F493491

General Info

Members Datasets Scaffolds Average Seq Length
1377 659 1263 244

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0204925|Ga0501043_0204925_520_1389
Length 289
Sequence LRDIDAPPGGTMIMLPVLVFSFIVRRHLASGDQRGDQRMTSVLLITGGASGIGAETARRAASRGYSVALNYRTRDTEAKKVVADVEAKGAKAVAIKADMARETDIVRMFEETTQALGPVTHLLNSAGISRQMRVADYDASVLTTLFATNVTGLMLCCREAVKRMSTKHGGKGGAIVNVSSLAATLGGRQGSSAYAATKGAVDSFTRGFAREVAGEGIRVNTLRPGMVLTEMTEKRLGDAVFRNHIQSSIPMGRVGKAGEIADAALWLLSDEAAFITGAMLDAAGGGYNI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
6 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
9 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
10 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
11 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2738543024 Aminobacter sp. AP02 Isolate Unclassified
14 2791355256 Rhizobium sp. M10 Isolate Nodule
15 2791355261 Rhizobium sp. J15 Isolate Nodule
16 2791355262 Rhizobium sp. M1 Isolate Nodule
17 2791355265 Rhizobium sp. H4 Isolate Nodule
18 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
19 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
20 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
21 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
22 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
23 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
24 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
25 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
26 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
27 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
30 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
31 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
32 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
33 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
34 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
35 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
36 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
37 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
38 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
39 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
40 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
41 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
42 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
43 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
44 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
45 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
46 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
47 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
48 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
49 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
50 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
51 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
52 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
53 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
54 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
55 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
56 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
57 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
58 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
59 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
60 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
61 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
62 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
63 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
64 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
65 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
66 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
67 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
68 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
69 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
70 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
71 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
72 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
73 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
74 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
75 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
76 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
77 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
78 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
79 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
80 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
81 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
82 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
83 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
84 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
85 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
86 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
87 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
88 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
89 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
90 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
91 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
92 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
93 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
94 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
95 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
96 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
97 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
98 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
99 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
100 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
101 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
102 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
103 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
104 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
105 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
106 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
107 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
108 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
109 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
110 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
111 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
112 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
113 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
114 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
115 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
116 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
117 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
118 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
119 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
120 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
121 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
122 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
123 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
124 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
125 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
126 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
127 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
128 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
129 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
131 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
132 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
133 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
134 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
135 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
136 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
137 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
138 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
139 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
140 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
141 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
142 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
143 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
144 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
145 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
146 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
147 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
148 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
149 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
152 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
153 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
154 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
155 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
156 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
157 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
158 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
159 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
160 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
161 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
162 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
163 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
164 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
165 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
166 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
167 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
168 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
169 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
174 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
175 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
176 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
177 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
178 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
179 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
180 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
181 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
182 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
183 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
184 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
185 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
186 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
187 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
188 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
189 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
190 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
191 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
192 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
193 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
194 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
195 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
196 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
197 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
198 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
199 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
200 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
201 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
202 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
203 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
204 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
205 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
206 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
207 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
208 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
209 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
210 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
211 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
212 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
213 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
214 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
215 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
220 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
221 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
222 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
223 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
224 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
225 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
228 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
229 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
230 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
231 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
232 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
236 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
237 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
238 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
239 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
240 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
241 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
242 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
243 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
244 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
245 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
246 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
247 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
248 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
249 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
250 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
251 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
252 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
253 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
254 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
255 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
256 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
257 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
258 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
259 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
260 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
261 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
265 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
267 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
268 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
269 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
270 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
274 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
360 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
361 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
362 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
363 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
364 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
365 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
366 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
367 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
368 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
369 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
370 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
371 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
372 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
373 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
374 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
375 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
376 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
377 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
378 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
379 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
380 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
381 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
382 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
383 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
384 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
385 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
386 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
387 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
388 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
389 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
390 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
391 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
392 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
393 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
394 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
395 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
396 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
397 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
398 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
399 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
400 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
401 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
402 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
403 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
404 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
405 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
406 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
407 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
408 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
409 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
410 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
411 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
412 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
413 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
414 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
415 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
416 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
417 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
418 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
419 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
420 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
421 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
422 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
423 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
424 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
425 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
426 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
427 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
428 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
429 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
430 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
431 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
432 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
433 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
434 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
435 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
436 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
437 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
438 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
439 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
440 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
441 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
442 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
443 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
444 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
445 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
446 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
447 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
448 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
449 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
450 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
451 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
452 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
