 | Ga0495684_0282601 | 3300047471 | Unclassified | 1197 |
| 1042 | Ga0495686_0049134 | 3300047472 | Bacteria | 2655 |
| 1043 | Ga0495686_0105336 | 3300047472 | Bacteria | 1697 |
| 1044 | Ga0495593_0004626 | 3300047673 | Bacteria | 8180 |
| 1045 | Ga0495602_0000740 | 3300048088 | Bacteria | 30918 |
| 1046 | Ga0495602_0005526 | 3300048088 | Bacteria | 13262 |
| 1047 | Ga0495602_0107280 | 3300048088 | Bacteria | 2277 |
| 1048 | Ga0495602_0113689 | 3300048088 | Bacteria | 2193 |
| 1049 | Ga0495614_0031402 | 3300048089 | Bacteria | 2286 |
| 1050 | Ga0495614_0114701 | 3300048089 | Unclassified | 1184 |
| 1051 | Ga0495615_0002437 | 3300048090 | Bacteria | 2984 |
| 1052 | Ga0495626_0043143 | 3300048091 | Bacteria | 2117 |
| 1053 | Ga0496100_0000106 | 3300048903 | Bacteria | 48123 |
| 1054 | Ga0496100_0002951 | 3300048903 | Bacteria | 8748 |
| 1055 | Ga0496100_0003648 | 3300048903 | Bacteria | 8050 |
| 1056 | Ga0496101_0000992 | 3300048904 | Bacteria | 16792 |
| 1057 | Ga0496101_0020995 | 3300048904 | Bacteria | 4481 |
| 1058 | Ga0496101_0023715 | 3300048904 | Bacteria | 4241 |
| 1059 | Ga0496101_0137951 | 3300048904 | Bacteria | 1857 |
| 1060 | Ga0496101_0591310 | 3300048904 | Bacteria | 877 |
| 1061 | Ga0496102_0011236 | 3300048905 | Bacteria | 7715 |
| 1062 | Ga0496102_0019045 | 3300048905 | Bacteria | 6041 |
| 1063 | Ga0496102_0039093 | 3300048905 | Bacteria | 4285 |
| 1064 | Ga0496103_0006368 | 3300048906 | Bacteria | 7051 |
| 1065 | Ga0496103_0052592 | 3300048906 | Bacteria | 2522 |
| 1066 | Ga0496103_0196082 | 3300048906 | Bacteria | 1298 |
| 1067 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 1068 | Ga0496104_0005547 | 3300048907 | Bacteria | 11050 |
| 1069 | Ga0496104_0113779 | 3300048907 | Bacteria | 2595 |
| 1070 | Ga0496104_0213441 | 3300048907 | Bacteria | 1841 |
| 1071 | Ga0496104_0239954 | 3300048907 | Bacteria | 1725 |
| 1072 | Ga0496105_0001574 | 3300048908 | Bacteria | 16176 |
| 1073 | Ga0496105_0193026 | 3300048908 | Bacteria | 1664 |
| 1074 | Ga0496105_0248474 | 3300048908 | Bacteria | 1442 |
| 1075 | Ga0496106_0002499 | 3300048909 | Bacteria | 13684 |
| 1076 | Ga0496106_0012172 | 3300048909 | Bacteria | 6349 |
| 1077 | Ga0496106_0013964 | 3300048909 | Bacteria | 5939 |
| 1078 | Ga0496107_0000223 | 3300048910 | Bacteria | 30018 |
| 1079 | Ga0496107_0034213 | 3300048910 | Bacteria | 3639 |
| 1080 | Ga0496107_0037809 | 3300048910 | Bacteria | 3464 |
| 1081 | Ga0496107_0041516 | 3300048910 | Bacteria | 3303 |
| 1082 | Ga0496108_0003914 | 3300048911 | Bacteria | 11960 |
| 1083 | Ga0496108_0046748 | 3300048911 | Bacteria | 3617 |
| 1084 | Ga0496108_0203837 | 3300048911 | Bacteria | 1716 |
| 1085 | Ga0496109_0014846 | 3300048912 | Bacteria | 6778 |
| 1086 | Ga0496109_0016176 | 3300048912 | Bacteria | 6519 |
| 1087 | Ga0496109_0040980 | 3300048912 | Bacteria | 4195 |
| 1088 | Ga0496109_0072253 | 3300048912 | Bacteria | 3169 |
| 1089 | Ga0496109_0593511 | 3300048912 | Unclassified | 1043 |
| 1090 | Ga0496110_0046530 | 3300048913 | Bacteria | 3796 |
| 1091 | Ga0496110_0371797 | 3300048913 | Unclassified | 1302 |
| 1092 | Ga0496111_0113348 | 3300048914 | Bacteria | 1998 |
| 1093 | Ga0496112_0281134 | 3300048915 | Bacteria | 1611 |
| 1094 | Ga0496112_0661226 | 3300048915 | Bacteria | 974 |
| 1095 | Ga0496113_0006216 | 3300048916 | Bacteria | 7545 |
| 1096 | Ga0496113_0010789 | 3300048916 | Bacteria | 6060 |
| 1097 | Ga0496113_0085943 | 3300048916 | Bacteria | 2416 |
| 1098 | Ga0496113_0380979 | 3300048916 | Bacteria | 1132 |
| 1099 | Ga0496114_0006841 | 3300048917 | Bacteria | 8982 |
| 1100 | Ga0496114_0399786 | 3300048917 | Bacteria | 1217 |
| 1101 | Ga0496115_0021146 | 3300048918 | Bacteria | 5022 |
| 1102 | Ga0496115_0021880 | 3300048918 | Bacteria | 4945 |
| 1103 | Ga0496115_0073152 | 3300048918 | Bacteria | 2781 |
| 1104 | Ga0496115_0094696 | 3300048918 | Bacteria | 2443 |
| 1105 | Ga0496115_0155608 | 3300048918 | Bacteria | 1888 |
| 1106 | Ga0496115_0203915 | 3300048918 | Unclassified | 1633 |
| 1107 | Ga0496115_0471745 | 3300048918 | Unclassified | 1011 |
| 1108 | Ga0496116_0236119 | 3300048919 | Bacteria | 922 |
| 1109 | Ga0496118_0162592 | 3300048921 | Bacteria | 1378 |
| 1110 | Ga0496121_0050228 | 3300048924 | Bacteria | 3525 |
| 1111 | Ga0496121_0116997 | 3300048924 | Bacteria | 2020 |
| 1112 | Ga0496122_0004785 | 3300048925 | Bacteria | 16556 |
| 1113 | Ga0496123_0000329 | 3300048926 | Bacteria | 90380 |
| 1114 | Ga0496123_0084360 | 3300048926 | Bacteria | 1916 |
| 1115 | Ga0496124_0148716 | 3300048927 | Bacteria | 1840 |
| 1116 | Ga0496124_0368877 | 3300048927 | Bacteria | 1008 |
| 1117 | Ga0496126_0021159 | 3300048929 | Bacteria | 6360 |
| 1118 | Ga0496126_0106930 | 3300048929 | Bacteria | 2441 |
| 1119 | Ga0496126_0309794 | 3300048929 | Bacteria | 1300 |
| 1120 | Ga0495678_024007 | 3300049459 | Bacteria | 2640 |
| 1121 | Ga0495678_103844 | 3300049459 | Bacteria | 981 |
| 1122 | Ga0501031_0007403 | 3300049568 | Bacteria | 7151 |
| 1123 | Ga0501031_0064822 | 3300049568 | Bacteria | 2380 |
| 1124 | Ga0501032_0001244 | 3300049569 | Bacteria | 20453 |
| 1125 | Ga0501033_0000075 | 3300049570 | Bacteria | 94239 |
| 1126 | Ga0501033_0180842 | 3300049570 | Bacteria | 1512 |
| 1127 | Ga0501034_0000743 | 3300049571 | Bacteria | 49281 |
| 1128 | Ga0501034_0000760 | 3300049571 | Bacteria | 48430 |
| 1129 | Ga0501034_0280292 | 3300049571 | Bacteria | 1606 |
| 1130 | Ga0501034_0880791 | 3300049571 | Bacteria | 784 |
| 1131 | Ga0501036_0000105 | 3300049572 | Bacteria | 52655 |
| 1132 | Ga0501037_0001098 | 3300049573 | Bacteria | 20052 |
| 1133 | Ga0501038_0002155 | 3300049574 | Bacteria | 18292 |
| 1134 | Ga0501039_0001038 | 3300049575 | Bacteria | 20317 |
| 1135 | Ga0501043_0000017 | 3300049579 | Bacteria | 166630 |
| 1136 | Ga0501043_0204925 | 3300049579 | Bacteria | 1530 |
| 1137 | Ga0501043_0477819 | 3300049579 | Bacteria | 933 |
| 1138 | Ga0501046_0000215 | 3300049580 | Bacteria | 60301 |
| 1139 | Ga0501047_0002474 | 3300049581 | Bacteria | 17628 |
| 1140 | Ga0501047_0009616 | 3300049581 | Bacteria | 9142 |
| 1141 | Ga0501047_0272559 | 3300049581 | Bacteria | 1538 |
| 1142 | Ga0501048_0008070 | 3300049582 | Bacteria | 7971 |
| 1143 | Ga0501067_0000168 | 3300049583 | Bacteria | 36922 |
| 1144 | Ga0501067_0075382 | 3300049583 | Bacteria | 1869 |
| 1145 | Ga0501068_0005835 | 3300049584 | Bacteria | 6755 |
| 1146 | Ga0501068_0017682 | 3300049584 | Plasmid | 4125 |
| 1147 | Ga0501069_0000283 | 3300049585 | Bacteria | 23129 |
| 1148 | Ga0501069_0004666 | 3300049585 | Bacteria | 7084 |
| 1149 | Ga0501069_0220208 | 3300049585 | Bacteria | 1103 |
| 1150 | Ga0501069_0339534 | 3300049585 | Bacteria | 884 |
| 1151 | Ga0501070_0001274 | 3300049586 | Bacteria | 22623 |
| 1152 | Ga0501070_0079486 | 3300049586 | Unclassified | 2714 |
| 1153 | Ga0501070_0312239 | 3300049586 | Bacteria | 1280 |
| 1154 | Ga0501070_0372851 | 3300049586 | Bacteria | 1157 |
| 1155 | Ga0501071_0065933 | 3300049587 | Bacteria | 2630 |
| 1156 | Ga0501072_0007217 | 3300049588 | Bacteria | 8434 |
| 1157 | Ga0501072_0191989 | 3300049588 | Bacteria | 1629 |
| 1158 | Ga0501073_0001048 | 3300049589 | Bacteria | 19926 |
| 1159 | Ga0501073_0288906 | 3300049589 | Bacteria | 1131 |
| 1160 | Ga0501074_0007807 | 3300049590 | Bacteria | 7748 |
| 1161 | Ga0501076_0147833 | 3300049592 | Bacteria | 1911 |
| 1162 | Ga0501077_0019577 | 3300049593 | Bacteria | 4280 |
| 1163 | Ga0501079_0024258 | 3300049741 | Bacteria | 4654 |
| 1164 | Ga0501080_0075828 | 3300049742 | Bacteria | 3127 |
| 1165 | Ga0501080_0393713 | 3300049742 | Bacteria | 1247 |
| 1166 | Ga0501080_0447518 | 3300049742 | Bacteria | 1158 |
| 1167 | Ga0501083_0077570 | 3300049744 | Bacteria | 2204 |
| 1168 | Ga0501083_0273548 | 3300049744 | Bacteria | 1099 |
| 1169 | Ga0501083_0388712 | 3300049744 | Bacteria | 907 |
| 1170 | Ga0501263_029224 | 3300049760 | Bacteria | 772 |
| 1171 | Ga0501266_009130 | 3300049763 | Bacteria | 1252 |
| 1172 | Ga0501035_0000731 | 3300049822 | Bacteria | 35650 |
| 1173 | Ga0501035_0002545 | 3300049822 | Bacteria | 17829 |
| 1174 | Ga0501035_0201180 | 3300049822 | Bacteria | 1708 |
| 1175 | Ga0501035_0219439 | 3300049822 | Bacteria | 1624 |
| 1176 | Ga0501044_0000329 | 3300049823 | Bacteria | 59853 |
| 1177 | Ga0501044_0030272 | 3300049823 | Bacteria | 5706 |
| 1178 | Ga0501044_0120966 | 3300049823 | Unclassified | 2619 |
| 1179 | Ga0501044_0163759 | 3300049823 | Bacteria | 2199 |
| 1180 | Ga0501044_0196917 | 3300049823 | Bacteria | 1974 |
| 1181 | Ga0501044_0352360 | 3300049823 | Bacteria | 1391 |
| 1182 | Ga0501044_0360960 | 3300049823 | Bacteria | 1371 |
| 1183 | Ga0501044_0415062 | 3300049823 | Bacteria | 1257 |
| 1184 | Ga0501045_0083231 | 3300049824 | Bacteria | 2360 |
| 1185 | nmdc:mga03n38_14483_c1 | 3300050490 | Bacteria | 3023 |
| 1186 | nmdc:mga03n38_276968_c1 | 3300050490 | Bacteria | 894 |
| 1187 | nmdc:mga0yw44_125128_c1 | 3300050492 | Bacteria | 1659 |
| 1188 | nmdc:mga0yw44_352931_c1 | 3300050492 | Bacteria | 990 |
| 1189 | nmdc:mga0yw44_86133_c1 | 3300050492 | Bacteria | 1978 |
| 1190 | nmdc:mga0k408_24714_c1 | 3300050493 | Bacteria | 3398 |
| 1191 | nmdc:mga0k408_3983_c1 | 3300050493 | Bacteria | 7831 |
| 1192 | nmdc:mga06z11_126158_c1 | 3300050494 | Bacteria | 1432 |
| 1193 | nmdc:mga06z11_1795_c1 | 3300050494 | Bacteria | 8072 |
| 1194 | nmdc:mga05p37_13519_c1 | 3300050507 | Bacteria | 9784 |
| 1195 | nmdc:mga05p37_56_c3 | 3300050507 | Bacteria | 77819 |
| 1196 | nmdc:mga09592_976_c1 | 3300050508 | Bacteria | 22595 |
| 1197 | nmdc:mga0qj67_4772_c1 | 3300050509 | Bacteria | 9855 |
| 1198 | nmdc:mga06r32_34244_c1 | 3300050510 | Bacteria | 4789 |
| 1199 | nmdc:mga08y16_10784_c1 | 3300050511 | Bacteria | 9592 |
| 1200 | nmdc:mga08y16_206_c1 | 3300050511 | Bacteria | 46039 |
| 1201 | nmdc:mga08y16_2396_c1 | 3300050511 | Bacteria | 19256 |
| 1202 | nmdc:mga08y16_610118_c1 | 3300050511 | Bacteria | 1099 |
| 1203 | nmdc:mga0n895_327311_c1 | 3300050512 | Bacteria | 1553 |
| 1204 | nmdc:mga0n895_51689_c1 | 3300050512 | Bacteria | 4032 |
| 1205 | nmdc:mga0n895_5847_c1 | 3300050512 | Bacteria | 10340 |
| 1206 | nmdc:mga0rr50_154672_c1 | 3300050513 | Bacteria | 1857 |
| 1207 | nmdc:mga0rr50_256812_c1 | 3300050513 | Bacteria | 1453 |
| 1208 | nmdc:mga0rr50_44591_c1 | 3300050513 | Bacteria | 3253 |
| 1209 | nmdc:mga08x19_379394_c1 | 3300050514 | Bacteria | 990 |
| 1210 | nmdc:mga0a205_11514_c1 | 3300050515 | Bacteria | 8147 |
| 1211 | nmdc:mga0a205_80_c1 | 3300050515 | Bacteria | 53083 |
| 1212 | Ga0495601_0000360 | 3300053077 | Bacteria | 23959 |
| 1213 | Ga0495601_0001260 | 3300053077 | Bacteria | 13862 |
| 1214 | Ga0495601_0007151 | 3300053077 | Bacteria | 6544 |
| 1215 | Ga0495601_0070227 | 3300053077 | Bacteria | 2235 |
| 1216 | Ga0495601_0282707 | 3300053077 | Bacteria | 1082 |
| 1217 | Ga0495612_0000964 | 3300053078 | Bacteria | 11832 |
| 1218 | Ga0495612_0002659 | 3300053078 | Bacteria | 7371 |
| 1219 | Ga0495612_0008741 | 3300053078 | Bacteria | 4108 |
| 1220 | Ga0495612_0009169 | 3300053078 | Bacteria | 4014 |
| 1221 | Ga0495612_0038379 | 3300053078 | Bacteria | 1946 |
| 1222 | Ga0500610_0226643 | 3300053079 | Bacteria | 880 |
| 1223 | Ga0495595_0000969 | 3300053084 | Bacteria | 11036 |
| 1224 | Ga0495595_0001276 | 3300053084 | Bacteria | 9815 |
| 1225 | Ga0495595_0003989 | 3300053084 | Bacteria | 5900 |
| 1226 | Ga0495619_0000375 | 3300053085 | Bacteria | 30799 |
| 1227 | Ga0495619_0000581 | 3300053085 | Bacteria | 24290 |
| 1228 | Ga0495619_0001851 | 3300053085 | Bacteria | 14080 |
| 1229 | Ga0495619_0002471 | 3300053085 | Bacteria | 12094 |
| 1230 | Ga0500578_0097311 | 3300053086 | Bacteria | 1865 |
| 1231 | Ga0500644_0008930 | 3300053088 | Bacteria | 2662 |
| 1232 | Ga0500644_0116210 | 3300053088 | Bacteria | 1037 |
| 1233 | Ga0500646_0000891 | 3300053090 | Bacteria | 8244 |
| 1234 | Ga0500566_0024974 | 3300053094 | Bacteria | 3504 |
| 1235 | Ga0500566_0103442 | 3300053094 | Unclassified | 1558 |
| 1236 | Ga0500566_0130230 | 3300053094 | Bacteria | 1347 |
| 1237 | Ga0500641_0006059 | 3300053096 | Bacteria | 4283 |
| 1238 | Ga0500557_020936 | 3300053105 | Bacteria | 1867 |
| 1239 | Ga0500562_011565 | 3300053108 | Bacteria | 2241 |
| 1240 | Ga0500562_049758 | 3300053108 | Bacteria | 1120 |
| 1241 | Ga0500594_0006878 | 3300053118 | Bacteria | 2563 |
| 1242 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1243 | Ga0500618_010091 | 3300053125 | Bacteria | 2547 |
| 1244 | Ga0500642_0091146 | 3300053130 | Bacteria | 1409 |
| 1245 | Ga0500559_0009761 | 3300053136 | Bacteria | 4142 |
| 1246 | Ga0500568_0005193 | 3300053139 | Bacteria | 6788 |
| 1247 | Ga0500577_0031696 | 3300053142 | Bacteria | 1852 |
| 1248 | Ga0500586_066588 | 3300053145 | Bacteria | 1258 |
| 1249 | Ga0500588_0019735 | 3300053146 | Bacteria | 1797 |
| 1250 | Ga0500588_0107918 | 3300053146 | Bacteria | 968 |
| 1251 | Ga0500589_169386 | 3300053147 | Bacteria | 870 |
| 1252 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1253 | Ga0500620_000770 | 3300053155 | Bacteria | 5516 |
| 1254 | Ga0500627_0015729 | 3300053158 | Bacteria | 2933 |
| 1255 | Ga0500627_0086179 | 3300053158 | Bacteria | 1403 |
| 1256 | Ga0500611_017475 | 3300053727 | Bacteria | 1307 |
| 1257 | Ga0500645_000471 | 3300053730 | Bacteria | 27490 |
| 1258 | Ga0500609_004193 | 3300053731 | Bacteria | 2003 |
| 1259 | Ga0500552_009611 | 3300053733 | Bacteria | 1170 |
| 1260 | Ga0501084_0099825 | 3300054114 | Bacteria | 2437 |
| 1261 | Ga0501084_0427144 | 3300054114 | Bacteria | 1120 |
| 1262 | Ga0501082_0081394 | 3300060353 | Bacteria | 2794 |
| 1263 | Ga0501082_0086383 | 3300060353 | Bacteria | 2706 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0289307 | Ga0373933_0289307_126_875 | 190 |
| 2 | 3300037418 | Ga0395900_1282466 | Ga0395900_1282466_25_627 | 192 |
| 3 | 3300027252 | Ga0209973_1008250 | Ga0209973_10082502 | 198 |
| 4 | 3300049579 | Ga0501043_0477819 | Ga0501043_0477819_17_625 | 198 |
| 5 | 3300025941 | Ga0207711_10471013 | Ga0207711_104710132 | 199 |
| 6 | 3300035113 | Ga0373936_0332104 | Ga0373936_0332104_12_620 | 202 |
| 7 | 3300046473 | Ga0495582_0510306 | Ga0495582_0510306_19_627 | 202 |
| 8 | 3300049571 | Ga0501034_0880791 | Ga0501034_0880791_147_755 | 202 |
| 9 | 3300049585 | Ga0501069_0339534 | Ga0501069_0339534_15_623 | 202 |
| 10 | 3300042157 | Ga0439458_0065715 | Ga0439458_0065715_269_895 | 204 |
| 11 | 3300000041 | ARcpr5oldR_c007944 | ARcpr5oldR_0079441 | 208 |