453 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
454 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
455 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
456 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
457 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
458 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
459 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
460 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
461 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
462 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
463 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
464 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
465 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
466 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
467 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
468 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
469 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
470 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
471 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
472 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
473 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
474 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
475 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
476 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
477 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
478 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
479 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
480 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
481 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
482 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
483 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
484 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
485 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
486 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
487 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
488 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
489 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
490 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
491 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
492 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
493 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
494 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
495 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
496 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
497 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
498 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
499 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
500 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
501 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
502 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
503 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
504 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
505 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
506 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
507 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
508 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
509 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
510 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
511 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
512 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
513 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
514 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
515 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
516 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
517 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
518 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
519 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
520 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
521 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
522 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
523 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
524 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
525 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
526 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
527 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
528 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
529 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
530 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
531 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
532 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
533 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
534 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
535 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
536 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
537 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
538 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
539 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
540 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
541 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
542 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
543 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
544 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
545 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
546 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
547 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
548 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
549 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
550 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
551 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
552 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
553 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
554 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
555 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
556 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
557 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
558 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
559 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
560 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
561 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
562 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
563 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
564 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
565 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
566 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
567 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
568 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
569 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
570 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
571 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
572 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
573 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
574 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
575 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
576 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
577 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
580 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
582 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
587 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
588 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
589 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
590 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
591 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
592 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
593 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
594 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
595 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
596 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
597 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
598 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
599 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
600 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
601 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
604 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
605 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
606 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
607 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
608 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
609 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
610 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
611 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
612 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
613 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
614 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
615 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
616 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
617 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
618 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
619 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
620 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
621 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
622 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
623 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
624 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
625 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
626 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
627 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
628 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
629 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
630 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
631 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
632 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
633 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
634 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
635 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
636 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
637 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
638 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
639 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
640 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
641 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
642 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
643 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
644 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
645 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
646 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
647 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
648 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
649 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
650 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
651 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
652 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
653 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
654 8005382845 Rhizobium sp. R634 Isolate Nodule
655 8005395548 Rhizobium sp. R339 Isolate Nodule
656 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
657 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
658 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
659 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.58
Metatranscriptomes 0.15
Isolates 8.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 6.75
Rhizoplane 4.07
Rhizosphere 80.39
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3421311 2162886007 Bacteria 1335
2 2214772983 2209111006 Bacteria 12374
3 ARcpr5oldR_c000140 3300000041 Bacteria 12413
4 ARcpr5oldR_c007944 3300000041 Bacteria 900
5 ARSoilYngRDRAFT_c00234 3300000042 Bacteria 8859
6 ARSoilOldRDRAFT_c000126 3300000044 Bacteria 13655
7 ARCol0oldRDRAFT_c00368 3300000045 Bacteria 4373
8 ARCol0yngRDRAFT_1001388 3300000652 Bacteria 1988
9 JGI24752J21851_1002485 3300001976 Bacteria 2455
10 JGI24739J22299_10014140 3300001989 Bacteria 2905
11 JGI24737J22298_10000960 3300001990 Bacteria 10240
12 JGI24737J22298_10007118 3300001990 Bacteria 3790
13 JGI24745J21846_1000099 3300002073 Bacteria 6492
14 JGI24738J21930_10000223 3300002075 Bacteria 15332
15 JGI24034J26672_10000557 3300002239 Bacteria 4762
16 JGI24742J22300_10000264 3300002244 Bacteria 7810
17 JGI24751J29686_10014205 3300002459 Bacteria 1644
18 JGI25156J39149_1007168 3300002705 Bacteria 2962
19 JGI25162J39368_1000996 3300002737 Bacteria 17861
20 JGI25157J39369_1002448 3300002741 Bacteria 4619
21 JGI25152J39213_1003754 3300002773 Bacteria 5065
22 JGI25151J46595_10011807 3300003187 Bacteria 4001
23 JGI25151J46595_10044197 3300003187 Bacteria 1585
24 JGI25165J46597_1000052 3300003214 Bacteria 236064
25 JGI25165J46597_1000819 3300003214 Bacteria 23374
26 JGI25165J46597_1001228 3300003214 Bacteria 15275
27 rootL2_10099291 3300003322 Bacteria 1779
28 Ga0055536_1004740 3300003781 Bacteria 6836
29 Ga0055536_1008523 3300003781 Bacteria 4394
30 Ga0055534_1000464 3300003784 Bacteria 23141
31 Ga0055528_1005404 3300003790 Bacteria 5956
32 Ga0055531_10001782 3300003794 Bacteria 15294
33 JGI25405J52794_10016886 3300003911 Bacteria 1445
34 Ga0065704_10074561 3300005289 Bacteria 6184
35 Ga0065712_10070835 3300005290 Bacteria 5657
36 Ga0065712_10074294 3300005290 Bacteria 4134
37 Ga0065715_10003522 3300005293 Bacteria 3983
38 Ga0070658_10007004 3300005327 Bacteria 9104
39 Ga0070658_10038546 3300005327 Bacteria 3853
40 Ga0070658_10068898 3300005327 Bacteria 2893
41 Ga0070658_10073399 3300005327 Bacteria 2805
42 Ga0070658_10121287 3300005327 Bacteria 2172
43 Ga0070676_10000012 3300005328 Bacteria 58061
44 Ga0070676_10103970 3300005328 Bacteria 1759
45 Ga0070676_10275987 3300005328 Bacteria 1131
46 Ga0070683_100000139 3300005329 Bacteria 46987
47 Ga0070683_100028063 3300005329 Bacteria 5084
48 Ga0070690_100005164 3300005330 Bacteria 7309
49 Ga0070690_100005412 3300005330 Bacteria 7168
50 Ga0070670_100028821 3300005331 Bacteria 4779
51 Ga0070670_100103508 3300005331 Bacteria 2452
52 Ga0070670_100158033 3300005331 Bacteria 1964
53 Ga0070670_100321229 3300005331 Bacteria 1356
54 Ga0070677_10000125 3300005333 Bacteria 25491
55 Ga0070677_10010258 3300005333 Bacteria 3200
56 Ga0068869_100000605 3300005334 Bacteria 20215
57 Ga0068869_100087083 3300005334 Bacteria 2343
58 Ga0070666_10017025 3300005335 Bacteria 4656
59 Ga0070666_10030551 3300005335 Bacteria 3550
60 Ga0070680_100000179 3300005336 Bacteria 40975
61 Ga0070680_100004099 3300005336 Bacteria 10914
62 Ga0070680_100014505 3300005336 Bacteria 6165
63 Ga0070680_100099250 3300005336 Bacteria 2416
64 Ga0070680_100117098 3300005336 Bacteria 2221
65 Ga0070680_100264523 3300005336 Bacteria 1455
66 Ga0070680_100378803 3300005336 Bacteria 1204
67 Ga0070682_100000319 3300005337 Bacteria 33197
68 Ga0070682_100016170 3300005337 Bacteria 4335
69 Ga0068868_100000593 3300005338 Bacteria 24375
70 Ga0068868_100060491 3300005338 Bacteria 2999
71 Ga0070660_100001605 3300005339 Bacteria 15534
72 Ga0070660_100004143 3300005339 Bacteria 10011
73 Ga0070660_100143095 3300005339 Bacteria 1920
74 Ga0070660_100227297 3300005339 Bacteria 1518
75 Ga0070689_100004685 3300005340 Bacteria 9267
76 Ga0070689_100062016 3300005340 Bacteria 2908
77 Ga0070689_100341791 3300005340 Bacteria 1253
78 Ga0070691_10001565 3300005341 Bacteria 9871
79 Ga0070691_10010361 3300005341 Bacteria 4252
80 Ga0070687_100003572 3300005343 Bacteria 6061
81 Ga0070661_100001455 3300005344 Bacteria 16432
82 Ga0070661_100130814 3300005344 Bacteria 1885
83 Ga0070661_100153007 3300005344 Bacteria 1744
84 Ga0070661_100171662 3300005344 Bacteria 1647
85 Ga0070692_10000434 3300005345 Bacteria 12695
86 Ga0070692_10002195 3300005345 Bacteria 7472
87 Ga0070668_100004423 3300005347 Bacteria 10433
88 Ga0070668_100535252 3300005347 Bacteria 1018
89 Ga0070669_100000409 3300005353 Bacteria 32911
90 Ga0070675_100000166 3300005354 Bacteria 40573
91 Ga0070675_100043171 3300005354 Bacteria 3684
92 Ga0070675_100053571 3300005354 Bacteria 3318
93 Ga0070675_100246730 3300005354 Bacteria 1561
94 Ga0070671_100005938 3300005355 Bacteria 9730
95 Ga0070671_100006280 3300005355 Bacteria 9470
96 Ga0070671_100094656 3300005355 Bacteria 2504
97 Ga0070671_100197434 3300005355 Bacteria 1706
98 Ga0070671_100231824 3300005355 Bacteria 1567
99 Ga0070674_100000644 3300005356 Bacteria 17586
100 Ga0070674_100012815 3300005356 Bacteria 5160
101 Ga0070674_100029715 3300005356 Bacteria 3605
102 Ga0070674_100317081 3300005356 Bacteria 1249
103 Ga0070673_100000041 3300005364 Bacteria 54096
104 Ga0070673_100057607 3300005364 Bacteria 3070
105 Ga0070673_100058559 3300005364 Bacteria 3046
106 Ga0070688_100000180 3300005365 Bacteria 33887
107 Ga0070688_100011831 3300005365 Bacteria 4866
108 Ga0070688_100049523 3300005365 Bacteria 2615
109 Ga0070659_100000752 3300005366 Bacteria 23551
110 Ga0070659_100007504 3300005366 Bacteria 7924
111 Ga0070659_100107888 3300005366 Bacteria 2246
112 Ga0070667_100000365 3300005367 Bacteria 49335
113 Ga0070667_100209204 3300005367 Bacteria 1733
114 Ga0070667_100515964 3300005367 Bacteria 1096
115 Ga0070703_10003914 3300005406 Bacteria 4219
116 Ga0070703_10012992 3300005406 Bacteria 2360
117 Ga0070709_10003137 3300005434 Bacteria 8867
118 Ga0070709_10019500 3300005434 Bacteria 3922
119 Ga0070709_10236320 3300005434 Bacteria 1310
120 Ga0070709_10304704 3300005434 Bacteria 1164
121 Ga0070714_100045790 3300005435 Bacteria 3709
122 Ga0070714_100098674 3300005435 Bacteria 2570
123 Ga0070714_100110282 3300005435 Bacteria 2436
124 Ga0070713_100034352 3300005436 Bacteria 4072
125 Ga0070710_10005022 3300005437 Bacteria 6261
126 Ga0070710_10044400 3300005437 Bacteria 2466
127 Ga0070701_10000493 3300005438 Bacteria 13517
128 Ga0070701_10012908 3300005438 Bacteria 3784
129 Ga0070701_10133855 3300005438 Unclassified 1411
130 Ga0070701_10411171 3300005438 Bacteria 860
131 Ga0070711_100015744 3300005439 Bacteria 4789
132 Ga0070711_100030851 3300005439 Bacteria 3553
133 Ga0070711_100054801 3300005439 Bacteria 2753
134 Ga0070705_100002314 3300005440 Bacteria 9618
135 Ga0070705_100148366 3300005440 Bacteria 1553
136 Ga0070700_100000467 3300005441 Bacteria 20231
137 Ga0070694_100000065 3300005444 Bacteria 49515
138 Ga0070694_100029375 3300005444 Bacteria 3587
139 Ga0070694_100116812 3300005444 Bacteria 1909
140 Ga0070708_100113795 3300005445 Bacteria 2489
141 Ga0070708_100267667 3300005445 Bacteria 1607
142 Ga0070663_100000473 3300005455 Bacteria 21137
143 Ga0070663_100019373 3300005455 Bacteria 4483
144 Ga0070663_100054747 3300005455 Bacteria 2853
145 Ga0070678_100000091 3300005456 Bacteria 34559
146 Ga0070678_100007141 3300005456 Bacteria 6603
147 Ga0070678_100018286 3300005456 Bacteria 4542
148 Ga0070678_100034927 3300005456 Bacteria 3505
149 Ga0070678_100479335 3300005456 Bacteria 1094
150 Ga0070662_100006535 3300005457 Bacteria 7521
151 Ga0070662_100043231 3300005457 Bacteria 3222
152 Ga0070662_100128907 3300005457 Bacteria 1948
153 Ga0070662_100165636 3300005457 Bacteria 1732
154 Ga0070681_10010003 3300005458 Bacteria 9350
155 Ga0070681_10092484 3300005458 Bacteria 2973
156 Ga0070681_10092722 3300005458 Bacteria 2969
157 Ga0068867_100000859 3300005459 Bacteria 20487
158 Ga0068867_100017280 3300005459 Bacteria 5123
159 Ga0068867_100349822 3300005459 Bacteria 1233
160 Ga0068867_100489759 3300005459 Bacteria 1055
161 Ga0070685_10001731 3300005466 Bacteria 11442
162 Ga0070685_10015115 3300005466 Bacteria 4096
163 Ga0070685_10041755 3300005466 Bacteria 2615
164 Ga0074259_12095147 3300005507 Bacteria 2029
165 Ga0070679_100006957 3300005530 Bacteria 10555
166 Ga0070679_100009091 3300005530 Bacteria 9377
167 Ga0070679_100012754 3300005530 Bacteria 8038
168 Ga0070679_100097400 3300005530 Bacteria 2929
169 Ga0070679_100236656 3300005530 Bacteria 1785
170 Ga0070679_100265204 3300005530 Bacteria 1672
171 Ga0070679_100784827 3300005530 Bacteria 896
172 Ga0070684_100000219 3300005535 Bacteria 39995
173 Ga0070684_100228069 3300005535 Bacteria 1700
174 Ga0070697_100534991 3300005536 Bacteria 1027
175 Ga0068853_100000600 3300005539 Bacteria 24713
176 Ga0068853_100005223 3300005539 Bacteria 10160
177 Ga0068853_100185112 3300005539 Bacteria 1890
178 Ga0068853_100232654 3300005539 Bacteria 1686
179 Ga0070672_100000019 3300005543 Bacteria 69855
180 Ga0070672_100065787 3300005543 Bacteria 2868
181 Ga0070672_100108041 3300005543 Bacteria 2265
182 Ga0070672_100625671 3300005543 Unclassified 939
183 Ga0070686_100007875 3300005544 Bacteria 5955
184 Ga0070686_100032042 3300005544 Unclassified 3220
185 Ga0070686_100100051 3300005544 Bacteria 1957
186 Ga0070695_100000474 3300005545 Bacteria 20848
187 Ga0070696_100003100 3300005546 Bacteria 11055
188 Ga0070696_100078891 3300005546 Bacteria 2329
189 Ga0070693_100001868 3300005547 Bacteria 9623
190 Ga0070693_100096721 3300005547 Bacteria 1790
191 Ga0070693_100291868 3300005547 Bacteria 1096
192 Ga0070665_100010015 3300005548 Bacteria 9588
193 Ga0070665_100138556 3300005548 Bacteria 2436
194 Ga0070665_100322171 3300005548 Bacteria 1550
195 Ga0070704_100000252 3300005549 Bacteria 23218
196 Ga0070704_100001606 3300005549 Bacteria 12238
197 Ga0068855_100018421 3300005563 Bacteria 8389
198 Ga0068855_100019721 3300005563 Bacteria 8099
199 Ga0068855_100094398 3300005563 Bacteria 3449
200 Ga0068855_100136866 3300005563 Bacteria 2794
201 Ga0068855_100263165 3300005563 Bacteria 1920
202 Ga0070664_100000819 3300005564 Bacteria 23927
203 Ga0070664_100022255 3300005564 Bacteria 5227
204 Ga0070664_100106972 3300005564 Bacteria 2438
205 Ga0070664_100183771 3300005564 Bacteria 1860
206 Ga0068857_100000768 3300005577 Bacteria 23872
207 Ga0068857_100016644 3300005577 Bacteria 6441
208 Ga0068857_100281877 3300005577 Bacteria 1529
209 Ga0068857_100336134 3300005577 Bacteria 1397
210 Ga0068857_100351722 3300005577 Bacteria 1364
211 Ga0068854_100001736 3300005578 Bacteria 13299
212 Ga0068854_100080315 3300005578 Bacteria 2406
213 Ga0068854_100112791 3300005578 Bacteria 2053
214 Ga0068854_100169225 3300005578 Bacteria 1699
215 Ga0068856_100002295 3300005614 Bacteria 19718
216 Ga0068856_100035175 3300005614 Bacteria 4908
217 Ga0068856_100110986 3300005614 Bacteria 2739
218 Ga0068856_100144924 3300005614 Bacteria 2383
219 Ga0068856_100747445 3300005614 Bacteria 998
220 Ga0070702_100000898 3300005615 Bacteria 11591
221 Ga0070702_100050904 3300005615 Bacteria 2368
222 Ga0068852_100001992 3300005616 Bacteria 13920
223 Ga0068852_100118580 3300005616 Bacteria 2418
224 Ga0068852_100230669 3300005616 Bacteria 1764
225 Ga0068859_100389314 3300005617 Unclassified 1490
226 Ga0068864_100029150 3300005618 Bacteria 4670
227 Ga0068864_100279994 3300005618 Bacteria 1556
228 Ga0068866_10001028 3300005718 Bacteria 12272
229 Ga0068861_100000169 3300005719 Bacteria 34559
230 Ga0068861_100660716 3300005719 Bacteria 967
231 Ga0068851_10038538 3300005834 Bacteria 2398
232 Ga0068870_10000586 3300005840 Bacteria 13817
233 Ga0068863_100000381 3300005841 Bacteria 45003
234 Ga0068863_100198046 3300005841 Bacteria 1931
235 Ga0068863_100396538 3300005841 Bacteria 1349
236 Ga0068858_100009197 3300005842 Bacteria 9441
237 Ga0068858_100348350 3300005842 Bacteria 1419
238 Ga0068860_100001472 3300005843 Bacteria 25432
239 Ga0068860_100081520 3300005843 Bacteria 3077
240 Ga0068862_100001886 3300005844 Bacteria 19006
241 Ga0068862_100065508 3300005844 Bacteria 3129
242 Ga0081455_10000036 3300005937 Bacteria 136303
243 Ga0081455_10012017 3300005937 Bacteria 8664
244 Ga0081455_10056729 3300005937 Bacteria 3324
245 Ga0081540_1011095 3300005983 Bacteria 6048
246 Ga0081540_1050829 3300005983 Bacteria 2054
247 Ga0070717_10000199 3300006028 Bacteria 41940
248 Ga0070717_10616900 3300006028 Bacteria 984
249 Ga0075365_10062820 3300006038 Bacteria 2485
250 Ga0075365_10101999 3300006038 Bacteria 1966
251 Ga0075365_10304165 3300006038 Bacteria 1122
252 Ga0075363_100001113 3300006048 Bacteria 9759
253 Ga0075363_100096961 3300006048 Bacteria 1629
254 Ga0075432_10000873 3300006058 Bacteria 9497
255 Ga0075432_10083948 3300006058 Bacteria 1158
256 Ga0070715_10049118 3300006163 Bacteria 1807
257 Ga0070716_100002448 3300006173 Bacteria 8559
258 Ga0070712_100120706 3300006175 Bacteria 1972
259 Ga0075362_10000122 3300006177 Bacteria 21744
260 Ga0075367_10004445 3300006178 Bacteria 6850
261 Ga0075367_10034749 3300006178 Bacteria 2914
262 Ga0075369_10205047 3300006186 Bacteria 910
263 Ga0075366_10019342 3300006195 Bacteria 3939
264 Ga0075366_10128560 3300006195 Bacteria 1528
265 Ga0097621_100001234 3300006237 Bacteria 17707
266 Ga0097621_100036113 3300006237 Bacteria 3952
267 Ga0097621_100176973 3300006237 Bacteria 1842
268 Ga0068871_100000068 3300006358 Bacteria 57531
269 Ga0068871_100012500 3300006358 Bacteria 6262
270 Ga0068871_100025352 3300006358 Bacteria 4612
271 Ga0068871_100232041 3300006358 Bacteria 1602
272 Ga0075428_100035558 3300006844 Bacteria 5491
273 Ga0075430_100004696 3300006846 Bacteria 11490
274 Ga0075431_100006639 3300006847 Bacteria 11490
275 Ga0075433_10001599 3300006852 Bacteria 16784
276 Ga0075433_10099038 3300006852 Bacteria 2581
277 Ga0075434_100000576 3300006871 Bacteria 28251
278 Ga0075434_100001666 3300006871 Bacteria 18944
279 Ga0075434_100113294 3300006871 Bacteria 2724
280 Ga0075429_100060828 3300006880 Bacteria 3289
281 Ga0068865_100005133 3300006881 Bacteria 7927
282 Ga0075436_100070922 3300006914 Bacteria 2409
283 Ga0075436_100238776 3300006914 Bacteria 1292
284 Ga0097620_100389303 3300006931 Unclassified 1490
285 Ga0075435_100002716 3300007076 Bacteria 11816
286 Ga0075435_100010036 3300007076 Bacteria 6904
287 Ga0105251_10030580 3300009011 Bacteria 2702
288 Ga0105244_10159346 3300009036 Bacteria 1078
289 Ga0105250_10061706 3300009092 Bacteria 1508
290 Ga0105240_10014101 3300009093 Bacteria 10923
291 Ga0105240_10068510 3300009093 Bacteria 4394
292 Ga0111539_10000082 3300009094 Bacteria 96811
293 Ga0111539_10000503 3300009094 Bacteria 49808
294 Ga0111539_10003417 3300009094 Bacteria 20918
295 Ga0111539_10315126 3300009094 Bacteria 1820
296 Ga0105245_10000780 3300009098 Bacteria 28901
297 Ga0105245_10091423 3300009098 Bacteria 2801
298 Ga0105245_10113448 3300009098 Bacteria 2523
299 Ga0105247_10002726 3300009101 Bacteria 11844
300 Ga0105247_10029759 3300009101 Bacteria 3310
301 Ga0105247_10078113 3300009101 Bacteria 2081
302 Ga0105247_10095825 3300009101 Bacteria 1890
303 Ga0114129_10009008 3300009147 Bacteria 14232
304 Ga0114129_10013874 3300009147 Bacteria 11481
305 Ga0105243_10001083 3300009148 Bacteria 24917
306 Ga0105243_10032306 3300009148 Bacteria 4043
307 Ga0105243_10033088 3300009148 Bacteria 3996
308 Ga0105243_10096320 3300009148 Bacteria 2448
309 Ga0105243_10481400 3300009148 Bacteria 1171
310 Ga0105241_10000760 3300009174 Bacteria 24503
311 Ga0105241_10072064 3300009174 Bacteria 2684
312 Ga0105241_10095627 3300009174 Bacteria 2352
313 Ga0105241_10432246 3300009174 Bacteria 1161
314 Ga0105241_10678471 3300009174 Bacteria 938
315 Ga0105242_10019812 3300009176 Bacteria 5270
316 Ga0105242_10230382 3300009176 Bacteria 1660
317 Ga0105248_10011305 3300009177 Bacteria 9844
318 Ga0105248_10021002 3300009177 Bacteria 7235
319 Ga0105248_10031416 3300009177 Bacteria 5936
320 Ga0105248_10167723 3300009177 Bacteria 2475
321 Ga0105248_10429777 3300009177 Bacteria 1487
322 Ga0105237_10006171 3300009545 Bacteria 13387
323 Ga0105237_10024205 3300009545 Bacteria 6213
324 Ga0105237_10038056 3300009545 Bacteria 4859
325 Ga0105238_10013907 3300009551 Bacteria 8139
326 Ga0105238_10019606 3300009551 Bacteria 6886
327 Ga0105238_10021283 3300009551 Bacteria 6609
328 Ga0105238_10024469 3300009551 Bacteria 6153
329 Ga0105238_10036872 3300009551 Bacteria 4972
330 Ga0105238_10074611 3300009551 Bacteria 3384
331 Ga0105238_10632641 3300009551 Bacteria 1079
332 Ga0105249_10002196 3300009553 Bacteria 16907
333 Ga0105249_10007626 3300009553 Bacteria 9439
334 Ga0105249_10028272 3300009553 Bacteria 5062
335 Ga0105249_10134000 3300009553 Bacteria 2369
336 Ga0105249_10142930 3300009553 Bacteria 2296
337 Ga0105249_10143026 3300009553 Bacteria 2296
338 Ga0123342_1007031 3300009766 Bacteria 15168
339 Ga0105239_10002791 3300010375 Bacteria 21868
340 Ga0105239_10047454 3300010375 Bacteria 4707
341 Ga0105239_10060085 3300010375 Bacteria 4171
342 Ga0105239_10222845 3300010375 Bacteria 2115
343 Ga0105246_10001585 3300011119 Bacteria 13535
344 Ga0105246_10009274 3300011119 Bacteria 6058
345 Ga0105246_10096520 3300011119 Bacteria 2143
346 Ga0105246_10113686 3300011119 Bacteria 1993
347 Ga0157373_10001948 3300013100 Bacteria 15667
348 Ga0157373_10006240 3300013100 Bacteria 8908
349 Ga0157371_10085248 3300013102 Bacteria 2238
350 Ga0157371_10085742 3300013102 Bacteria 2231
351 Ga0157371_10443528 3300013102 Bacteria 954
352 Ga0157370_10092033 3300013104 Bacteria 2846
353 Ga0157370_10103800 3300013104 Bacteria 2660
354 Ga0157370_10344776 3300013104 Bacteria 1373
355 Ga0157370_10649341 3300013104 Bacteria 964
356 Ga0157369_10269257 3300013105 Bacteria 1775
357 Ga0157369_10959270 3300013105 Bacteria 876
358 Ga0157374_10001691 3300013296 Bacteria 18474
359 Ga0157374_10141327 3300013296 Bacteria 2337
360 Ga0157378_10001445 3300013297 Bacteria 21386
361 Ga0157378_10052925 3300013297 Bacteria 3612
362 Ga0157378_10127916 3300013297 Bacteria 2348
363 Ga0163162_10000790 3300013306 Bacteria 29412
364 Ga0163162_10018394 3300013306 Bacteria 6847
365 Ga0163162_10093404 3300013306 Bacteria 3093
366 Ga0163162_10134911 3300013306 Bacteria 2579
367 Ga0163162_10327920 3300013306 Unclassified 1663
368 Ga0163162_10756418 3300013306 Bacteria 1091
369 Ga0157372_10009037 3300013307 Bacteria 10590
370 Ga0157372_10023483 3300013307 Bacteria 6685
371 Ga0157372_10232691 3300013307 Bacteria 2136
372 Ga0157372_10515578 3300013307 Bacteria 1394
373 Ga0157372_11143932 3300013307 Unclassified 900
374 Ga0157375_10000468 3300013308 Bacteria 36848
375 Ga0157375_10078898 3300013308 Bacteria 3327
376 Ga0163163_10003322 3300014325 Bacteria 13641
377 Ga0163163_10020189 3300014325 Bacteria 6270
378 Ga0163163_10032174 3300014325 Bacteria 5066
379 Ga0163163_10134668 3300014325 Bacteria 2511
380 Ga0163163_10148371 3300014325 Bacteria 2389
381 Ga0157380_10002913 3300014326 Bacteria 11638
382 Ga0157380_10009719 3300014326 Bacteria 6903
383 Ga0157380_10630896 3300014326 Bacteria 1065
384 Ga0157377_10000276 3300014745 Bacteria 24762
385 Ga0157379_10002285 3300014968 Bacteria 15975
386 Ga0157379_10063216 3300014968 Bacteria 3310
387 Ga0157379_10110590 3300014968 Bacteria 2467
388 Ga0157379_10147615 3300014968 Bacteria 2121
389 Ga0157379_10147731 3300014968 Bacteria 2120
390 Ga0157376_10000692 3300014969 Bacteria 21811
391 Ga0157376_10153359 3300014969 Unclassified 2080
392 Ga0163161_10000384 3300017792 Bacteria 37040
393 Ga0163161_10047076 3300017792 Bacteria 3114
394 Ga0163161_10362314 3300017792 Unclassified 1155
395 Ga0206356_10010133 3300020070 Bacteria 1965
396 Ga0206353_11031164 3300020082 Bacteria 1360
397 Ga0209437_100057 3300025233 Bacteria 362922
398 Ga0209026_1000032 3300025250 Bacteria 322378
399 Ga0209759_1000142 3300025256 Bacteria 124090
400 Ga0209129_1000118 3300025258 Bacteria 139972
401 Ga0209233_1000118 3300025261 Bacteria 236172
402 Ga0209233_1000134 3300025261 Bacteria 202535
403 Ga0207666_1000097 3300025271 Bacteria 13853
404 Ga0209673_1000033 3300025273 Bacteria 335369
405 Ga0209130_1001541 3300025284 Bacteria 14695
406 Ga0209130_1025592 3300025284 Bacteria 1276
407 Ga0207673_1000201 3300025290 Bacteria 5994
408 Ga0209675_1002318 3300025291 Bacteria 9845
409 Ga0209676_1011115 3300025292 Bacteria 3667
410 Ga0209676_1013366 3300025292 Bacteria 3161
411 Ga0209025_1000617 3300025294 Bacteria 63860
412 Ga0209025_1041288 3300025294 Bacteria 1978
413 Ga0209564_1012515 3300025295 Bacteria 3692
414 Ga0209758_1040778 3300025297 Bacteria 1746
415 Ga0209050_1037713 3300025298 Bacteria 1389
416 Ga0209256_1007611 3300025299 Bacteria 5281
417 Ga0209051_1001617 3300025303 Bacteria 18379
418 Ga0209051_1007087 3300025303 Bacteria 6199
419 Ga0209257_1002499 3300025304 Bacteria 18154
420 Ga0209257_1021446 3300025304 Bacteria 2345
421 Ga0207697_10000550 3300025315 Bacteria 21243
422 Ga0207697_10013264 3300025315 Bacteria 3440
423 Ga0207656_10262794 3300025321 Bacteria 848
424 Ga0207653_10010851 3300025885 Bacteria 2843
425 Ga0207653_10018054 3300025885 Bacteria 2223
426 Ga0207682_10000088 3300025893 Bacteria 41732
427 Ga0207682_10000521 3300025893 Bacteria 17673
428 Ga0207692_10000876 3300025898 Bacteria 10871
429 Ga0207692_10001966 3300025898 Bacteria 7840
430 Ga0207692_10271610 3300025898 Unclassified 1023
431 Ga0207642_10000381 3300025899 Bacteria 13280
432 Ga0207710_10001324 3300025900 Bacteria 12473
433 Ga0207710_10001609 3300025900 Bacteria 11050
434 Ga0207710_10032716 3300025900 Bacteria 2278
435 Ga0207710_10142784 3300025900 Bacteria 1157
436 Ga0207688_10001203 3300025901 Bacteria 13390
437 Ga0207688_10021688 3300025901 Bacteria 3513
438 Ga0207688_10059462 3300025901 Bacteria 2153
439 Ga0207680_10009047 3300025903 Bacteria 4921
440 Ga0207680_10151416 3300025903 Bacteria 1547
441 Ga0207680_10223472 3300025903 Bacteria 1292
442 Ga0207647_10002714 3300025904 Bacteria 13370
443 Ga0207699_10002088 3300025906 Bacteria 9440
444 Ga0207645_10000140 3300025907 Bacteria 55845
445 Ga0207645_10035558 3300025907 Bacteria 3198
446 Ga0207645_10069729 3300025907 Bacteria 2249
447 Ga0207643_10000083 3300025908 Bacteria 62116
448 Ga0207643_10016129 3300025908 Bacteria 4072
449 Ga0207705_10008972 3300025909 Bacteria 7285
450 Ga0207705_10049472 3300025909 Bacteria 3025
451 Ga0207705_10098196 3300025909 Bacteria 2151
452 Ga0207684_10423987 3300025910 Bacteria 1143
453 Ga0207654_10002699 3300025911 Bacteria 9011
454 Ga0207654_10025064 3300025911 Bacteria 3213
455 Ga0207707_10001464 3300025912 Bacteria 21829
456 Ga0207707_10020854 3300025912 Bacteria 5724
457 Ga0207707_10122457 3300025912 Bacteria 2274
458 Ga0207707_10226903 3300025912 Bacteria 1625
459 Ga0207707_10271360 3300025912 Bacteria 1470
460 Ga0207695_10390519 3300025913 Bacteria 1276
461 Ga0207671_10004533 3300025914 Bacteria 13203
462 Ga0207671_10063500 3300025914 Bacteria 2744
463 Ga0207671_10138535 3300025914 Bacteria 1873
464 Ga0207693_10007304 3300025915 Bacteria 9091
465 Ga0207693_10021626 3300025915 Bacteria 5112
466 Ga0207663_10021132 3300025916 Bacteria 3700
467 Ga0207663_10113170 3300025916 Bacteria 1845
468 Ga0207663_10126218 3300025916 Unclassified 1760
469 Ga0207663_10232610 3300025916 Bacteria 1347
470 Ga0207660_10000073 3300025917 Bacteria 51871
471 Ga0207660_10006940 3300025917 Bacteria 7334
472 Ga0207660_10346099 3300025917 Bacteria 1191
473 Ga0207662_10000964 3300025918 Bacteria 13368
474 Ga0207662_10019591 3300025918 Bacteria 3853
475 Ga0207662_10037630 3300025918 Bacteria 2832
476 Ga0207657_10005395 3300025919 Bacteria 13362
477 Ga0207657_10007647 3300025919 Bacteria 11057
478 Ga0207657_10020125 3300025919 Bacteria 6315
479 Ga0207657_10068436 3300025919 Bacteria 3016
480 Ga0207657_10072526 3300025919 Bacteria 2913
481 Ga0207657_10077205 3300025919 Bacteria 2808
482 Ga0207649_10000450 3300025920 Bacteria 29604
483 Ga0207649_10020627 3300025920 Bacteria 3781
484 Ga0207649_10026888 3300025920 Bacteria 3371
485 Ga0207649_10101143 3300025920 Bacteria 1908
486 Ga0207649_10163391 3300025920 Bacteria 1545
487 Ga0207649_10368929 3300025920 Bacteria 1067
488 Ga0207652_10008726 3300025921 Bacteria 8158
489 Ga0207652_10016838 3300025921 Bacteria 5974
490 Ga0207652_10028066 3300025921 Bacteria 4693
491 Ga0207652_10075123 3300025921 Bacteria 2944
492 Ga0207652_10157189 3300025921 Bacteria 2037
493 Ga0207652_10595059 3300025921 Bacteria 992
494 Ga0207646_10296809 3300025922 Bacteria 1460
495 Ga0207681_10000097 3300025923 Bacteria 73836
496 Ga0207681_10065126 3300025923 Bacteria 2518
497 Ga0207694_10011454 3300025924 Bacteria 6692
498 Ga0207694_10024241 3300025924 Bacteria 4606
499 Ga0207694_10059954 3300025924 Bacteria 2961
500 Ga0207694_10059980 3300025924 Bacteria 2960
501 Ga0207694_10159147 3300025924 Bacteria 1823
502 Ga0207659_10000092 3300025926 Bacteria 52642
503 Ga0207659_10045065 3300025926 Bacteria 3107
504 Ga0207659_10066522 3300025926 Bacteria 2616
505 Ga0207687_10000219 3300025927 Bacteria 38995
506 Ga0207687_10027744 3300025927 Bacteria 3801
507 Ga0207687_10029871 3300025927 Bacteria 3669
508 Ga0207700_10002485 3300025928 Bacteria 10567
509 Ga0207700_10064607 3300025928 Bacteria 2788
510 Ga0207700_10115487 3300025928 Bacteria 2168
511 Ga0207664_10005574 3300025929 Bacteria 8618
512 Ga0207664_10060581 3300025929 Bacteria 3017
513 Ga0207664_10430438 3300025929 Bacteria 1176
514 Ga0207664_10484029 3300025929 Bacteria 1107
515 Ga0207644_10005083 3300025931 Bacteria 8591
516 Ga0207644_10007663 3300025931 Bacteria 7040
517 Ga0207644_10079676 3300025931 Bacteria 2417
518 Ga0207690_10003312 3300025932 Bacteria 9636
519 Ga0207706_10004310 3300025933 Bacteria 13370
520 Ga0207706_10008823 3300025933 Bacteria 9280
521 Ga0207706_10035694 3300025933 Bacteria 4419
522 Ga0207706_10256446 3300025933 Bacteria 1527
523 Ga0207686_10000796 3300025934 Bacteria 19364
524 Ga0207686_10007990 3300025934 Bacteria 5703
525 Ga0207686_10062208 3300025934 Bacteria 2369
526 Ga0207686_10449951 3300025934 Bacteria 990
527 Ga0207709_10000362 3300025935 Bacteria 45886
528 Ga0207709_10220374 3300025935 Bacteria 1368
529 Ga0207670_10002375 3300025936 Bacteria 9862
530 Ga0207669_10000350 3300025937 Bacteria 20966
531 Ga0207669_10041720 3300025937 Bacteria 2673
532 Ga0207669_10055748 3300025937 Bacteria 2395
533 Ga0207669_10165114 3300025937 Bacteria 1569
534 Ga0207704_10000479 3300025938 Bacteria 17812
535 Ga0207704_10098385 3300025938 Bacteria 1943
536 Ga0207704_10112038 3300025938 Bacteria 1847
537 Ga0207704_10317554 3300025938 Unclassified 1200
538 Ga0207665_10001702 3300025939 Bacteria 14793
539 Ga0207665_10089990 3300025939 Unclassified 2126
540 Ga0207665_10491370 3300025939 Bacteria 947
541 Ga0207691_10000283 3300025940 Bacteria 50040
542 Ga0207691_10070775 3300025940 Bacteria 3149
543 Ga0207691_10129322 3300025940 Bacteria 2232
544 Ga0207691_10509947 3300025940 Unclassified 1021
545 Ga0207711_10005310 3300025941 Bacteria 10924
546 Ga0207711_10009170 3300025941 Bacteria 8267
547 Ga0207711_10009675 3300025941 Bacteria 8032
548 Ga0207711_10471013 3300025941 Bacteria 1170
549 Ga0207689_10000085 3300025942 Bacteria 75467
550 Ga0207661_10000464 3300025944 Bacteria 26194
551 Ga0207661_10272418 3300025944 Bacteria 1511
552 Ga0207661_10495672 3300025944 Unclassified 1116
553 Ga0207661_10595864 3300025944 Bacteria 1014
554 Ga0207679_10000030 3300025945 Bacteria 169351
555 Ga0207679_10095656 3300025945 Bacteria 2309
556 Ga0207679_10414830 3300025945 Bacteria 1187
557 Ga0207679_10441453 3300025945 Bacteria 1152
558 Ga0207667_10021184 3300025949 Bacteria 7208
559 Ga0207667_10024372 3300025949 Bacteria 6643
560 Ga0207667_10047002 3300025949 Bacteria 4570
561 Ga0207667_10105591 3300025949 Bacteria 2906
562 Ga0207667_10106876 3300025949 Bacteria 2887
563 Ga0207667_10339117 3300025949 Bacteria 1534
564 Ga0207651_10000422 3300025960 Bacteria 18024
565 Ga0207651_10039537 3300025960 Bacteria 3111
566 Ga0207651_10114169 3300025960 Bacteria 2034
567 Ga0207651_10116032 3300025960 Bacteria 2020
568 Ga0207651_10327355 3300025960 Unclassified 1283
569 Ga0207712_10004682 3300025961 Bacteria 8649
570 Ga0207712_10024382 3300025961 Bacteria 4004
571 Ga0207712_10346974 3300025961 Bacteria 1233
572 Ga0207668_10000114 3300025972 Bacteria 57323
573 Ga0207668_10035290 3300025972 Bacteria 3328