| 12 | iso_pu_bacteria | 2922185730 | 2922192077 | 210 |
| 13 | 3300037471 | Ga0395905_1086154 | Ga0395905_1086154_19_663 | 211 |
| 14 | 3300005327 | Ga0070658_10073399 | Ga0070658_100733994 | 213 |
| 15 | 3300005344 | Ga0070661_100153007 | Ga0070661_1001530072 | 213 |
| 16 | 3300025920 | Ga0207649_10368929 | Ga0207649_103689292 | 213 |
| 17 | 3300050490 | nmdc:mga03n38_276968_c1 | nmdc:mga03n38_276968_c1_57_722 | 215 |
| 18 | 3300010375 | Ga0105239_10060085 | Ga0105239_100600854 | 216 |
| 19 | 3300049760 | Ga0501263_029224 | Ga0501263_029224_17_679 | 216 |
| 20 | 3300050492 | nmdc:mga0yw44_352931_c1 | nmdc:mga0yw44_352931_c1_312_980 | 216 |
| 21 | 3300003790 | Ga0055528_1005404 | Ga0055528_10054044 | 217 |
| 22 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033316 | 217 |
| 23 | 3300025299 | Ga0209256_1007611 | Ga0209256_10076115 | 217 |
| 24 | iso_pu_bacteria | 2510917026 | 2511169427 | 218 |
| 25 | 3300025928 | Ga0207700_10115487 | Ga0207700_101154873 | 221 |
| 26 | 3300050493 | nmdc:mga0k408_24714_c1 | nmdc:mga0k408_24714_c1_736_1491 | 221 |
| 27 | 3300005347 | Ga0070668_100535252 | Ga0070668_1005352522 | 222 |
| 28 | 3300025972 | Ga0207668_10035290 | Ga0207668_100352902 | 222 |
| 29 | 3300046691 | Ga0495670_0004221 | Ga0495670_0004221_3324_4070 | 222 |
| 30 | iso_pu_bacteria | 2881853255 | 2881856833 | 222 |
| 31 | 3300031649 | Ga0307514_10002390 | Ga0307514_100023904 | 223 |
| 32 | 3300025920 | Ga0207649_10101143 | Ga0207649_101011432 | 224 |
| 33 | 3300042157 | Ga0439458_0073289 | Ga0439458_0073289_172_846 | 224 |
| 34 | 3300048907 | Ga0496104_0239954 | Ga0496104_0239954_1028_1702 | 224 |
| 35 | 3300050513 | nmdc:mga0rr50_256812_c1 | nmdc:mga0rr50_256812_c1_21_695 | 224 |
| 36 | 3300053088 | Ga0500644_0008930 | Ga0500644_0008930_101_838 | 224 |
| 37 | 3300053094 | Ga0500566_0024974 | Ga0500566_0024974_1077_1814 | 224 |
| 38 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_46073_46810 | 224 |
| 39 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_60909_61646 | 224 |
| 40 | 3300053730 | Ga0500645_000471 | Ga0500645_000471_22327_23064 | 224 |
| 41 | 3300031711 | Ga0265314_10005122 | Ga0265314_100051224 | 225 |
| 42 | 3300048907 | Ga0496104_0213441 | Ga0496104_0213441_595_1317 | 225 |
| 43 | 3300049822 | Ga0501035_0002545 | Ga0501035_0002545_9200_9895 | 226 |
| 44 | 3300005328 | Ga0070676_10275987 | Ga0070676_102759872 | 227 |
| 45 | 3300025949 | Ga0207667_10339117 | Ga0207667_103391172 | 227 |
| 46 | 3300053088 | Ga0500644_0116210 | Ga0500644_0116210_234_1001 | 227 |
| 47 | 3300013100 | Ga0157373_10001948 | Ga0157373_100019485 | 228 |
| 48 | 3300037068 | Ga0373925_0127186 | Ga0373925_0127186_43_729 | 228 |
| 49 | 3300031456 | Ga0307513_10261468 | Ga0307513_102614682 | 229 |
| 50 | 3300031548 | Ga0307408_100054991 | Ga0307408_1000549912 | 229 |
| 51 | 3300031616 | Ga0307508_10124354 | Ga0307508_101243542 | 229 |
| 52 | 3300031731 | Ga0307405_10000665 | Ga0307405_1000066510 | 229 |
| 53 | 3300031824 | Ga0307413_10381904 | Ga0307413_103819041 | 229 |
| 54 | 3300031852 | Ga0307410_10005796 | Ga0307410_100057963 | 229 |
| 55 | 3300031901 | Ga0307406_10042974 | Ga0307406_100429742 | 229 |
| 56 | 3300031903 | Ga0307407_10016631 | Ga0307407_100166314 | 229 |
| 57 | 3300031995 | Ga0307409_100026359 | Ga0307409_1000263592 | 229 |
| 58 | 3300032002 | Ga0307416_100002531 | Ga0307416_1000025312 | 229 |
| 59 | 3300032126 | Ga0307415_100000759 | Ga0307415_10000075911 | 229 |
| 60 | 3300053086 | Ga0500578_0097311 | Ga0500578_0097311_918_1631 | 229 |
| 61 | 3300053142 | Ga0500577_0031696 | Ga0500577_0031696_403_1116 | 229 |
| 62 | 3300053146 | Ga0500588_0019735 | Ga0500588_0019735_868_1581 | 229 |
| 63 | 3300000652 | ARCol0yngRDRAFT_1001388 | ARCol0yngRDRAFT_10013883 | 230 |
| 64 | 3300005331 | Ga0070670_100028821 | Ga0070670_1000288215 | 230 |
| 65 | 3300005334 | Ga0068869_100087083 | Ga0068869_1000870832 | 230 |
| 66 | 3300005335 | Ga0070666_10030551 | Ga0070666_100305512 | 230 |
| 67 | 3300005340 | Ga0070689_100062016 | Ga0070689_1000620161 | 230 |
| 68 | 3300005355 | Ga0070671_100006280 | Ga0070671_1000062806 | 230 |
| 69 | 3300005364 | Ga0070673_100057607 | Ga0070673_1000576074 | 230 |
| 70 | 3300005434 | Ga0070709_10003137 | Ga0070709_100031372 | 230 |
| 71 | 3300005436 | Ga0070713_100034352 | Ga0070713_1000343522 | 230 |
| 72 | 3300005437 | Ga0070710_10005022 | Ga0070710_100050223 | 230 |
| 73 | 3300005438 | Ga0070701_10133855 | Ga0070701_101338552 | 230 |
| 74 | 3300005439 | Ga0070711_100030851 | Ga0070711_1000308514 | 230 |
| 75 | 3300005456 | Ga0070678_100034927 | Ga0070678_1000349272 | 230 |
| 76 | 3300005466 | Ga0070685_10015115 | Ga0070685_100151153 | 230 |
| 77 | 3300005535 | Ga0070684_100228069 | Ga0070684_1002280692 | 230 |
| 78 | 3300005543 | Ga0070672_100625671 | Ga0070672_1006256711 | 230 |
| 79 | 3300005548 | Ga0070665_100138556 | Ga0070665_1001385562 | 230 |
| 80 | 3300005615 | Ga0070702_100050904 | Ga0070702_1000509042 | 230 |
| 81 | 3300005618 | Ga0068864_100029150 | Ga0068864_1000291502 | 230 |
| 82 | 3300005841 | Ga0068863_100198046 | Ga0068863_1001980462 | 230 |
| 83 | 3300006028 | Ga0070717_10000199 | Ga0070717_1000019915 | 230 |
| 84 | 3300006173 | Ga0070716_100002448 | Ga0070716_1000024487 | 230 |
| 85 | 3300006175 | Ga0070712_100120706 | Ga0070712_1001207062 | 230 |
| 86 | 3300006237 | Ga0097621_100036113 | Ga0097621_1000361132 | 230 |
| 87 | 3300006358 | Ga0068871_100012500 | Ga0068871_1000125004 | 230 |
| 88 | 3300009011 | Ga0105251_10030580 | Ga0105251_100305803 | 230 |
| 89 | 3300009101 | Ga0105247_10029759 | Ga0105247_100297592 | 230 |
| 90 | 3300009148 | Ga0105243_10033088 | Ga0105243_100330885 | 230 |
| 91 | 3300009177 | Ga0105248_10031416 | Ga0105248_100314165 | 230 |
| 92 | 3300009553 | Ga0105249_10134000 | Ga0105249_101340002 | 230 |
| 93 | 3300011119 | Ga0105246_10113686 | Ga0105246_101136861 | 230 |
| 94 | 3300013296 | Ga0157374_10141327 | Ga0157374_101413271 | 230 |
| 95 | 3300013308 | Ga0157375_10078898 | Ga0157375_100788982 | 230 |
| 96 | 3300014969 | Ga0157376_10153359 | Ga0157376_101533591 | 230 |
| 97 | 3300025898 | Ga0207692_10000876 | Ga0207692_1000087610 | 230 |
| 98 | 3300025900 | Ga0207710_10001609 | Ga0207710_100016095 | 230 |
| 99 | 3300025901 | Ga0207688_10059462 | Ga0207688_100594622 | 230 |
| 100 | 3300025906 | Ga0207699_10002088 | Ga0207699_100020888 | 230 |
| 101 | 3300025915 | Ga0207693_10007304 | Ga0207693_100073049 | 230 |
| 102 | 3300025916 | Ga0207663_10126218 | Ga0207663_101262182 | 230 |
| 103 | 3300025928 | Ga0207700_10002485 | Ga0207700_100024856 | 230 |
| 104 | 3300025929 | Ga0207664_10005574 | Ga0207664_100055745 | 230 |
| 105 | 3300025934 | Ga0207686_10007990 | Ga0207686_100079904 | 230 |
| 106 | 3300025937 | Ga0207669_10165114 | Ga0207669_101651142 | 230 |
| 107 | 3300025939 | Ga0207665_10001702 | Ga0207665_100017029 | 230 |
| 108 | 3300025940 | Ga0207691_10509947 | Ga0207691_105099471 | 230 |
| 109 | 3300025941 | Ga0207711_10009675 | Ga0207711_100096752 | 230 |
| 110 | 3300025944 | Ga0207661_10595864 | Ga0207661_105958642 | 230 |
| 111 | 3300025945 | Ga0207679_10095656 | Ga0207679_100956562 | 230 |
| 112 | 3300025960 | Ga0207651_10116032 | Ga0207651_101160323 | 230 |
| 113 | 3300025972 | Ga0207668_10303789 | Ga0207668_103037892 | 230 |
| 114 | 3300026095 | Ga0207676_10019580 | Ga0207676_100195805 | 230 |
| 115 | 3300028379 | Ga0268266_10034656 | Ga0268266_100346562 | 230 |
| 116 | 3300028379 | Ga0268266_10104379 | Ga0268266_101043792 | 230 |
| 117 | 3300045836 | Ga0466958_0034786 | Ga0466958_0034786_1069_1785 | 230 |
| 118 | 3300047472 | Ga0495686_0105336 | Ga0495686_0105336_771_1517 | 230 |
| 119 | 3300048903 | Ga0496100_0003648 | Ga0496100_0003648_3239_3976 | 230 |
| 120 | 3300048904 | Ga0496101_0023715 | Ga0496101_0023715_704_1441 | 230 |
| 121 | 3300048906 | Ga0496103_0052592 | Ga0496103_0052592_261_998 | 230 |
| 122 | 3300048912 | Ga0496109_0593511 | Ga0496109_0593511_245_982 | 230 |
| 123 | 3300048913 | Ga0496110_0371797 | Ga0496110_0371797_373_1110 | 230 |
| 124 | 3300048918 | Ga0496115_0203915 | Ga0496115_0203915_704_1441 | 230 |
| 125 | 3300028381 | Ga0268264_10679750 | Ga0268264_106797502 | 231 |
| 126 | 3300002737 | JGI25162J39368_1000996 | JGI25162J39368_10009969 | 232 |
| 127 | 3300003214 | JGI25165J46597_1000819 | JGI25165J46597_100081915 | 232 |
| 128 | 3300003214 | JGI25165J46597_1001228 | JGI25165J46597_10012289 | 232 |
| 129 | 3300005338 | Ga0068868_100060491 | Ga0068868_1000604914 | 232 |
| 130 | 3300005339 | Ga0070660_100143095 | Ga0070660_1001430952 | 232 |
| 131 | 3300005365 | Ga0070688_100011831 | Ga0070688_1000118315 | 232 |
| 132 | 3300005366 | Ga0070659_100007504 | Ga0070659_1000075044 | 232 |
| 133 | 3300005367 | Ga0070667_100209204 | Ga0070667_1002092041 | 232 |
| 134 | 3300005539 | Ga0068853_100185112 | Ga0068853_1001851122 | 232 |
| 135 | 3300005544 | Ga0070686_100032042 | Ga0070686_1000320424 | 232 |
| 136 | 3300005546 | Ga0070696_100078891 | Ga0070696_1000788911 | 232 |
| 137 | 3300005548 | Ga0070665_100010015 | Ga0070665_1000100156 | 232 |
| 138 | 3300005564 | Ga0070664_100022255 | Ga0070664_1000222552 | 232 |
| 139 | 3300005617 | Ga0068859_100389314 | Ga0068859_1003893142 | 232 |
| 140 | 3300006931 | Ga0097620_100389303 | Ga0097620_1003893032 | 232 |
| 141 | 3300009098 | Ga0105245_10091423 | Ga0105245_100914232 | 232 |
| 142 | 3300009174 | Ga0105241_10095627 | Ga0105241_100956272 | 232 |
| 143 | 3300009176 | Ga0105242_10019812 | Ga0105242_100198125 | 232 |
| 144 | 3300009551 | Ga0105238_10036872 | Ga0105238_100368725 | 232 |
| 145 | 3300009551 | Ga0105238_10074611 | Ga0105238_100746112 | 232 |
| 146 | 3300013297 | Ga0157378_10052925 | Ga0157378_100529253 | 232 |
| 147 | 3300013306 | Ga0163162_10327920 | Ga0163162_103279201 | 232 |
| 148 | 3300025233 | Ga0209437_100057 | Ga0209437_100057139 | 232 |
| 149 | 3300025261 | Ga0209233_1000134 | Ga0209233_1000134139 | 232 |
| 150 | 3300025907 | Ga0207645_10035558 | Ga0207645_100355583 | 232 |
| 151 | 3300025914 | Ga0207671_10063500 | Ga0207671_100635003 | 232 |
| 152 | 3300025919 | Ga0207657_10077205 | Ga0207657_100772052 | 232 |
| 153 | 3300025920 | Ga0207649_10020627 | Ga0207649_100206272 | 232 |
| 154 | 3300025924 | Ga0207694_10059954 | Ga0207694_100599544 | 232 |
| 155 | 3300025927 | Ga0207687_10029871 | Ga0207687_100298715 | 232 |
| 156 | 3300025931 | Ga0207644_10007663 | Ga0207644_100076632 | 232 |
| 157 | 3300025938 | Ga0207704_10098385 | Ga0207704_100983852 | 232 |
| 158 | 3300026035 | Ga0207703_10043709 | Ga0207703_100437092 | 232 |
| 159 | 3300026089 | Ga0207648_10136180 | Ga0207648_101361802 | 232 |
| 160 | 3300026121 | Ga0207683_10005254 | Ga0207683_100052546 | 232 |
| 161 | 3300026121 | Ga0207683_10351552 | Ga0207683_103515522 | 232 |
| 162 | 3300028381 | Ga0268264_10016375 | Ga0268264_100163751 | 232 |
| 163 | 3300035115 | Ga0373941_0073329 | Ga0373941_0073329_30_794 | 232 |
| 164 | 3300046452 | Ga0495617_032203 | Ga0495617_032203_646_1407 | 232 |
| 165 | 3300046457 | Ga0495590_0038336 | Ga0495590_0038336_888_1649 | 232 |
| 166 | 3300046474 | Ga0495605_0030593 | Ga0495605_0030593_887_1648 | 232 |
| 167 | 3300046492 | Ga0495585_0102018 | Ga0495585_0102018_730_1491 | 232 |
| 168 | 3300046506 | Ga0495583_0023652 | Ga0495583_0023652_1449_2210 | 232 |
| 169 | 3300046507 | Ga0495606_0151096 | Ga0495606_0151096_71_832 | 232 |
| 170 | 3300046518 | Ga0495631_0008269 | Ga0495631_0008269_3803_4564 | 232 |
| 171 | 3300046519 | Ga0495632_0022670 | Ga0495632_0022670_187_948 | 232 |
| 172 | 3300046524 | Ga0495648_0134160 | Ga0495648_0134160_443_1204 | 232 |
| 173 | 3300046538 | Ga0495609_0116715 | Ga0495609_0116715_254_1015 | 232 |
| 174 | 3300046616 | Ga0495668_0023779 | Ga0495668_0023779_1391_2152 | 232 |
| 175 | 3300046648 | Ga0495611_0116281 | Ga0495611_0116281_453_1214 | 232 |
| 176 | 3300046660 | Ga0495625_0017209 | Ga0495625_0017209_1434_2195 | 232 |
| 177 | 3300046691 | Ga0495670_0130511 | Ga0495670_0130511_524_1285 | 232 |
| 178 | 3300046810 | Ga0495660_0026320 | Ga0495660_0026320_1839_2600 | 232 |
| 179 | 3300047445 | Ga0495677_0048032 | Ga0495677_0048032_70_831 | 232 |
| 180 | 3300048912 | Ga0496109_0040980 | Ga0496109_0040980_62_799 | 232 |
| 181 | 3300049459 | Ga0495678_024007 | Ga0495678_024007_361_1122 | 232 |
| 182 | 3300053105 | Ga0500557_020936 | Ga0500557_020936_553_1314 | 232 |
| 183 | 3300053118 | Ga0500594_0006878 | Ga0500594_0006878_988_1749 | 232 |
| 184 | 3300053130 | Ga0500642_0091146 | Ga0500642_0091146_30_791 | 232 |
| 185 | 3300053146 | Ga0500588_0107918 | Ga0500588_0107918_178_939 | 232 |
| 186 | 3300049823 | Ga0501044_0415062 | Ga0501044_0415062_185_943 | 233 |
| 187 | 3300005983 | Ga0081540_1011095 | Ga0081540_10110955 | 235 |
| 188 | 3300034818 | Ga0373950_0014391 | Ga0373950_0014391_330_1067 | 235 |
| 189 | 3300046457 | Ga0495590_0002579 | Ga0495590_0002579_1535_2287 | 235 |
| 190 | 3300047318 | Ga0495636_0043692 | Ga0495636_0043692_778_1539 | 235 |
| 191 | 3300047320 | Ga0495672_0028555 | Ga0495672_0028555_510_1271 | 235 |
| 192 | 3300003911 | JGI25405J52794_10016886 | JGI25405J52794_100168862 | 236 |
| 193 | 3300005438 | Ga0070701_10411171 | Ga0070701_104111711 | 236 |
| 194 | 3300005445 | Ga0070708_100113795 | Ga0070708_1001137953 | 236 |
| 195 | 3300005937 | Ga0081455_10012017 | Ga0081455_100120174 | 236 |
| 196 | 3300005937 | Ga0081455_10056729 | Ga0081455_100567291 | 236 |
| 197 | 3300005983 | Ga0081540_1050829 | Ga0081540_10508292 | 236 |
| 198 | 3300006058 | Ga0075432_10000873 | Ga0075432_100008732 | 236 |
| 199 | 3300006844 | Ga0075428_100035558 | Ga0075428_1000355582 | 236 |
| 200 | 3300006846 | Ga0075430_100004696 | Ga0075430_1000046962 | 236 |
| 201 | 3300006847 | Ga0075431_100006639 | Ga0075431_1000066392 | 236 |
| 202 | 3300006852 | Ga0075433_10001599 | Ga0075433_1000159910 | 236 |
| 203 | 3300006871 | Ga0075434_100000576 | Ga0075434_10000057619 | 236 |
| 204 | 3300006880 | Ga0075429_100060828 | Ga0075429_1000608282 | 236 |
| 205 | 3300007076 | Ga0075435_100002716 | Ga0075435_1000027166 | 236 |
| 206 | 3300009094 | Ga0111539_10000503 | Ga0111539_1000050332 | 236 |
| 207 | 3300009147 | Ga0114129_10009008 | Ga0114129_1000900814 | 236 |
| 208 | 3300009147 | Ga0114129_10013874 | Ga0114129_1001387410 | 236 |
| 209 | 3300027907 | Ga0207428_10000114 | Ga0207428_1000011470 | 236 |
| 210 | 3300044656 | Ga0466969_0152944 | Ga0466969_0152944_74_820 | 236 |
| 211 | 3300044684 | Ga0466966_0014495 | Ga0466966_0014495_1459_2205 | 236 |
| 212 | 3300044719 | Ga0466971_0016255 | Ga0466971_0016255_1187_1933 | 236 |
| 213 | 3300045049 | Ga0466959_0057725 | Ga0466959_0057725_1886_2632 | 236 |
| 214 | 3300046460 | Ga0495638_0002787 | Ga0495638_0002787_9328_10080 | 236 |
| 215 | 3300050507 | nmdc:mga05p37_13519_c1 | nmdc:mga05p37_13519_c1_3837_4574 | 236 |
| 216 | 3300050507 | nmdc:mga05p37_56_c3 | nmdc:mga05p37_56_c3_35633_36370 | 236 |
| 217 | 3300050508 | nmdc:mga09592_976_c1 | nmdc:mga09592_976_c1_7006_7743 | 236 |
| 218 | 3300050509 | nmdc:mga0qj67_4772_c1 | nmdc:mga0qj67_4772_c1_1153_1890 | 236 |
| 219 | 3300050510 | nmdc:mga06r32_34244_c1 | nmdc:mga06r32_34244_c1_1251_1988 | 236 |
| 220 | 3300050511 | nmdc:mga08y16_206_c1 | nmdc:mga08y16_206_c1_9670_10407 | 236 |
| 221 | 3300050512 | nmdc:mga0n895_51689_c1 | nmdc:mga0n895_51689_c1_2271_3008 | 236 |
| 222 | 3300050512 | nmdc:mga0n895_5847_c1 | nmdc:mga0n895_5847_c1_7480_8217 | 236 |
| 223 | 3300050513 | nmdc:mga0rr50_154672_c1 | nmdc:mga0rr50_154672_c1_266_1003 | 236 |
| 224 | 3300050515 | nmdc:mga0a205_11514_c1 | nmdc:mga0a205_11514_c1_2227_2964 | 236 |
| 225 | 3300050515 | nmdc:mga0a205_80_c1 | nmdc:mga0a205_80_c1_42601_43338 | 236 |
| 226 | 3300053108 | Ga0500562_011565 | Ga0500562_011565_722_1474 | 236 |
| 227 | 3300053139 | Ga0500568_0005193 | Ga0500568_0005193_1602_2354 | 236 |
| 228 | 3300053158 | Ga0500627_0015729 | Ga0500627_0015729_967_1719 | 236 |
| 229 | 3300005355 | Ga0070671_100197434 | Ga0070671_1001974342 | 237 |
| 230 | 3300006028 | Ga0070717_10616900 | Ga0070717_106169001 | 237 |
| 231 | 3300014968 | Ga0157379_10147615 | Ga0157379_101476152 | 237 |
| 232 | 3300026118 | Ga0207675_100312265 | Ga0207675_1003122653 | 237 |
| 233 | 3300031250 | Ga0265331_10001870 | Ga0265331_100018707 | 237 |
| 234 | 3300031595 | Ga0265313_10004127 | Ga0265313_100041276 | 237 |
| 235 | 3300031711 | Ga0265314_10027436 | Ga0265314_100274361 | 237 |
| 236 | 3300031712 | Ga0265342_10052084 | Ga0265342_100520843 | 237 |
| 237 | 3300037853 | Ga0436364_1391236 | Ga0436364_1391236_1184_1927 | 237 |
| 238 | iso_pu_bacteria | 2842733646 | 2842738235 | 237 |
| 239 | 3300009176 | Ga0105242_10230382 | Ga0105242_102303822 | 238 |
| 240 | 3300009177 | Ga0105248_10167723 | Ga0105248_101677232 | 238 |
| 241 | 3300009553 | Ga0105249_10142930 | Ga0105249_101429302 | 238 |
| 242 | 3300013306 | Ga0163162_10093404 | Ga0163162_100934042 | 238 |
| 243 | 3300013307 | Ga0157372_10023483 | Ga0157372_100234835 | 238 |
| 244 | 3300014325 | Ga0163163_10032174 | Ga0163163_100321742 | 238 |
| 245 | 3300025911 | Ga0207654_10025064 | Ga0207654_100250642 | 238 |
| 246 | 3300025961 | Ga0207712_10346974 | Ga0207712_103469742 | 238 |
| 247 | 3300025986 | Ga0207658_10494495 | Ga0207658_104944952 | 238 |
| 248 | 3300031249 | Ga0265339_10099784 | Ga0265339_100997842 | 238 |
| 249 | 3300031344 | Ga0265316_10149979 | Ga0265316_101499793 | 238 |
| 250 | 3300009098 | Ga0105245_10113448 | Ga0105245_101134482 | 239 |
| 251 | 3300009177 | Ga0105248_10021002 | Ga0105248_100210022 | 239 |
| 252 | 3300009551 | Ga0105238_10019606 | Ga0105238_100196064 | 239 |
| 253 | 3300009553 | Ga0105249_10007626 | Ga0105249_100076269 | 239 |
| 254 | 3300011119 | Ga0105246_10009274 | Ga0105246_100092744 | 239 |
| 255 | 3300025321 | Ga0207656_10262794 | Ga0207656_102627941 | 239 |
| 256 | 3300025924 | Ga0207694_10011454 | Ga0207694_100114544 | 239 |
| 257 | 3300025927 | Ga0207687_10027744 | Ga0207687_100277443 | 239 |
| 258 | 3300025941 | Ga0207711_10005310 | Ga0207711_1000531011 | 239 |
| 259 | 3300025961 | Ga0207712_10024382 | Ga0207712_100243825 | 239 |
| 260 | 3300031911 | Ga0307412_10261302 | Ga0307412_102613022 | 239 |
| 261 | 3300032002 | Ga0307416_100763014 | Ga0307416_1007630142 | 239 |
| 262 | 3300033179 | Ga0307507_10189955 | Ga0307507_101899552 | 239 |
| 263 | 3300049588 | Ga0501072_0191989 | Ga0501072_0191989_117_848 | 239 |
| 264 | 3300049742 | Ga0501080_0393713 | Ga0501080_0393713_480_1211 | 239 |
| 265 | 3300001989 | JGI24739J22299_10014140 | JGI24739J22299_100141401 | 240 |
| 266 | 3300005327 | Ga0070658_10007004 | Ga0070658_100070043 | 240 |
| 267 | 3300005336 | Ga0070680_100004099 | Ga0070680_10000409910 | 240 |
| 268 | 3300005341 | Ga0070691_10010361 | Ga0070691_100103612 | 240 |
| 269 | 3300005530 | Ga0070679_100009091 | Ga0070679_1000090916 | 240 |
| 270 | 3300005530 | Ga0070679_100784827 | Ga0070679_1007848271 | 240 |
| 271 | 3300005577 | Ga0068857_100336134 | Ga0068857_1003361342 | 240 |
| 272 | 3300006048 | Ga0075363_100096961 | Ga0075363_1000969612 | 240 |
| 273 | 3300009036 | Ga0105244_10159346 | Ga0105244_101593461 | 240 |
| 274 | 3300009092 | Ga0105250_10061706 | Ga0105250_100617062 | 240 |
| 275 | 3300009093 | Ga0105240_10014101 | Ga0105240_100141019 | 240 |
| 276 | 3300009093 | Ga0105240_10068510 | Ga0105240_100685103 | 240 |
| 277 | 3300009094 | Ga0111539_10000082 | Ga0111539_1000008216 | 240 |
| 278 | 3300009098 | Ga0105245_10000780 | Ga0105245_1000078015 | 240 |
| 279 | 3300009101 | Ga0105247_10002726 | Ga0105247_100027265 | 240 |
| 280 | 3300009148 | Ga0105243_10001083 | Ga0105243_1000108316 | 240 |
| 281 | 3300009174 | Ga0105241_10000760 | Ga0105241_1000076015 | 240 |
| 282 | 3300009177 | Ga0105248_10011305 | Ga0105248_100113055 | 240 |
| 283 | 3300009545 | Ga0105237_10006171 | Ga0105237_1000617113 | 240 |
| 284 | 3300009553 | Ga0105249_10002196 | Ga0105249_100021967 | 240 |
| 285 | 3300010375 | Ga0105239_10002791 | Ga0105239_1000279114 | 240 |
| 286 | 3300011119 | Ga0105246_10001585 | Ga0105246_1000158515 | 240 |
| 287 | 3300013100 | Ga0157373_10006240 | Ga0157373_100062408 | 240 |
| 288 | 3300013102 | Ga0157371_10085248 | Ga0157371_100852483 | 240 |
| 289 | 3300013296 | Ga0157374_10001691 | Ga0157374_1000169112 | 240 |
| 290 | 3300013297 | Ga0157378_10001445 | Ga0157378_1000144511 | 240 |
| 291 | 3300013306 | Ga0163162_10000790 | Ga0163162_1000079012 | 240 |
| 292 | 3300013307 | Ga0157372_10009037 | Ga0157372_100090377 | 240 |
| 293 | 3300013308 | Ga0157375_10000468 | Ga0157375_1000046822 | 240 |
| 294 | 3300014325 | Ga0163163_10003322 | Ga0163163_1000332218 | 240 |
| 295 | 3300014326 | Ga0157380_10002913 | Ga0157380_100029138 | 240 |
| 296 | 3300014745 | Ga0157377_10000276 | Ga0157377_1000027616 | 240 |
| 297 | 3300014968 | Ga0157379_10002285 | Ga0157379_1000228511 | 240 |
| 298 | 3300014969 | Ga0157376_10000692 | Ga0157376_100006925 | 240 |
| 299 | 3300025909 | Ga0207705_10008972 | Ga0207705_100089726 | 240 |
| 300 | 3300025912 | Ga0207707_10001464 | Ga0207707_1000146417 | 240 |
| 301 | 3300025917 | Ga0207660_10006940 | Ga0207660_100069407 | 240 |
| 302 | 3300025921 | Ga0207652_10016838 | Ga0207652_100168386 | 240 |
| 303 | 3300025949 | Ga0207667_10024372 | Ga0207667_100243722 | 240 |
| 304 | 3300026078 | Ga0207702_10324710 | Ga0207702_103247102 | 240 |
| 305 | 3300034818 | Ga0373950_0012337 | Ga0373950_0012337_255_977 | 240 |
| 306 | 3300034819 | Ga0373958_0002841 | Ga0373958_0002841_273_995 | 240 |
| 307 | 3300034957 | Ga0373938_0002852 | Ga0373938_0002852_1206_1928 | 240 |
| 308 | 3300034957 | Ga0373938_0009646 | Ga0373938_0009646_1021_1743 | 240 |
| 309 | 3300035084 | Ga0373928_0004477 | Ga0373928_0004477_315_1037 | 240 |
| 310 | 3300035085 | Ga0373929_0002872 | Ga0373929_0002872_1563_2285 | 240 |
| 311 | 3300035085 | Ga0373929_0003760 | Ga0373929_0003760_491_1213 | 240 |
| 312 | 3300035088 | Ga0373940_0026893 | Ga0373940_0026893_98_820 | 240 |
| 313 | 3300035090 | Ga0373949_0001450 | Ga0373949_0001450_4337_5059 | 240 |
| 314 | 3300035091 | Ga0373951_0011607 | Ga0373951_0011607_177_899 | 240 |
| 315 | 3300035112 | Ga0373932_0001864 | Ga0373932_0001864_636_1358 | 240 |
| 316 | 3300035114 | Ga0373939_0000339 | Ga0373939_0000339_2705_3427 | 240 |
| 317 | 3300035114 | Ga0373939_0009371 | Ga0373939_0009371_672_1394 | 240 |
| 318 | 3300035115 | Ga0373941_0002285 | Ga0373941_0002285_1426_2148 | 240 |
| 319 | 3300035115 | Ga0373941_0017574 | Ga0373941_0017574_837_1559 | 240 |
| 320 | 3300035170 | Ga0373943_0016793 | Ga0373943_0016793_1679_2401 | 240 |
| 321 | 3300035207 | Ga0373942_0003994 | Ga0373942_0003994_1718_2440 | 240 |
| 322 | 3300035241 | Ga0373961_0003896 | Ga0373961_0003896_1322_2044 | 240 |
| 323 | 3300035242 | Ga0373962_0005133 | Ga0373962_0005133_617_1339 | 240 |
| 324 | 3300035242 | Ga0373962_0006682 | Ga0373962_0006682_442_1164 | 240 |
| 325 | 3300035691 | Ga0373931_0000169 | Ga0373931_0000169_18130_18852 | 240 |
| 326 | 3300035691 | Ga0373931_0056827 | Ga0373931_0056827_462_1184 | 240 |
| 327 | 3300035695 | Ga0373927_0016232 | Ga0373927_0016232_2030_2752 | 240 |
| 328 | 3300035725 | Ga0373947_0005580 | Ga0373947_0005580_93_815 | 240 |
| 329 | 3300036401 | Ga0373937_0038298 | Ga0373937_0038298_1868_2590 | 240 |
| 330 | 3300037068 | Ga0373925_0009626 | Ga0373925_0009626_6219_6941 | 240 |
| 331 | 3300037312 | Ga0395899_0202627 | Ga0395899_0202627_278_1033 | 240 |
| 332 | 3300037418 | Ga0395900_0450445 | Ga0395900_0450445_206_961 | 240 |
| 333 | 3300046459 | Ga0495629_0000535 | Ga0495629_0000535_14420_15142 | 240 |
| 334 | 3300046459 | Ga0495629_0081599 | Ga0495629_0081599_100_822 | 240 |
| 335 | 3300046463 | Ga0495653_0154948 | Ga0495653_0154948_549_1271 | 240 |
| 336 | 3300046475 | Ga0495639_0026471 | Ga0495639_0026471_808_1530 | 240 |
| 337 | 3300046511 | Ga0495608_0039849 | Ga0495608_0039849_930_1652 | 240 |
| 338 | 3300046559 | Ga0495667_0024955 | Ga0495667_0024955_1960_2682 | 240 |
| 339 | 3300046681 | Ga0495647_0024629 | Ga0495647_0024629_1125_1847 | 240 |
| 340 | 3300046683 | Ga0495658_0000788 | Ga0495658_0000788_2663_3385 | 240 |
| 341 | 3300046684 | Ga0495669_0031148 | Ga0495669_0031148_1091_1813 | 240 |
| 342 | 3300046689 | Ga0495613_0257921 | Ga0495613_0257921_216_938 | 240 |
| 343 | 3300047317 | Ga0495604_0028398 | Ga0495604_0028398_2539_3261 | 240 |
| 344 | 3300047321 | Ga0495676_0076650 | Ga0495676_0076650_1053_1775 | 240 |
| 345 | 3300047322 | Ga0495680_0011254 | Ga0495680_0011254_4881_5603 | 240 |
| 346 | 3300047322 | Ga0495680_0088135 | Ga0495680_0088135_321_1043 | 240 |
| 347 | 3300048088 | Ga0495602_0107280 | Ga0495602_0107280_291_1013 | 240 |
| 348 | 3300048903 | Ga0496100_0000106 | Ga0496100_0000106_35986_36708 | 240 |
| 349 | 3300048904 | Ga0496101_0000992 | Ga0496101_0000992_9402_10124 | 240 |
| 350 | 3300048904 | Ga0496101_0591310 | Ga0496101_0591310_74_796 | 240 |
| 351 | 3300048905 | Ga0496102_0011236 | Ga0496102_0011236_4689_5411 | 240 |
| 352 | 3300048906 | Ga0496103_0006368 | Ga0496103_0006368_4094_4816 | 240 |
| 353 | 3300048906 | Ga0496103_0196082 | Ga0496103_0196082_521_1243 | 240 |
| 354 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_74859_75581 | 240 |
| 355 | 3300048907 | Ga0496104_0113779 | Ga0496104_0113779_1069_1791 | 240 |
| 356 | 3300048908 | Ga0496105_0001574 | Ga0496105_0001574_4191_4913 | 240 |
| 357 | 3300048908 | Ga0496105_0248474 | Ga0496105_0248474_599_1321 | 240 |
| 358 | 3300048909 | Ga0496106_0002499 | Ga0496106_0002499_9630_10352 | 240 |
| 359 | 3300048910 | Ga0496107_0000223 | Ga0496107_0000223_7556_8278 | 240 |
| 360 | 3300048911 | Ga0496108_0003914 | Ga0496108_0003914_1970_2692 | 240 |
| 361 | 3300048911 | Ga0496108_0203837 | Ga0496108_0203837_729_1451 | 240 |
| 362 | 3300048912 | Ga0496109_0014846 | Ga0496109_0014846_2262_2984 | 240 |
| 363 | 3300048912 | Ga0496109_0016176 | Ga0496109_0016176_500_1222 | 240 |
| 364 | 3300048913 | Ga0496110_0046530 | Ga0496110_0046530_2115_2837 | 240 |
| 365 | 3300048915 | Ga0496112_0281134 | Ga0496112_0281134_673_1395 | 240 |
| 366 | 3300048916 | Ga0496113_0006216 | Ga0496113_0006216_3501_4223 | 240 |
| 367 | 3300048916 | Ga0496113_0085943 | Ga0496113_0085943_1050_1772 | 240 |
| 368 | 3300048917 | Ga0496114_0006841 | Ga0496114_0006841_6347_7069 | 240 |
| 369 | 3300048918 | Ga0496115_0021146 | Ga0496115_0021146_2190_2912 | 240 |
| 370 | 3300048918 | Ga0496115_0021880 | Ga0496115_0021880_970_1692 | 240 |
| 371 | 3300048918 | Ga0496115_0073152 | Ga0496115_0073152_768_1490 | 240 |
| 372 | 3300049579 | Ga0501043_0204925 | Ga0501043_0204925_520_1389 | 240 |
| 373 | 3300049581 | Ga0501047_0272559 | Ga0501047_0272559_254_1084 | 240 |
| 374 | 3300050494 | nmdc:mga06z11_1795_c1 | nmdc:mga06z11_1795_c1_4410_5132 | 240 |
| 375 | 3300050511 | nmdc:mga08y16_2396_c1 | nmdc:mga08y16_2396_c1_8371_9093 | 240 |
| 376 | 3300050512 | nmdc:mga0n895_327311_c1 | nmdc:mga0n895_327311_c1_217_939 | 240 |
| 377 | 3300050513 | nmdc:mga0rr50_44591_c1 | nmdc:mga0rr50_44591_c1_551_1273 | 240 |
| 378 | 3300050514 | nmdc:mga08x19_379394_c1 | nmdc:mga08x19_379394_c1_231_953 | 240 |
| 379 | 3300053077 | Ga0495601_0007151 | Ga0495601_0007151_2508_3230 | 240 |
| 380 | 3300053078 | Ga0495612_0038379 | Ga0495612_0038379_1149_1871 | 240 |
| 381 | 3300053084 | Ga0495595_0003989 | Ga0495595_0003989_2053_2775 | 240 |
| 382 | 3300053085 | Ga0495619_0000375 | Ga0495619_0000375_12474_13196 | 240 |
| 383 | 3300053085 | Ga0495619_0002471 | Ga0495619_0002471_11209_11931 | 240 |
| 384 | 3300053108 | Ga0500562_049758 | Ga0500562_049758_52_786 | 240 |
| 385 | 3300053731 | Ga0500609_004193 | Ga0500609_004193_433_1188 | 240 |
| 386 | 3300053733 | Ga0500552_009611 | Ga0500552_009611_159_914 | 240 |
| 387 | iso_pu_bacteria | 2554235132 | 2554814217 | 240 |
| 388 | iso_pu_bacteria | 2606217733 | 2608381617 | 240 |
| 389 | iso_pu_bacteria | 2643221652 | 2644292306 | 240 |
| 390 | iso_pu_bacteria | 2811994881 | 2812371531 | 240 |
| 391 | iso_pu_bacteria | 2923519811 | 2923525647 | 240 |
| 392 | iso_pu_bacteria | 8011350971 | 8011355375 | 240 |
| 393 | iso_pu_bacteria | 8045864390 | 8045868996 | 240 |
| 394 | 3300003322 | rootL2_10099291 | rootL2_100992912 | 241 |
| 395 | 3300003781 | Ga0055536_1008523 | Ga0055536_10085235 | 241 |
| 396 | 3300003784 | Ga0055534_1000464 | Ga0055534_100046412 | 241 |
| 397 | 3300006038 | Ga0075365_10304165 | Ga0075365_103041652 | 241 |
| 398 | 3300006195 | Ga0075366_10128560 | Ga0075366_101285602 | 241 |
| 399 | 3300009174 | Ga0105241_10678471 | Ga0105241_106784711 | 241 |
| 400 | 3300013306 | Ga0163162_10134911 | Ga0163162_101349115 | 241 |
| 401 | 3300025284 | Ga0209130_1001541 | Ga0209130_10015412 | 241 |
| 402 | 3300025291 | Ga0209675_1002318 | Ga0209675_100231812 | 241 |
| 403 | 3300025292 | Ga0209676_1011115 | Ga0209676_10111152 | 241 |
| 404 | 3300025297 | Ga0209758_1040778 | Ga0209758_10407782 | 241 |
| 405 | 3300025298 | Ga0209050_1037713 | Ga0209050_10377132 | 241 |