574 Ga0207668_10303789 3300025972 Bacteria 1318
575 Ga0207668_10550177 3300025972 Bacteria 1000
576 Ga0207640_10000141 3300025981 Bacteria 52638
577 Ga0207640_10035965 3300025981 Bacteria 3104
578 Ga0207640_10096880 3300025981 Bacteria 2058
579 Ga0207658_10155178 3300025986 Bacteria 1870
580 Ga0207658_10494495 3300025986 Bacteria 1089
581 Ga0207658_10782989 3300025986 Bacteria 865
582 Ga0207677_10001776 3300026023 Bacteria 11384
583 Ga0207677_10021038 3300026023 Bacteria 3977
584 Ga0207703_10000983 3300026035 Bacteria 27443
585 Ga0207703_10043709 3300026035 Bacteria 3597
586 Ga0207639_10000305 3300026041 Bacteria 34869
587 Ga0207639_10097689 3300026041 Bacteria 2366
588 Ga0207639_10165221 3300026041 Bacteria 1869
589 Ga0207639_10341225 3300026041 Bacteria 1335
590 Ga0207678_10000125 3300026067 Bacteria 63817
591 Ga0207678_10026095 3300026067 Bacteria 5097
592 Ga0207678_10032760 3300026067 Bacteria 4529
593 Ga0207678_10197514 3300026067 Unclassified 1719
594 Ga0207678_10500729 3300026067 Bacteria 1059
595 Ga0207708_10000187 3300026075 Bacteria 48792
596 Ga0207708_10014918 3300026075 Bacteria 5818
597 Ga0207708_10099362 3300026075 Bacteria 2251
598 Ga0207702_10005437 3300026078 Bacteria 11146
599 Ga0207702_10054512 3300026078 Bacteria 3388
600 Ga0207702_10058876 3300026078 Bacteria 3270
601 Ga0207702_10128627 3300026078 Bacteria 2276
602 Ga0207702_10324710 3300026078 Bacteria 1467
603 Ga0207702_10496893 3300026078 Bacteria 1189
604 Ga0207702_10720177 3300026078 Unclassified 984
605 Ga0207641_10003649 3300026088 Bacteria 13575
606 Ga0207641_10055119 3300026088 Bacteria 3376
607 Ga0207641_10141916 3300026088 Bacteria 2168
608 Ga0207648_10002168 3300026089 Bacteria 21342
609 Ga0207648_10008536 3300026089 Bacteria 9913
610 Ga0207648_10136180 3300026089 Bacteria 2163
611 Ga0207676_10000074 3300026095 Bacteria 101208
612 Ga0207676_10019580 3300026095 Bacteria 4939
613 Ga0207676_10236705 3300026095 Bacteria 1635
614 Ga0207674_10002501 3300026116 Bacteria 23186
615 Ga0207674_10009631 3300026116 Bacteria 11019
616 Ga0207674_10276142 3300026116 Bacteria 1628
617 Ga0207675_100004556 3300026118 Bacteria 13370
618 Ga0207675_100169240 3300026118 Bacteria 2088
619 Ga0207675_100312265 3300026118 Bacteria 1533
620 Ga0207683_10000014 3300026121 Bacteria 128817
621 Ga0207683_10002066 3300026121 Bacteria 17758
622 Ga0207683_10003999 3300026121 Bacteria 12769
623 Ga0207683_10005254 3300026121 Bacteria 11113
624 Ga0207683_10351552 3300026121 Bacteria 1353
625 Ga0207698_10001242 3300026142 Bacteria 14899
626 Ga0207698_10070852 3300026142 Bacteria 2764
627 Ga0207698_10308641 3300026142 Bacteria 1476
628 Ga0209973_1008250 3300027252 Bacteria 1184
629 Ga0209970_1005489 3300027614 Bacteria 2092
630 Ga0209983_1006800 3300027665 Bacteria 2347
631 Ga0209966_1006091 3300027695 Bacteria 2087
632 Ga0209998_10000361 3300027717 Bacteria 13355
633 Ga0209998_10001516 3300027717 Bacteria 5583
634 Ga0209974_10002250 3300027876 Bacteria 7018
635 Ga0209974_10012895 3300027876 Bacteria 2790
636 Ga0207428_10000114 3300027907 Bacteria 109533
637 Ga0207428_10000467 3300027907 Bacteria 48756
638 Ga0207428_10011322 3300027907 Bacteria 7891
639 Ga0268266_10034656 3300028379 Bacteria 4293
640 Ga0268266_10041670 3300028379 Bacteria 3919
641 Ga0268266_10104379 3300028379 Bacteria 2502
642 Ga0268266_10201484 3300028379 Bacteria 1822
643 Ga0268266_10235503 3300028379 Bacteria 1688
644 Ga0268266_10502461 3300028379 Bacteria 1158
645 Ga0268265_10001371 3300028380 Bacteria 20700
646 Ga0268265_10337188 3300028380 Bacteria 1371
647 Ga0268264_10000469 3300028381 Bacteria 54801
648 Ga0268264_10016375 3300028381 Bacteria 6070
649 Ga0268264_10679750 3300028381 Bacteria 1021
650 Ga0265337_1008317 3300028556 Bacteria 3784
651 Ga0265318_10012048 3300028577 Bacteria 3694
652 Ga0265338_10137794 3300028800 Bacteria 1915
653 Ga0265330_10029569 3300031235 Bacteria 2463
654 Ga0265330_10030972 3300031235 Bacteria 2398
655 Ga0265332_10134827 3300031238 Bacteria 1035
656 Ga0265328_10020279 3300031239 Bacteria 2546
657 Ga0265320_10021158 3300031240 Bacteria 3505
658 Ga0265325_10000423 3300031241 Bacteria 30296
659 Ga0265325_10068734 3300031241 Bacteria 1782
660 Ga0265329_10096506 3300031242 Bacteria 939
661 Ga0265340_10001277 3300031247 Bacteria 14437
662 Ga0265340_10096324 3300031247 Bacteria 1379
663 Ga0265339_10026539 3300031249 Bacteria 3316
664 Ga0265339_10099784 3300031249 Bacteria 1513
665 Ga0265331_10001870 3300031250 Bacteria 14848
666 Ga0265331_10022567 3300031250 Bacteria 3210
667 Ga0265327_10002224 3300031251 Bacteria 21112
668 Ga0265316_10010284 3300031344 Bacteria 8533
669 Ga0265316_10048508 3300031344 Bacteria 3351
670 Ga0265316_10149979 3300031344 Bacteria 1747
671 Ga0265316_10161738 3300031344 Bacteria 1673
672 Ga0307513_10261468 3300031456 Bacteria 1520
673 Ga0307513_10300298 3300031456 Bacteria 1373
674 Ga0307513_10350860 3300031456 Bacteria 1223
675 Ga0307408_100054991 3300031548 Bacteria 2880
676 Ga0265313_10000448 3300031595 Bacteria 43625
677 Ga0265313_10004127 3300031595 Bacteria 11295
678 Ga0265313_10016322 3300031595 Bacteria 4274
679 Ga0265313_10034290 3300031595 Bacteria 2568
680 Ga0265313_10053271 3300031595 Bacteria 1926
681 Ga0307508_10124354 3300031616 Bacteria 2181
682 Ga0307514_10002390 3300031649 Bacteria 19631
683 Ga0265314_10005122 3300031711 Bacteria 11925
684 Ga0265314_10027436 3300031711 Bacteria 4263
685 Ga0265314_10105082 3300031711 Bacteria 1806
686 Ga0265342_10000763 3300031712 Bacteria 32827
687 Ga0265342_10004375 3300031712 Bacteria 11163
688 Ga0265342_10010728 3300031712 Bacteria 6327
689 Ga0265342_10038340 3300031712 Bacteria 2918
690 Ga0265342_10052084 3300031712 Bacteria 2440
691 Ga0265342_10056611 3300031712 Bacteria 2323
692 Ga0307405_10000665 3300031731 Bacteria 13278
693 Ga0307413_10301608 3300031824 Bacteria 1215
694 Ga0307413_10381904 3300031824 Bacteria 1098
695 Ga0307410_10005796 3300031852 Bacteria 6587
696 Ga0307406_10042974 3300031901 Bacteria 2824
697 Ga0307407_10016631 3300031903 Bacteria 3667
698 Ga0307412_10261302 3300031911 Bacteria 1350
699 Ga0307409_100026359 3300031995 Bacteria 4097
700 Ga0307409_100868698 3300031995 Bacteria 914
701 Ga0307416_100002531 3300032002 Bacteria 10519
702 Ga0307416_100763014 3300032002 Bacteria 1061
703 Ga0307415_100000759 3300032126 Bacteria 14559
704 Ga0307507_10189955 3300033179 Bacteria 1446
705 Ga0373930_0000150 3300034816 Bacteria 7874
706 Ga0373948_0000307 3300034817 Bacteria 5896
707 Ga0373950_0002075 3300034818 Bacteria 2717
708 Ga0373950_0012337 3300034818 Bacteria 1409
709 Ga0373950_0014391 3300034818 Bacteria 1330
710 Ga0373958_0001702 3300034819 Bacteria 2986
711 Ga0373958_0002841 3300034819 Bacteria 2464
712 Ga0373959_0001657 3300034820 Bacteria 3542
713 Ga0373938_0002852 3300034957 Bacteria 2790
714 Ga0373938_0009646 3300034957 Bacteria 1755
715 Ga0373926_0027180 3300035083 Bacteria 2003
716 Ga0373928_0000222 3300035084 Bacteria 11055
717 Ga0373928_0004477 3300035084 Bacteria 2663
718 Ga0373928_0063198 3300035084 Bacteria 900
719 Ga0373929_0002112 3300035085 Bacteria 3692
720 Ga0373929_0002872 3300035085 Bacteria 3145
721 Ga0373929_0003760 3300035085 Bacteria 2721
722 Ga0373934_0137209 3300035086 Bacteria 999
723 Ga0373940_0012698 3300035088 Bacteria 2021
724 Ga0373940_0026893 3300035088 Bacteria 1508
725 Ga0373944_0001828 3300035089 Bacteria 5375
726 Ga0373944_0080792 3300035089 Unclassified 1073
727 Ga0373949_0001450 3300035090 Bacteria 6781
728 Ga0373949_0006107 3300035090 Bacteria 2665
729 Ga0373949_0050996 3300035090 Bacteria 1043
730 Ga0373951_0011607 3300035091 Bacteria 1979
731 Ga0373952_0000029 3300035092 Bacteria 16517
732 Ga0373923_0038247 3300035111 Bacteria 1965
733 Ga0373932_0001251 3300035112 Bacteria 7218
734 Ga0373932_0001864 3300035112 Bacteria 5647
735 Ga0373936_0006326 3300035113 Bacteria 4461
736 Ga0373936_0033686 3300035113 Bacteria 2032
737 Ga0373936_0332104 3300035113 Unclassified 690
738 Ga0373939_0000339 3300035114 Bacteria 11943
739 Ga0373939_0002855 3300035114 Bacteria 4058
740 Ga0373939_0009371 3300035114 Bacteria 2426
741 Ga0373941_0002285 3300035115 Bacteria 4194
742 Ga0373941_0017574 3300035115 Bacteria 1962
743 Ga0373941_0073329 3300035115 Bacteria 1141
744 Ga0373945_0058939 3300035116 Bacteria 1428
745 Ga0373953_0023666 3300035117 Bacteria 2327
746 Ga0373953_0028414 3300035117 Bacteria 2156
747 Ga0373954_0090293 3300035118 Bacteria 1471
748 Ga0373954_0093987 3300035118 Bacteria 1442
749 Ga0373954_0118861 3300035118 Bacteria 1282
750 Ga0373956_0117071 3300035119 Bacteria 1243
751 Ga0373956_0118830 3300035119 Unclassified 1234
752 Ga0373957_0006384 3300035120 Bacteria 3712
753 Ga0373960_0000372 3300035121 Bacteria 8658
754 Ga0373943_0016793 3300035170 Bacteria 3344
755 Ga0373943_0042125 3300035170 Bacteria 2211
756 Ga0373943_0042928 3300035170 Bacteria 2193
757 Ga0373943_0301588 3300035170 Bacteria 910
758 Ga0373946_0006340 3300035171 Bacteria 4288
759 Ga0373955_0001269 3300035172 Bacteria 10731
760 Ga0373955_0001523 3300035172 Bacteria 9899
761 Ga0373955_0004969 3300035172 Bacteria 5934
762 Ga0373942_0000767 3300035207 Bacteria 8832
763 Ga0373942_0003994 3300035207 Bacteria 3441
764 Ga0373942_0011842 3300035207 Bacteria 2074
765 Ga0373961_0001835 3300035241 Bacteria 5803
766 Ga0373961_0003896 3300035241 Bacteria 3641
767 Ga0373962_0005133 3300035242 Bacteria 3164
768 Ga0373962_0005930 3300035242 Bacteria 2950
769 Ga0373962_0006682 3300035242 Bacteria 2798
770 Ga0373924_0023997 3300035410 Bacteria 2399
771 Ga0373931_0000169 3300035691 Bacteria 28308
772 Ga0373931_0056827 3300035691 Bacteria 2097
773 Ga0373931_0068208 3300035691 Bacteria 1935
774 Ga0373935_0020667 3300035692 Bacteria 4024
775 Ga0373935_0073204 3300035692 Bacteria 2213
776 Ga0373927_0016232 3300035695 Bacteria 4914
777 Ga0373927_0050616 3300035695 Bacteria 2686
778 Ga0373933_0001124 3300035724 Bacteria 15927
779 Ga0373933_0005311 3300035724 Bacteria 7020
780 Ga0373933_0017906 3300035724 Bacteria 3978
781 Ga0373933_0289307 3300035724 Bacteria 1060
782 Ga0373947_0005580 3300035725 Bacteria 7335
783 Ga0373947_0038674 3300035725 Bacteria 2835
784 Ga0373947_0244013 3300035725 Bacteria 1186
785 Ga0373937_0004918 3300036401 Bacteria 11357
786 Ga0373937_0012121 3300036401 Bacteria 7568
787 Ga0373937_0038298 3300036401 Bacteria 4369
788 Ga0373937_0049021 3300036401 Bacteria 3867
789 Ga0373925_0009626 3300037068 Bacteria 7042
790 Ga0373925_0105557 3300037068 Unclassified 2171
791 Ga0373925_0127186 3300037068 Bacteria 1983
792 Ga0373925_0183511 3300037068 Unclassified 1657
793 Ga0395899_0004706 3300037312 Bacteria 10648
794 Ga0395899_0052474 3300037312 Bacteria 3022
795 Ga0395899_0107269 3300037312 Bacteria 2010
796 Ga0395899_0124191 3300037312 Bacteria 1846
797 Ga0395899_0186411 3300037312 Bacteria 1454
798 Ga0395899_0202627 3300037312 Bacteria 1383
799 Ga0395900_0005070 3300037418 Bacteria 13821
800 Ga0395900_0005219 3300037418 Bacteria 13628
801 Ga0395900_0179779 3300037418 Bacteria 2150
802 Ga0395900_0187123 3300037418 Bacteria 2101
803 Ga0395900_0304643 3300037418 Bacteria 1578
804 Ga0395900_0352299 3300037418 Bacteria 1445
805 Ga0395900_0450445 3300037418 Bacteria 1243
806 Ga0395900_1282466 3300037418 Bacteria 647
807 Ga0395898_0000804 3300037466 Bacteria 52956
808 Ga0395898_0003156 3300037466 Bacteria 18609
809 Ga0395898_0011599 3300037466 Bacteria 9147
810 Ga0395898_0014510 3300037466 Bacteria 8090
811 Ga0395898_0086896 3300037466 Bacteria 3013
812 Ga0395898_0123799 3300037466 Bacteria 2477
813 Ga0395898_0135233 3300037466 Bacteria 2360
814 Ga0395905_0035464 3300037471 Bacteria 4684
815 Ga0395905_0036713 3300037471 Bacteria 4603
816 Ga0395905_0051198 3300037471 Bacteria 3867
817 Ga0395905_0062059 3300037471 Bacteria 3496
818 Ga0395905_0070451 3300037471 Bacteria 3276
819 Ga0395905_0090886 3300037471 Bacteria 2862
820 Ga0395905_0362003 3300037471 Bacteria 1343
821 Ga0395905_1086154 3300037471 Bacteria 703
822 Ga0436364_1391236 3300037853 Bacteria 1997
823 Ga0395901_0000593 3300038443 Bacteria 42246
824 Ga0395901_0007281 3300038443 Bacteria 11166
825 Ga0395901_0087898 3300038443 Bacteria 3250
826 Ga0395901_0139381 3300038443 Bacteria 2549
827 Ga0395901_0163403 3300038443 Bacteria 2338
828 Ga0395901_0194575 3300038443 Bacteria 2126
829 Ga0395901_0240297 3300038443 Bacteria 1889
830 Ga0395901_0262468 3300038443 Bacteria 1797
831 Ga0395901_0367986 3300038443 Bacteria 1481
832 Ga0242420_012515 3300038996 Bacteria 1438
833 Ga0439436_0032846 3300041404 Bacteria 1504
834 Ga0439436_0037684 3300041404 Bacteria 1392
835 Ga0439461_0015906 3300041410 Bacteria 1446
836 Ga0439465_0018105 3300041413 Bacteria 2201
837 Ga0439465_0020970 3300041413 Bacteria 2048
838 Ga0439441_003611 3300042001 Bacteria 2293
839 Ga0439441_018364 3300042001 Bacteria 1264
840 Ga0439448_0019150 3300042005 Bacteria 2105
841 Ga0439432_058230 3300042006 Bacteria 1195
842 Ga0439449_0036981 3300042007 Bacteria 1816
843 Ga0439450_006022 3300042008 Bacteria 2164
844 Ga0450897_009908 3300042128 Bacteria 908
845 Ga0450898_005994 3300042134 Bacteria 1855
846 Ga0439458_0065715 3300042157 Bacteria 910
847 Ga0439458_0073289 3300042157 Bacteria 867
848 Ga0439434_0015569 3300042435 Bacteria 2268
849 Ga0439464_0001894 3300042439 Bacteria 5057
850 Ga0439464_0043627 3300042439 Bacteria 1283
851 Ga0439460_0058121 3300042461 Bacteria 1175
852 Ga0466969_0152944 3300044656 Bacteria 1062
853 Ga0466972_0148221 3300044658 Bacteria 1103
854 Ga0453683_0002883 3300044673 Bacteria 13004
855 Ga0466966_0014495 3300044684 Bacteria 5217
856 Ga0466966_0065521 3300044684 Bacteria 2284
857 Ga0466966_0139101 3300044684 Bacteria 1484
858 Ga0453684_0037028 3300044712 Bacteria 6705
859 Ga0466971_0016255 3300044719 Bacteria 3281
860 Ga0466957_0259493 3300044842 Bacteria 1158
861 Ga0466959_0057725 3300045049 Bacteria 2829
862 Ga0451576_0004677 3300045051 Bacteria 17627
863 Ga0451576_0033369 3300045051 Bacteria 5472
864 Ga0466958_0034786 3300045836 Bacteria 3008
865 Ga0466967_0137994 3300045976 Bacteria 2269
866 Ga0495617_000026 3300046452 Bacteria 157675
867 Ga0495617_032203 3300046452 Bacteria 1760
868 Ga0495617_070130 3300046452 Bacteria 1153
869 Ga0495627_000043 3300046453 Bacteria 185855
870 Ga0495592_0024186 3300046454 Bacteria 4617
871 Ga0495592_0040848 3300046454 Bacteria 3479
872 Ga0495603_0272938 3300046455 Bacteria 972
873 Ga0495590_0002579 3300046457 Bacteria 7485
874 Ga0495590_0038336 3300046457 Bacteria 1671
875 Ga0495591_067573 3300046458 Bacteria 935
876 Ga0495629_0000535 3300046459 Bacteria 31312
877 Ga0495629_0081599 3300046459 Bacteria 2257
878 Ga0495629_0262307 3300046459 Unclassified 1187
879 Ga0495638_0002787 3300046460 Bacteria 14034
880 Ga0495638_0161544 3300046460 Bacteria 1292
881 Ga0495641_0019259 3300046461 Bacteria 3497
882 Ga0495651_0011021 3300046462 Bacteria 6956
883 Ga0495651_0011844 3300046462 Bacteria 6706
884 Ga0495653_0008326 3300046463 Bacteria 8500
885 Ga0495653_0012564 3300046463 Bacteria 6915
886 Ga0495653_0024311 3300046463 Bacteria 4884
887 Ga0495653_0154948 3300046463 Bacteria 1597
888 Ga0495650_0003986 3300046471 Bacteria 10374
889 Ga0495650_0028303 3300046471 Bacteria 2576
890 Ga0495650_0055124 3300046471 Bacteria 1619
891 Ga0495580_0023721 3300046472 Bacteria 4499
892 Ga0495582_0039312 3300046473 Bacteria 2604
893 Ga0495582_0510306 3300046473 Unclassified 695
894 Ga0495605_0000113 3300046474 Bacteria 103900
895 Ga0495605_0030593 3300046474 Bacteria 2758
896 Ga0495639_0026471 3300046475 Bacteria 2564
897 Ga0495639_0029697 3300046475 Bacteria 2427
898 Ga0495662_0010283 3300046476 Bacteria 4586
899 Ga0495664_0003537 3300046477 Bacteria 8521
900 Ga0495664_0066458 3300046477 Bacteria 2150
901 Ga0495584_0002689 3300046491 Bacteria 9996
902 Ga0495585_0008366 3300046492 Bacteria 6274
903 Ga0495585_0102018 3300046492 Bacteria 1533
904 Ga0495585_0105342 3300046492 Bacteria 1504
905 Ga0495594_0042775 3300046499 Bacteria 2481
906 Ga0495594_0043598 3300046499 Bacteria 2459
907 Ga0495596_0003840 3300046500 Bacteria 7464
908 Ga0495596_0045908 3300046500 Bacteria 1717
909 Ga0495607_0001654 3300046501 Bacteria 19275
910 Ga0495607_0048620 3300046501 Bacteria 2479
911 Ga0495583_0023652 3300046506 Bacteria 3104
912 Ga0495606_0015605 3300046507 Bacteria 5841
913 Ga0495606_0077668 3300046507 Bacteria 2072
914 Ga0495606_0134974 3300046507 Bacteria 1462
915 Ga0495606_0151096 3300046507 Bacteria 1363
916 Ga0495608_0001474 3300046511 Bacteria 16724
917 Ga0495608_0039849 3300046511 Bacteria 3148
918 Ga0495608_0055452 3300046511 Bacteria 2619
919 Ga0495608_0141830 3300046511 Bacteria 1533
920 Ga0495616_0000280 3300046513 Bacteria 41320
921 Ga0495616_0047724 3300046513 Bacteria 2155
922 Ga0495618_0004984 3300046514 Bacteria 8114
923 Ga0495628_0001927 3300046516 Bacteria 18830
924 Ga0495628_0023873 3300046516 Bacteria 5015
925 Ga0495628_0244742 3300046516 Bacteria 1340
926 Ga0495630_0121732 3300046517 Bacteria 1979
927 Ga0495631_0004753 3300046518 Bacteria 7172
928 Ga0495631_0008269 3300046518 Bacteria 5245
929 Ga0495631_0022829 3300046518 Bacteria 2907
930 Ga0495631_0024362 3300046518 Bacteria 2794
931 Ga0495632_0022670 3300046519 Bacteria 3362
932 Ga0495632_0028969 3300046519 Bacteria 2887
933 Ga0495644_0002701 3300046523 Bacteria 7045
934 Ga0495644_0007525 3300046523 Bacteria 4198
935 Ga0495648_0000353 3300046524 Bacteria 50659
936 Ga0495648_0044149 3300046524 Bacteria 2785
937 Ga0495648_0134160 3300046524 Bacteria 1312
938 Ga0495642_0000123 3300046528 Bacteria 44369
939 Ga0495652_0022449 3300046529 Bacteria 5599
940 Ga0495652_0048857 3300046529 Bacteria 3624
941 Ga0495652_0087560 3300046529 Bacteria 2554
942 Ga0495652_0218826 3300046529 Bacteria 1432
943 Ga0495654_0025199 3300046530 Bacteria 3066
944 Ga0495665_0023481 3300046531 Bacteria 3312
945 Ga0495640_0027462 3300046533 Bacteria 4104
946 Ga0495640_0295102 3300046533 Bacteria 1007
947 Ga0495586_0036479 3300046535 Bacteria 2639
948 Ga0495586_0068990 3300046535 Bacteria 1929
949 Ga0495587_0002240 3300046536 Bacteria 12923
950 Ga0495587_0047875 3300046536 Bacteria 2534
951 Ga0495587_0111209 3300046536 Bacteria 1573
952 Ga0495598_0007286 3300046537 Bacteria 2533
953 Ga0495609_0058799 3300046538 Unclassified 1700
954 Ga0495609_0071180 3300046538 Bacteria 1528
955 Ga0495609_0116715 3300046538 Bacteria 1149
956 Ga0495621_0005528 3300046539 Bacteria 3636
957 Ga0495645_0002539 3300046543 Bacteria 12383
958 Ga0495645_0019854 3300046543 Bacteria 4842
959 Ga0495645_0297721 3300046543 Bacteria 1055
960 Ga0495622_0015565 3300046557 Bacteria 3535
961 Ga0495633_0002969 3300046558 Bacteria 11596
962 Ga0495633_0040050 3300046558 Bacteria 2234
963 Ga0495667_0024955 3300046559 Bacteria 4028
964 Ga0495667_0026523 3300046559 Bacteria 3905
965 Ga0495667_0099693 3300046559 Bacteria 1880
966 Ga0495656_0002822 3300046615 Bacteria 5812
967 Ga0495656_0003380 3300046615 Bacteria 5393
968 Ga0495668_0000546 3300046616 Bacteria 46545
969 Ga0495668_0023779 3300046616 Bacteria 3490
970 Ga0495634_0026079 3300046642 Bacteria 4081
971 Ga0495611_0076488 3300046648 Bacteria 1534
972 Ga0495611_0081731 3300046648 Unclassified 1486
973 Ga0495611_0116281 3300046648 Bacteria 1246
974 Ga0495625_0017209 3300046660 Bacteria 5661
975 Ga0495625_0019383 3300046660 Bacteria 5278
976 Ga0495625_0099008 3300046660 Bacteria 2005
977 Ga0495635_0003881 3300046663 Bacteria 10388
978 Ga0495635_0021401 3300046663 Bacteria 4506
979 Ga0495635_0398033 3300046663 Bacteria 915
980 Ga0495659_0001458 3300046664 Bacteria 8030
981 Ga0495659_0057268 3300046664 Bacteria 1432
982 Ga0495661_0000588 3300046665 Bacteria 37543
983 Ga0495661_0042470 3300046665 Bacteria 2802
984 Ga0495661_0044928 3300046665 Bacteria 2705
985 Ga0495661_0066043 3300046665 Bacteria 2130
986 Ga0495588_0000148 3300046674 Bacteria 100600
987 Ga0495588_0009890 3300046674 Bacteria 4421
988 Ga0495588_0045221 3300046674 Bacteria 2256
989 Ga0495657_0010946 3300046675 Bacteria 6803