| 406 | 3300025303 | Ga0209051_1007087 | Ga0209051_10070876 | 241 |
| 407 | 3300025304 | Ga0209257_1021446 | Ga0209257_10214462 | 241 |
| 408 | 3300025903 | Ga0207680_10151416 | Ga0207680_101514162 | 241 |
| 409 | 3300026023 | Ga0207677_10021038 | Ga0207677_100210385 | 241 |
| 410 | 3300031251 | Ga0265327_10002224 | Ga0265327_1000222412 | 241 |
| 411 | 3300037312 | Ga0395899_0052474 | Ga0395899_0052474_2216_2962 | 241 |
| 412 | 3300037312 | Ga0395899_0107269 | Ga0395899_0107269_530_1288 | 241 |
| 413 | 3300037312 | Ga0395899_0186411 | Ga0395899_0186411_447_1205 | 241 |
| 414 | 3300037418 | Ga0395900_0005219 | Ga0395900_0005219_7232_7978 | 241 |
| 415 | 3300037418 | Ga0395900_0179779 | Ga0395900_0179779_693_1451 | 241 |
| 416 | 3300037466 | Ga0395898_0003156 | Ga0395898_0003156_4271_5017 | 241 |
| 417 | 3300037466 | Ga0395898_0011599 | Ga0395898_0011599_3944_4702 | 241 |
| 418 | 3300037466 | Ga0395898_0086896 | Ga0395898_0086896_1618_2364 | 241 |
| 419 | 3300037471 | Ga0395905_0051198 | Ga0395905_0051198_2481_3227 | 241 |
| 420 | 3300037471 | Ga0395905_0070451 | Ga0395905_0070451_751_1566 | 241 |
| 421 | 3300037471 | Ga0395905_0090886 | Ga0395905_0090886_507_1253 | 241 |
| 422 | 3300038443 | Ga0395901_0000593 | Ga0395901_0000593_32007_32765 | 241 |
| 423 | 3300038443 | Ga0395901_0163403 | Ga0395901_0163403_531_1277 | 241 |
| 424 | 3300038443 | Ga0395901_0194575 | Ga0395901_0194575_673_1431 | 241 |
| 425 | 3300038443 | Ga0395901_0367986 | Ga0395901_0367986_151_897 | 241 |
| 426 | 3300041404 | Ga0439436_0037684 | Ga0439436_0037684_49_795 | 241 |
| 427 | 3300041410 | Ga0439461_0015906 | Ga0439461_0015906_181_927 | 241 |
| 428 | 3300042001 | Ga0439441_018364 | Ga0439441_018364_91_837 | 241 |
| 429 | 3300042128 | Ga0450897_009908 | Ga0450897_009908_95_832 | 241 |
| 430 | 3300042134 | Ga0450898_005994 | Ga0450898_005994_1009_1755 | 241 |
| 431 | 3300042435 | Ga0439434_0015569 | Ga0439434_0015569_1361_2107 | 241 |
| 432 | 3300044673 | Ga0453683_0002883 | Ga0453683_0002883_1609_2355 | 241 |
| 433 | 3300044842 | Ga0466957_0259493 | Ga0466957_0259493_89_835 | 241 |
| 434 | 3300045051 | Ga0451576_0004677 | Ga0451576_0004677_6128_6874 | 241 |
| 435 | 3300045976 | Ga0466967_0137994 | Ga0466967_0137994_249_1004 | 241 |
| 436 | 3300049763 | Ga0501266_009130 | Ga0501266_009130_299_1045 | 241 |
| 437 | 3300049822 | Ga0501035_0201180 | Ga0501035_0201180_21_779 | 241 |
| 438 | 3300049823 | Ga0501044_0196917 | Ga0501044_0196917_500_1258 | 241 |
| 439 | 3300003794 | Ga0055531_10001782 | Ga0055531_100017827 | 242 |
| 440 | 3300005328 | Ga0070676_10103970 | Ga0070676_101039702 | 242 |
| 441 | 3300005331 | Ga0070670_100321229 | Ga0070670_1003212292 | 242 |
| 442 | 3300005333 | Ga0070677_10010258 | Ga0070677_100102582 | 242 |
| 443 | 3300005354 | Ga0070675_100246730 | Ga0070675_1002467302 | 242 |
| 444 | 3300005356 | Ga0070674_100012815 | Ga0070674_1000128154 | 242 |
| 445 | 3300005364 | Ga0070673_100058559 | Ga0070673_1000585593 | 242 |
| 446 | 3300005456 | Ga0070678_100018286 | Ga0070678_1000182864 | 242 |
| 447 | 3300005459 | Ga0068867_100017280 | Ga0068867_1000172805 | 242 |
| 448 | 3300005543 | Ga0070672_100065787 | Ga0070672_1000657873 | 242 |
| 449 | 3300005577 | Ga0068857_100281877 | Ga0068857_1002818772 | 242 |
| 450 | 3300005618 | Ga0068864_100279994 | Ga0068864_1002799942 | 242 |
| 451 | 3300006048 | Ga0075363_100001113 | Ga0075363_1000011132 | 242 |
| 452 | 3300006177 | Ga0075362_10000122 | Ga0075362_1000012210 | 242 |
| 453 | 3300006178 | Ga0075367_10004445 | Ga0075367_100044455 | 242 |
| 454 | 3300006195 | Ga0075366_10019342 | Ga0075366_100193423 | 242 |
| 455 | 3300009148 | Ga0105243_10096320 | Ga0105243_100963202 | 242 |
| 456 | 3300009148 | Ga0105243_10481400 | Ga0105243_104814002 | 242 |
| 457 | 3300009177 | Ga0105248_10429777 | Ga0105248_104297772 | 242 |
| 458 | 3300009551 | Ga0105238_10021283 | Ga0105238_100212835 | 242 |
| 459 | 3300014325 | Ga0163163_10134668 | Ga0163163_101346683 | 242 |
| 460 | 3300014325 | Ga0163163_10148371 | Ga0163163_101483712 | 242 |
| 461 | 3300014326 | Ga0157380_10630896 | Ga0157380_106308961 | 242 |
| 462 | 3300025303 | Ga0209051_1001617 | Ga0209051_100161712 | 242 |
| 463 | 3300025304 | Ga0209257_1002499 | Ga0209257_100249911 | 242 |
| 464 | 3300025893 | Ga0207682_10000521 | Ga0207682_1000052112 | 242 |
| 465 | 3300025900 | Ga0207710_10142784 | Ga0207710_101427841 | 242 |
| 466 | 3300025908 | Ga0207643_10016129 | Ga0207643_100161293 | 242 |
| 467 | 3300025918 | Ga0207662_10037630 | Ga0207662_100376303 | 242 |
| 468 | 3300025923 | Ga0207681_10065126 | Ga0207681_100651262 | 242 |
| 469 | 3300025926 | Ga0207659_10066522 | Ga0207659_100665222 | 242 |
| 470 | 3300025931 | Ga0207644_10079676 | Ga0207644_100796763 | 242 |
| 471 | 3300025937 | Ga0207669_10041720 | Ga0207669_100417204 | 242 |
| 472 | 3300025938 | Ga0207704_10112038 | Ga0207704_101120382 | 242 |
| 473 | 3300025940 | Ga0207691_10129322 | Ga0207691_101293222 | 242 |
| 474 | 3300025960 | Ga0207651_10039537 | Ga0207651_100395372 | 242 |
| 475 | 3300025986 | Ga0207658_10782989 | Ga0207658_107829891 | 242 |
| 476 | 3300026075 | Ga0207708_10099362 | Ga0207708_100993622 | 242 |
| 477 | 3300026088 | Ga0207641_10141916 | Ga0207641_101419161 | 242 |
| 478 | 3300026089 | Ga0207648_10008536 | Ga0207648_100085364 | 242 |
| 479 | 3300026095 | Ga0207676_10236705 | Ga0207676_102367052 | 242 |
| 480 | 3300026118 | Ga0207675_100169240 | Ga0207675_1001692402 | 242 |
| 481 | 3300026121 | Ga0207683_10002066 | Ga0207683_1000206614 | 242 |
| 482 | 3300031456 | Ga0307513_10300298 | Ga0307513_103002981 | 242 |
| 483 | 3300037466 | Ga0395898_0000804 | Ga0395898_0000804_32781_33539 | 242 |
| 484 | 3300038443 | Ga0395901_0087898 | Ga0395901_0087898_1027_1785 | 242 |
| 485 | 3300046539 | Ga0495621_0005528 | Ga0495621_0005528_706_1458 | 242 |
| 486 | 3300048090 | Ga0495615_0002437 | Ga0495615_0002437_1987_2739 | 242 |
| 487 | 3300048925 | Ga0496122_0004785 | Ga0496122_0004785_6181_6930 | 242 |
| 488 | 3300048926 | Ga0496123_0000329 | Ga0496123_0000329_9670_10419 | 242 |
| 489 | 3300048927 | Ga0496124_0148716 | Ga0496124_0148716_798_1547 | 242 |
| 490 | 3300049570 | Ga0501033_0180842 | Ga0501033_0180842_703_1437 | 242 |
| 491 | 3300049586 | Ga0501070_0372851 | Ga0501070_0372851_284_1018 | 242 |
| 492 | 3300049589 | Ga0501073_0288906 | Ga0501073_0288906_357_1091 | 242 |
| 493 | 3300049744 | Ga0501083_0388712 | Ga0501083_0388712_25_759 | 242 |
| 494 | 3300049823 | Ga0501044_0163759 | Ga0501044_0163759_1203_1937 | 242 |
| 495 | 3300049823 | Ga0501044_0360960 | Ga0501044_0360960_67_801 | 242 |
| 496 | 3300050490 | nmdc:mga03n38_14483_c1 | nmdc:mga03n38_14483_c1_429_1181 | 242 |
| 497 | 3300050493 | nmdc:mga0k408_3983_c1 | nmdc:mga0k408_3983_c1_5774_6526 | 242 |
| 498 | 3300053079 | Ga0500610_0226643 | Ga0500610_0226643_83_835 | 242 |
| 499 | 3300053096 | Ga0500641_0006059 | Ga0500641_0006059_1669_2421 | 242 |
| 500 | 3300053136 | Ga0500559_0009761 | Ga0500559_0009761_3281_4030 | 242 |
| 501 | 3300053147 | Ga0500589_169386 | Ga0500589_169386_69_821 | 242 |
| 502 | iso_pu_bacteria | 2513237144 | 2513912305 | 242 |
| 503 | iso_pu_bacteria | 2513237146 | 2513928511 | 242 |
| 504 | iso_pu_bacteria | 2599185170 | 2599420223 | 242 |
| 505 | iso_pu_bacteria | 2643221634 | 2644194900 | 242 |
| 506 | iso_pu_bacteria | 2791355256 | 2793295712 | 242 |
| 507 | iso_pu_bacteria | 2791355261 | 2793327201 | 242 |
| 508 | iso_pu_bacteria | 2791355262 | 2793332152 | 242 |
| 509 | iso_pu_bacteria | 2791355265 | 2793353943 | 242 |
| 510 | iso_pu_bacteria | 2838035591 | 2838040429 | 242 |
| 511 | iso_pu_bacteria | 2838661181 | 2838667843 | 242 |
| 512 | iso_pu_bacteria | 2842205361 | 2842207336 | 242 |
| 513 | iso_pu_bacteria | 2842278818 | 2842280953 | 242 |
| 514 | iso_pu_bacteria | 2842285085 | 2842288431 | 242 |
| 515 | iso_pu_bacteria | 2842402390 | 2842406223 | 242 |
| 516 | iso_pu_bacteria | 2842409023 | 2842412808 | 242 |
| 517 | iso_pu_bacteria | 2842415677 | 2842419313 | 242 |
| 518 | iso_pu_bacteria | 2854896431 | 2854897049 | 242 |
| 519 | iso_pu_bacteria | 2854916844 | 2854917195 | 242 |
| 520 | iso_pu_bacteria | 2933016740 | 2933021898 | 242 |
| 521 | iso_pu_bacteria | 3005409236 | 3005409558 | 242 |
| 522 | iso_pu_bacteria | 8005289223 | 8005295004 | 242 |
| 523 | iso_pu_bacteria | 8005382845 | 8005387854 | 242 |
| 524 | iso_pu_bacteria | 8005395548 | 8005400890 | 242 |
| 525 | iso_pu_bacteria | 8005430974 | 8005431021 | 242 |
| 526 | iso_pu_bacteria | 8056382006 | 8056383879 | 242 |
| 527 | 3300002773 | JGI25152J39213_1003754 | JGI25152J39213_10037542 | 243 |
| 528 | 3300003187 | JGI25151J46595_10011807 | JGI25151J46595_100118075 | 243 |
| 529 | 3300003187 | JGI25151J46595_10044197 | JGI25151J46595_100441972 | 243 |
| 530 | 3300003781 | Ga0055536_1004740 | Ga0055536_10047403 | 243 |
| 531 | 3300005327 | Ga0070658_10068898 | Ga0070658_100688984 | 243 |
| 532 | 3300005327 | Ga0070658_10121287 | Ga0070658_101212872 | 243 |
| 533 | 3300005336 | Ga0070680_100099250 | Ga0070680_1000992502 | 243 |
| 534 | 3300005336 | Ga0070680_100264523 | Ga0070680_1002645232 | 243 |
| 535 | 3300005339 | Ga0070660_100227297 | Ga0070660_1002272972 | 243 |
| 536 | 3300005340 | Ga0070689_100341791 | Ga0070689_1003417912 | 243 |
| 537 | 3300005344 | Ga0070661_100130814 | Ga0070661_1001308142 | 243 |
| 538 | 3300005366 | Ga0070659_100107888 | Ga0070659_1001078882 | 243 |
| 539 | 3300005435 | Ga0070714_100110282 | Ga0070714_1001102822 | 243 |
| 540 | 3300005458 | Ga0070681_10092484 | Ga0070681_100924843 | 243 |
| 541 | 3300005530 | Ga0070679_100006957 | Ga0070679_1000069574 | 243 |
| 542 | 3300005530 | Ga0070679_100097400 | Ga0070679_1000974004 | 243 |
| 543 | 3300005530 | Ga0070679_100236656 | Ga0070679_1002366562 | 243 |
| 544 | 3300005530 | Ga0070679_100265204 | Ga0070679_1002652042 | 243 |
| 545 | 3300005563 | Ga0068855_100018421 | Ga0068855_1000184214 | 243 |
| 546 | 3300005563 | Ga0068855_100094398 | Ga0068855_1000943983 | 243 |
| 547 | 3300005563 | Ga0068855_100263165 | Ga0068855_1002631653 | 243 |
| 548 | 3300005577 | Ga0068857_100351722 | Ga0068857_1003517222 | 243 |
| 549 | 3300005578 | Ga0068854_100112791 | Ga0068854_1001127911 | 243 |
| 550 | 3300005614 | Ga0068856_100144924 | Ga0068856_1001449242 | 243 |
| 551 | 3300005616 | Ga0068852_100118580 | Ga0068852_1001185803 | 243 |
| 552 | 3300005616 | Ga0068852_100230669 | Ga0068852_1002306693 | 243 |
| 553 | 3300006038 | Ga0075365_10062820 | Ga0075365_100628204 | 243 |
| 554 | 3300006178 | Ga0075367_10034749 | Ga0075367_100347493 | 243 |
| 555 | 3300009551 | Ga0105238_10013907 | Ga0105238_100139076 | 243 |
| 556 | 3300009766 | Ga0123342_1007031 | Ga0123342_10070315 | 243 |
| 557 | 3300013102 | Ga0157371_10085742 | Ga0157371_100857423 | 243 |
| 558 | 3300013102 | Ga0157371_10443528 | Ga0157371_104435282 | 243 |
| 559 | 3300013104 | Ga0157370_10092033 | Ga0157370_100920334 | 243 |
| 560 | 3300013104 | Ga0157370_10344776 | Ga0157370_103447762 | 243 |
| 561 | 3300013104 | Ga0157370_10649341 | Ga0157370_106493411 | 243 |
| 562 | 3300013105 | Ga0157369_10269257 | Ga0157369_102692573 | 243 |
| 563 | 3300020070 | Ga0206356_10010133 | Ga0206356_100101332 | 243 |
| 564 | 3300020082 | Ga0206353_11031164 | Ga0206353_110311642 | 243 |
| 565 | 3300025258 | Ga0209129_1000118 | Ga0209129_100011898 | 243 |
| 566 | 3300025284 | Ga0209130_1025592 | Ga0209130_10255922 | 243 |
| 567 | 3300025292 | Ga0209676_1013366 | Ga0209676_10133663 | 243 |
| 568 | 3300025294 | Ga0209025_1000617 | Ga0209025_100061751 | 243 |
| 569 | 3300025294 | Ga0209025_1041288 | Ga0209025_10412881 | 243 |
| 570 | 3300025295 | Ga0209564_1012515 | Ga0209564_10125154 | 243 |
| 571 | 3300025909 | Ga0207705_10098196 | Ga0207705_100981963 | 243 |
| 572 | 3300025912 | Ga0207707_10226903 | Ga0207707_102269032 | 243 |
| 573 | 3300025912 | Ga0207707_10271360 | Ga0207707_102713602 | 243 |
| 574 | 3300025921 | Ga0207652_10028066 | Ga0207652_100280664 | 243 |
| 575 | 3300025921 | Ga0207652_10075123 | Ga0207652_100751234 | 243 |
| 576 | 3300025921 | Ga0207652_10595059 | Ga0207652_105950592 | 243 |
| 577 | 3300025924 | Ga0207694_10024241 | Ga0207694_100242416 | 243 |
| 578 | 3300025929 | Ga0207664_10430438 | Ga0207664_104304382 | 243 |
| 579 | 3300025949 | Ga0207667_10047002 | Ga0207667_100470021 | 243 |
| 580 | 3300025949 | Ga0207667_10105591 | Ga0207667_101055912 | 243 |
| 581 | 3300025949 | Ga0207667_10106876 | Ga0207667_101068763 | 243 |
| 582 | 3300025981 | Ga0207640_10096880 | Ga0207640_100968803 | 243 |
| 583 | 3300026067 | Ga0207678_10500729 | Ga0207678_105007292 | 243 |
| 584 | 3300026078 | Ga0207702_10128627 | Ga0207702_101286272 | 243 |
| 585 | 3300026078 | Ga0207702_10496893 | Ga0207702_104968932 | 243 |
| 586 | 3300026078 | Ga0207702_10720177 | Ga0207702_107201772 | 243 |
| 587 | 3300026142 | Ga0207698_10070852 | Ga0207698_100708522 | 243 |
| 588 | 3300028379 | Ga0268266_10201484 | Ga0268266_102014843 | 243 |
| 589 | 3300028577 | Ga0265318_10012048 | Ga0265318_100120482 | 243 |
| 590 | 3300028800 | Ga0265338_10137794 | Ga0265338_101377943 | 243 |
| 591 | 3300031235 | Ga0265330_10029569 | Ga0265330_100295692 | 243 |
| 592 | 3300031235 | Ga0265330_10030972 | Ga0265330_100309722 | 243 |
| 593 | 3300031238 | Ga0265332_10134827 | Ga0265332_101348271 | 243 |
| 594 | 3300031240 | Ga0265320_10021158 | Ga0265320_100211584 | 243 |
| 595 | 3300031241 | Ga0265325_10068734 | Ga0265325_100687342 | 243 |
| 596 | 3300031242 | Ga0265329_10096506 | Ga0265329_100965061 | 243 |
| 597 | 3300031249 | Ga0265339_10026539 | Ga0265339_100265392 | 243 |
| 598 | 3300031250 | Ga0265331_10022567 | Ga0265331_100225672 | 243 |
| 599 | 3300031344 | Ga0265316_10161738 | Ga0265316_101617382 | 243 |
| 600 | 3300031595 | Ga0265313_10053271 | Ga0265313_100532712 | 243 |
| 601 | 3300031711 | Ga0265314_10105082 | Ga0265314_101050822 | 243 |
| 602 | 3300031712 | Ga0265342_10000763 | Ga0265342_1000076335 | 243 |
| 603 | 3300031712 | Ga0265342_10038340 | Ga0265342_100383402 | 243 |
| 604 | 3300031712 | Ga0265342_10056611 | Ga0265342_100566112 | 243 |
| 605 | 3300037312 | Ga0395899_0124191 | Ga0395899_0124191_87_818 | 243 |
| 606 | 3300037466 | Ga0395898_0014510 | Ga0395898_0014510_3815_4546 | 243 |
| 607 | 3300038443 | Ga0395901_0262468 | Ga0395901_0262468_672_1403 | 243 |
| 608 | 3300041404 | Ga0439436_0032846 | Ga0439436_0032846_433_1185 | 243 |
| 609 | 3300041413 | Ga0439465_0018105 | Ga0439465_0018105_1120_1872 | 243 |
| 610 | 3300041413 | Ga0439465_0020970 | Ga0439465_0020970_822_1583 | 243 |
| 611 | 3300042006 | Ga0439432_058230 | Ga0439432_058230_123_875 | 243 |
| 612 | 3300042007 | Ga0439449_0036981 | Ga0439449_0036981_756_1517 | 243 |
| 613 | 3300046471 | Ga0495650_0028303 | Ga0495650_0028303_1018_1770 | 243 |
| 614 | 3300046492 | Ga0495585_0105342 | Ga0495585_0105342_478_1230 | 243 |
| 615 | 3300046507 | Ga0495606_0134974 | Ga0495606_0134974_472_1233 | 243 |
| 616 | 3300046558 | Ga0495633_0040050 | Ga0495633_0040050_377_1129 | 243 |
| 617 | 3300046660 | Ga0495625_0099008 | Ga0495625_0099008_374_1126 | 243 |
| 618 | 3300046665 | Ga0495661_0066043 | Ga0495661_0066043_1007_1759 | 243 |
| 619 | 3300047443 | Ga0495687_046987 | Ga0495687_046987_823_1575 | 243 |
| 620 | 3300048924 | Ga0496121_0050228 | Ga0496121_0050228_1042_1803 | 243 |
| 621 | 3300048926 | Ga0496123_0084360 | Ga0496123_0084360_56_817 | 243 |
| 622 | 3300048929 | Ga0496126_0021159 | Ga0496126_0021159_1243_1995 | 243 |
| 623 | 3300048929 | Ga0496126_0106930 | Ga0496126_0106930_1442_2203 | 243 |
| 624 | 3300049568 | Ga0501031_0007403 | Ga0501031_0007403_4914_5657 | 243 |
| 625 | 3300049569 | Ga0501032_0001244 | Ga0501032_0001244_18084_18827 | 243 |
| 626 | 3300049570 | Ga0501033_0000075 | Ga0501033_0000075_67653_68396 | 243 |
| 627 | 3300049571 | Ga0501034_0000760 | Ga0501034_0000760_15017_15760 | 243 |
| 628 | 3300049571 | Ga0501034_0280292 | Ga0501034_0280292_255_1028 | 243 |
| 629 | 3300049572 | Ga0501036_0000105 | Ga0501036_0000105_34899_35642 | 243 |
| 630 | 3300049573 | Ga0501037_0001098 | Ga0501037_0001098_1173_1916 | 243 |
| 631 | 3300049574 | Ga0501038_0002155 | Ga0501038_0002155_11442_12185 | 243 |
| 632 | 3300049575 | Ga0501039_0001038 | Ga0501039_0001038_1507_2250 | 243 |
| 633 | 3300049579 | Ga0501043_0000017 | Ga0501043_0000017_129656_130399 | 243 |
| 634 | 3300049580 | Ga0501046_0000215 | Ga0501046_0000215_11504_12247 | 243 |
| 635 | 3300049581 | Ga0501047_0002474 | Ga0501047_0002474_15173_15916 | 243 |
| 636 | 3300049581 | Ga0501047_0009616 | Ga0501047_0009616_7588_8319 | 243 |
| 637 | 3300049582 | Ga0501048_0008070 | Ga0501048_0008070_1738_2481 | 243 |
| 638 | 3300049583 | Ga0501067_0000168 | Ga0501067_0000168_34697_35440 | 243 |
| 639 | 3300049584 | Ga0501068_0005835 | Ga0501068_0005835_1075_1818 | 243 |
| 640 | 3300049585 | Ga0501069_0004666 | Ga0501069_0004666_210_953 | 243 |
| 641 | 3300049586 | Ga0501070_0001274 | Ga0501070_0001274_13307_14050 | 243 |
| 642 | 3300049587 | Ga0501071_0065933 | Ga0501071_0065933_1025_1768 | 243 |
| 643 | 3300049588 | Ga0501072_0007217 | Ga0501072_0007217_1411_2154 | 243 |
| 644 | 3300049589 | Ga0501073_0001048 | Ga0501073_0001048_13129_13872 | 243 |
| 645 | 3300049590 | Ga0501074_0007807 | Ga0501074_0007807_6339_7082 | 243 |
| 646 | 3300049592 | Ga0501076_0147833 | Ga0501076_0147833_607_1350 | 243 |
| 647 | 3300049741 | Ga0501079_0024258 | Ga0501079_0024258_2428_3171 | 243 |
| 648 | 3300049742 | Ga0501080_0075828 | Ga0501080_0075828_1016_1759 | 243 |
| 649 | 3300049742 | Ga0501080_0447518 | Ga0501080_0447518_256_999 | 243 |
| 650 | 3300049744 | Ga0501083_0077570 | Ga0501083_0077570_380_1123 | 243 |
| 651 | 3300049822 | Ga0501035_0000731 | Ga0501035_0000731_28042_28785 | 243 |
| 652 | 3300049823 | Ga0501044_0000329 | Ga0501044_0000329_50386_51129 | 243 |
| 653 | 3300049823 | Ga0501044_0030272 | Ga0501044_0030272_3410_4141 | 243 |
| 654 | 3300049823 | Ga0501044_0352360 | Ga0501044_0352360_463_1206 | 243 |
| 655 | 3300049824 | Ga0501045_0083231 | Ga0501045_0083231_133_876 | 243 |
| 656 | 3300050492 | nmdc:mga0yw44_86133_c1 | nmdc:mga0yw44_86133_c1_132_893 | 243 |
| 657 | 3300053125 | Ga0500618_010091 | Ga0500618_010091_868_1629 | 243 |
| 658 | 3300053145 | Ga0500586_066588 | Ga0500586_066588_380_1141 | 243 |
| 659 | 3300054114 | Ga0501084_0099825 | Ga0501084_0099825_1498_2241 | 243 |
| 660 | 3300060353 | Ga0501082_0081394 | Ga0501082_0081394_487_1230 | 243 |
| 661 | 3300060353 | Ga0501082_0086383 | Ga0501082_0086383_1358_2119 | 243 |
| 662 | iso_pu_bacteria | 2582581316 | 2585334226 | 243 |
| 663 | iso_pu_bacteria | 2643221623 | 2644131596 | 243 |
| 664 | iso_pu_bacteria | 2738543024 | 2739306049 | 243 |
| 665 | iso_pu_bacteria | 2795385470 | 2795781023 | 243 |
| 666 | iso_pu_bacteria | 2847670302 | 2847673764 | 243 |
| 667 | iso_pu_bacteria | 2847686936 | 2847690196 | 243 |
| 668 | iso_pu_bacteria | 2856314179 | 2856320585 | 243 |
| 669 | iso_pu_bacteria | 2856356410 | 2856363995 | 243 |
| 670 | iso_pu_bacteria | 2856364286 | 2856365062 | 243 |
| 671 | iso_pu_bacteria | 2857349434 | 2857353260 | 243 |
| 672 | iso_pu_bacteria | 2869285874 | 2869286314 | 243 |
| 673 | iso_pu_bacteria | 2871429161 | 2871430283 | 243 |
| 674 | iso_pu_bacteria | 2874102143 | 2874103375 | 243 |
| 675 | iso_pu_bacteria | 2874146452 | 2874146700 | 243 |
| 676 | iso_pu_bacteria | 2874155637 | 2874155774 | 243 |
| 677 | iso_pu_bacteria | 2876369609 | 2876374886 | 243 |
| 678 | iso_pu_bacteria | 2876377896 | 2876381549 | 243 |
| 679 | iso_pu_bacteria | 2876392853 | 2876399171 | 243 |
| 680 | iso_pu_bacteria | 2876413966 | 2876414103 | 243 |
| 681 | iso_pu_bacteria | 2878035449 | 2878039000 | 243 |
| 682 | iso_pu_bacteria | 2878745973 | 2878746479 | 243 |
| 683 | iso_pu_bacteria | 2881147464 | 2881148537 | 243 |
| 684 | iso_pu_bacteria | 2881161766 | 2881165269 | 243 |
| 685 | iso_pu_bacteria | 2881861095 | 2881864765 | 243 |
| 686 | iso_pu_bacteria | 2885305155 | 2885307178 | 243 |
| 687 | iso_pu_bacteria | 2885318864 | 2885323338 | 243 |
| 688 | iso_pu_bacteria | 2885326080 | 2885330899 | 243 |
| 689 | iso_pu_bacteria | 2885334103 | 2885336951 | 243 |
| 690 | iso_pu_bacteria | 2888350351 | 2888353532 | 243 |
| 691 | iso_pu_bacteria | 2889010040 | 2889015249 | 243 |
| 692 | iso_pu_bacteria | 2889016732 | 2889019674 | 243 |
| 693 | iso_pu_bacteria | 2903492973 | 2903499812 | 243 |
| 694 | iso_pu_bacteria | 2904659560 | 2904665698 | 243 |
| 695 | iso_pu_bacteria | 2906308376 | 2906308880 | 243 |
| 696 | iso_pu_bacteria | 2906321335 | 2906322160 | 243 |
| 697 | iso_pu_bacteria | 2906328253 | 2906333946 | 243 |
| 698 | iso_pu_bacteria | 2906354277 | 2906358160 | 243 |
| 699 | iso_pu_bacteria | 2906414383 | 2906421364 | 243 |
| 700 | iso_pu_bacteria | 2922130491 | 2922136500 | 243 |
| 701 | iso_pu_bacteria | 2922158528 | 2922160438 | 243 |
| 702 | iso_pu_bacteria | 2924726620 | 2924732197 | 243 |
| 703 | iso_pu_bacteria | 2924784321 | 2924790874 | 243 |
| 704 | iso_pu_bacteria | 2937813078 | 2937822219 | 243 |
| 705 | iso_pu_bacteria | 2937891427 | 2937897802 | 243 |
| 706 | iso_pu_bacteria | 2938014810 | 2938019639 | 243 |
| 707 | iso_pu_bacteria | 2958041894 | 2958052467 | 243 |
| 708 | iso_pu_bacteria | 2958100919 | 2958104036 | 243 |
| 709 | iso_pu_bacteria | 2958115193 | 2958120368 | 243 |
| 710 | iso_pu_bacteria | 2958130278 | 2958130713 | 243 |
| 711 | iso_pu_bacteria | 2958172287 | 2958173962 | 243 |
| 712 | iso_pu_bacteria | 2958179912 | 2958180052 | 243 |
| 713 | iso_pu_bacteria | 2961077736 | 2961077879 | 243 |
| 714 | iso_pu_bacteria | 2961114664 | 2961121041 | 243 |
| 715 | iso_pu_bacteria | 2965062239 | 2965063703 | 243 |
| 716 | iso_pu_bacteria | 2965119406 | 2965127011 | 243 |
| 717 | iso_pu_bacteria | 2968091066 | 2968093479 | 243 |
| 718 | iso_pu_bacteria | 2968097103 | 2968100197 | 243 |
| 719 | iso_pu_bacteria | 2968110612 | 2968117191 | 243 |
| 720 | iso_pu_bacteria | 2968128360 | 2968129602 | 243 |
| 721 | iso_pu_bacteria | 2977828996 | 2977834494 | 243 |
| 722 | iso_pu_bacteria | 2977843712 | 2977844284 | 243 |
| 723 | iso_pu_bacteria | 2977858184 | 2977858540 | 243 |
| 724 | iso_pu_bacteria | 2977942078 | 2977942407 | 243 |
| 725 | iso_pu_bacteria | 2977971508 | 2977973925 | 243 |
| 726 | iso_pu_bacteria | 2977986579 | 2977988018 | 243 |
| 727 | iso_pu_bacteria | 2979710463 | 2979711713 | 243 |
| 728 | iso_pu_bacteria | 2979742915 | 2979749854 | 243 |
| 729 | iso_pu_bacteria | 2979779861 | 2979780967 | 243 |
| 730 | iso_pu_bacteria | 2987636660 | 2987641852 | 243 |
| 731 | iso_pu_bacteria | 2987652177 | 2987658627 | 243 |
| 732 | iso_pu_bacteria | 2996341866 | 2996346025 | 243 |
| 733 | iso_pu_bacteria | 3004203850 | 3004209336 | 243 |
| 734 | iso_pu_bacteria | 8002285264 | 8002291837 | 243 |
| 735 | iso_pu_bacteria | 8004387939 | 8004388660 | 243 |
| 736 | iso_pu_bacteria | 8004445564 | 8004450844 | 243 |
| 737 | iso_pu_bacteria | 8004703790 | 8004706475 | 243 |
| 738 | iso_pu_bacteria | 8004714634 | 8004715136 | 243 |
| 739 | 3300002705 | JGI25156J39149_1007168 | JGI25156J39149_10071682 | 244 |
| 740 | 3300002741 | JGI25157J39369_1002448 | JGI25157J39369_10024483 | 244 |
| 741 | 3300003214 | JGI25165J46597_1000052 | JGI25165J46597_1000052225 | 244 |
| 742 | 3300005327 | Ga0070658_10038546 | Ga0070658_100385462 | 244 |
| 743 | 3300005336 | Ga0070680_100117098 | Ga0070680_1001170981 | 244 |
| 744 | 3300005339 | Ga0070660_100004143 | Ga0070660_1000041439 | 244 |
| 745 | 3300005344 | Ga0070661_100171662 | Ga0070661_1001716622 | 244 |
| 746 | 3300005354 | Ga0070675_100053571 | Ga0070675_1000535713 | 244 |
| 747 | 3300005355 | Ga0070671_100231824 | Ga0070671_1002318242 | 244 |
| 748 | 3300005356 | Ga0070674_100029715 | Ga0070674_1000297153 | 244 |
| 749 | 3300005434 | Ga0070709_10236320 | Ga0070709_102363201 | 244 |
| 750 | 3300005455 | Ga0070663_100054747 | Ga0070663_1000547472 | 244 |
| 751 | 3300005457 | Ga0070662_100165636 | Ga0070662_1001656361 | 244 |
| 752 | 3300005458 | Ga0070681_10092722 | Ga0070681_100927222 | 244 |
| 753 | 3300005459 | Ga0068867_100349822 | Ga0068867_1003498222 | 244 |
| 754 | 3300005539 | Ga0068853_100005223 | Ga0068853_1000052237 | 244 |
| 755 | 3300005539 | Ga0068853_100232654 | Ga0068853_1002326542 | 244 |
| 756 | 3300005547 | Ga0070693_100291868 | Ga0070693_1002918682 | 244 |
| 757 | 3300005563 | Ga0068855_100136866 | Ga0068855_1001368662 | 244 |
| 758 | 3300005564 | Ga0070664_100106972 | Ga0070664_1001069722 | 244 |
| 759 | 3300005577 | Ga0068857_100016644 | Ga0068857_1000166442 | 244 |
| 760 | 3300005578 | Ga0068854_100080315 | Ga0068854_1000803153 | 244 |
| 761 | 3300005614 | Ga0068856_100035175 | Ga0068856_1000351752 | 244 |
| 762 | 3300005834 | Ga0068851_10038538 | Ga0068851_100385383 | 244 |
| 763 | 3300006038 | Ga0075365_10101999 | Ga0075365_101019992 | 244 |
| 764 | 3300006186 | Ga0075369_10205047 | Ga0075369_102050472 | 244 |
| 765 | 3300006358 | Ga0068871_100232041 | Ga0068871_1002320413 | 244 |
| 766 | 3300009174 | Ga0105241_10072064 | Ga0105241_100720642 | 244 |
| 767 | 3300009545 | Ga0105237_10038056 | Ga0105237_100380565 | 244 |
| 768 | 3300009551 | Ga0105238_10024469 | Ga0105238_100244693 | 244 |
| 769 | 3300009551 | Ga0105238_10632641 | Ga0105238_106326412 | 244 |
| 770 | 3300010375 | Ga0105239_10047454 | Ga0105239_100474545 | 244 |
| 771 | 3300013104 | Ga0157370_10103800 | Ga0157370_101038003 | 244 |
| 772 | 3300013105 | Ga0157369_10959270 | Ga0157369_109592701 | 244 |
| 773 | 3300013307 | Ga0157372_10232691 | Ga0157372_102326912 | 244 |
| 774 | 3300025250 | Ga0209026_1000032 | Ga0209026_100003290 | 244 |
| 775 | 3300025256 | Ga0209759_1000142 | Ga0209759_1000142107 | 244 |
| 776 | 3300025261 | Ga0209233_1000118 | Ga0209233_100011842 | 244 |
| 777 | 3300025907 | Ga0207645_10069729 | Ga0207645_100697292 | 244 |
| 778 | 3300025909 | Ga0207705_10049472 | Ga0207705_100494722 | 244 |
| 779 | 3300025913 | Ga0207695_10390519 | Ga0207695_103905191 | 244 |
| 780 | 3300025914 | Ga0207671_10138535 | Ga0207671_101385352 | 244 |
| 781 | 3300025919 | Ga0207657_10007647 | Ga0207657_100076473 | 244 |
| 782 | 3300025919 | Ga0207657_10072526 | Ga0207657_100725262 | 244 |
| 783 | 3300025920 | Ga0207649_10163391 | Ga0207649_101633912 | 244 |
| 784 | 3300025924 | Ga0207694_10059980 | Ga0207694_100599802 | 244 |
| 785 | 3300025924 | Ga0207694_10159147 | Ga0207694_101591473 | 244 |
| 786 | 3300025937 | Ga0207669_10055748 | Ga0207669_100557482 | 244 |
| 787 | 3300025944 | Ga0207661_10272418 | Ga0207661_102724182 | 244 |
| 788 | 3300025945 | Ga0207679_10414830 | Ga0207679_104148302 | 244 |
| 789 | 3300025949 | Ga0207667_10021184 | Ga0207667_100211843 | 244 |
| 790 | 3300025981 | Ga0207640_10035965 | Ga0207640_100359653 | 244 |
| 791 | 3300026041 | Ga0207639_10097689 | Ga0207639_100976892 | 244 |
| 792 | 3300026041 | Ga0207639_10165221 | Ga0207639_101652213 | 244 |
| 793 | 3300026067 | Ga0207678_10032760 | Ga0207678_100327602 | 244 |
| 794 | 3300026078 | Ga0207702_10054512 | Ga0207702_100545122 | 244 |
| 795 | 3300026116 | Ga0207674_10009631 | Ga0207674_100096312 | 244 |
| 796 | 3300026142 | Ga0207698_10308641 | Ga0207698_103086412 | 244 |
| 797 | 3300028379 | Ga0268266_10235503 | Ga0268266_102355032 | 244 |
| 798 | 3300028556 | Ga0265337_1008317 | Ga0265337_10083172 | 244 |
| 799 | 3300031239 | Ga0265328_10020279 | Ga0265328_100202792 | 244 |
| 800 | 3300031247 | Ga0265340_10001277 | Ga0265340_100012777 | 244 |
| 801 | 3300031247 | Ga0265340_10096324 | Ga0265340_100963242 | 244 |
| 802 | 3300031344 | Ga0265316_10010284 | Ga0265316_100102842 | 244 |
| 803 | 3300031595 | Ga0265313_10000448 | Ga0265313_1000044834 | 244 |
| 804 | 3300031595 | Ga0265313_10016322 | Ga0265313_100163222 | 244 |
| 805 | 3300031712 | Ga0265342_10004375 | Ga0265342_1000437512 | 244 |
| 806 | 3300031712 | Ga0265342_10010728 | Ga0265342_100107283 | 244 |
| 807 | 3300035207 | Ga0373942_0011842 | Ga0373942_0011842_406_1161 | 244 |
| 808 | 3300037312 | Ga0395899_0004706 | Ga0395899_0004706_6765_7511 | 244 |
| 809 | 3300037418 | Ga0395900_0005070 | Ga0395900_0005070_12424_13170 | 244 |
| 810 | 3300037418 | Ga0395900_0304643 | Ga0395900_0304643_464_1219 | 244 |
| 811 | 3300037466 | Ga0395898_0135233 | Ga0395898_0135233_1357_2118 | 244 |
| 812 | 3300037471 | Ga0395905_0035464 | Ga0395905_0035464_2851_3606 | 244 |
| 813 | 3300037471 | Ga0395905_0036713 | Ga0395905_0036713_696_1442 | 244 |
| 814 | 3300037471 | Ga0395905_0062059 | Ga0395905_0062059_1835_2590 | 244 |
| 815 | 3300037471 | Ga0395905_0362003 | Ga0395905_0362003_163_918 | 244 |
| 816 | 3300038443 | Ga0395901_0007281 | Ga0395901_0007281_2734_3480 | 244 |
| 817 | 3300038443 | Ga0395901_0139381 | Ga0395901_0139381_1339_2094 | 244 |
| 818 | 3300038443 | Ga0395901_0240297 | Ga0395901_0240297_86_841 | 244 |
| 819 | 3300044658 | Ga0466972_0148221 | Ga0466972_0148221_247_1002 | 244 |
| 820 | 3300044684 | Ga0466966_0065521 | Ga0466966_0065521_1505_2251 | 244 |