990 Ga0495599_0004481 3300046678 Bacteria 8275
991 Ga0495599_0017530 3300046678 Bacteria 4451
992 Ga0495623_0000420 3300046679 Bacteria 27960
993 Ga0495623_0007330 3300046679 Bacteria 7157
994 Ga0495646_0020687 3300046680 Bacteria 4163
995 Ga0495647_0024629 3300046681 Bacteria 2192
996 Ga0495658_0000788 3300046683 Bacteria 17050
997 Ga0495658_0006062 3300046683 Bacteria 5938
998 Ga0495658_0009215 3300046683 Bacteria 4909
999 Ga0495669_0031148 3300046684 Bacteria 2342
1000 Ga0495613_0257921 3300046689 Bacteria 1215
1001 Ga0495613_0264446 3300046689 Unclassified 1197
1002 Ga0495624_0026468 3300046690 Unclassified 3801
1003 Ga0495624_0051811 3300046690 Bacteria 2595
1004 Ga0495624_0091076 3300046690 Bacteria 1881
1005 Ga0495670_0000291 3300046691 Bacteria 23680
1006 Ga0495670_0004221 3300046691 Bacteria 7037
1007 Ga0495670_0130511 3300046691 Bacteria 1309
1008 Ga0495671_0000426 3300046692 Bacteria 33503
1009 Ga0495671_0078965 3300046692 Bacteria 1613
1010 Ga0495600_0001326 3300046809 Bacteria 13661
1011 Ga0495600_0011214 3300046809 Bacteria 5584
1012 Ga0495660_0001751 3300046810 Bacteria 14463
1013 Ga0495660_0026320 3300046810 Bacteria 3298
1014 Ga0495581_0049705 3300047315 Bacteria 2421
1015 Ga0495581_0055269 3300047315 Bacteria 2291
1016 Ga0495604_0003891 3300047317 Bacteria 11887
1017 Ga0495604_0009082 3300047317 Bacteria 7865
1018 Ga0495604_0028398 3300047317 Bacteria 4451
1019 Ga0495636_0043692 3300047318 Bacteria 1865
1020 Ga0495636_0122156 3300047318 Bacteria 1153
1021 Ga0495674_0015363 3300047319 Bacteria 7160
1022 Ga0495674_0027169 3300047319 Bacteria 5232
1023 Ga0495674_0069524 3300047319 Unclassified 3044
1024 Ga0495672_0000142 3300047320 Bacteria 105843
1025 Ga0495672_0028555 3300047320 Bacteria 3528
1026 Ga0495676_0076650 3300047321 Bacteria 2552
1027 Ga0495676_0332651 3300047321 Bacteria 1018
1028 Ga0495680_0011254 3300047322 Bacteria 7932
1029 Ga0495680_0012959 3300047322 Bacteria 7301
1030 Ga0495680_0044687 3300047322 Bacteria 3502
1031 Ga0495680_0062737 3300047322 Unclassified 2856
1032 Ga0495680_0088135 3300047322 Bacteria 2333
1033 Ga0495687_000140 3300047443 Bacteria 109311
1034 Ga0495687_000236 3300047443 Bacteria 76970
1035 Ga0495687_046987 3300047443 Bacteria 1860
1036 Ga0495675_0001544 3300047444 Bacteria 13904
1037 Ga0495677_0032250 3300047445 Bacteria 1908
1038 Ga0495677_0048032 3300047445 Bacteria 1568
1039 Ga0495681_0115790 3300047470 Bacteria 1156
1040 Ga0495684_0002087 3300047471 Bacteria 16070
1041 Ga0495684_0282601 3300047471 Unclassified 1197
1042 Ga0495686_0049134 3300047472 Bacteria 2655
1043 Ga0495686_0105336 3300047472 Bacteria 1697
1044 Ga0495593_0004626 3300047673 Bacteria 8180
1045 Ga0495602_0000740 3300048088 Bacteria 30918
1046 Ga0495602_0005526 3300048088 Bacteria 13262
1047 Ga0495602_0107280 3300048088 Bacteria 2277
1048 Ga0495602_0113689 3300048088 Bacteria 2193
1049 Ga0495614_0031402 3300048089 Bacteria 2286
1050 Ga0495614_0114701 3300048089 Unclassified 1184
1051 Ga0495615_0002437 3300048090 Bacteria 2984
1052 Ga0495626_0043143 3300048091 Bacteria 2117
1053 Ga0496100_0000106 3300048903 Bacteria 48123
1054 Ga0496100_0002951 3300048903 Bacteria 8748
1055 Ga0496100_0003648 3300048903 Bacteria 8050
1056 Ga0496101_0000992 3300048904 Bacteria 16792
1057 Ga0496101_0020995 3300048904 Bacteria 4481
1058 Ga0496101_0023715 3300048904 Bacteria 4241
1059 Ga0496101_0137951 3300048904 Bacteria 1857
1060 Ga0496101_0591310 3300048904 Bacteria 877
1061 Ga0496102_0011236 3300048905 Bacteria 7715
1062 Ga0496102_0019045 3300048905 Bacteria 6041
1063 Ga0496102_0039093 3300048905 Bacteria 4285
1064 Ga0496103_0006368 3300048906 Bacteria 7051
1065 Ga0496103_0052592 3300048906 Bacteria 2522
1066 Ga0496103_0196082 3300048906 Bacteria 1298
1067 Ga0496104_0000090 3300048907 Bacteria 87877
1068 Ga0496104_0005547 3300048907 Bacteria 11050
1069 Ga0496104_0113779 3300048907 Bacteria 2595
1070 Ga0496104_0213441 3300048907 Bacteria 1841
1071 Ga0496104_0239954 3300048907 Bacteria 1725
1072 Ga0496105_0001574 3300048908 Bacteria 16176
1073 Ga0496105_0193026 3300048908 Bacteria 1664
1074 Ga0496105_0248474 3300048908 Bacteria 1442
1075 Ga0496106_0002499 3300048909 Bacteria 13684
1076 Ga0496106_0012172 3300048909 Bacteria 6349
1077 Ga0496106_0013964 3300048909 Bacteria 5939
1078 Ga0496107_0000223 3300048910 Bacteria 30018
1079 Ga0496107_0034213 3300048910 Bacteria 3639
1080 Ga0496107_0037809 3300048910 Bacteria 3464
1081 Ga0496107_0041516 3300048910 Bacteria 3303
1082 Ga0496108_0003914 3300048911 Bacteria 11960
1083 Ga0496108_0046748 3300048911 Bacteria 3617
1084 Ga0496108_0203837 3300048911 Bacteria 1716
1085 Ga0496109_0014846 3300048912 Bacteria 6778
1086 Ga0496109_0016176 3300048912 Bacteria 6519
1087 Ga0496109_0040980 3300048912 Bacteria 4195
1088 Ga0496109_0072253 3300048912 Bacteria 3169
1089 Ga0496109_0593511 3300048912 Unclassified 1043
1090 Ga0496110_0046530 3300048913 Bacteria 3796
1091 Ga0496110_0371797 3300048913 Unclassified 1302
1092 Ga0496111_0113348 3300048914 Bacteria 1998
1093 Ga0496112_0281134 3300048915 Bacteria 1611
1094 Ga0496112_0661226 3300048915 Bacteria 974
1095 Ga0496113_0006216 3300048916 Bacteria 7545
1096 Ga0496113_0010789 3300048916 Bacteria 6060
1097 Ga0496113_0085943 3300048916 Bacteria 2416
1098 Ga0496113_0380979 3300048916 Bacteria 1132
1099 Ga0496114_0006841 3300048917 Bacteria 8982
1100 Ga0496114_0399786 3300048917 Bacteria 1217
1101 Ga0496115_0021146 3300048918 Bacteria 5022
1102 Ga0496115_0021880 3300048918 Bacteria 4945
1103 Ga0496115_0073152 3300048918 Bacteria 2781
1104 Ga0496115_0094696 3300048918 Bacteria 2443
1105 Ga0496115_0155608 3300048918 Bacteria 1888
1106 Ga0496115_0203915 3300048918 Unclassified 1633
1107 Ga0496115_0471745 3300048918 Unclassified 1011
1108 Ga0496116_0236119 3300048919 Bacteria 922
1109 Ga0496118_0162592 3300048921 Bacteria 1378
1110 Ga0496121_0050228 3300048924 Bacteria 3525
1111 Ga0496121_0116997 3300048924 Bacteria 2020
1112 Ga0496122_0004785 3300048925 Bacteria 16556
1113 Ga0496123_0000329 3300048926 Bacteria 90380
1114 Ga0496123_0084360 3300048926 Bacteria 1916
1115 Ga0496124_0148716 3300048927 Bacteria 1840
1116 Ga0496124_0368877 3300048927 Bacteria 1008
1117 Ga0496126_0021159 3300048929 Bacteria 6360
1118 Ga0496126_0106930 3300048929 Bacteria 2441
1119 Ga0496126_0309794 3300048929 Bacteria 1300
1120 Ga0495678_024007 3300049459 Bacteria 2640
1121 Ga0495678_103844 3300049459 Bacteria 981
1122 Ga0501031_0007403 3300049568 Bacteria 7151
1123 Ga0501031_0064822 3300049568 Bacteria 2380
1124 Ga0501032_0001244 3300049569 Bacteria 20453
1125 Ga0501033_0000075 3300049570 Bacteria 94239
1126 Ga0501033_0180842 3300049570 Bacteria 1512
1127 Ga0501034_0000743 3300049571 Bacteria 49281
1128 Ga0501034_0000760 3300049571 Bacteria 48430
1129 Ga0501034_0280292 3300049571 Bacteria 1606
1130 Ga0501034_0880791 3300049571 Bacteria 784
1131 Ga0501036_0000105 3300049572 Bacteria 52655
1132 Ga0501037_0001098 3300049573 Bacteria 20052
1133 Ga0501038_0002155 3300049574 Bacteria 18292
1134 Ga0501039_0001038 3300049575 Bacteria 20317
1135 Ga0501043_0000017 3300049579 Bacteria 166630
1136 Ga0501043_0204925 3300049579 Bacteria 1530
1137 Ga0501043_0477819 3300049579 Bacteria 933
1138 Ga0501046_0000215 3300049580 Bacteria 60301
1139 Ga0501047_0002474 3300049581 Bacteria 17628
1140 Ga0501047_0009616 3300049581 Bacteria 9142
1141 Ga0501047_0272559 3300049581 Bacteria 1538
1142 Ga0501048_0008070 3300049582 Bacteria 7971
1143 Ga0501067_0000168 3300049583 Bacteria 36922
1144 Ga0501067_0075382 3300049583 Bacteria 1869
1145 Ga0501068_0005835 3300049584 Bacteria 6755
1146 Ga0501068_0017682 3300049584 Plasmid 4125
1147 Ga0501069_0000283 3300049585 Bacteria 23129
1148 Ga0501069_0004666 3300049585 Bacteria 7084
1149 Ga0501069_0220208 3300049585 Bacteria 1103
1150 Ga0501069_0339534 3300049585 Bacteria 884
1151 Ga0501070_0001274 3300049586 Bacteria 22623
1152 Ga0501070_0079486 3300049586 Unclassified 2714
1153 Ga0501070_0312239 3300049586 Bacteria 1280
1154 Ga0501070_0372851 3300049586 Bacteria 1157
1155 Ga0501071_0065933 3300049587 Bacteria 2630
1156 Ga0501072_0007217 3300049588 Bacteria 8434
1157 Ga0501072_0191989 3300049588 Bacteria 1629
1158 Ga0501073_0001048 3300049589 Bacteria 19926
1159 Ga0501073_0288906 3300049589 Bacteria 1131
1160 Ga0501074_0007807 3300049590 Bacteria 7748
1161 Ga0501076_0147833 3300049592 Bacteria 1911
1162 Ga0501077_0019577 3300049593 Bacteria 4280
1163 Ga0501079_0024258 3300049741 Bacteria 4654
1164 Ga0501080_0075828 3300049742 Bacteria 3127
1165 Ga0501080_0393713 3300049742 Bacteria 1247
1166 Ga0501080_0447518 3300049742 Bacteria 1158
1167 Ga0501083_0077570 3300049744 Bacteria 2204
1168 Ga0501083_0273548 3300049744 Bacteria 1099
1169 Ga0501083_0388712 3300049744 Bacteria 907
1170 Ga0501263_029224 3300049760 Bacteria 772
1171 Ga0501266_009130 3300049763 Bacteria 1252
1172 Ga0501035_0000731 3300049822 Bacteria 35650
1173 Ga0501035_0002545 3300049822 Bacteria 17829
1174 Ga0501035_0201180 3300049822 Bacteria 1708
1175 Ga0501035_0219439 3300049822 Bacteria 1624
1176 Ga0501044_0000329 3300049823 Bacteria 59853
1177 Ga0501044_0030272 3300049823 Bacteria 5706
1178 Ga0501044_0120966 3300049823 Unclassified 2619
1179 Ga0501044_0163759 3300049823 Bacteria 2199
1180 Ga0501044_0196917 3300049823 Bacteria 1974
1181 Ga0501044_0352360 3300049823 Bacteria 1391
1182 Ga0501044_0360960 3300049823 Bacteria 1371
1183 Ga0501044_0415062 3300049823 Bacteria 1257
1184 Ga0501045_0083231 3300049824 Bacteria 2360
1185 nmdc:mga03n38_14483_c1 3300050490 Bacteria 3023
1186 nmdc:mga03n38_276968_c1 3300050490 Bacteria 894
1187 nmdc:mga0yw44_125128_c1 3300050492 Bacteria 1659
1188 nmdc:mga0yw44_352931_c1 3300050492 Bacteria 990
1189 nmdc:mga0yw44_86133_c1 3300050492 Bacteria 1978
1190 nmdc:mga0k408_24714_c1 3300050493 Bacteria 3398
1191 nmdc:mga0k408_3983_c1 3300050493 Bacteria 7831
1192 nmdc:mga06z11_126158_c1 3300050494 Bacteria 1432
1193 nmdc:mga06z11_1795_c1 3300050494 Bacteria 8072
1194 nmdc:mga05p37_13519_c1 3300050507 Bacteria 9784
1195 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
1196 nmdc:mga09592_976_c1 3300050508 Bacteria 22595
1197 nmdc:mga0qj67_4772_c1 3300050509 Bacteria 9855
1198 nmdc:mga06r32_34244_c1 3300050510 Bacteria 4789
1199 nmdc:mga08y16_10784_c1 3300050511 Bacteria 9592
1200 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
1201 nmdc:mga08y16_2396_c1 3300050511 Bacteria 19256
1202 nmdc:mga08y16_610118_c1 3300050511 Bacteria 1099
1203 nmdc:mga0n895_327311_c1 3300050512 Bacteria 1553
1204 nmdc:mga0n895_51689_c1 3300050512 Bacteria 4032
1205 nmdc:mga0n895_5847_c1 3300050512 Bacteria 10340
1206 nmdc:mga0rr50_154672_c1 3300050513 Bacteria 1857
1207 nmdc:mga0rr50_256812_c1 3300050513 Bacteria 1453
1208 nmdc:mga0rr50_44591_c1 3300050513 Bacteria 3253
1209 nmdc:mga08x19_379394_c1 3300050514 Bacteria 990
1210 nmdc:mga0a205_11514_c1 3300050515 Bacteria 8147
1211 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
1212 Ga0495601_0000360 3300053077 Bacteria 23959
1213 Ga0495601_0001260 3300053077 Bacteria 13862
1214 Ga0495601_0007151 3300053077 Bacteria 6544
1215 Ga0495601_0070227 3300053077 Bacteria 2235
1216 Ga0495601_0282707 3300053077 Bacteria 1082
1217 Ga0495612_0000964 3300053078 Bacteria 11832
1218 Ga0495612_0002659 3300053078 Bacteria 7371
1219 Ga0495612_0008741 3300053078 Bacteria 4108
1220 Ga0495612_0009169 3300053078 Bacteria 4014
1221 Ga0495612_0038379 3300053078 Bacteria 1946
1222 Ga0500610_0226643 3300053079 Bacteria 880
1223 Ga0495595_0000969 3300053084 Bacteria 11036
1224 Ga0495595_0001276 3300053084 Bacteria 9815
1225 Ga0495595_0003989 3300053084 Bacteria 5900
1226 Ga0495619_0000375 3300053085 Bacteria 30799
1227 Ga0495619_0000581 3300053085 Bacteria 24290
1228 Ga0495619_0001851 3300053085 Bacteria 14080
1229 Ga0495619_0002471 3300053085 Bacteria 12094
1230 Ga0500578_0097311 3300053086 Bacteria 1865
1231 Ga0500644_0008930 3300053088 Bacteria 2662
1232 Ga0500644_0116210 3300053088 Bacteria 1037
1233 Ga0500646_0000891 3300053090 Bacteria 8244
1234 Ga0500566_0024974 3300053094 Bacteria 3504
1235 Ga0500566_0103442 3300053094 Unclassified 1558
1236 Ga0500566_0130230 3300053094 Bacteria 1347
1237 Ga0500641_0006059 3300053096 Bacteria 4283
1238 Ga0500557_020936 3300053105 Bacteria 1867
1239 Ga0500562_011565 3300053108 Bacteria 2241
1240 Ga0500562_049758 3300053108 Bacteria 1120
1241 Ga0500594_0006878 3300053118 Bacteria 2563
1242 Ga0500595_000002 3300053119 Bacteria 1074388
1243 Ga0500618_010091 3300053125 Bacteria 2547
1244 Ga0500642_0091146 3300053130 Bacteria 1409
1245 Ga0500559_0009761 3300053136 Bacteria 4142
1246 Ga0500568_0005193 3300053139 Bacteria 6788
1247 Ga0500577_0031696 3300053142 Bacteria 1852
1248 Ga0500586_066588 3300053145 Bacteria 1258
1249 Ga0500588_0019735 3300053146 Bacteria 1797
1250 Ga0500588_0107918 3300053146 Bacteria 968
1251 Ga0500589_169386 3300053147 Bacteria 870
1252 Ga0500616_0000002 3300053153 Bacteria 1611257
1253 Ga0500620_000770 3300053155 Bacteria 5516
1254 Ga0500627_0015729 3300053158 Bacteria 2933
1255 Ga0500627_0086179 3300053158 Bacteria 1403
1256 Ga0500611_017475 3300053727 Bacteria 1307
1257 Ga0500645_000471 3300053730 Bacteria 27490
1258 Ga0500609_004193 3300053731 Bacteria 2003
1259 Ga0500552_009611 3300053733 Bacteria 1170
1260 Ga0501084_0099825 3300054114 Bacteria 2437
1261 Ga0501084_0427144 3300054114 Bacteria 1120
1262 Ga0501082_0081394 3300060353 Bacteria 2794
1263 Ga0501082_0086383 3300060353 Bacteria 2706

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0289307 Ga0373933_0289307_126_875 190
2 3300037418 Ga0395900_1282466 Ga0395900_1282466_25_627 192
3 3300027252 Ga0209973_1008250 Ga0209973_10082502 198
4 3300049579 Ga0501043_0477819 Ga0501043_0477819_17_625 198
5 3300025941 Ga0207711_10471013 Ga0207711_104710132 199
6 3300035113 Ga0373936_0332104 Ga0373936_0332104_12_620 202
7 3300046473 Ga0495582_0510306 Ga0495582_0510306_19_627 202
8 3300049571 Ga0501034_0880791 Ga0501034_0880791_147_755 202
9 3300049585 Ga0501069_0339534 Ga0501069_0339534_15_623 202
10 3300042157 Ga0439458_0065715 Ga0439458_0065715_269_895 204
11 3300000041 ARcpr5oldR_c007944 ARcpr5oldR_0079441 208
12 iso_pu_bacteria 2922185730 2922192077 210
13 3300037471 Ga0395905_1086154 Ga0395905_1086154_19_663 211
14 3300005327 Ga0070658_10073399 Ga0070658_100733994 213
15 3300005344 Ga0070661_100153007 Ga0070661_1001530072 213
16 3300025920 Ga0207649_10368929 Ga0207649_103689292 213
17 3300050490 nmdc:mga03n38_276968_c1 nmdc:mga03n38_276968_c1_57_722 215
18 3300010375 Ga0105239_10060085 Ga0105239_100600854 216
19 3300049760 Ga0501263_029224 Ga0501263_029224_17_679 216
20 3300050492 nmdc:mga0yw44_352931_c1 nmdc:mga0yw44_352931_c1_312_980 216
21 3300003790 Ga0055528_1005404 Ga0055528_10054044 217
22 3300025273 Ga0209673_1000033 Ga0209673_1000033316 217
23 3300025299 Ga0209256_1007611 Ga0209256_10076115 217
24 iso_pu_bacteria 2510917026 2511169427 218
25 3300025928 Ga0207700_10115487 Ga0207700_101154873 221
26 3300050493 nmdc:mga0k408_24714_c1 nmdc:mga0k408_24714_c1_736_1491 221
27 3300005347 Ga0070668_100535252 Ga0070668_1005352522 222
28 3300025972 Ga0207668_10035290 Ga0207668_100352902 222
29 3300046691 Ga0495670_0004221 Ga0495670_0004221_3324_4070 222
30 iso_pu_bacteria 2881853255 2881856833 222
31 3300031649 Ga0307514_10002390 Ga0307514_100023904 223
32 3300025920 Ga0207649_10101143 Ga0207649_101011432 224
33 3300042157 Ga0439458_0073289 Ga0439458_0073289_172_846 224
34 3300048907 Ga0496104_0239954 Ga0496104_0239954_1028_1702 224
35 3300050513 nmdc:mga0rr50_256812_c1 nmdc:mga0rr50_256812_c1_21_695 224
36 3300053088 Ga0500644_0008930 Ga0500644_0008930_101_838 224
37 3300053094 Ga0500566_0024974 Ga0500566_0024974_1077_1814 224
38 3300053119 Ga0500595_000002 Ga0500595_000002_46073_46810 224
39 3300053153 Ga0500616_0000002 Ga0500616_0000002_60909_61646 224
40 3300053730 Ga0500645_000471 Ga0500645_000471_22327_23064 224
41 3300031711 Ga0265314_10005122 Ga0265314_100051224 225
42 3300048907 Ga0496104_0213441 Ga0496104_0213441_595_1317 225
43 3300049822 Ga0501035_0002545 Ga0501035_0002545_9200_9895 226
44 3300005328 Ga0070676_10275987 Ga0070676_102759872 227
45 3300025949 Ga0207667_10339117 Ga0207667_103391172 227
46 3300053088 Ga0500644_0116210 Ga0500644_0116210_234_1001 227
47 3300013100 Ga0157373_10001948 Ga0157373_100019485 228
48 3300037068 Ga0373925_0127186 Ga0373925_0127186_43_729 228
49 3300031456 Ga0307513_10261468 Ga0307513_102614682 229
50 3300031548 Ga0307408_100054991 Ga0307408_1000549912 229
51 3300031616 Ga0307508_10124354 Ga0307508_101243542 229
52 3300031731 Ga0307405_10000665 Ga0307405_1000066510 229
53 3300031824 Ga0307413_10381904 Ga0307413_103819041 229
54 3300031852 Ga0307410_10005796 Ga0307410_100057963 229
55 3300031901 Ga0307406_10042974 Ga0307406_100429742 229
56 3300031903 Ga0307407_10016631 Ga0307407_100166314 229
57 3300031995 Ga0307409_100026359 Ga0307409_1000263592 229
58 3300032002 Ga0307416_100002531 Ga0307416_1000025312 229
59 3300032126 Ga0307415_100000759 Ga0307415_10000075911 229
60 3300053086 Ga0500578_0097311 Ga0500578_0097311_918_1631 229
61 3300053142 Ga0500577_0031696 Ga0500577_0031696_403_1116 229
62 3300053146 Ga0500588_0019735 Ga0500588_0019735_868_1581 229
63 3300000652 ARCol0yngRDRAFT_1001388 ARCol0yngRDRAFT_10013883 230
64 3300005331 Ga0070670_100028821 Ga0070670_1000288215 230
65 3300005334 Ga0068869_100087083 Ga0068869_1000870832 230
66 3300005335 Ga0070666_10030551 Ga0070666_100305512 230
67 3300005340 Ga0070689_100062016 Ga0070689_1000620161 230
68 3300005355 Ga0070671_100006280 Ga0070671_1000062806 230
69 3300005364 Ga0070673_100057607 Ga0070673_1000576074 230
70 3300005434 Ga0070709_10003137 Ga0070709_100031372 230
71 3300005436 Ga0070713_100034352 Ga0070713_1000343522 230
72 3300005437 Ga0070710_10005022 Ga0070710_100050223 230
73 3300005438 Ga0070701_10133855 Ga0070701_101338552 230
74 3300005439 Ga0070711_100030851 Ga0070711_1000308514 230
75 3300005456 Ga0070678_100034927 Ga0070678_1000349272 230
76 3300005466 Ga0070685_10015115 Ga0070685_100151153 230
77 3300005535 Ga0070684_100228069 Ga0070684_1002280692 230
78 3300005543 Ga0070672_100625671 Ga0070672_1006256711 230
79 3300005548 Ga0070665_100138556 Ga0070665_1001385562 230
80 3300005615 Ga0070702_100050904 Ga0070702_1000509042 230
81 3300005618 Ga0068864_100029150 Ga0068864_1000291502 230
82 3300005841 Ga0068863_100198046 Ga0068863_1001980462 230
83 3300006028 Ga0070717_10000199 Ga0070717_1000019915 230
84 3300006173 Ga0070716_100002448 Ga0070716_1000024487 230
85 3300006175 Ga0070712_100120706 Ga0070712_1001207062 230
86 3300006237 Ga0097621_100036113 Ga0097621_1000361132 230
87 3300006358 Ga0068871_100012500 Ga0068871_1000125004 230
88 3300009011 Ga0105251_10030580 Ga0105251_100305803 230
89 3300009101 Ga0105247_10029759 Ga0105247_100297592 230
90 3300009148 Ga0105243_10033088 Ga0105243_100330885 230
91 3300009177 Ga0105248_10031416 Ga0105248_100314165 230
92 3300009553 Ga0105249_10134000 Ga0105249_101340002 230
93 3300011119 Ga0105246_10113686 Ga0105246_101136861 230
94 3300013296 Ga0157374_10141327 Ga0157374_101413271 230
95 3300013308 Ga0157375_10078898 Ga0157375_100788982 230
96 3300014969 Ga0157376_10153359 Ga0157376_101533591 230
97 3300025898 Ga0207692_10000876 Ga0207692_1000087610 230
98 3300025900 Ga0207710_10001609 Ga0207710_100016095 230
99 3300025901 Ga0207688_10059462 Ga0207688_100594622 230
100 3300025906 Ga0207699_10002088 Ga0207699_100020888 230
101 3300025915 Ga0207693_10007304 Ga0207693_100073049 230
102 3300025916 Ga0207663_10126218 Ga0207663_101262182 230
103 3300025928 Ga0207700_10002485 Ga0207700_100024856 230
104 3300025929 Ga0207664_10005574 Ga0207664_100055745 230
105 3300025934 Ga0207686_10007990 Ga0207686_100079904 230
106 3300025937 Ga0207669_10165114 Ga0207669_101651142 230
107 3300025939 Ga0207665_10001702 Ga0207665_100017029 230
108 3300025940 Ga0207691_10509947 Ga0207691_105099471 230
109 3300025941 Ga0207711_10009675 Ga0207711_100096752 230
110 3300025944 Ga0207661_10595864 Ga0207661_105958642 230
111 3300025945 Ga0207679_10095656 Ga0207679_100956562 230
112 3300025960 Ga0207651_10116032 Ga0207651_101160323 230
113 3300025972 Ga0207668_10303789 Ga0207668_103037892 230
114 3300026095 Ga0207676_10019580 Ga0207676_100195805 230
115 3300028379 Ga0268266_10034656 Ga0268266_100346562 230
116 3300028379 Ga0268266_10104379 Ga0268266_101043792 230
117 3300045836 Ga0466958_0034786 Ga0466958_0034786_1069_1785 230
118 3300047472 Ga0495686_0105336 Ga0495686_0105336_771_1517 230
119 3300048903 Ga0496100_0003648 Ga0496100_0003648_3239_3976 230
120 3300048904 Ga0496101_0023715 Ga0496101_0023715_704_1441 230
121 3300048906 Ga0496103_0052592 Ga0496103_0052592_261_998 230
122 3300048912 Ga0496109_0593511 Ga0496109_0593511_245_982 230
123 3300048913 Ga0496110_0371797 Ga0496110_0371797_373_1110 230
124 3300048918 Ga0496115_0203915 Ga0496115_0203915_704_1441 230
125 3300028381 Ga0268264_10679750 Ga0268264_106797502 231
126 3300002737 JGI25162J39368_1000996 JGI25162J39368_10009969 232
127 3300003214 JGI25165J46597_1000819 JGI25165J46597_100081915 232
128 3300003214 JGI25165J46597_1001228 JGI25165J46597_10012289 232
129 3300005338 Ga0068868_100060491 Ga0068868_1000604914 232
130 3300005339 Ga0070660_100143095 Ga0070660_1001430952 232
131 3300005365 Ga0070688_100011831 Ga0070688_1000118315 232
132 3300005366 Ga0070659_100007504 Ga0070659_1000075044 232
133 3300005367 Ga0070667_100209204 Ga0070667_1002092041 232
134 3300005539 Ga0068853_100185112 Ga0068853_1001851122 232
135 3300005544 Ga0070686_100032042 Ga0070686_1000320424 232
136 3300005546 Ga0070696_100078891 Ga0070696_1000788911 232
137 3300005548 Ga0070665_100010015 Ga0070665_1000100156 232
138 3300005564 Ga0070664_100022255 Ga0070664_1000222552 232
139 3300005617 Ga0068859_100389314 Ga0068859_1003893142 232
140 3300006931 Ga0097620_100389303 Ga0097620_1003893032 232
141 3300009098 Ga0105245_10091423 Ga0105245_100914232 232
142 3300009174 Ga0105241_10095627 Ga0105241_100956272 232
143 3300009176 Ga0105242_10019812 Ga0105242_100198125 232
144 3300009551 Ga0105238_10036872 Ga0105238_100368725 232
145 3300009551 Ga0105238_10074611 Ga0105238_100746112 232
146 3300013297 Ga0157378_10052925 Ga0157378_100529253 232
147 3300013306 Ga0163162_10327920 Ga0163162_103279201 232
148 3300025233 Ga0209437_100057 Ga0209437_100057139 232
149 3300025261 Ga0209233_1000134 Ga0209233_1000134139 232
150 3300025907 Ga0207645_10035558 Ga0207645_100355583 232
151 3300025914 Ga0207671_10063500 Ga0207671_100635003 232
152 3300025919 Ga0207657_10077205 Ga0207657_100772052 232
153 3300025920 Ga0207649_10020627 Ga0207649_100206272 232
154 3300025924 Ga0207694_10059954 Ga0207694_100599544 232
155 3300025927 Ga0207687_10029871 Ga0207687_100298715 232
156 3300025931 Ga0207644_10007663 Ga0207644_100076632 232
157 3300025938 Ga0207704_10098385 Ga0207704_100983852 232
158 3300026035 Ga0207703_10043709 Ga0207703_100437092 232
159 3300026089 Ga0207648_10136180 Ga0207648_101361802 232
160 3300026121 Ga0207683_10005254 Ga0207683_100052546 232
161 3300026121 Ga0207683_10351552 Ga0207683_103515522 232
162 3300028381 Ga0268264_10016375 Ga0268264_100163751 232
163 3300035115 Ga0373941_0073329 Ga0373941_0073329_30_794 232
164 3300046452 Ga0495617_032203 Ga0495617_032203_646_1407 232
165 3300046457 Ga0495590_0038336 Ga0495590_0038336_888_1649 232
166 3300046474 Ga0495605_0030593 Ga0495605_0030593_887_1648 232
167 3300046492 Ga0495585_0102018 Ga0495585_0102018_730_1491 232
168 3300046506 Ga0495583_0023652 Ga0495583_0023652_1449_2210 232
169 3300046507 Ga0495606_0151096 Ga0495606_0151096_71_832 232
170 3300046518 Ga0495631_0008269 Ga0495631_0008269_3803_4564 232
171 3300046519 Ga0495632_0022670 Ga0495632_0022670_187_948 232
172 3300046524 Ga0495648_0134160 Ga0495648_0134160_443_1204 232
173 3300046538 Ga0495609_0116715 Ga0495609_0116715_254_1015 232
174 3300046616 Ga0495668_0023779 Ga0495668_0023779_1391_2152 232
175 3300046648 Ga0495611_0116281 Ga0495611_0116281_453_1214 232
176 3300046660 Ga0495625_0017209 Ga0495625_0017209_1434_2195 232
177 3300046691 Ga0495670_0130511 Ga0495670_0130511_524_1285 232
178 3300046810 Ga0495660_0026320 Ga0495660_0026320_1839_2600 232
179 3300047445 Ga0495677_0048032 Ga0495677_0048032_70_831 232
180 3300048912 Ga0496109_0040980 Ga0496109_0040980_62_799 232
181 3300049459 Ga0495678_024007 Ga0495678_024007_361_1122 232
182 3300053105 Ga0500557_020936 Ga0500557_020936_553_1314 232
183 3300053118 Ga0500594_0006878 Ga0500594_0006878_988_1749 232
184 3300053130 Ga0500642_0091146 Ga0500642_0091146_30_791 232
185 3300053146 Ga0500588_0107918 Ga0500588_0107918_178_939 232
186 3300049823 Ga0501044_0415062 Ga0501044_0415062_185_943 233
187 3300005983 Ga0081540_1011095 Ga0081540_10110955 235
188 3300034818 Ga0373950_0014391 Ga0373950_0014391_330_1067 235
189 3300046457 Ga0495590_0002579 Ga0495590_0002579_1535_2287 235
190 3300047318 Ga0495636_0043692 Ga0495636_0043692_778_1539 235
191 3300047320 Ga0495672_0028555 Ga0495672_0028555_510_1271 235
192 3300003911 JGI25405J52794_10016886 JGI25405J52794_100168862 236
193 3300005438 Ga0070701_10411171 Ga0070701_104111711 236
194 3300005445 Ga0070708_100113795 Ga0070708_1001137953 236
195 3300005937 Ga0081455_10012017 Ga0081455_100120174 236
196 3300005937 Ga0081455_10056729 Ga0081455_100567291 236
197 3300005983 Ga0081540_1050829 Ga0081540_10508292 236
198 3300006058 Ga0075432_10000873 Ga0075432_100008732 236
199 3300006844 Ga0075428_100035558 Ga0075428_1000355582 236
200 3300006846 Ga0075430_100004696 Ga0075430_1000046962 236
201 3300006847 Ga0075431_100006639 Ga0075431_1000066392 236
202 3300006852 Ga0075433_10001599 Ga0075433_1000159910 236
203 3300006871 Ga0075434_100000576 Ga0075434_10000057619 236
204 3300006880 Ga0075429_100060828 Ga0075429_1000608282 236
205 3300007076 Ga0075435_100002716 Ga0075435_1000027166 236
206 3300009094 Ga0111539_10000503 Ga0111539_1000050332 236
207 3300009147 Ga0114129_10009008 Ga0114129_1000900814 236
208 3300009147 Ga0114129_10013874 Ga0114129_1001387410 236
209 3300027907 Ga0207428_10000114 Ga0207428_1000011470 236
210 3300044656 Ga0466969_0152944 Ga0466969_0152944_74_820 236
211 3300044684 Ga0466966_0014495 Ga0466966_0014495_1459_2205 236
212 3300044719 Ga0466971_0016255 Ga0466971_0016255_1187_1933 236
213 3300045049 Ga0466959_0057725 Ga0466959_0057725_1886_2632 236
214 3300046460 Ga0495638_0002787 Ga0495638_0002787_9328_10080 236
215 3300050507 nmdc:mga05p37_13519_c1 nmdc:mga05p37_13519_c1_3837_4574 236
216 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_35633_36370 236
217 3300050508 nmdc:mga09592_976_c1 nmdc:mga09592_976_c1_7006_7743 236
218 3300050509 nmdc:mga0qj67_4772_c1 nmdc:mga0qj67_4772_c1_1153_1890 236
219 3300050510 nmdc:mga06r32_34244_c1 nmdc:mga06r32_34244_c1_1251_1988 236
220 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_9670_10407 236
221 3300050512 nmdc:mga0n895_51689_c1 nmdc:mga0n895_51689_c1_2271_3008 236
222 3300050512 nmdc:mga0n895_5847_c1 nmdc:mga0n895_5847_c1_7480_8217 236
223 3300050513 nmdc:mga0rr50_154672_c1 nmdc:mga0rr50_154672_c1_266_1003 236
224 3300050515 nmdc:mga0a205_11514_c1 nmdc:mga0a205_11514_c1_2227_2964 236
225 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_42601_43338 236
226 3300053108 Ga0500562_011565 Ga0500562_011565_722_1474 236
227 3300053139 Ga0500568_0005193 Ga0500568_0005193_1602_2354 236
228 3300053158 Ga0500627_0015729 Ga0500627_0015729_967_1719 236
229 3300005355 Ga0070671_100197434 Ga0070671_1001974342 237
230 3300006028 Ga0070717_10616900 Ga0070717_106169001 237
231 3300014968 Ga0157379_10147615 Ga0157379_101476152 237
232 3300026118 Ga0207675_100312265 Ga0207675_1003122653 237
233 3300031250 Ga0265331_10001870 Ga0265331_100018707 237
234 3300031595 Ga0265313_10004127 Ga0265313_100041276 237
235 3300031711 Ga0265314_10027436 Ga0265314_100274361 237
236 3300031712 Ga0265342_10052084 Ga0265342_100520843 237
237 3300037853 Ga0436364_1391236 Ga0436364_1391236_1184_1927 237
238 iso_pu_bacteria 2842733646 2842738235 237
239 3300009176 Ga0105242_10230382 Ga0105242_102303822 238
240 3300009177 Ga0105248_10167723 Ga0105248_101677232 238
241 3300009553 Ga0105249_10142930 Ga0105249_101429302 238
242 3300013306 Ga0163162_10093404 Ga0163162_100934042 238
243 3300013307 Ga0157372_10023483 Ga0157372_100234835 238
244 3300014325 Ga0163163_10032174 Ga0163163_100321742 238
245 3300025911 Ga0207654_10025064 Ga0207654_100250642 238
246 3300025961 Ga0207712_10346974 Ga0207712_103469742 238
247 3300025986 Ga0207658_10494495 Ga0207658_104944952 238
248 3300031249 Ga0265339_10099784 Ga0265339_100997842 238
249 3300031344 Ga0265316_10149979 Ga0265316_101499793 238
250 3300009098 Ga0105245_10113448 Ga0105245_101134482 239
251 3300009177 Ga0105248_10021002 Ga0105248_100210022 239
252 3300009551 Ga0105238_10019606 Ga0105238_100196064 239
253 3300009553 Ga0105249_10007626 Ga0105249_100076269 239
254 3300011119 Ga0105246_10009274 Ga0105246_100092744 239
255 3300025321 Ga0207656_10262794 Ga0207656_102627941 239
256 3300025924 Ga0207694_10011454 Ga0207694_100114544 239
257 3300025927 Ga0207687_10027744 Ga0207687_100277443 239
258 3300025941 Ga0207711_10005310 Ga0207711_1000531011 239
259 3300025961 Ga0207712_10024382 Ga0207712_100243825 239
260 3300031911 Ga0307412_10261302 Ga0307412_102613022 239
261 3300032002 Ga0307416_100763014 Ga0307416_1007630142 239
262 3300033179 Ga0307507_10189955 Ga0307507_101899552 239
263 3300049588 Ga0501072_0191989 Ga0501072_0191989_117_848 239
264 3300049742 Ga0501080_0393713 Ga0501080_0393713_480_1211 239
265 3300001989 JGI24739J22299_10014140 JGI24739J22299_100141401 240
266 3300005327 Ga0070658_10007004 Ga0070658_100070043 240
267 3300005336 Ga0070680_100004099 Ga0070680_10000409910 240
268 3300005341 Ga0070691_10010361 Ga0070691_100103612 240
269 3300005530 Ga0070679_100009091 Ga0070679_1000090916 240
270 3300005530 Ga0070679_100784827 Ga0070679_1007848271 240
271 3300005577 Ga0068857_100336134 Ga0068857_1003361342 240
272 3300006048 Ga0075363_100096961 Ga0075363_1000969612 240
273 3300009036 Ga0105244_10159346 Ga0105244_101593461 240
274 3300009092 Ga0105250_10061706 Ga0105250_100617062 240
275 3300009093 Ga0105240_10014101 Ga0105240_100141019 240
276 3300009093 Ga0105240_10068510 Ga0105240_100685103 240
277 3300009094 Ga0111539_10000082 Ga0111539_1000008216 240
278 3300009098 Ga0105245_10000780 Ga0105245_1000078015 240
279 3300009101 Ga0105247_10002726 Ga0105247_100027265 240
280 3300009148 Ga0105243_10001083 Ga0105243_1000108316 240
281 3300009174 Ga0105241_10000760 Ga0105241_1000076015 240
282 3300009177 Ga0105248_10011305 Ga0105248_100113055 240
283 3300009545 Ga0105237_10006171 Ga0105237_1000617113 240
284 3300009553 Ga0105249_10002196 Ga0105249_100021967 240
285 3300010375 Ga0105239_10002791 Ga0105239_1000279114 240
286 3300011119 Ga0105246_10001585 Ga0105246_1000158515 240
287 3300013100 Ga0157373_10006240 Ga0157373_100062408 240
288 3300013102 Ga0157371_10085248 Ga0157371_100852483 240
289 3300013296 Ga0157374_10001691 Ga0157374_1000169112 240
290 3300013297 Ga0157378_10001445 Ga0157378_1000144511 240
291 3300013306 Ga0163162_10000790 Ga0163162_1000079012 240
292 3300013307 Ga0157372_10009037 Ga0157372_100090377 240
293 3300013308 Ga0157375_10000468 Ga0157375_1000046822 240
294 3300014325 Ga0163163_10003322 Ga0163163_1000332218 240
295 3300014326 Ga0157380_10002913 Ga0157380_100029138 240
296 3300014745 Ga0157377_10000276 Ga0157377_1000027616 240
297 3300014968 Ga0157379_10002285 Ga0157379_1000228511 240
298 3300014969 Ga0157376_10000692 Ga0157376_100006925 240
299 3300025909 Ga0207705_10008972 Ga0207705_100089726 240
300 3300025912 Ga0207707_10001464 Ga0207707_1000146417 240
301 3300025917 Ga0207660_10006940 Ga0207660_100069407 240
302 3300025921 Ga0207652_10016838 Ga0207652_100168386 240
303 3300025949 Ga0207667_10024372 Ga0207667_100243722 240
304 3300026078 Ga0207702_10324710 Ga0207702_103247102 240
305 3300034818 Ga0373950_0012337 Ga0373950_0012337_255_977 240
306 3300034819 Ga0373958_0002841 Ga0373958_0002841_273_995 240
307 3300034957 Ga0373938_0002852 Ga0373938_0002852_1206_1928 240
308 3300034957 Ga0373938_0009646 Ga0373938_0009646_1021_1743 240
309 3300035084 Ga0373928_0004477 Ga0373928_0004477_315_1037 240
310 3300035085 Ga0373929_0002872 Ga0373929_0002872_1563_2285 240
311 3300035085 Ga0373929_0003760 Ga0373929_0003760_491_1213 240
312 3300035088 Ga0373940_0026893 Ga0373940_0026893_98_820 240
313 3300035090 Ga0373949_0001450 Ga0373949_0001450_4337_5059 240
314 3300035091 Ga0373951_0011607 Ga0373951_0011607_177_899 240
315 3300035112 Ga0373932_0001864 Ga0373932_0001864_636_1358 240
316 3300035114 Ga0373939_0000339 Ga0373939_0000339_2705_3427 240
317 3300035114 Ga0373939_0009371 Ga0373939_0009371_672_1394 240
318 3300035115 Ga0373941_0002285 Ga0373941_0002285_1426_2148 240
319 3300035115 Ga0373941_0017574 Ga0373941_0017574_837_1559 240
320 3300035170 Ga0373943_0016793 Ga0373943_0016793_1679_2401 240
321 3300035207 Ga0373942_0003994 Ga0373942_0003994_1718_2440 240
322 3300035241 Ga0373961_0003896 Ga0373961_0003896_1322_2044 240
323 3300035242 Ga0373962_0005133 Ga0373962_0005133_617_1339 240
324 3300035242 Ga0373962_0006682 Ga0373962_0006682_442_1164 240
325 3300035691 Ga0373931_0000169 Ga0373931_0000169_18130_18852 240
326 3300035691 Ga0373931_0056827 Ga0373931_0056827_462_1184 240
327 3300035695 Ga0373927_0016232 Ga0373927_0016232_2030_2752 240
328 3300035725 Ga0373947_0005580 Ga0373947_0005580_93_815 240
329 3300036401 Ga0373937_0038298 Ga0373937_0038298_1868_2590 240
330 3300037068 Ga0373925_0009626 Ga0373925_0009626_6219_6941 240
331 3300037312 Ga0395899_0202627 Ga0395899_0202627_278_1033 240
332 3300037418 Ga0395900_0450445 Ga0395900_0450445_206_961 240
333 3300046459 Ga0495629_0000535 Ga0495629_0000535_14420_15142 240
334 3300046459 Ga0495629_0081599 Ga0495629_0081599_100_822 240
335 3300046463 Ga0495653_0154948 Ga0495653_0154948_549_1271 240
336 3300046475 Ga0495639_0026471 Ga0495639_0026471_808_1530 240
337 3300046511 Ga0495608_0039849 Ga0495608_0039849_930_1652 240
338 3300046559 Ga0495667_0024955 Ga0495667_0024955_1960_2682 240
339 3300046681 Ga0495647_0024629 Ga0495647_0024629_1125_1847 240
340 3300046683 Ga0495658_0000788 Ga0495658_0000788_2663_3385 240
341 3300046684 Ga0495669_0031148 Ga0495669_0031148_1091_1813 240
342 3300046689 Ga0495613_0257921 Ga0495613_0257921_216_938 240
343 3300047317 Ga0495604_0028398 Ga0495604_0028398_2539_3261 240
344 3300047321 Ga0495676_0076650 Ga0495676_0076650_1053_1775 240
345 3300047322 Ga0495680_0011254 Ga0495680_0011254_4881_5603 240
346 3300047322 Ga0495680_0088135 Ga0495680_0088135_321_1043 240
347 3300048088 Ga0495602_0107280 Ga0495602_0107280_291_1013 240
348 3300048903 Ga0496100_0000106 Ga0496100_0000106_35986_36708 240
349 3300048904 Ga0496101_0000992 Ga0496101_0000992_9402_10124 240
350 3300048904 Ga0496101_0591310 Ga0496101_0591310_74_796 240
351 3300048905 Ga0496102_0011236 Ga0496102_0011236_4689_5411 240
352 3300048906 Ga0496103_0006368 Ga0496103_0006368_4094_4816 240
353 3300048906 Ga0496103_0196082 Ga0496103_0196082_521_1243 240
354 3300048907 Ga0496104_0000090 Ga0496104_0000090_74859_75581 240
355 3300048907 Ga0496104_0113779 Ga0496104_0113779_1069_1791 240
356 3300048908 Ga0496105_0001574 Ga0496105_0001574_4191_4913 240
357 3300048908 Ga0496105_0248474 Ga0496105_0248474_599_1321 240
358 3300048909 Ga0496106_0002499 Ga0496106_0002499_9630_10352 240
359 3300048910 Ga0496107_0000223 Ga0496107_0000223_7556_8278 240
360 3300048911 Ga0496108_0003914 Ga0496108_0003914_1970_2692 240
361 3300048911 Ga0496108_0203837 Ga0496108_0203837_729_1451 240
362 3300048912 Ga0496109_0014846 Ga0496109_0014846_2262_2984 240
363 3300048912 Ga0496109_0016176 Ga0496109_0016176_500_1222 240
364 3300048913 Ga0496110_0046530 Ga0496110_0046530_2115_2837 240
365 3300048915 Ga0496112_0281134 Ga0496112_0281134_673_1395 240
366 3300048916 Ga0496113_0006216 Ga0496113_0006216_3501_4223 240
367 3300048916 Ga0496113_0085943 Ga0496113_0085943_1050_1772 240
368 3300048917 Ga0496114_0006841 Ga0496114_0006841_6347_7069 240
369 3300048918 Ga0496115_0021146 Ga0496115_0021146_2190_2912 240
370 3300048918 Ga0496115_0021880 Ga0496115_0021880_970_1692 240
371 3300048918 Ga0496115_0073152 Ga0496115_0073152_768_1490 240
372 3300049579 Ga0501043_0204925 Ga0501043_0204925_520_1389 240
373 3300049581 Ga0501047_0272559 Ga0501047_0272559_254_1084 240
374 3300050494 nmdc:mga06z11_1795_c1 nmdc:mga06z11_1795_c1_4410_5132 240
375 3300050511 nmdc:mga08y16_2396_c1 nmdc:mga08y16_2396_c1_8371_9093 240
376 3300050512 nmdc:mga0n895_327311_c1 nmdc:mga0n895_327311_c1_217_939 240
377 3300050513 nmdc:mga0rr50_44591_c1 nmdc:mga0rr50_44591_c1_551_1273 240
378 3300050514 nmdc:mga08x19_379394_c1 nmdc:mga08x19_379394_c1_231_953 240
379 3300053077 Ga0495601_0007151 Ga0495601_0007151_2508_3230 240
380 3300053078 Ga0495612_0038379 Ga0495612_0038379_1149_1871 240
381 3300053084 Ga0495595_0003989 Ga0495595_0003989_2053_2775 240
382 3300053085 Ga0495619_0000375 Ga0495619_0000375_12474_13196 240
383 3300053085 Ga0495619_0002471 Ga0495619_0002471_11209_11931 240
384 3300053108 Ga0500562_049758 Ga0500562_049758_52_786 240
385 3300053731 Ga0500609_004193 Ga0500609_004193_433_1188 240
386 3300053733 Ga0500552_009611 Ga0500552_009611_159_914 240
387 iso_pu_bacteria 2554235132 2554814217 240
388 iso_pu_bacteria 2606217733 2608381617 240
389 iso_pu_bacteria 2643221652 2644292306 240
390 iso_pu_bacteria 2811994881 2812371531 240
391 iso_pu_bacteria 2923519811 2923525647 240
392 iso_pu_bacteria 8011350971 8011355375 240
393 iso_pu_bacteria 8045864390 8045868996 240
394 3300003322 rootL2_10099291 rootL2_100992912 241
395 3300003781 Ga0055536_1008523 Ga0055536_10085235 241
396 3300003784 Ga0055534_1000464 Ga0055534_100046412 241
397 3300006038 Ga0075365_10304165 Ga0075365_103041652 241
398 3300006195 Ga0075366_10128560 Ga0075366_101285602 241
399 3300009174 Ga0105241_10678471 Ga0105241_106784711 241
400 3300013306 Ga0163162_10134911 Ga0163162_101349115 241
401 3300025284 Ga0209130_1001541 Ga0209130_10015412 241
402 3300025291 Ga0209675_1002318 Ga0209675_100231812 241
403 3300025292 Ga0209676_1011115 Ga0209676_10111152 241
404 3300025297 Ga0209758_1040778 Ga0209758_10407782 241
405 3300025298 Ga0209050_1037713 Ga0209050_10377132 241
406 3300025303 Ga0209051_1007087 Ga0209051_10070876 241
407 3300025304 Ga0209257_1021446 Ga0209257_10214462 241
408 3300025903 Ga0207680_10151416 Ga0207680_101514162 241
409 3300026023 Ga0207677_10021038 Ga0207677_100210385 241
410 3300031251 Ga0265327_10002224 Ga0265327_1000222412 241
411 3300037312 Ga0395899_0052474 Ga0395899_0052474_2216_2962 241
412 3300037312 Ga0395899_0107269 Ga0395899_0107269_530_1288 241
413 3300037312 Ga0395899_0186411 Ga0395899_0186411_447_1205 241
414 3300037418 Ga0395900_0005219 Ga0395900_0005219_7232_7978 241
415 3300037418 Ga0395900_0179779 Ga0395900_0179779_693_1451 241
416 3300037466 Ga0395898_0003156 Ga0395898_0003156_4271_5017 241
417 3300037466 Ga0395898_0011599 Ga0395898_0011599_3944_4702 241
418 3300037466 Ga0395898_0086896 Ga0395898_0086896_1618_2364 241
419 3300037471 Ga0395905_0051198 Ga0395905_0051198_2481_3227 241
420 3300037471 Ga0395905_0070451 Ga0395905_0070451_751_1566 241
421 3300037471 Ga0395905_0090886 Ga0395905_0090886_507_1253 241
422 3300038443 Ga0395901_0000593 Ga0395901_0000593_32007_32765 241
423 3300038443 Ga0395901_0163403 Ga0395901_0163403_531_1277 241
424 3300038443 Ga0395901_0194575 Ga0395901_0194575_673_1431 241
425 3300038443 Ga0395901_0367986 Ga0395901_0367986_151_897 241
426 3300041404 Ga0439436_0037684 Ga0439436_0037684_49_795 241
427 3300041410 Ga0439461_0015906 Ga0439461_0015906_181_927 241
428 3300042001 Ga0439441_018364 Ga0439441_018364_91_837 241