| 821 | 3300044684 | Ga0466966_0139101 | Ga0466966_0139101_666_1430 | 244 |
| 822 | 3300046452 | Ga0495617_000026 | Ga0495617_000026_125713_126459 | 244 |
| 823 | 3300046453 | Ga0495627_000043 | Ga0495627_000043_154069_154815 | 244 |
| 824 | 3300046463 | Ga0495653_0024311 | Ga0495653_0024311_1007_1753 | 244 |
| 825 | 3300046471 | Ga0495650_0003986 | Ga0495650_0003986_8560_9306 | 244 |
| 826 | 3300046471 | Ga0495650_0055124 | Ga0495650_0055124_46_792 | 244 |
| 827 | 3300046474 | Ga0495605_0000113 | Ga0495605_0000113_72111_72857 | 244 |
| 828 | 3300046491 | Ga0495584_0002689 | Ga0495584_0002689_757_1503 | 244 |
| 829 | 3300046500 | Ga0495596_0003840 | Ga0495596_0003840_5178_5924 | 244 |
| 830 | 3300046500 | Ga0495596_0045908 | Ga0495596_0045908_832_1578 | 244 |
| 831 | 3300046501 | Ga0495607_0001654 | Ga0495607_0001654_13746_14492 | 244 |
| 832 | 3300046507 | Ga0495606_0015605 | Ga0495606_0015605_4307_5053 | 244 |
| 833 | 3300046507 | Ga0495606_0077668 | Ga0495606_0077668_787_1542 | 244 |
| 834 | 3300046513 | Ga0495616_0000280 | Ga0495616_0000280_30336_31082 | 244 |
| 835 | 3300046513 | Ga0495616_0047724 | Ga0495616_0047724_818_1564 | 244 |
| 836 | 3300046518 | Ga0495631_0004753 | Ga0495631_0004753_2952_3698 | 244 |
| 837 | 3300046518 | Ga0495631_0022829 | Ga0495631_0022829_743_1489 | 244 |
| 838 | 3300046519 | Ga0495632_0028969 | Ga0495632_0028969_1875_2621 | 244 |
| 839 | 3300046523 | Ga0495644_0007525 | Ga0495644_0007525_1341_2087 | 244 |
| 840 | 3300046524 | Ga0495648_0000353 | Ga0495648_0000353_24740_25486 | 244 |
| 841 | 3300046524 | Ga0495648_0044149 | Ga0495648_0044149_644_1390 | 244 |
| 842 | 3300046528 | Ga0495642_0000123 | Ga0495642_0000123_24743_25489 | 244 |
| 843 | 3300046530 | Ga0495654_0025199 | Ga0495654_0025199_1285_2031 | 244 |
| 844 | 3300046538 | Ga0495609_0071180 | Ga0495609_0071180_114_860 | 244 |
| 845 | 3300046615 | Ga0495656_0003380 | Ga0495656_0003380_247_993 | 244 |
| 846 | 3300046616 | Ga0495668_0000546 | Ga0495668_0000546_18807_19553 | 244 |
| 847 | 3300046648 | Ga0495611_0076488 | Ga0495611_0076488_733_1479 | 244 |
| 848 | 3300046660 | Ga0495625_0019383 | Ga0495625_0019383_1169_1924 | 244 |
| 849 | 3300046665 | Ga0495661_0000588 | Ga0495661_0000588_6354_7100 | 244 |
| 850 | 3300046665 | Ga0495661_0042470 | Ga0495661_0042470_513_1259 | 244 |
| 851 | 3300046674 | Ga0495588_0000148 | Ga0495588_0000148_65024_65770 | 244 |
| 852 | 3300046674 | Ga0495588_0009890 | Ga0495588_0009890_3495_4241 | 244 |
| 853 | 3300046692 | Ga0495671_0000426 | Ga0495671_0000426_3680_4426 | 244 |
| 854 | 3300046692 | Ga0495671_0078965 | Ga0495671_0078965_852_1598 | 244 |
| 855 | 3300046810 | Ga0495660_0001751 | Ga0495660_0001751_302_1048 | 244 |
| 856 | 3300047320 | Ga0495672_0000142 | Ga0495672_0000142_82871_83617 | 244 |
| 857 | 3300047443 | Ga0495687_000140 | Ga0495687_000140_30921_31667 | 244 |
| 858 | 3300047443 | Ga0495687_000236 | Ga0495687_000236_69726_70472 | 244 |
| 859 | 3300047470 | Ga0495681_0115790 | Ga0495681_0115790_153_908 | 244 |
| 860 | 3300047472 | Ga0495686_0049134 | Ga0495686_0049134_1093_1848 | 244 |
| 861 | 3300048088 | Ga0495602_0113689 | Ga0495602_0113689_383_1129 | 244 |
| 862 | 3300048091 | Ga0495626_0043143 | Ga0495626_0043143_48_794 | 244 |
| 863 | 3300048916 | Ga0496113_0380979 | Ga0496113_0380979_82_837 | 244 |
| 864 | 3300048921 | Ga0496118_0162592 | Ga0496118_0162592_526_1281 | 244 |
| 865 | 3300048924 | Ga0496121_0116997 | Ga0496121_0116997_503_1258 | 244 |
| 866 | 3300048929 | Ga0496126_0309794 | Ga0496126_0309794_406_1161 | 244 |
| 867 | 3300049459 | Ga0495678_103844 | Ga0495678_103844_207_953 | 244 |
| 868 | 3300049568 | Ga0501031_0064822 | Ga0501031_0064822_281_1042 | 244 |
| 869 | 3300049571 | Ga0501034_0000743 | Ga0501034_0000743_43506_44252 | 244 |
| 870 | 3300049584 | Ga0501068_0017682 | Ga0501068_0017682_157_903 | 244 |
| 871 | 3300049586 | Ga0501070_0079486 | Ga0501070_0079486_308_1054 | 244 |
| 872 | 3300049744 | Ga0501083_0273548 | Ga0501083_0273548_51_797 | 244 |
| 873 | 3300049822 | Ga0501035_0219439 | Ga0501035_0219439_224_970 | 244 |
| 874 | 3300049823 | Ga0501044_0120966 | Ga0501044_0120966_417_1163 | 244 |
| 875 | 3300050492 | nmdc:mga0yw44_125128_c1 | nmdc:mga0yw44_125128_c1_41_799 | 244 |
| 876 | 3300050494 | nmdc:mga06z11_126158_c1 | nmdc:mga06z11_126158_c1_34_789 | 244 |
| 877 | 3300053155 | Ga0500620_000770 | Ga0500620_000770_3835_4590 | 244 |
| 878 | 3300053158 | Ga0500627_0086179 | Ga0500627_0086179_521_1276 | 244 |
| 879 | 2162886007 | SwRhRL2b_contig_3421311 | SwRhRL2b_0803.00005670 | 245 |
| 880 | 2209111006 | 2214772983 | 2213792887 | 245 |
| 881 | 3300000041 | ARcpr5oldR_c000140 | ARcpr5oldR_0001405 | 245 |
| 882 | 3300000042 | ARSoilYngRDRAFT_c00234 | ARSoilYngRDRAFT_002347 | 245 |
| 883 | 3300000044 | ARSoilOldRDRAFT_c000126 | ARSoilOldRDRAFT_00012613 | 245 |
| 884 | 3300000045 | ARCol0oldRDRAFT_c00368 | ARCol0oldRDRAFT_003684 | 245 |
| 885 | 3300001976 | JGI24752J21851_1002485 | JGI24752J21851_10024853 | 245 |
| 886 | 3300001990 | JGI24737J22298_10000960 | JGI24737J22298_100009608 | 245 |
| 887 | 3300001990 | JGI24737J22298_10007118 | JGI24737J22298_100071183 | 245 |
| 888 | 3300002073 | JGI24745J21846_1000099 | JGI24745J21846_10000995 | 245 |
| 889 | 3300002075 | JGI24738J21930_10000223 | JGI24738J21930_100002237 | 245 |
| 890 | 3300002239 | JGI24034J26672_10000557 | JGI24034J26672_100005574 | 245 |
| 891 | 3300002244 | JGI24742J22300_10000264 | JGI24742J22300_100002646 | 245 |
| 892 | 3300002459 | JGI24751J29686_10014205 | JGI24751J29686_100142052 | 245 |
| 893 | 3300005289 | Ga0065704_10074561 | Ga0065704_100745616 | 245 |
| 894 | 3300005290 | Ga0065712_10070835 | Ga0065712_100708353 | 245 |
| 895 | 3300005290 | Ga0065712_10074294 | Ga0065712_100742944 | 245 |
| 896 | 3300005293 | Ga0065715_10003522 | Ga0065715_100035222 | 245 |
| 897 | 3300005328 | Ga0070676_10000012 | Ga0070676_1000001250 | 245 |
| 898 | 3300005329 | Ga0070683_100000139 | Ga0070683_10000013915 | 245 |
| 899 | 3300005329 | Ga0070683_100028063 | Ga0070683_1000280635 | 245 |
| 900 | 3300005330 | Ga0070690_100005164 | Ga0070690_1000051647 | 245 |
| 901 | 3300005330 | Ga0070690_100005412 | Ga0070690_1000054126 | 245 |
| 902 | 3300005331 | Ga0070670_100103508 | Ga0070670_1001035082 | 245 |
| 903 | 3300005331 | Ga0070670_100158033 | Ga0070670_1001580332 | 245 |
| 904 | 3300005333 | Ga0070677_10000125 | Ga0070677_100001257 | 245 |
| 905 | 3300005334 | Ga0068869_100000605 | Ga0068869_10000060511 | 245 |
| 906 | 3300005335 | Ga0070666_10017025 | Ga0070666_100170253 | 245 |
| 907 | 3300005336 | Ga0070680_100000179 | Ga0070680_10000017912 | 245 |
| 908 | 3300005336 | Ga0070680_100014505 | Ga0070680_1000145054 | 245 |
| 909 | 3300005336 | Ga0070680_100378803 | Ga0070680_1003788031 | 245 |
| 910 | 3300005337 | Ga0070682_100000319 | Ga0070682_1000003198 | 245 |
| 911 | 3300005337 | Ga0070682_100016170 | Ga0070682_1000161704 | 245 |
| 912 | 3300005338 | Ga0068868_100000593 | Ga0068868_1000005933 | 245 |
| 913 | 3300005339 | Ga0070660_100001605 | Ga0070660_1000016056 | 245 |
| 914 | 3300005340 | Ga0070689_100004685 | Ga0070689_1000046858 | 245 |
| 915 | 3300005341 | Ga0070691_10001565 | Ga0070691_100015656 | 245 |
| 916 | 3300005343 | Ga0070687_100003572 | Ga0070687_1000035726 | 245 |
| 917 | 3300005344 | Ga0070661_100001455 | Ga0070661_10000145512 | 245 |
| 918 | 3300005345 | Ga0070692_10000434 | Ga0070692_100004344 | 245 |
| 919 | 3300005345 | Ga0070692_10002195 | Ga0070692_100021957 | 245 |
| 920 | 3300005347 | Ga0070668_100004423 | Ga0070668_1000044237 | 245 |
| 921 | 3300005353 | Ga0070669_100000409 | Ga0070669_1000004096 | 245 |
| 922 | 3300005354 | Ga0070675_100000166 | Ga0070675_10000016634 | 245 |
| 923 | 3300005354 | Ga0070675_100043171 | Ga0070675_1000431713 | 245 |
| 924 | 3300005355 | Ga0070671_100005938 | Ga0070671_1000059386 | 245 |
| 925 | 3300005355 | Ga0070671_100094656 | Ga0070671_1000946561 | 245 |
| 926 | 3300005356 | Ga0070674_100000644 | Ga0070674_10000064414 | 245 |
| 927 | 3300005356 | Ga0070674_100317081 | Ga0070674_1003170811 | 245 |
| 928 | 3300005364 | Ga0070673_100000041 | Ga0070673_10000004115 | 245 |
| 929 | 3300005365 | Ga0070688_100000180 | Ga0070688_10000018018 | 245 |
| 930 | 3300005365 | Ga0070688_100049523 | Ga0070688_1000495232 | 245 |
| 931 | 3300005366 | Ga0070659_100000752 | Ga0070659_10000075213 | 245 |
| 932 | 3300005367 | Ga0070667_100000365 | Ga0070667_1000003655 | 245 |
| 933 | 3300005367 | Ga0070667_100515964 | Ga0070667_1005159641 | 245 |
| 934 | 3300005406 | Ga0070703_10003914 | Ga0070703_100039143 | 245 |
| 935 | 3300005406 | Ga0070703_10012992 | Ga0070703_100129924 | 245 |
| 936 | 3300005434 | Ga0070709_10019500 | Ga0070709_100195002 | 245 |
| 937 | 3300005434 | Ga0070709_10304704 | Ga0070709_103047041 | 245 |
| 938 | 3300005435 | Ga0070714_100045790 | Ga0070714_1000457905 | 245 |
| 939 | 3300005435 | Ga0070714_100098674 | Ga0070714_1000986742 | 245 |
| 940 | 3300005437 | Ga0070710_10044400 | Ga0070710_100444001 | 245 |
| 941 | 3300005438 | Ga0070701_10000493 | Ga0070701_1000049312 | 245 |
| 942 | 3300005438 | Ga0070701_10012908 | Ga0070701_100129082 | 245 |
| 943 | 3300005439 | Ga0070711_100015744 | Ga0070711_1000157445 | 245 |
| 944 | 3300005439 | Ga0070711_100054801 | Ga0070711_1000548013 | 245 |
| 945 | 3300005440 | Ga0070705_100002314 | Ga0070705_1000023148 | 245 |
| 946 | 3300005440 | Ga0070705_100148366 | Ga0070705_1001483662 | 245 |
| 947 | 3300005441 | Ga0070700_100000467 | Ga0070700_10000046714 | 245 |
| 948 | 3300005444 | Ga0070694_100000065 | Ga0070694_10000006546 | 245 |
| 949 | 3300005444 | Ga0070694_100029375 | Ga0070694_1000293753 | 245 |
| 950 | 3300005444 | Ga0070694_100116812 | Ga0070694_1001168123 | 245 |
| 951 | 3300005445 | Ga0070708_100267667 | Ga0070708_1002676672 | 245 |
| 952 | 3300005455 | Ga0070663_100000473 | Ga0070663_10000047312 | 245 |
| 953 | 3300005455 | Ga0070663_100019373 | Ga0070663_1000193735 | 245 |
| 954 | 3300005456 | Ga0070678_100000091 | Ga0070678_1000000916 | 245 |
| 955 | 3300005456 | Ga0070678_100007141 | Ga0070678_1000071413 | 245 |
| 956 | 3300005456 | Ga0070678_100479335 | Ga0070678_1004793352 | 245 |
| 957 | 3300005457 | Ga0070662_100006535 | Ga0070662_1000065356 | 245 |
| 958 | 3300005457 | Ga0070662_100043231 | Ga0070662_1000432315 | 245 |
| 959 | 3300005457 | Ga0070662_100128907 | Ga0070662_1001289072 | 245 |
| 960 | 3300005458 | Ga0070681_10010003 | Ga0070681_100100039 | 245 |
| 961 | 3300005459 | Ga0068867_100000859 | Ga0068867_10000085922 | 245 |
| 962 | 3300005459 | Ga0068867_100489759 | Ga0068867_1004897591 | 245 |
| 963 | 3300005466 | Ga0070685_10001731 | Ga0070685_100017314 | 245 |
| 964 | 3300005466 | Ga0070685_10041755 | Ga0070685_100417554 | 245 |
| 965 | 3300005507 | Ga0074259_12095147 | Ga0074259_120951472 | 245 |
| 966 | 3300005530 | Ga0070679_100012754 | Ga0070679_1000127546 | 245 |
| 967 | 3300005535 | Ga0070684_100000219 | Ga0070684_1000002196 | 245 |
| 968 | 3300005536 | Ga0070697_100534991 | Ga0070697_1005349911 | 245 |
| 969 | 3300005539 | Ga0068853_100000600 | Ga0068853_10000060019 | 245 |
| 970 | 3300005543 | Ga0070672_100000019 | Ga0070672_10000001915 | 245 |
| 971 | 3300005543 | Ga0070672_100108041 | Ga0070672_1001080412 | 245 |
| 972 | 3300005544 | Ga0070686_100007875 | Ga0070686_1000078755 | 245 |
| 973 | 3300005544 | Ga0070686_100100051 | Ga0070686_1001000512 | 245 |
| 974 | 3300005545 | Ga0070695_100000474 | Ga0070695_10000047414 | 245 |
| 975 | 3300005546 | Ga0070696_100003100 | Ga0070696_10000310012 | 245 |
| 976 | 3300005547 | Ga0070693_100001868 | Ga0070693_1000018687 | 245 |
| 977 | 3300005547 | Ga0070693_100096721 | Ga0070693_1000967212 | 245 |
| 978 | 3300005548 | Ga0070665_100322171 | Ga0070665_1003221711 | 245 |
| 979 | 3300005549 | Ga0070704_100000252 | Ga0070704_10000025218 | 245 |
| 980 | 3300005549 | Ga0070704_100001606 | Ga0070704_10000160613 | 245 |
| 981 | 3300005563 | Ga0068855_100019721 | Ga0068855_1000197217 | 245 |
| 982 | 3300005564 | Ga0070664_100000819 | Ga0070664_10000081913 | 245 |
| 983 | 3300005564 | Ga0070664_100183771 | Ga0070664_1001837712 | 245 |
| 984 | 3300005577 | Ga0068857_100000768 | Ga0068857_1000007687 | 245 |
| 985 | 3300005578 | Ga0068854_100001736 | Ga0068854_1000017364 | 245 |
| 986 | 3300005578 | Ga0068854_100169225 | Ga0068854_1001692252 | 245 |
| 987 | 3300005614 | Ga0068856_100002295 | Ga0068856_10000229518 | 245 |
| 988 | 3300005614 | Ga0068856_100110986 | Ga0068856_1001109862 | 245 |
| 989 | 3300005614 | Ga0068856_100747445 | Ga0068856_1007474451 | 245 |
| 990 | 3300005615 | Ga0070702_100000898 | Ga0070702_1000008986 | 245 |
| 991 | 3300005616 | Ga0068852_100001992 | Ga0068852_1000019928 | 245 |
| 992 | 3300005718 | Ga0068866_10001028 | Ga0068866_100010284 | 245 |
| 993 | 3300005719 | Ga0068861_100000169 | Ga0068861_1000001697 | 245 |
| 994 | 3300005719 | Ga0068861_100660716 | Ga0068861_1006607161 | 245 |
| 995 | 3300005840 | Ga0068870_10000586 | Ga0068870_100005866 | 245 |
| 996 | 3300005841 | Ga0068863_100000381 | Ga0068863_10000038128 | 245 |
| 997 | 3300005841 | Ga0068863_100396538 | Ga0068863_1003965382 | 245 |
| 998 | 3300005842 | Ga0068858_100009197 | Ga0068858_1000091978 | 245 |
| 999 | 3300005842 | Ga0068858_100348350 | Ga0068858_1003483502 | 245 |
| 1000 | 3300005843 | Ga0068860_100001472 | Ga0068860_10000147218 | 245 |
| 1001 | 3300005843 | Ga0068860_100081520 | Ga0068860_1000815204 | 245 |
| 1002 | 3300005844 | Ga0068862_100001886 | Ga0068862_1000018867 | 245 |
| 1003 | 3300005844 | Ga0068862_100065508 | Ga0068862_1000655085 | 245 |
| 1004 | 3300005937 | Ga0081455_10000036 | Ga0081455_10000036126 | 245 |
| 1005 | 3300006058 | Ga0075432_10083948 | Ga0075432_100839481 | 245 |
| 1006 | 3300006163 | Ga0070715_10049118 | Ga0070715_100491182 | 245 |
| 1007 | 3300006237 | Ga0097621_100001234 | Ga0097621_1000012347 | 245 |
| 1008 | 3300006237 | Ga0097621_100176973 | Ga0097621_1001769731 | 245 |
| 1009 | 3300006358 | Ga0068871_100000068 | Ga0068871_10000006851 | 245 |
| 1010 | 3300006358 | Ga0068871_100025352 | Ga0068871_1000253523 | 245 |
| 1011 | 3300006852 | Ga0075433_10099038 | Ga0075433_100990383 | 245 |
| 1012 | 3300006871 | Ga0075434_100001666 | Ga0075434_1000016669 | 245 |
| 1013 | 3300006871 | Ga0075434_100113294 | Ga0075434_1001132943 | 245 |
| 1014 | 3300006881 | Ga0068865_100005133 | Ga0068865_1000051335 | 245 |
| 1015 | 3300006914 | Ga0075436_100070922 | Ga0075436_1000709222 | 245 |
| 1016 | 3300006914 | Ga0075436_100238776 | Ga0075436_1002387762 | 245 |
| 1017 | 3300007076 | Ga0075435_100010036 | Ga0075435_1000100367 | 245 |
| 1018 | 3300009094 | Ga0111539_10003417 | Ga0111539_1000341711 | 245 |
| 1019 | 3300009094 | Ga0111539_10315126 | Ga0111539_103151262 | 245 |
| 1020 | 3300009101 | Ga0105247_10078113 | Ga0105247_100781132 | 245 |
| 1021 | 3300009101 | Ga0105247_10095825 | Ga0105247_100958252 | 245 |
| 1022 | 3300009148 | Ga0105243_10032306 | Ga0105243_100323066 | 245 |
| 1023 | 3300009174 | Ga0105241_10432246 | Ga0105241_104322462 | 245 |
| 1024 | 3300009545 | Ga0105237_10024205 | Ga0105237_100242055 | 245 |
| 1025 | 3300009553 | Ga0105249_10028272 | Ga0105249_100282722 | 245 |
| 1026 | 3300009553 | Ga0105249_10143026 | Ga0105249_101430262 | 245 |
| 1027 | 3300010375 | Ga0105239_10222845 | Ga0105239_102228452 | 245 |
| 1028 | 3300011119 | Ga0105246_10096520 | Ga0105246_100965203 | 245 |
| 1029 | 3300013297 | Ga0157378_10127916 | Ga0157378_101279161 | 245 |
| 1030 | 3300013306 | Ga0163162_10018394 | Ga0163162_100183942 | 245 |
| 1031 | 3300013306 | Ga0163162_10756418 | Ga0163162_107564182 | 245 |
| 1032 | 3300013307 | Ga0157372_10515578 | Ga0157372_105155782 | 245 |
| 1033 | 3300013307 | Ga0157372_11143932 | Ga0157372_111439321 | 245 |
| 1034 | 3300014325 | Ga0163163_10020189 | Ga0163163_100201895 | 245 |
| 1035 | 3300014326 | Ga0157380_10009719 | Ga0157380_100097192 | 245 |
| 1036 | 3300014968 | Ga0157379_10063216 | Ga0157379_100632162 | 245 |
| 1037 | 3300014968 | Ga0157379_10110590 | Ga0157379_101105902 | 245 |
| 1038 | 3300014968 | Ga0157379_10147731 | Ga0157379_101477313 | 245 |
| 1039 | 3300017792 | Ga0163161_10000384 | Ga0163161_1000038415 | 245 |
| 1040 | 3300017792 | Ga0163161_10047076 | Ga0163161_100470763 | 245 |
| 1041 | 3300017792 | Ga0163161_10362314 | Ga0163161_103623142 | 245 |
| 1042 | 3300025271 | Ga0207666_1000097 | Ga0207666_100009711 | 245 |
| 1043 | 3300025290 | Ga0207673_1000201 | Ga0207673_10002015 | 245 |
| 1044 | 3300025315 | Ga0207697_10000550 | Ga0207697_1000055011 | 245 |
| 1045 | 3300025315 | Ga0207697_10013264 | Ga0207697_100132644 | 245 |
| 1046 | 3300025885 | Ga0207653_10010851 | Ga0207653_100108512 | 245 |
| 1047 | 3300025885 | Ga0207653_10018054 | Ga0207653_100180543 | 245 |
| 1048 | 3300025893 | Ga0207682_10000088 | Ga0207682_1000008816 | 245 |
| 1049 | 3300025898 | Ga0207692_10001966 | Ga0207692_100019665 | 245 |
| 1050 | 3300025898 | Ga0207692_10271610 | Ga0207692_102716102 | 245 |
| 1051 | 3300025899 | Ga0207642_10000381 | Ga0207642_1000038115 | 245 |
| 1052 | 3300025900 | Ga0207710_10001324 | Ga0207710_100013245 | 245 |
| 1053 | 3300025900 | Ga0207710_10032716 | Ga0207710_100327162 | 245 |
| 1054 | 3300025901 | Ga0207688_10001203 | Ga0207688_100012036 | 245 |
| 1055 | 3300025901 | Ga0207688_10021688 | Ga0207688_100216882 | 245 |
| 1056 | 3300025903 | Ga0207680_10009047 | Ga0207680_100090475 | 245 |
| 1057 | 3300025903 | Ga0207680_10223472 | Ga0207680_102234722 | 245 |
| 1058 | 3300025904 | Ga0207647_10002714 | Ga0207647_100027146 | 245 |
| 1059 | 3300025907 | Ga0207645_10000140 | Ga0207645_100001406 | 245 |
| 1060 | 3300025908 | Ga0207643_10000083 | Ga0207643_100000836 | 245 |
| 1061 | 3300025910 | Ga0207684_10423987 | Ga0207684_104239872 | 245 |
| 1062 | 3300025911 | Ga0207654_10002699 | Ga0207654_100026996 | 245 |
| 1063 | 3300025912 | Ga0207707_10020854 | Ga0207707_100208545 | 245 |
| 1064 | 3300025912 | Ga0207707_10122457 | Ga0207707_101224572 | 245 |
| 1065 | 3300025914 | Ga0207671_10004533 | Ga0207671_100045335 | 245 |
| 1066 | 3300025915 | Ga0207693_10021626 | Ga0207693_100216263 | 245 |
| 1067 | 3300025916 | Ga0207663_10021132 | Ga0207663_100211322 | 245 |
| 1068 | 3300025916 | Ga0207663_10113170 | Ga0207663_101131702 | 245 |
| 1069 | 3300025916 | Ga0207663_10232610 | Ga0207663_102326102 | 245 |
| 1070 | 3300025917 | Ga0207660_10000073 | Ga0207660_1000007318 | 245 |
| 1071 | 3300025917 | Ga0207660_10346099 | Ga0207660_103460992 | 245 |
| 1072 | 3300025918 | Ga0207662_10000964 | Ga0207662_1000096411 | 245 |
| 1073 | 3300025918 | Ga0207662_10019591 | Ga0207662_100195915 | 245 |
| 1074 | 3300025919 | Ga0207657_10005395 | Ga0207657_1000539511 | 245 |
| 1075 | 3300025919 | Ga0207657_10020125 | Ga0207657_100201256 | 245 |
| 1076 | 3300025919 | Ga0207657_10068436 | Ga0207657_100684362 | 245 |
| 1077 | 3300025920 | Ga0207649_10000450 | Ga0207649_1000045017 | 245 |
| 1078 | 3300025920 | Ga0207649_10026888 | Ga0207649_100268882 | 245 |
| 1079 | 3300025921 | Ga0207652_10008726 | Ga0207652_100087265 | 245 |
| 1080 | 3300025921 | Ga0207652_10157189 | Ga0207652_101571892 | 245 |
| 1081 | 3300025922 | Ga0207646_10296809 | Ga0207646_102968092 | 245 |
| 1082 | 3300025923 | Ga0207681_10000097 | Ga0207681_1000009734 | 245 |
| 1083 | 3300025926 | Ga0207659_10000092 | Ga0207659_1000009244 | 245 |
| 1084 | 3300025926 | Ga0207659_10045065 | Ga0207659_100450654 | 245 |
| 1085 | 3300025927 | Ga0207687_10000219 | Ga0207687_100002194 | 245 |
| 1086 | 3300025928 | Ga0207700_10064607 | Ga0207700_100646072 | 245 |
| 1087 | 3300025929 | Ga0207664_10060581 | Ga0207664_100605812 | 245 |
| 1088 | 3300025929 | Ga0207664_10484029 | Ga0207664_104840292 | 245 |
| 1089 | 3300025931 | Ga0207644_10005083 | Ga0207644_100050833 | 245 |
| 1090 | 3300025932 | Ga0207690_10003312 | Ga0207690_100033124 | 245 |
| 1091 | 3300025933 | Ga0207706_10004310 | Ga0207706_100043106 | 245 |
| 1092 | 3300025933 | Ga0207706_10008823 | Ga0207706_100088235 | 245 |
| 1093 | 3300025933 | Ga0207706_10035694 | Ga0207706_100356942 | 245 |
| 1094 | 3300025933 | Ga0207706_10256446 | Ga0207706_102564462 | 245 |
| 1095 | 3300025934 | Ga0207686_10000796 | Ga0207686_100007967 | 245 |
| 1096 | 3300025934 | Ga0207686_10062208 | Ga0207686_100622083 | 245 |
| 1097 | 3300025934 | Ga0207686_10449951 | Ga0207686_104499512 | 245 |
| 1098 | 3300025935 | Ga0207709_10000362 | Ga0207709_1000036228 | 245 |
| 1099 | 3300025935 | Ga0207709_10220374 | Ga0207709_102203742 | 245 |
| 1100 | 3300025936 | Ga0207670_10002375 | Ga0207670_100023759 | 245 |
| 1101 | 3300025937 | Ga0207669_10000350 | Ga0207669_1000035010 | 245 |
| 1102 | 3300025938 | Ga0207704_10000479 | Ga0207704_100004798 | 245 |
| 1103 | 3300025938 | Ga0207704_10317554 | Ga0207704_103175542 | 245 |
| 1104 | 3300025939 | Ga0207665_10089990 | Ga0207665_100899901 | 245 |
| 1105 | 3300025939 | Ga0207665_10491370 | Ga0207665_104913701 | 245 |
| 1106 | 3300025940 | Ga0207691_10000283 | Ga0207691_1000028344 | 245 |
| 1107 | 3300025940 | Ga0207691_10070775 | Ga0207691_100707752 | 245 |
| 1108 | 3300025941 | Ga0207711_10009170 | Ga0207711_100091707 | 245 |
| 1109 | 3300025942 | Ga0207689_10000085 | Ga0207689_1000008565 | 245 |
| 1110 | 3300025944 | Ga0207661_10000464 | Ga0207661_1000046416 | 245 |
| 1111 | 3300025944 | Ga0207661_10495672 | Ga0207661_104956721 | 245 |
| 1112 | 3300025945 | Ga0207679_10000030 | Ga0207679_10000030151 | 245 |
| 1113 | 3300025945 | Ga0207679_10441453 | Ga0207679_104414532 | 245 |
| 1114 | 3300025960 | Ga0207651_10000422 | Ga0207651_100004225 | 245 |
| 1115 | 3300025960 | Ga0207651_10114169 | Ga0207651_101141692 | 245 |
| 1116 | 3300025960 | Ga0207651_10327355 | Ga0207651_103273552 | 245 |
| 1117 | 3300025961 | Ga0207712_10004682 | Ga0207712_100046828 | 245 |
| 1118 | 3300025972 | Ga0207668_10000114 | Ga0207668_1000011444 | 245 |
| 1119 | 3300025972 | Ga0207668_10550177 | Ga0207668_105501772 | 245 |
| 1120 | 3300025981 | Ga0207640_10000141 | Ga0207640_1000014152 | 245 |
| 1121 | 3300025986 | Ga0207658_10155178 | Ga0207658_101551783 | 245 |
| 1122 | 3300026023 | Ga0207677_10001776 | Ga0207677_100017764 | 245 |
| 1123 | 3300026035 | Ga0207703_10000983 | Ga0207703_100009839 | 245 |
| 1124 | 3300026041 | Ga0207639_10000305 | Ga0207639_1000030517 | 245 |
| 1125 | 3300026041 | Ga0207639_10341225 | Ga0207639_103412252 | 245 |
| 1126 | 3300026067 | Ga0207678_10000125 | Ga0207678_1000012551 | 245 |
| 1127 | 3300026067 | Ga0207678_10026095 | Ga0207678_100260956 | 245 |
| 1128 | 3300026067 | Ga0207678_10197514 | Ga0207678_101975142 | 245 |
| 1129 | 3300026075 | Ga0207708_10000187 | Ga0207708_1000018711 | 245 |
| 1130 | 3300026075 | Ga0207708_10014918 | Ga0207708_100149186 | 245 |
| 1131 | 3300026078 | Ga0207702_10005437 | Ga0207702_100054378 | 245 |
| 1132 | 3300026078 | Ga0207702_10058876 | Ga0207702_100588762 | 245 |
| 1133 | 3300026088 | Ga0207641_10003649 | Ga0207641_1000364915 | 245 |
| 1134 | 3300026088 | Ga0207641_10055119 | Ga0207641_100551194 | 245 |
| 1135 | 3300026089 | Ga0207648_10002168 | Ga0207648_1000216816 | 245 |
| 1136 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007415 | 245 |
| 1137 | 3300026116 | Ga0207674_10002501 | Ga0207674_1000250111 | 245 |
| 1138 | 3300026116 | Ga0207674_10276142 | Ga0207674_102761422 | 245 |
| 1139 | 3300026118 | Ga0207675_100004556 | Ga0207675_10000455611 | 245 |
| 1140 | 3300026121 | Ga0207683_10000014 | Ga0207683_1000001445 | 245 |
| 1141 | 3300026121 | Ga0207683_10003999 | Ga0207683_100039999 | 245 |
| 1142 | 3300026142 | Ga0207698_10001242 | Ga0207698_100012428 | 245 |
| 1143 | 3300027614 | Ga0209970_1005489 | Ga0209970_10054892 | 245 |
| 1144 | 3300027665 | Ga0209983_1006800 | Ga0209983_10068003 | 245 |
| 1145 | 3300027695 | Ga0209966_1006091 | Ga0209966_10060911 | 245 |
| 1146 | 3300027717 | Ga0209998_10000361 | Ga0209998_1000036111 | 245 |
| 1147 | 3300027717 | Ga0209998_10001516 | Ga0209998_100015165 | 245 |
| 1148 | 3300027876 | Ga0209974_10002250 | Ga0209974_100022502 | 245 |
| 1149 | 3300027876 | Ga0209974_10012895 | Ga0209974_100128953 | 245 |
| 1150 | 3300027907 | Ga0207428_10000467 | Ga0207428_1000046733 | 245 |
| 1151 | 3300027907 | Ga0207428_10011322 | Ga0207428_100113225 | 245 |
| 1152 | 3300028379 | Ga0268266_10041670 | Ga0268266_100416702 | 245 |
| 1153 | 3300028379 | Ga0268266_10502461 | Ga0268266_105024612 | 245 |
| 1154 | 3300028380 | Ga0268265_10001371 | Ga0268265_100013713 | 245 |
| 1155 | 3300028380 | Ga0268265_10337188 | Ga0268265_103371881 | 245 |
| 1156 | 3300028381 | Ga0268264_10000469 | Ga0268264_1000046914 | 245 |
| 1157 | 3300031241 | Ga0265325_10000423 | Ga0265325_1000042324 | 245 |
| 1158 | 3300031344 | Ga0265316_10048508 | Ga0265316_100485083 | 245 |
| 1159 | 3300031456 | Ga0307513_10350860 | Ga0307513_103508601 | 245 |
| 1160 | 3300031595 | Ga0265313_10034290 | Ga0265313_100342903 | 245 |
| 1161 | 3300031824 | Ga0307413_10301608 | Ga0307413_103016082 | 245 |
| 1162 | 3300031995 | Ga0307409_100868698 | Ga0307409_1008686981 | 245 |
| 1163 | 3300034816 | Ga0373930_0000150 | Ga0373930_0000150_4779_5516 | 245 |
| 1164 | 3300034817 | Ga0373948_0000307 | Ga0373948_0000307_4076_4813 | 245 |
| 1165 | 3300034818 | Ga0373950_0002075 | Ga0373950_0002075_1410_2147 | 245 |
| 1166 | 3300034819 | Ga0373958_0001702 | Ga0373958_0001702_694_1431 | 245 |
| 1167 | 3300034820 | Ga0373959_0001657 | Ga0373959_0001657_2409_3146 | 245 |
| 1168 | 3300035083 | Ga0373926_0027180 | Ga0373926_0027180_1251_1988 | 245 |
| 1169 | 3300035084 | Ga0373928_0000222 | Ga0373928_0000222_8611_9348 | 245 |
| 1170 | 3300035084 | Ga0373928_0063198 | Ga0373928_0063198_40_777 | 245 |
| 1171 | 3300035085 | Ga0373929_0002112 | Ga0373929_0002112_2829_3566 | 245 |
| 1172 | 3300035086 | Ga0373934_0137209 | Ga0373934_0137209_119_856 | 245 |
| 1173 | 3300035088 | Ga0373940_0012698 | Ga0373940_0012698_841_1578 | 245 |
| 1174 | 3300035089 | Ga0373944_0001828 | Ga0373944_0001828_3550_4287 | 245 |
| 1175 | 3300035089 | Ga0373944_0080792 | Ga0373944_0080792_209_946 | 245 |
| 1176 | 3300035090 | Ga0373949_0006107 | Ga0373949_0006107_1125_1862 | 245 |
| 1177 | 3300035090 | Ga0373949_0050996 | Ga0373949_0050996_243_980 | 245 |
| 1178 | 3300035092 | Ga0373952_0000029 | Ga0373952_0000029_3137_3874 | 245 |
| 1179 | 3300035111 | Ga0373923_0038247 | Ga0373923_0038247_400_1137 | 245 |
| 1180 | 3300035112 | Ga0373932_0001251 | Ga0373932_0001251_2983_3720 | 245 |
| 1181 | 3300035113 | Ga0373936_0006326 | Ga0373936_0006326_2960_3697 | 245 |
| 1182 | 3300035113 | Ga0373936_0033686 | Ga0373936_0033686_726_1463 | 245 |
| 1183 | 3300035114 | Ga0373939_0002855 | Ga0373939_0002855_2864_3601 | 245 |
| 1184 | 3300035116 | Ga0373945_0058939 | Ga0373945_0058939_614_1351 | 245 |
| 1185 | 3300035117 | Ga0373953_0023666 | Ga0373953_0023666_1572_2309 | 245 |
| 1186 | 3300035117 | Ga0373953_0028414 | Ga0373953_0028414_1154_1891 | 245 |
| 1187 | 3300035118 | Ga0373954_0090293 | Ga0373954_0090293_474_1211 | 245 |
| 1188 | 3300035118 | Ga0373954_0093987 | Ga0373954_0093987_355_1092 | 245 |
| 1189 | 3300035118 | Ga0373954_0118861 | Ga0373954_0118861_476_1213 | 245 |
| 1190 | 3300035119 | Ga0373956_0117071 | Ga0373956_0117071_168_905 | 245 |
| 1191 | 3300035119 | Ga0373956_0118830 | Ga0373956_0118830_118_855 | 245 |
| 1192 | 3300035120 | Ga0373957_0006384 | Ga0373957_0006384_1970_2707 | 245 |
| 1193 | 3300035121 | Ga0373960_0000372 | Ga0373960_0000372_4111_4848 | 245 |
| 1194 | 3300035170 | Ga0373943_0042125 | Ga0373943_0042125_735_1472 | 245 |
| 1195 | 3300035170 | Ga0373943_0042928 | Ga0373943_0042928_1129_1866 | 245 |
| 1196 | 3300035170 | Ga0373943_0301588 | Ga0373943_0301588_82_819 | 245 |
| 1197 | 3300035171 | Ga0373946_0006340 | Ga0373946_0006340_2917_3654 | 245 |
| 1198 | 3300035172 | Ga0373955_0001269 | Ga0373955_0001269_6278_7015 | 245 |
| 1199 | 3300035172 | Ga0373955_0001523 | Ga0373955_0001523_3310_4047 | 245 |
| 1200 | 3300035172 | Ga0373955_0004969 | Ga0373955_0004969_4169_4906 | 245 |
| 1201 | 3300035207 | Ga0373942_0000767 | Ga0373942_0000767_3807_4544 | 245 |
| 1202 | 3300035241 | Ga0373961_0001835 | Ga0373961_0001835_1754_2491 | 245 |
| 1203 | 3300035242 | Ga0373962_0005930 | Ga0373962_0005930_1369_2106 | 245 |
| 1204 | 3300035410 | Ga0373924_0023997 | Ga0373924_0023997_900_1637 | 245 |
| 1205 | 3300035691 | Ga0373931_0068208 | Ga0373931_0068208_461_1198 | 245 |
| 1206 | 3300035692 | Ga0373935_0020667 | Ga0373935_0020667_2549_3286 | 245 |
| 1207 | 3300035692 | Ga0373935_0073204 | Ga0373935_0073204_1149_1886 | 245 |
| 1208 | 3300035695 | Ga0373927_0050616 | Ga0373927_0050616_147_884 | 245 |
| 1209 | 3300035724 | Ga0373933_0001124 | Ga0373933_0001124_14277_15014 | 245 |
| 1210 | 3300035724 | Ga0373933_0005311 | Ga0373933_0005311_4644_5381 | 245 |
| 1211 | 3300035724 | Ga0373933_0017906 | Ga0373933_0017906_2081_2818 | 245 |
| 1212 | 3300035725 | Ga0373947_0038674 | Ga0373947_0038674_1496_2233 | 245 |