429 3300042128 Ga0450897_009908 Ga0450897_009908_95_832 241
430 3300042134 Ga0450898_005994 Ga0450898_005994_1009_1755 241
431 3300042435 Ga0439434_0015569 Ga0439434_0015569_1361_2107 241
432 3300044673 Ga0453683_0002883 Ga0453683_0002883_1609_2355 241
433 3300044842 Ga0466957_0259493 Ga0466957_0259493_89_835 241
434 3300045051 Ga0451576_0004677 Ga0451576_0004677_6128_6874 241
435 3300045976 Ga0466967_0137994 Ga0466967_0137994_249_1004 241
436 3300049763 Ga0501266_009130 Ga0501266_009130_299_1045 241
437 3300049822 Ga0501035_0201180 Ga0501035_0201180_21_779 241
438 3300049823 Ga0501044_0196917 Ga0501044_0196917_500_1258 241
439 3300003794 Ga0055531_10001782 Ga0055531_100017827 242
440 3300005328 Ga0070676_10103970 Ga0070676_101039702 242
441 3300005331 Ga0070670_100321229 Ga0070670_1003212292 242
442 3300005333 Ga0070677_10010258 Ga0070677_100102582 242
443 3300005354 Ga0070675_100246730 Ga0070675_1002467302 242
444 3300005356 Ga0070674_100012815 Ga0070674_1000128154 242
445 3300005364 Ga0070673_100058559 Ga0070673_1000585593 242
446 3300005456 Ga0070678_100018286 Ga0070678_1000182864 242
447 3300005459 Ga0068867_100017280 Ga0068867_1000172805 242
448 3300005543 Ga0070672_100065787 Ga0070672_1000657873 242
449 3300005577 Ga0068857_100281877 Ga0068857_1002818772 242
450 3300005618 Ga0068864_100279994 Ga0068864_1002799942 242
451 3300006048 Ga0075363_100001113 Ga0075363_1000011132 242
452 3300006177 Ga0075362_10000122 Ga0075362_1000012210 242
453 3300006178 Ga0075367_10004445 Ga0075367_100044455 242
454 3300006195 Ga0075366_10019342 Ga0075366_100193423 242
455 3300009148 Ga0105243_10096320 Ga0105243_100963202 242
456 3300009148 Ga0105243_10481400 Ga0105243_104814002 242
457 3300009177 Ga0105248_10429777 Ga0105248_104297772 242
458 3300009551 Ga0105238_10021283 Ga0105238_100212835 242
459 3300014325 Ga0163163_10134668 Ga0163163_101346683 242
460 3300014325 Ga0163163_10148371 Ga0163163_101483712 242
461 3300014326 Ga0157380_10630896 Ga0157380_106308961 242
462 3300025303 Ga0209051_1001617 Ga0209051_100161712 242
463 3300025304 Ga0209257_1002499 Ga0209257_100249911 242
464 3300025893 Ga0207682_10000521 Ga0207682_1000052112 242
465 3300025900 Ga0207710_10142784 Ga0207710_101427841 242
466 3300025908 Ga0207643_10016129 Ga0207643_100161293 242
467 3300025918 Ga0207662_10037630 Ga0207662_100376303 242
468 3300025923 Ga0207681_10065126 Ga0207681_100651262 242
469 3300025926 Ga0207659_10066522 Ga0207659_100665222 242
470 3300025931 Ga0207644_10079676 Ga0207644_100796763 242
471 3300025937 Ga0207669_10041720 Ga0207669_100417204 242
472 3300025938 Ga0207704_10112038 Ga0207704_101120382 242
473 3300025940 Ga0207691_10129322 Ga0207691_101293222 242
474 3300025960 Ga0207651_10039537 Ga0207651_100395372 242
475 3300025986 Ga0207658_10782989 Ga0207658_107829891 242
476 3300026075 Ga0207708_10099362 Ga0207708_100993622 242
477 3300026088 Ga0207641_10141916 Ga0207641_101419161 242
478 3300026089 Ga0207648_10008536 Ga0207648_100085364 242
479 3300026095 Ga0207676_10236705 Ga0207676_102367052 242
480 3300026118 Ga0207675_100169240 Ga0207675_1001692402 242
481 3300026121 Ga0207683_10002066 Ga0207683_1000206614 242
482 3300031456 Ga0307513_10300298 Ga0307513_103002981 242
483 3300037466 Ga0395898_0000804 Ga0395898_0000804_32781_33539 242
484 3300038443 Ga0395901_0087898 Ga0395901_0087898_1027_1785 242
485 3300046539 Ga0495621_0005528 Ga0495621_0005528_706_1458 242
486 3300048090 Ga0495615_0002437 Ga0495615_0002437_1987_2739 242
487 3300048925 Ga0496122_0004785 Ga0496122_0004785_6181_6930 242
488 3300048926 Ga0496123_0000329 Ga0496123_0000329_9670_10419 242
489 3300048927 Ga0496124_0148716 Ga0496124_0148716_798_1547 242
490 3300049570 Ga0501033_0180842 Ga0501033_0180842_703_1437 242
491 3300049586 Ga0501070_0372851 Ga0501070_0372851_284_1018 242
492 3300049589 Ga0501073_0288906 Ga0501073_0288906_357_1091 242
493 3300049744 Ga0501083_0388712 Ga0501083_0388712_25_759 242
494 3300049823 Ga0501044_0163759 Ga0501044_0163759_1203_1937 242
495 3300049823 Ga0501044_0360960 Ga0501044_0360960_67_801 242
496 3300050490 nmdc:mga03n38_14483_c1 nmdc:mga03n38_14483_c1_429_1181 242
497 3300050493 nmdc:mga0k408_3983_c1 nmdc:mga0k408_3983_c1_5774_6526 242
498 3300053079 Ga0500610_0226643 Ga0500610_0226643_83_835 242
499 3300053096 Ga0500641_0006059 Ga0500641_0006059_1669_2421 242
500 3300053136 Ga0500559_0009761 Ga0500559_0009761_3281_4030 242
501 3300053147 Ga0500589_169386 Ga0500589_169386_69_821 242
502 iso_pu_bacteria 2513237144 2513912305 242
503 iso_pu_bacteria 2513237146 2513928511 242
504 iso_pu_bacteria 2599185170 2599420223 242
505 iso_pu_bacteria 2643221634 2644194900 242
506 iso_pu_bacteria 2791355256 2793295712 242
507 iso_pu_bacteria 2791355261 2793327201 242
508 iso_pu_bacteria 2791355262 2793332152 242
509 iso_pu_bacteria 2791355265 2793353943 242
510 iso_pu_bacteria 2838035591 2838040429 242
511 iso_pu_bacteria 2838661181 2838667843 242
512 iso_pu_bacteria 2842205361 2842207336 242
513 iso_pu_bacteria 2842278818 2842280953 242
514 iso_pu_bacteria 2842285085 2842288431 242
515 iso_pu_bacteria 2842402390 2842406223 242
516 iso_pu_bacteria 2842409023 2842412808 242
517 iso_pu_bacteria 2842415677 2842419313 242
518 iso_pu_bacteria 2854896431 2854897049 242
519 iso_pu_bacteria 2854916844 2854917195 242
520 iso_pu_bacteria 2933016740 2933021898 242
521 iso_pu_bacteria 3005409236 3005409558 242
522 iso_pu_bacteria 8005289223 8005295004 242
523 iso_pu_bacteria 8005382845 8005387854 242
524 iso_pu_bacteria 8005395548 8005400890 242
525 iso_pu_bacteria 8005430974 8005431021 242
526 iso_pu_bacteria 8056382006 8056383879 242
527 3300002773 JGI25152J39213_1003754 JGI25152J39213_10037542 243
528 3300003187 JGI25151J46595_10011807 JGI25151J46595_100118075 243
529 3300003187 JGI25151J46595_10044197 JGI25151J46595_100441972 243
530 3300003781 Ga0055536_1004740 Ga0055536_10047403 243
531 3300005327 Ga0070658_10068898 Ga0070658_100688984 243
532 3300005327 Ga0070658_10121287 Ga0070658_101212872 243
533 3300005336 Ga0070680_100099250 Ga0070680_1000992502 243
534 3300005336 Ga0070680_100264523 Ga0070680_1002645232 243
535 3300005339 Ga0070660_100227297 Ga0070660_1002272972 243
536 3300005340 Ga0070689_100341791 Ga0070689_1003417912 243
537 3300005344 Ga0070661_100130814 Ga0070661_1001308142 243
538 3300005366 Ga0070659_100107888 Ga0070659_1001078882 243
539 3300005435 Ga0070714_100110282 Ga0070714_1001102822 243
540 3300005458 Ga0070681_10092484 Ga0070681_100924843 243
541 3300005530 Ga0070679_100006957 Ga0070679_1000069574 243
542 3300005530 Ga0070679_100097400 Ga0070679_1000974004 243
543 3300005530 Ga0070679_100236656 Ga0070679_1002366562 243
544 3300005530 Ga0070679_100265204 Ga0070679_1002652042 243
545 3300005563 Ga0068855_100018421 Ga0068855_1000184214 243
546 3300005563 Ga0068855_100094398 Ga0068855_1000943983 243
547 3300005563 Ga0068855_100263165 Ga0068855_1002631653 243
548 3300005577 Ga0068857_100351722 Ga0068857_1003517222 243
549 3300005578 Ga0068854_100112791 Ga0068854_1001127911 243
550 3300005614 Ga0068856_100144924 Ga0068856_1001449242 243
551 3300005616 Ga0068852_100118580 Ga0068852_1001185803 243
552 3300005616 Ga0068852_100230669 Ga0068852_1002306693 243
553 3300006038 Ga0075365_10062820 Ga0075365_100628204 243
554 3300006178 Ga0075367_10034749 Ga0075367_100347493 243
555 3300009551 Ga0105238_10013907 Ga0105238_100139076 243
556 3300009766 Ga0123342_1007031 Ga0123342_10070315 243
557 3300013102 Ga0157371_10085742 Ga0157371_100857423 243
558 3300013102 Ga0157371_10443528 Ga0157371_104435282 243
559 3300013104 Ga0157370_10092033 Ga0157370_100920334 243
560 3300013104 Ga0157370_10344776 Ga0157370_103447762 243
561 3300013104 Ga0157370_10649341 Ga0157370_106493411 243
562 3300013105 Ga0157369_10269257 Ga0157369_102692573 243
563 3300020070 Ga0206356_10010133 Ga0206356_100101332 243
564 3300020082 Ga0206353_11031164 Ga0206353_110311642 243
565 3300025258 Ga0209129_1000118 Ga0209129_100011898 243
566 3300025284 Ga0209130_1025592 Ga0209130_10255922 243
567 3300025292 Ga0209676_1013366 Ga0209676_10133663 243
568 3300025294 Ga0209025_1000617 Ga0209025_100061751 243
569 3300025294 Ga0209025_1041288 Ga0209025_10412881 243
570 3300025295 Ga0209564_1012515 Ga0209564_10125154 243
571 3300025909 Ga0207705_10098196 Ga0207705_100981963 243
572 3300025912 Ga0207707_10226903 Ga0207707_102269032 243
573 3300025912 Ga0207707_10271360 Ga0207707_102713602 243
574 3300025921 Ga0207652_10028066 Ga0207652_100280664 243
575 3300025921 Ga0207652_10075123 Ga0207652_100751234 243
576 3300025921 Ga0207652_10595059 Ga0207652_105950592 243
577 3300025924 Ga0207694_10024241 Ga0207694_100242416 243
578 3300025929 Ga0207664_10430438 Ga0207664_104304382 243
579 3300025949 Ga0207667_10047002 Ga0207667_100470021 243
580 3300025949 Ga0207667_10105591 Ga0207667_101055912 243
581 3300025949 Ga0207667_10106876 Ga0207667_101068763 243
582 3300025981 Ga0207640_10096880 Ga0207640_100968803 243
583 3300026067 Ga0207678_10500729 Ga0207678_105007292 243
584 3300026078 Ga0207702_10128627 Ga0207702_101286272 243
585 3300026078 Ga0207702_10496893 Ga0207702_104968932 243
586 3300026078 Ga0207702_10720177 Ga0207702_107201772 243
587 3300026142 Ga0207698_10070852 Ga0207698_100708522 243
588 3300028379 Ga0268266_10201484 Ga0268266_102014843 243
589 3300028577 Ga0265318_10012048 Ga0265318_100120482 243
590 3300028800 Ga0265338_10137794 Ga0265338_101377943 243
591 3300031235 Ga0265330_10029569 Ga0265330_100295692 243
592 3300031235 Ga0265330_10030972 Ga0265330_100309722 243
593 3300031238 Ga0265332_10134827 Ga0265332_101348271 243
594 3300031240 Ga0265320_10021158 Ga0265320_100211584 243
595 3300031241 Ga0265325_10068734 Ga0265325_100687342 243
596 3300031242 Ga0265329_10096506 Ga0265329_100965061 243
597 3300031249 Ga0265339_10026539 Ga0265339_100265392 243
598 3300031250 Ga0265331_10022567 Ga0265331_100225672 243
599 3300031344 Ga0265316_10161738 Ga0265316_101617382 243
600 3300031595 Ga0265313_10053271 Ga0265313_100532712 243
601 3300031711 Ga0265314_10105082 Ga0265314_101050822 243
602 3300031712 Ga0265342_10000763 Ga0265342_1000076335 243
603 3300031712 Ga0265342_10038340 Ga0265342_100383402 243
604 3300031712 Ga0265342_10056611 Ga0265342_100566112 243
605 3300037312 Ga0395899_0124191 Ga0395899_0124191_87_818 243
606 3300037466 Ga0395898_0014510 Ga0395898_0014510_3815_4546 243
607 3300038443 Ga0395901_0262468 Ga0395901_0262468_672_1403 243
608 3300041404 Ga0439436_0032846 Ga0439436_0032846_433_1185 243
609 3300041413 Ga0439465_0018105 Ga0439465_0018105_1120_1872 243
610 3300041413 Ga0439465_0020970 Ga0439465_0020970_822_1583 243
611 3300042006 Ga0439432_058230 Ga0439432_058230_123_875 243
612 3300042007 Ga0439449_0036981 Ga0439449_0036981_756_1517 243
613 3300046471 Ga0495650_0028303 Ga0495650_0028303_1018_1770 243
614 3300046492 Ga0495585_0105342 Ga0495585_0105342_478_1230 243
615 3300046507 Ga0495606_0134974 Ga0495606_0134974_472_1233 243
616 3300046558 Ga0495633_0040050 Ga0495633_0040050_377_1129 243
617 3300046660 Ga0495625_0099008 Ga0495625_0099008_374_1126 243
618 3300046665 Ga0495661_0066043 Ga0495661_0066043_1007_1759 243
619 3300047443 Ga0495687_046987 Ga0495687_046987_823_1575 243
620 3300048924 Ga0496121_0050228 Ga0496121_0050228_1042_1803 243
621 3300048926 Ga0496123_0084360 Ga0496123_0084360_56_817 243
622 3300048929 Ga0496126_0021159 Ga0496126_0021159_1243_1995 243
623 3300048929 Ga0496126_0106930 Ga0496126_0106930_1442_2203 243
624 3300049568 Ga0501031_0007403 Ga0501031_0007403_4914_5657 243
625 3300049569 Ga0501032_0001244 Ga0501032_0001244_18084_18827 243
626 3300049570 Ga0501033_0000075 Ga0501033_0000075_67653_68396 243
627 3300049571 Ga0501034_0000760 Ga0501034_0000760_15017_15760 243
628 3300049571 Ga0501034_0280292 Ga0501034_0280292_255_1028 243
629 3300049572 Ga0501036_0000105 Ga0501036_0000105_34899_35642 243
630 3300049573 Ga0501037_0001098 Ga0501037_0001098_1173_1916 243
631 3300049574 Ga0501038_0002155 Ga0501038_0002155_11442_12185 243
632 3300049575 Ga0501039_0001038 Ga0501039_0001038_1507_2250 243
633 3300049579 Ga0501043_0000017 Ga0501043_0000017_129656_130399 243
634 3300049580 Ga0501046_0000215 Ga0501046_0000215_11504_12247 243
635 3300049581 Ga0501047_0002474 Ga0501047_0002474_15173_15916 243
636 3300049581 Ga0501047_0009616 Ga0501047_0009616_7588_8319 243
637 3300049582 Ga0501048_0008070 Ga0501048_0008070_1738_2481 243
638 3300049583 Ga0501067_0000168 Ga0501067_0000168_34697_35440 243
639 3300049584 Ga0501068_0005835 Ga0501068_0005835_1075_1818 243
640 3300049585 Ga0501069_0004666 Ga0501069_0004666_210_953 243
641 3300049586 Ga0501070_0001274 Ga0501070_0001274_13307_14050 243
642 3300049587 Ga0501071_0065933 Ga0501071_0065933_1025_1768 243
643 3300049588 Ga0501072_0007217 Ga0501072_0007217_1411_2154 243
644 3300049589 Ga0501073_0001048 Ga0501073_0001048_13129_13872 243
645 3300049590 Ga0501074_0007807 Ga0501074_0007807_6339_7082 243
646 3300049592 Ga0501076_0147833 Ga0501076_0147833_607_1350 243
647 3300049741 Ga0501079_0024258 Ga0501079_0024258_2428_3171 243
648 3300049742 Ga0501080_0075828 Ga0501080_0075828_1016_1759 243
649 3300049742 Ga0501080_0447518 Ga0501080_0447518_256_999 243
650 3300049744 Ga0501083_0077570 Ga0501083_0077570_380_1123 243
651 3300049822 Ga0501035_0000731 Ga0501035_0000731_28042_28785 243
652 3300049823 Ga0501044_0000329 Ga0501044_0000329_50386_51129 243
653 3300049823 Ga0501044_0030272 Ga0501044_0030272_3410_4141 243
654 3300049823 Ga0501044_0352360 Ga0501044_0352360_463_1206 243
655 3300049824 Ga0501045_0083231 Ga0501045_0083231_133_876 243
656 3300050492 nmdc:mga0yw44_86133_c1 nmdc:mga0yw44_86133_c1_132_893 243
657 3300053125 Ga0500618_010091 Ga0500618_010091_868_1629 243
658 3300053145 Ga0500586_066588 Ga0500586_066588_380_1141 243
659 3300054114 Ga0501084_0099825 Ga0501084_0099825_1498_2241 243
660 3300060353 Ga0501082_0081394 Ga0501082_0081394_487_1230 243
661 3300060353 Ga0501082_0086383 Ga0501082_0086383_1358_2119 243
662 iso_pu_bacteria 2582581316 2585334226 243
663 iso_pu_bacteria 2643221623 2644131596 243
664 iso_pu_bacteria 2738543024 2739306049 243
665 iso_pu_bacteria 2795385470 2795781023 243
666 iso_pu_bacteria 2847670302 2847673764 243
667 iso_pu_bacteria 2847686936 2847690196 243
668 iso_pu_bacteria 2856314179 2856320585 243
669 iso_pu_bacteria 2856356410 2856363995 243
670 iso_pu_bacteria 2856364286 2856365062 243
671 iso_pu_bacteria 2857349434 2857353260 243
672 iso_pu_bacteria 2869285874 2869286314 243
673 iso_pu_bacteria 2871429161 2871430283 243
674 iso_pu_bacteria 2874102143 2874103375 243
675 iso_pu_bacteria 2874146452 2874146700 243
676 iso_pu_bacteria 2874155637 2874155774 243
677 iso_pu_bacteria 2876369609 2876374886 243
678 iso_pu_bacteria 2876377896 2876381549 243
679 iso_pu_bacteria 2876392853 2876399171 243
680 iso_pu_bacteria 2876413966 2876414103 243
681 iso_pu_bacteria 2878035449 2878039000 243
682 iso_pu_bacteria 2878745973 2878746479 243
683 iso_pu_bacteria 2881147464 2881148537 243
684 iso_pu_bacteria 2881161766 2881165269 243
685 iso_pu_bacteria 2881861095 2881864765 243
686 iso_pu_bacteria 2885305155 2885307178 243
687 iso_pu_bacteria 2885318864 2885323338 243
688 iso_pu_bacteria 2885326080 2885330899 243
689 iso_pu_bacteria 2885334103 2885336951 243
690 iso_pu_bacteria 2888350351 2888353532 243
691 iso_pu_bacteria 2889010040 2889015249 243
692 iso_pu_bacteria 2889016732 2889019674 243
693 iso_pu_bacteria 2903492973 2903499812 243
694 iso_pu_bacteria 2904659560 2904665698 243
695 iso_pu_bacteria 2906308376 2906308880 243
696 iso_pu_bacteria 2906321335 2906322160 243
697 iso_pu_bacteria 2906328253 2906333946 243
698 iso_pu_bacteria 2906354277 2906358160 243
699 iso_pu_bacteria 2906414383 2906421364 243
700 iso_pu_bacteria 2922130491 2922136500 243
701 iso_pu_bacteria 2922158528 2922160438 243
702 iso_pu_bacteria 2924726620 2924732197 243
703 iso_pu_bacteria 2924784321 2924790874 243
704 iso_pu_bacteria 2937813078 2937822219 243
705 iso_pu_bacteria 2937891427 2937897802 243
706 iso_pu_bacteria 2938014810 2938019639 243
707 iso_pu_bacteria 2958041894 2958052467 243
708 iso_pu_bacteria 2958100919 2958104036 243
709 iso_pu_bacteria 2958115193 2958120368 243
710 iso_pu_bacteria 2958130278 2958130713 243
711 iso_pu_bacteria 2958172287 2958173962 243
712 iso_pu_bacteria 2958179912 2958180052 243
713 iso_pu_bacteria 2961077736 2961077879 243
714 iso_pu_bacteria 2961114664 2961121041 243
715 iso_pu_bacteria 2965062239 2965063703 243
716 iso_pu_bacteria 2965119406 2965127011 243
717 iso_pu_bacteria 2968091066 2968093479 243
718 iso_pu_bacteria 2968097103 2968100197 243
719 iso_pu_bacteria 2968110612 2968117191 243
720 iso_pu_bacteria 2968128360 2968129602 243
721 iso_pu_bacteria 2977828996 2977834494 243
722 iso_pu_bacteria 2977843712 2977844284 243
723 iso_pu_bacteria 2977858184 2977858540 243
724 iso_pu_bacteria 2977942078 2977942407 243
725 iso_pu_bacteria 2977971508 2977973925 243
726 iso_pu_bacteria 2977986579 2977988018 243
727 iso_pu_bacteria 2979710463 2979711713 243
728 iso_pu_bacteria 2979742915 2979749854 243
729 iso_pu_bacteria 2979779861 2979780967 243
730 iso_pu_bacteria 2987636660 2987641852 243
731 iso_pu_bacteria 2987652177 2987658627 243
732 iso_pu_bacteria 2996341866 2996346025 243
733 iso_pu_bacteria 3004203850 3004209336 243
734 iso_pu_bacteria 8002285264 8002291837 243
735 iso_pu_bacteria 8004387939 8004388660 243
736 iso_pu_bacteria 8004445564 8004450844 243
737 iso_pu_bacteria 8004703790 8004706475 243
738 iso_pu_bacteria 8004714634 8004715136 243
739 3300002705 JGI25156J39149_1007168 JGI25156J39149_10071682 244
740 3300002741 JGI25157J39369_1002448 JGI25157J39369_10024483 244
741 3300003214 JGI25165J46597_1000052 JGI25165J46597_1000052225 244
742 3300005327 Ga0070658_10038546 Ga0070658_100385462 244
743 3300005336 Ga0070680_100117098 Ga0070680_1001170981 244
744 3300005339 Ga0070660_100004143 Ga0070660_1000041439 244
745 3300005344 Ga0070661_100171662 Ga0070661_1001716622 244
746 3300005354 Ga0070675_100053571 Ga0070675_1000535713 244
747 3300005355 Ga0070671_100231824 Ga0070671_1002318242 244
748 3300005356 Ga0070674_100029715 Ga0070674_1000297153 244
749 3300005434 Ga0070709_10236320 Ga0070709_102363201 244
750 3300005455 Ga0070663_100054747 Ga0070663_1000547472 244
751 3300005457 Ga0070662_100165636 Ga0070662_1001656361 244
752 3300005458 Ga0070681_10092722 Ga0070681_100927222 244
753 3300005459 Ga0068867_100349822 Ga0068867_1003498222 244
754 3300005539 Ga0068853_100005223 Ga0068853_1000052237 244
755 3300005539 Ga0068853_100232654 Ga0068853_1002326542 244
756 3300005547 Ga0070693_100291868 Ga0070693_1002918682 244
757 3300005563 Ga0068855_100136866 Ga0068855_1001368662 244
758 3300005564 Ga0070664_100106972 Ga0070664_1001069722 244
759 3300005577 Ga0068857_100016644 Ga0068857_1000166442 244
760 3300005578 Ga0068854_100080315 Ga0068854_1000803153 244
761 3300005614 Ga0068856_100035175 Ga0068856_1000351752 244
762 3300005834 Ga0068851_10038538 Ga0068851_100385383 244
763 3300006038 Ga0075365_10101999 Ga0075365_101019992 244
764 3300006186 Ga0075369_10205047 Ga0075369_102050472 244
765 3300006358 Ga0068871_100232041 Ga0068871_1002320413 244
766 3300009174 Ga0105241_10072064 Ga0105241_100720642 244
767 3300009545 Ga0105237_10038056 Ga0105237_100380565 244
768 3300009551 Ga0105238_10024469 Ga0105238_100244693 244
769 3300009551 Ga0105238_10632641 Ga0105238_106326412 244
770 3300010375 Ga0105239_10047454 Ga0105239_100474545 244
771 3300013104 Ga0157370_10103800 Ga0157370_101038003 244
772 3300013105 Ga0157369_10959270 Ga0157369_109592701 244
773 3300013307 Ga0157372_10232691 Ga0157372_102326912 244
774 3300025250 Ga0209026_1000032 Ga0209026_100003290 244
775 3300025256 Ga0209759_1000142 Ga0209759_1000142107 244
776 3300025261 Ga0209233_1000118 Ga0209233_100011842 244
777 3300025907 Ga0207645_10069729 Ga0207645_100697292 244
778 3300025909 Ga0207705_10049472 Ga0207705_100494722 244
779 3300025913 Ga0207695_10390519 Ga0207695_103905191 244
780 3300025914 Ga0207671_10138535 Ga0207671_101385352 244
781 3300025919 Ga0207657_10007647 Ga0207657_100076473 244
782 3300025919 Ga0207657_10072526 Ga0207657_100725262 244
783 3300025920 Ga0207649_10163391 Ga0207649_101633912 244
784 3300025924 Ga0207694_10059980 Ga0207694_100599802 244
785 3300025924 Ga0207694_10159147 Ga0207694_101591473 244
786 3300025937 Ga0207669_10055748 Ga0207669_100557482 244
787 3300025944 Ga0207661_10272418 Ga0207661_102724182 244
788 3300025945 Ga0207679_10414830 Ga0207679_104148302 244
789 3300025949 Ga0207667_10021184 Ga0207667_100211843 244
790 3300025981 Ga0207640_10035965 Ga0207640_100359653 244
791 3300026041 Ga0207639_10097689 Ga0207639_100976892 244
792 3300026041 Ga0207639_10165221 Ga0207639_101652213 244
793 3300026067 Ga0207678_10032760 Ga0207678_100327602 244
794 3300026078 Ga0207702_10054512 Ga0207702_100545122 244
795 3300026116 Ga0207674_10009631 Ga0207674_100096312 244
796 3300026142 Ga0207698_10308641 Ga0207698_103086412 244
797 3300028379 Ga0268266_10235503 Ga0268266_102355032 244
798 3300028556 Ga0265337_1008317 Ga0265337_10083172 244
799 3300031239 Ga0265328_10020279 Ga0265328_100202792 244
800 3300031247 Ga0265340_10001277 Ga0265340_100012777 244
801 3300031247 Ga0265340_10096324 Ga0265340_100963242 244
802 3300031344 Ga0265316_10010284 Ga0265316_100102842 244
803 3300031595 Ga0265313_10000448 Ga0265313_1000044834 244
804 3300031595 Ga0265313_10016322 Ga0265313_100163222 244
805 3300031712 Ga0265342_10004375 Ga0265342_1000437512 244
806 3300031712 Ga0265342_10010728 Ga0265342_100107283 244
807 3300035207 Ga0373942_0011842 Ga0373942_0011842_406_1161 244
808 3300037312 Ga0395899_0004706 Ga0395899_0004706_6765_7511 244
809 3300037418 Ga0395900_0005070 Ga0395900_0005070_12424_13170 244
810 3300037418 Ga0395900_0304643 Ga0395900_0304643_464_1219 244
811 3300037466 Ga0395898_0135233 Ga0395898_0135233_1357_2118 244
812 3300037471 Ga0395905_0035464 Ga0395905_0035464_2851_3606 244
813 3300037471 Ga0395905_0036713 Ga0395905_0036713_696_1442 244
814 3300037471 Ga0395905_0062059 Ga0395905_0062059_1835_2590 244
815 3300037471 Ga0395905_0362003 Ga0395905_0362003_163_918 244
816 3300038443 Ga0395901_0007281 Ga0395901_0007281_2734_3480 244
817 3300038443 Ga0395901_0139381 Ga0395901_0139381_1339_2094 244
818 3300038443 Ga0395901_0240297 Ga0395901_0240297_86_841 244
819 3300044658 Ga0466972_0148221 Ga0466972_0148221_247_1002 244
820 3300044684 Ga0466966_0065521 Ga0466966_0065521_1505_2251 244
821 3300044684 Ga0466966_0139101 Ga0466966_0139101_666_1430 244
822 3300046452 Ga0495617_000026 Ga0495617_000026_125713_126459 244
823 3300046453 Ga0495627_000043 Ga0495627_000043_154069_154815 244
824 3300046463 Ga0495653_0024311 Ga0495653_0024311_1007_1753 244
825 3300046471 Ga0495650_0003986 Ga0495650_0003986_8560_9306 244
826 3300046471 Ga0495650_0055124 Ga0495650_0055124_46_792 244
827 3300046474 Ga0495605_0000113 Ga0495605_0000113_72111_72857 244
828 3300046491 Ga0495584_0002689 Ga0495584_0002689_757_1503 244
829 3300046500 Ga0495596_0003840 Ga0495596_0003840_5178_5924 244
830 3300046500 Ga0495596_0045908 Ga0495596_0045908_832_1578 244
831 3300046501 Ga0495607_0001654 Ga0495607_0001654_13746_14492 244
832 3300046507 Ga0495606_0015605 Ga0495606_0015605_4307_5053 244
833 3300046507 Ga0495606_0077668 Ga0495606_0077668_787_1542 244
834 3300046513 Ga0495616_0000280 Ga0495616_0000280_30336_31082 244
835 3300046513 Ga0495616_0047724 Ga0495616_0047724_818_1564 244
836 3300046518 Ga0495631_0004753 Ga0495631_0004753_2952_3698 244
837 3300046518 Ga0495631_0022829 Ga0495631_0022829_743_1489 244
838 3300046519 Ga0495632_0028969 Ga0495632_0028969_1875_2621 244
839 3300046523 Ga0495644_0007525 Ga0495644_0007525_1341_2087 244
840 3300046524 Ga0495648_0000353 Ga0495648_0000353_24740_25486 244
841 3300046524 Ga0495648_0044149 Ga0495648_0044149_644_1390 244
842 3300046528 Ga0495642_0000123 Ga0495642_0000123_24743_25489 244
843 3300046530 Ga0495654_0025199 Ga0495654_0025199_1285_2031 244
844 3300046538 Ga0495609_0071180 Ga0495609_0071180_114_860 244
845 3300046615 Ga0495656_0003380 Ga0495656_0003380_247_993 244
846 3300046616 Ga0495668_0000546 Ga0495668_0000546_18807_19553 244
847 3300046648 Ga0495611_0076488 Ga0495611_0076488_733_1479 244
848 3300046660 Ga0495625_0019383 Ga0495625_0019383_1169_1924 244
849 3300046665 Ga0495661_0000588 Ga0495661_0000588_6354_7100 244
850 3300046665 Ga0495661_0042470 Ga0495661_0042470_513_1259 244
851 3300046674 Ga0495588_0000148 Ga0495588_0000148_65024_65770 244
852 3300046674 Ga0495588_0009890 Ga0495588_0009890_3495_4241 244
853 3300046692 Ga0495671_0000426 Ga0495671_0000426_3680_4426 244
854 3300046692 Ga0495671_0078965 Ga0495671_0078965_852_1598 244
855 3300046810 Ga0495660_0001751 Ga0495660_0001751_302_1048 244
856 3300047320 Ga0495672_0000142 Ga0495672_0000142_82871_83617 244
857 3300047443 Ga0495687_000140 Ga0495687_000140_30921_31667 244
858 3300047443 Ga0495687_000236 Ga0495687_000236_69726_70472 244
859 3300047470 Ga0495681_0115790 Ga0495681_0115790_153_908 244
860 3300047472 Ga0495686_0049134 Ga0495686_0049134_1093_1848 244
861 3300048088 Ga0495602_0113689 Ga0495602_0113689_383_1129 244
862 3300048091 Ga0495626_0043143 Ga0495626_0043143_48_794 244
863 3300048916 Ga0496113_0380979 Ga0496113_0380979_82_837 244
864 3300048921 Ga0496118_0162592 Ga0496118_0162592_526_1281 244
865 3300048924 Ga0496121_0116997 Ga0496121_0116997_503_1258 244
866 3300048929 Ga0496126_0309794 Ga0496126_0309794_406_1161 244
867 3300049459 Ga0495678_103844 Ga0495678_103844_207_953 244
868 3300049568 Ga0501031_0064822 Ga0501031_0064822_281_1042 244
869 3300049571 Ga0501034_0000743 Ga0501034_0000743_43506_44252 244
870 3300049584 Ga0501068_0017682 Ga0501068_0017682_157_903 244
871 3300049586 Ga0501070_0079486 Ga0501070_0079486_308_1054 244
872 3300049744 Ga0501083_0273548 Ga0501083_0273548_51_797 244
873 3300049822 Ga0501035_0219439 Ga0501035_0219439_224_970 244
874 3300049823 Ga0501044_0120966 Ga0501044_0120966_417_1163 244
875 3300050492 nmdc:mga0yw44_125128_c1 nmdc:mga0yw44_125128_c1_41_799 244
876 3300050494 nmdc:mga06z11_126158_c1 nmdc:mga06z11_126158_c1_34_789 244
877 3300053155 Ga0500620_000770 Ga0500620_000770_3835_4590 244
878 3300053158 Ga0500627_0086179 Ga0500627_0086179_521_1276 244
879 2162886007 SwRhRL2b_contig_3421311 SwRhRL2b_0803.00005670 245
880 2209111006 2214772983 2213792887 245
881 3300000041 ARcpr5oldR_c000140 ARcpr5oldR_0001405 245
882 3300000042 ARSoilYngRDRAFT_c00234 ARSoilYngRDRAFT_002347 245
883 3300000044 ARSoilOldRDRAFT_c000126 ARSoilOldRDRAFT_00012613 245
884 3300000045 ARCol0oldRDRAFT_c00368 ARCol0oldRDRAFT_003684 245
885 3300001976 JGI24752J21851_1002485 JGI24752J21851_10024853 245
886 3300001990 JGI24737J22298_10000960 JGI24737J22298_100009608 245
887 3300001990 JGI24737J22298_10007118 JGI24737J22298_100071183 245
888 3300002073 JGI24745J21846_1000099 JGI24745J21846_10000995 245
889 3300002075 JGI24738J21930_10000223 JGI24738J21930_100002237 245
890 3300002239 JGI24034J26672_10000557 JGI24034J26672_100005574 245
891 3300002244 JGI24742J22300_10000264 JGI24742J22300_100002646 245
892 3300002459 JGI24751J29686_10014205 JGI24751J29686_100142052 245
893 3300005289 Ga0065704_10074561 Ga0065704_100745616 245
894 3300005290 Ga0065712_10070835 Ga0065712_100708353 245
895 3300005290 Ga0065712_10074294 Ga0065712_100742944 245
896 3300005293 Ga0065715_10003522 Ga0065715_100035222 245
897 3300005328 Ga0070676_10000012 Ga0070676_1000001250 245
898 3300005329 Ga0070683_100000139 Ga0070683_10000013915 245
899 3300005329 Ga0070683_100028063 Ga0070683_1000280635 245
900 3300005330 Ga0070690_100005164 Ga0070690_1000051647 245
901 3300005330 Ga0070690_100005412 Ga0070690_1000054126 245
902 3300005331 Ga0070670_100103508 Ga0070670_1001035082 245
903 3300005331 Ga0070670_100158033 Ga0070670_1001580332 245
904 3300005333 Ga0070677_10000125 Ga0070677_100001257 245
905 3300005334 Ga0068869_100000605 Ga0068869_10000060511 245
906 3300005335 Ga0070666_10017025 Ga0070666_100170253 245
907 3300005336 Ga0070680_100000179 Ga0070680_10000017912 245
908 3300005336 Ga0070680_100014505 Ga0070680_1000145054 245
909 3300005336 Ga0070680_100378803 Ga0070680_1003788031 245
910 3300005337 Ga0070682_100000319 Ga0070682_1000003198 245
911 3300005337 Ga0070682_100016170 Ga0070682_1000161704 245
912 3300005338 Ga0068868_100000593 Ga0068868_1000005933 245
913 3300005339 Ga0070660_100001605 Ga0070660_1000016056 245
914 3300005340 Ga0070689_100004685 Ga0070689_1000046858 245
915 3300005341 Ga0070691_10001565 Ga0070691_100015656 245
916 3300005343 Ga0070687_100003572 Ga0070687_1000035726 245
917 3300005344 Ga0070661_100001455 Ga0070661_10000145512 245
918 3300005345 Ga0070692_10000434 Ga0070692_100004344 245
919 3300005345 Ga0070692_10002195 Ga0070692_100021957 245
920 3300005347 Ga0070668_100004423 Ga0070668_1000044237 245
921 3300005353 Ga0070669_100000409 Ga0070669_1000004096 245
922 3300005354 Ga0070675_100000166 Ga0070675_10000016634 245
923 3300005354 Ga0070675_100043171 Ga0070675_1000431713 245
924 3300005355 Ga0070671_100005938 Ga0070671_1000059386 245
925 3300005355 Ga0070671_100094656 Ga0070671_1000946561 245
926 3300005356 Ga0070674_100000644 Ga0070674_10000064414 245
927 3300005356 Ga0070674_100317081 Ga0070674_1003170811 245
928 3300005364 Ga0070673_100000041 Ga0070673_10000004115 245
929 3300005365 Ga0070688_100000180 Ga0070688_10000018018 245
930 3300005365 Ga0070688_100049523 Ga0070688_1000495232 245
931 3300005366 Ga0070659_100000752 Ga0070659_10000075213 245
932 3300005367 Ga0070667_100000365 Ga0070667_1000003655 245
933 3300005367 Ga0070667_100515964 Ga0070667_1005159641 245
934 3300005406 Ga0070703_10003914 Ga0070703_100039143 245
935 3300005406 Ga0070703_10012992 Ga0070703_100129924 245
936 3300005434 Ga0070709_10019500 Ga0070709_100195002 245
937 3300005434 Ga0070709_10304704 Ga0070709_103047041 245
938 3300005435 Ga0070714_100045790 Ga0070714_1000457905 245
939 3300005435 Ga0070714_100098674 Ga0070714_1000986742 245
940 3300005437 Ga0070710_10044400 Ga0070710_100444001 245
941 3300005438 Ga0070701_10000493 Ga0070701_1000049312 245
942 3300005438 Ga0070701_10012908 Ga0070701_100129082 245
943 3300005439 Ga0070711_100015744 Ga0070711_1000157445 245
944 3300005439 Ga0070711_100054801 Ga0070711_1000548013 245
945 3300005440 Ga0070705_100002314 Ga0070705_1000023148 245
946 3300005440 Ga0070705_100148366 Ga0070705_1001483662 245
947 3300005441 Ga0070700_100000467 Ga0070700_10000046714 245
948 3300005444 Ga0070694_100000065 Ga0070694_10000006546 245
949 3300005444 Ga0070694_100029375 Ga0070694_1000293753 245
950 3300005444 Ga0070694_100116812 Ga0070694_1001168123 245
951 3300005445 Ga0070708_100267667 Ga0070708_1002676672 245
952 3300005455 Ga0070663_100000473 Ga0070663_10000047312 245
953 3300005455 Ga0070663_100019373 Ga0070663_1000193735 245
954 3300005456 Ga0070678_100000091 Ga0070678_1000000916 245
955 3300005456 Ga0070678_100007141 Ga0070678_1000071413 245
956 3300005456 Ga0070678_100479335 Ga0070678_1004793352 245
957 3300005457 Ga0070662_100006535 Ga0070662_1000065356 245
958 3300005457 Ga0070662_100043231 Ga0070662_1000432315 245
959 3300005457 Ga0070662_100128907 Ga0070662_1001289072 245
960 3300005458 Ga0070681_10010003 Ga0070681_100100039 245
961 3300005459 Ga0068867_100000859 Ga0068867_10000085922 245
962 3300005459 Ga0068867_100489759 Ga0068867_1004897591 245
963 3300005466 Ga0070685_10001731 Ga0070685_100017314 245
964 3300005466 Ga0070685_10041755 Ga0070685_100417554 245
965 3300005507 Ga0074259_12095147 Ga0074259_120951472 245
966 3300005530 Ga0070679_100012754 Ga0070679_1000127546 245
967 3300005535 Ga0070684_100000219 Ga0070684_1000002196 245
968 3300005536 Ga0070697_100534991 Ga0070697_1005349911 245
969 3300005539 Ga0068853_100000600 Ga0068853_10000060019 245
970 3300005543 Ga0070672_100000019 Ga0070672_10000001915 245
971 3300005543 Ga0070672_100108041 Ga0070672_1001080412 245
972 3300005544 Ga0070686_100007875 Ga0070686_1000078755 245
973 3300005544 Ga0070686_100100051 Ga0070686_1001000512 245
974 3300005545 Ga0070695_100000474 Ga0070695_10000047414 245
975 3300005546 Ga0070696_100003100 Ga0070696_10000310012 245
976 3300005547 Ga0070693_100001868 Ga0070693_1000018687 245
977 3300005547 Ga0070693_100096721 Ga0070693_1000967212 245
978 3300005548 Ga0070665_100322171 Ga0070665_1003221711 245
979 3300005549 Ga0070704_100000252 Ga0070704_10000025218 245
980 3300005549 Ga0070704_100001606 Ga0070704_10000160613 245
981 3300005563 Ga0068855_100019721 Ga0068855_1000197217 245
982 3300005564 Ga0070664_100000819 Ga0070664_10000081913 245
983 3300005564 Ga0070664_100183771 Ga0070664_1001837712 245
984 3300005577 Ga0068857_100000768 Ga0068857_1000007687 245
985 3300005578 Ga0068854_100001736 Ga0068854_1000017364 245
986 3300005578 Ga0068854_100169225 Ga0068854_1001692252 245
987 3300005614 Ga0068856_100002295 Ga0068856_10000229518 245
988 3300005614 Ga0068856_100110986 Ga0068856_1001109862 245
989 3300005614 Ga0068856_100747445 Ga0068856_1007474451 245
990 3300005615 Ga0070702_100000898 Ga0070702_1000008986 245
991 3300005616 Ga0068852_100001992 Ga0068852_1000019928 245
992 3300005718 Ga0068866_10001028 Ga0068866_100010284 245
993 3300005719 Ga0068861_100000169 Ga0068861_1000001697 245
994 3300005719 Ga0068861_100660716 Ga0068861_1006607161 245
995 3300005840 Ga0068870_10000586 Ga0068870_100005866 245
996 3300005841 Ga0068863_100000381 Ga0068863_10000038128 245
997 3300005841 Ga0068863_100396538 Ga0068863_1003965382 245
998 3300005842 Ga0068858_100009197 Ga0068858_1000091978 245
999 3300005842 Ga0068858_100348350 Ga0068858_1003483502 245
1000 3300005843 Ga0068860_100001472 Ga0068860_10000147218 245
1001 3300005843 Ga0068860_100081520 Ga0068860_1000815204 245
1002 3300005844 Ga0068862_100001886 Ga0068862_1000018867 245
1003 3300005844 Ga0068862_100065508 Ga0068862_1000655085 245
1004 3300005937 Ga0081455_10000036 Ga0081455_10000036126 245
1005 3300006058 Ga0075432_10083948 Ga0075432_100839481 245
1006 3300006163 Ga0070715_10049118 Ga0070715_100491182 245
1007 3300006237 Ga0097621_100001234 Ga0097621_1000012347 245
1008 3300006237 Ga0097621_100176973 Ga0097621_1001769731 245
1009 3300006358 Ga0068871_100000068 Ga0068871_10000006851 245
1010 3300006358 Ga0068871_100025352 Ga0068871_1000253523 245
1011 3300006852 Ga0075433_10099038 Ga0075433_100990383 245
1012 3300006871 Ga0075434_100001666 Ga0075434_1000016669 245
1013 3300006871 Ga0075434_100113294 Ga0075434_1001132943 245
1014 3300006881 Ga0068865_100005133 Ga0068865_1000051335 245
1015 3300006914 Ga0075436_100070922 Ga0075436_1000709222 245
1016 3300006914 Ga0075436_100238776 Ga0075436_1002387762 245
1017 3300007076 Ga0075435_100010036 Ga0075435_1000100367 245
1018 3300009094 Ga0111539_10003417 Ga0111539_1000341711 245
1019 3300009094 Ga0111539_10315126 Ga0111539_103151262 245
1020 3300009101 Ga0105247_10078113 Ga0105247_100781132 245
1021 3300009101 Ga0105247_10095825 Ga0105247_100958252 245
1022 3300009148 Ga0105243_10032306 Ga0105243_100323066 245
1023 3300009174 Ga0105241_10432246 Ga0105241_104322462 245
1024 3300009545 Ga0105237_10024205 Ga0105237_100242055 245
1025 3300009553 Ga0105249_10028272 Ga0105249_100282722 245
1026 3300009553 Ga0105249_10143026 Ga0105249_101430262 245
1027 3300010375 Ga0105239_10222845 Ga0105239_102228452 245
1028 3300011119 Ga0105246_10096520 Ga0105246_100965203 245
1029 3300013297 Ga0157378_10127916 Ga0157378_101279161 245
1030 3300013306 Ga0163162_10018394 Ga0163162_100183942 245
1031 3300013306 Ga0163162_10756418 Ga0163162_107564182 245
1032 3300013307 Ga0157372_10515578 Ga0157372_105155782 245
1033 3300013307 Ga0157372_11143932 Ga0157372_111439321 245
1034 3300014325 Ga0163163_10020189 Ga0163163_100201895 245
1035 3300014326 Ga0157380_10009719 Ga0157380_100097192 245
1036 3300014968 Ga0157379_10063216 Ga0157379_100632162 245
1037 3300014968 Ga0157379_10110590 Ga0157379_101105902 245
1038 3300014968 Ga0157379_10147731 Ga0157379_101477313 245
1039 3300017792 Ga0163161_10000384 Ga0163161_1000038415 245
1040 3300017792 Ga0163161_10047076 Ga0163161_100470763 245
1041 3300017792 Ga0163161_10362314 Ga0163161_103623142 245
1042 3300025271 Ga0207666_1000097 Ga0207666_100009711 245
1043 3300025290 Ga0207673_1000201 Ga0207673_10002015 245
1044 3300025315 Ga0207697_10000550 Ga0207697_1000055011 245
1045 3300025315 Ga0207697_10013264 Ga0207697_100132644 245
1046 3300025885 Ga0207653_10010851 Ga0207653_100108512 245
1047 3300025885 Ga0207653_10018054 Ga0207653_100180543 245
1048 3300025893 Ga0207682_10000088 Ga0207682_1000008816 245
1049 3300025898 Ga0207692_10001966 Ga0207692_100019665 245
1050 3300025898 Ga0207692_10271610 Ga0207692_102716102 245
1051 3300025899 Ga0207642_10000381 Ga0207642_1000038115 245
1052 3300025900 Ga0207710_10001324 Ga0207710_100013245 245
1053 3300025900 Ga0207710_10032716 Ga0207710_100327162 245
1054 3300025901 Ga0207688_10001203 Ga0207688_100012036 245
1055 3300025901 Ga0207688_10021688 Ga0207688_100216882 245
1056 3300025903 Ga0207680_10009047 Ga0207680_100090475 245
1057 3300025903 Ga0207680_10223472 Ga0207680_102234722 245
1058 3300025904 Ga0207647_10002714 Ga0207647_100027146 245
1059 3300025907 Ga0207645_10000140 Ga0207645_100001406 245
1060 3300025908 Ga0207643_10000083 Ga0207643_100000836 245
1061 3300025910 Ga0207684_10423987 Ga0207684_104239872 245
1062 3300025911 Ga0207654_10002699 Ga0207654_100026996 245
1063 3300025912 Ga0207707_10020854 Ga0207707_100208545 245
1064 3300025912 Ga0207707_10122457 Ga0207707_101224572 245
1065 3300025914 Ga0207671_10004533 Ga0207671_100045335 245
1066 3300025915 Ga0207693_10021626 Ga0207693_100216263 245
1067 3300025916 Ga0207663_10021132 Ga0207663_100211322 245
1068 3300025916 Ga0207663_10113170 Ga0207663_101131702 245
1069 3300025916 Ga0207663_10232610 Ga0207663_102326102 245
1070 3300025917 Ga0207660_10000073 Ga0207660_1000007318 245
1071 3300025917 Ga0207660_10346099 Ga0207660_103460992 245
1072 3300025918 Ga0207662_10000964 Ga0207662_1000096411 245
1073 3300025918 Ga0207662_10019591 Ga0207662_100195915 245
1074 3300025919 Ga0207657_10005395 Ga0207657_1000539511 245
1075 3300025919 Ga0207657_10020125 Ga0207657_100201256 245
1076 3300025919 Ga0207657_10068436 Ga0207657_100684362 245
1077 3300025920 Ga0207649_10000450 Ga0207649_1000045017 245
1078 3300025920 Ga0207649_10026888 Ga0207649_100268882 245
1079 3300025921 Ga0207652_10008726 Ga0207652_100087265 245
1080 3300025921 Ga0207652_10157189 Ga0207652_101571892 245
1081 3300025922 Ga0207646_10296809 Ga0207646_102968092 245
1082 3300025923 Ga0207681_10000097 Ga0207681_1000009734 245
1083 3300025926 Ga0207659_10000092 Ga0207659_1000009244 245
1084 3300025926 Ga0207659_10045065 Ga0207659_100450654 245
1085 3300025927 Ga0207687_10000219 Ga0207687_100002194 245
1086 3300025928 Ga0207700_10064607 Ga0207700_100646072 245
1087 3300025929 Ga0207664_10060581 Ga0207664_100605812 245
1088 3300025929 Ga0207664_10484029 Ga0207664_104840292 245
1089 3300025931 Ga0207644_10005083 Ga0207644_100050833 245
1090 3300025932 Ga0207690_10003312 Ga0207690_100033124 245
1091 3300025933 Ga0207706_10004310 Ga0207706_100043106 245
1092 3300025933 Ga0207706_10008823 Ga0207706_100088235 245
1093 3300025933 Ga0207706_10035694 Ga0207706_100356942 245
1094 3300025933 Ga0207706_10256446 Ga0207706_102564462 245
1095 3300025934 Ga0207686_10000796 Ga0207686_100007967 245
1096 3300025934 Ga0207686_10062208 Ga0207686_100622083 245
1097 3300025934 Ga0207686_10449951 Ga0207686_104499512 245
1098 3300025935 Ga0207709_10000362 Ga0207709_1000036228 245
1099 3300025935 Ga0207709_10220374 Ga0207709_102203742 245
1100 3300025936 Ga0207670_10002375 Ga0207670_100023759 245
1101 3300025937 Ga0207669_10000350 Ga0207669_1000035010 245
1102 3300025938 Ga0207704_10000479 Ga0207704_100004798 245
1103 3300025938 