| 1213 | 3300035725 | Ga0373947_0244013 | Ga0373947_0244013_148_885 | 245 |
| 1214 | 3300036401 | Ga0373937_0004918 | Ga0373937_0004918_709_1446 | 245 |
| 1215 | 3300036401 | Ga0373937_0012121 | Ga0373937_0012121_954_1691 | 245 |
| 1216 | 3300036401 | Ga0373937_0049021 | Ga0373937_0049021_1415_2152 | 245 |
| 1217 | 3300037068 | Ga0373925_0105557 | Ga0373925_0105557_259_996 | 245 |
| 1218 | 3300037068 | Ga0373925_0183511 | Ga0373925_0183511_626_1363 | 245 |
| 1219 | 3300037418 | Ga0395900_0187123 | Ga0395900_0187123_1146_1898 | 245 |
| 1220 | 3300037418 | Ga0395900_0352299 | Ga0395900_0352299_445_1197 | 245 |
| 1221 | 3300037466 | Ga0395898_0123799 | Ga0395898_0123799_574_1326 | 245 |
| 1222 | 3300038996 | Ga0242420_012515 | Ga0242420_012515_530_1267 | 245 |
| 1223 | 3300042001 | Ga0439441_003611 | Ga0439441_003611_1337_2074 | 245 |
| 1224 | 3300042005 | Ga0439448_0019150 | Ga0439448_0019150_872_1609 | 245 |
| 1225 | 3300042008 | Ga0439450_006022 | Ga0439450_006022_1006_1743 | 245 |
| 1226 | 3300042439 | Ga0439464_0001894 | Ga0439464_0001894_3191_3973 | 245 |
| 1227 | 3300042439 | Ga0439464_0043627 | Ga0439464_0043627_79_816 | 245 |
| 1228 | 3300042461 | Ga0439460_0058121 | Ga0439460_0058121_189_926 | 245 |
| 1229 | 3300044712 | Ga0453684_0037028 | Ga0453684_0037028_4541_5278 | 245 |
| 1230 | 3300045051 | Ga0451576_0033369 | Ga0451576_0033369_958_1695 | 245 |
| 1231 | 3300046452 | Ga0495617_070130 | Ga0495617_070130_269_1006 | 245 |
| 1232 | 3300046454 | Ga0495592_0024186 | Ga0495592_0024186_1359_2096 | 245 |
| 1233 | 3300046454 | Ga0495592_0040848 | Ga0495592_0040848_2037_2774 | 245 |
| 1234 | 3300046455 | Ga0495603_0272938 | Ga0495603_0272938_117_854 | 245 |
| 1235 | 3300046458 | Ga0495591_067573 | Ga0495591_067573_150_887 | 245 |
| 1236 | 3300046459 | Ga0495629_0262307 | Ga0495629_0262307_295_1032 | 245 |
| 1237 | 3300046460 | Ga0495638_0161544 | Ga0495638_0161544_127_879 | 245 |
| 1238 | 3300046461 | Ga0495641_0019259 | Ga0495641_0019259_2142_2879 | 245 |
| 1239 | 3300046462 | Ga0495651_0011021 | Ga0495651_0011021_3039_3776 | 245 |
| 1240 | 3300046462 | Ga0495651_0011844 | Ga0495651_0011844_5696_6433 | 245 |
| 1241 | 3300046463 | Ga0495653_0008326 | Ga0495653_0008326_7058_7795 | 245 |
| 1242 | 3300046463 | Ga0495653_0012564 | Ga0495653_0012564_4252_4989 | 245 |
| 1243 | 3300046472 | Ga0495580_0023721 | Ga0495580_0023721_3647_4384 | 245 |
| 1244 | 3300046473 | Ga0495582_0039312 | Ga0495582_0039312_1625_2362 | 245 |
| 1245 | 3300046475 | Ga0495639_0029697 | Ga0495639_0029697_1414_2151 | 245 |
| 1246 | 3300046476 | Ga0495662_0010283 | Ga0495662_0010283_2958_3695 | 245 |
| 1247 | 3300046477 | Ga0495664_0003537 | Ga0495664_0003537_7179_7916 | 245 |
| 1248 | 3300046477 | Ga0495664_0066458 | Ga0495664_0066458_795_1532 | 245 |
| 1249 | 3300046492 | Ga0495585_0008366 | Ga0495585_0008366_4177_4914 | 245 |
| 1250 | 3300046499 | Ga0495594_0042775 | Ga0495594_0042775_910_1647 | 245 |
| 1251 | 3300046499 | Ga0495594_0043598 | Ga0495594_0043598_557_1294 | 245 |
| 1252 | 3300046501 | Ga0495607_0048620 | Ga0495607_0048620_1396_2133 | 245 |
| 1253 | 3300046511 | Ga0495608_0001474 | Ga0495608_0001474_1224_1961 | 245 |
| 1254 | 3300046511 | Ga0495608_0055452 | Ga0495608_0055452_339_1076 | 245 |
| 1255 | 3300046511 | Ga0495608_0141830 | Ga0495608_0141830_656_1393 | 245 |
| 1256 | 3300046514 | Ga0495618_0004984 | Ga0495618_0004984_3512_4249 | 245 |
| 1257 | 3300046516 | Ga0495628_0001927 | Ga0495628_0001927_8022_8759 | 245 |
| 1258 | 3300046516 | Ga0495628_0023873 | Ga0495628_0023873_1544_2281 | 245 |
| 1259 | 3300046516 | Ga0495628_0244742 | Ga0495628_0244742_356_1093 | 245 |
| 1260 | 3300046517 | Ga0495630_0121732 | Ga0495630_0121732_289_1026 | 245 |
| 1261 | 3300046518 | Ga0495631_0024362 | Ga0495631_0024362_33_770 | 245 |
| 1262 | 3300046523 | Ga0495644_0002701 | Ga0495644_0002701_2299_3036 | 245 |
| 1263 | 3300046529 | Ga0495652_0022449 | Ga0495652_0022449_3515_4252 | 245 |
| 1264 | 3300046529 | Ga0495652_0048857 | Ga0495652_0048857_526_1263 | 245 |
| 1265 | 3300046529 | Ga0495652_0087560 | Ga0495652_0087560_328_1065 | 245 |
| 1266 | 3300046529 | Ga0495652_0218826 | Ga0495652_0218826_225_962 | 245 |
| 1267 | 3300046531 | Ga0495665_0023481 | Ga0495665_0023481_34_771 | 245 |
| 1268 | 3300046533 | Ga0495640_0027462 | Ga0495640_0027462_3029_3766 | 245 |
| 1269 | 3300046533 | Ga0495640_0295102 | Ga0495640_0295102_88_825 | 245 |
| 1270 | 3300046535 | Ga0495586_0036479 | Ga0495586_0036479_109_846 | 245 |
| 1271 | 3300046535 | Ga0495586_0068990 | Ga0495586_0068990_655_1392 | 245 |
| 1272 | 3300046536 | Ga0495587_0002240 | Ga0495587_0002240_9463_10200 | 245 |
| 1273 | 3300046536 | Ga0495587_0047875 | Ga0495587_0047875_1657_2394 | 245 |
| 1274 | 3300046536 | Ga0495587_0111209 | Ga0495587_0111209_754_1491 | 245 |
| 1275 | 3300046537 | Ga0495598_0007286 | Ga0495598_0007286_1173_1910 | 245 |
| 1276 | 3300046538 | Ga0495609_0058799 | Ga0495609_0058799_36_773 | 245 |
| 1277 | 3300046543 | Ga0495645_0002539 | Ga0495645_0002539_9091_9828 | 245 |
| 1278 | 3300046543 | Ga0495645_0019854 | Ga0495645_0019854_1082_1819 | 245 |
| 1279 | 3300046543 | Ga0495645_0297721 | Ga0495645_0297721_185_922 | 245 |
| 1280 | 3300046557 | Ga0495622_0015565 | Ga0495622_0015565_1507_2244 | 245 |
| 1281 | 3300046558 | Ga0495633_0002969 | Ga0495633_0002969_9676_10413 | 245 |
| 1282 | 3300046559 | Ga0495667_0026523 | Ga0495667_0026523_456_1193 | 245 |
| 1283 | 3300046559 | Ga0495667_0099693 | Ga0495667_0099693_366_1103 | 245 |
| 1284 | 3300046615 | Ga0495656_0002822 | Ga0495656_0002822_4113_4850 | 245 |
| 1285 | 3300046642 | Ga0495634_0026079 | Ga0495634_0026079_2957_3694 | 245 |
| 1286 | 3300046648 | Ga0495611_0081731 | Ga0495611_0081731_519_1256 | 245 |
| 1287 | 3300046663 | Ga0495635_0003881 | Ga0495635_0003881_1777_2514 | 245 |
| 1288 | 3300046663 | Ga0495635_0021401 | Ga0495635_0021401_2421_3158 | 245 |
| 1289 | 3300046663 | Ga0495635_0398033 | Ga0495635_0398033_116_874 | 245 |
| 1290 | 3300046664 | Ga0495659_0001458 | Ga0495659_0001458_6322_7059 | 245 |
| 1291 | 3300046664 | Ga0495659_0057268 | Ga0495659_0057268_357_1094 | 245 |
| 1292 | 3300046665 | Ga0495661_0044928 | Ga0495661_0044928_538_1275 | 245 |
| 1293 | 3300046674 | Ga0495588_0045221 | Ga0495588_0045221_1289_2026 | 245 |
| 1294 | 3300046675 | Ga0495657_0010946 | Ga0495657_0010946_2443_3180 | 245 |
| 1295 | 3300046678 | Ga0495599_0004481 | Ga0495599_0004481_3183_3920 | 245 |
| 1296 | 3300046678 | Ga0495599_0017530 | Ga0495599_0017530_1617_2354 | 245 |
| 1297 | 3300046679 | Ga0495623_0000420 | Ga0495623_0000420_26690_27427 | 245 |
| 1298 | 3300046679 | Ga0495623_0007330 | Ga0495623_0007330_2729_3466 | 245 |
| 1299 | 3300046680 | Ga0495646_0020687 | Ga0495646_0020687_874_1611 | 245 |
| 1300 | 3300046683 | Ga0495658_0006062 | Ga0495658_0006062_3074_3811 | 245 |
| 1301 | 3300046683 | Ga0495658_0009215 | Ga0495658_0009215_2622_3359 | 245 |
| 1302 | 3300046689 | Ga0495613_0264446 | Ga0495613_0264446_119_856 | 245 |
| 1303 | 3300046690 | Ga0495624_0026468 | Ga0495624_0026468_30_767 | 245 |
| 1304 | 3300046690 | Ga0495624_0051811 | Ga0495624_0051811_1145_1882 | 245 |
| 1305 | 3300046690 | Ga0495624_0091076 | Ga0495624_0091076_259_996 | 245 |
| 1306 | 3300046691 | Ga0495670_0000291 | Ga0495670_0000291_15111_15848 | 245 |
| 1307 | 3300046809 | Ga0495600_0001326 | Ga0495600_0001326_1713_2450 | 245 |
| 1308 | 3300046809 | Ga0495600_0011214 | Ga0495600_0011214_335_1072 | 245 |
| 1309 | 3300047315 | Ga0495581_0049705 | Ga0495581_0049705_1056_1793 | 245 |
| 1310 | 3300047315 | Ga0495581_0055269 | Ga0495581_0055269_327_1064 | 245 |
| 1311 | 3300047317 | Ga0495604_0003891 | Ga0495604_0003891_7841_8578 | 245 |
| 1312 | 3300047317 | Ga0495604_0009082 | Ga0495604_0009082_1575_2312 | 245 |
| 1313 | 3300047318 | Ga0495636_0122156 | Ga0495636_0122156_229_966 | 245 |
| 1314 | 3300047319 | Ga0495674_0015363 | Ga0495674_0015363_1878_2615 | 245 |
| 1315 | 3300047319 | Ga0495674_0027169 | Ga0495674_0027169_1194_1931 | 245 |
| 1316 | 3300047319 | Ga0495674_0069524 | Ga0495674_0069524_2189_2926 | 245 |
| 1317 | 3300047321 | Ga0495676_0332651 | Ga0495676_0332651_128_865 | 245 |
| 1318 | 3300047322 | Ga0495680_0012959 | Ga0495680_0012959_1973_2710 | 245 |
| 1319 | 3300047322 | Ga0495680_0044687 | Ga0495680_0044687_2544_3281 | 245 |
| 1320 | 3300047322 | Ga0495680_0062737 | Ga0495680_0062737_295_1032 | 245 |
| 1321 | 3300047444 | Ga0495675_0001544 | Ga0495675_0001544_10003_10740 | 245 |
| 1322 | 3300047445 | Ga0495677_0032250 | Ga0495677_0032250_379_1116 | 245 |
| 1323 | 3300047471 | Ga0495684_0002087 | Ga0495684_0002087_7856_8593 | 245 |
| 1324 | 3300047471 | Ga0495684_0282601 | Ga0495684_0282601_313_1050 | 245 |
| 1325 | 3300047673 | Ga0495593_0004626 | Ga0495593_0004626_4865_5602 | 245 |
| 1326 | 3300048088 | Ga0495602_0000740 | Ga0495602_0000740_25764_26501 | 245 |
| 1327 | 3300048088 | Ga0495602_0005526 | Ga0495602_0005526_10098_10835 | 245 |
| 1328 | 3300048089 | Ga0495614_0031402 | Ga0495614_0031402_708_1445 | 245 |
| 1329 | 3300048089 | Ga0495614_0114701 | Ga0495614_0114701_387_1124 | 245 |
| 1330 | 3300048903 | Ga0496100_0002951 | Ga0496100_0002951_3394_4131 | 245 |
| 1331 | 3300048904 | Ga0496101_0020995 | Ga0496101_0020995_2724_3461 | 245 |
| 1332 | 3300048904 | Ga0496101_0137951 | Ga0496101_0137951_153_890 | 245 |
| 1333 | 3300048905 | Ga0496102_0019045 | Ga0496102_0019045_3058_3795 | 245 |
| 1334 | 3300048905 | Ga0496102_0039093 | Ga0496102_0039093_1390_2127 | 245 |
| 1335 | 3300048907 | Ga0496104_0005547 | Ga0496104_0005547_225_962 | 245 |
| 1336 | 3300048908 | Ga0496105_0193026 | Ga0496105_0193026_173_910 | 245 |
| 1337 | 3300048909 | Ga0496106_0012172 | Ga0496106_0012172_1952_2689 | 245 |
| 1338 | 3300048909 | Ga0496106_0013964 | Ga0496106_0013964_1383_2120 | 245 |
| 1339 | 3300048910 | Ga0496107_0034213 | Ga0496107_0034213_2138_2875 | 245 |
| 1340 | 3300048910 | Ga0496107_0037809 | Ga0496107_0037809_2142_2879 | 245 |
| 1341 | 3300048910 | Ga0496107_0041516 | Ga0496107_0041516_1054_1791 | 245 |
| 1342 | 3300048911 | Ga0496108_0046748 | Ga0496108_0046748_873_1610 | 245 |
| 1343 | 3300048912 | Ga0496109_0072253 | Ga0496109_0072253_2375_3112 | 245 |
| 1344 | 3300048914 | Ga0496111_0113348 | Ga0496111_0113348_477_1214 | 245 |
| 1345 | 3300048915 | Ga0496112_0661226 | Ga0496112_0661226_127_864 | 245 |
| 1346 | 3300048916 | Ga0496113_0010789 | Ga0496113_0010789_3012_3749 | 245 |
| 1347 | 3300048917 | Ga0496114_0399786 | Ga0496114_0399786_63_800 | 245 |
| 1348 | 3300048918 | Ga0496115_0094696 | Ga0496115_0094696_1448_2185 | 245 |
| 1349 | 3300048918 | Ga0496115_0155608 | Ga0496115_0155608_709_1446 | 245 |
| 1350 | 3300048918 | Ga0496115_0471745 | Ga0496115_0471745_36_773 | 245 |
| 1351 | 3300048919 | Ga0496116_0236119 | Ga0496116_0236119_52_852 | 245 |
| 1352 | 3300048927 | Ga0496124_0368877 | Ga0496124_0368877_138_938 | 245 |
| 1353 | 3300049583 | Ga0501067_0075382 | Ga0501067_0075382_95_832 | 245 |
| 1354 | 3300049585 | Ga0501069_0000283 | Ga0501069_0000283_5778_6593 | 245 |
| 1355 | 3300049585 | Ga0501069_0220208 | Ga0501069_0220208_132_869 | 245 |
| 1356 | 3300049586 | Ga0501070_0312239 | Ga0501070_0312239_496_1263 | 245 |
| 1357 | 3300049593 | Ga0501077_0019577 | Ga0501077_0019577_3495_4232 | 245 |
| 1358 | 3300050511 | nmdc:mga08y16_10784_c1 | nmdc:mga08y16_10784_c1_5934_6671 | 245 |
| 1359 | 3300050511 | nmdc:mga08y16_610118_c1 | nmdc:mga08y16_610118_c1_251_988 | 245 |
| 1360 | 3300053077 | Ga0495601_0000360 | Ga0495601_0000360_15289_16026 | 245 |
| 1361 | 3300053077 | Ga0495601_0001260 | Ga0495601_0001260_1713_2450 | 245 |
| 1362 | 3300053077 | Ga0495601_0070227 | Ga0495601_0070227_689_1426 | 245 |
| 1363 | 3300053077 | Ga0495601_0282707 | Ga0495601_0282707_243_980 | 245 |
| 1364 | 3300053078 | Ga0495612_0000964 | Ga0495612_0000964_1532_2269 | 245 |
| 1365 | 3300053078 | Ga0495612_0002659 | Ga0495612_0002659_3925_4662 | 245 |
| 1366 | 3300053078 | Ga0495612_0008741 | Ga0495612_0008741_2829_3566 | 245 |
| 1367 | 3300053078 | Ga0495612_0009169 | Ga0495612_0009169_315_1052 | 245 |
| 1368 | 3300053084 | Ga0495595_0000969 | Ga0495595_0000969_10195_10932 | 245 |
| 1369 | 3300053084 | Ga0495595_0001276 | Ga0495595_0001276_6495_7232 | 245 |
| 1370 | 3300053085 | Ga0495619_0000581 | Ga0495619_0000581_9441_10178 | 245 |
| 1371 | 3300053085 | Ga0495619_0001851 | Ga0495619_0001851_10719_11456 | 245 |
| 1372 | 3300053090 | Ga0500646_0000891 | Ga0500646_0000891_3727_4545 | 245 |
| 1373 | 3300053094 | Ga0500566_0103442 | Ga0500566_0103442_735_1472 | 245 |
| 1374 | 3300053094 | Ga0500566_0130230 | Ga0500566_0130230_97_834 | 245 |
| 1375 | 3300053727 | Ga0500611_017475 | Ga0500611_017475_481_1233 | 245 |
| 1376 | 3300054114 | Ga0501084_0427144 | Ga0501084_0427144_271_1008 | 245 |
| 1377 | iso_pu_bacteria | 2939582691 | 2939585354 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jig-assembly1.cif.gz_A | crystal structure of a putative dehydrogenase from burkholderia cenocepacia | 0.9866 | 3 | 245 |
| 8bci-assembly2.cif.gz_C | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 | 0.9865 | 3 | 245 |
| 4iqg-assembly1.cif.gz_B | crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form | 0.9861 | 4 | 245 |
| 4e3z-assembly1.cif.gz_B | crystal structure of a oxidoreductase from rhizobium etli cfn 42 | 0.984 | 4 | 245 |
| 8bcj-assembly2.cif.gz_D | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ | 0.9827 | 3 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jigA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9866 | 3 | 245 | 3.40.50.720 |
| 4jigA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9701 | 3 | 245 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9641 | 4 | 244 | 3.40.50.720 |
| 3i3oG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9622 | 4 | 245 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9621 | 4 | 244 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A345ZSW4-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9976 | 1 | 245 |
GO:0016614
|
| AF-A0A1W7D5N1-F1-model_v4 | Oxidoreductase | 0.9932 | 1 | 245 |
GO:0016616
GO:0030497 |
| AF-A0A2D9YDP4-F1-model_v4 | NAD(P)-dependent oxidoreductase (EC 1.1.1.47) | 0.993 | 3 | 245 |
GO:0047936
|
| AF-A0A1Q2M9D9-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9911 | 3 | 245 |
|
| AF-A0A7X3YCA1-F1-model_v4 | SDR family oxidoreductase | 0.9904 | 3 | 245 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar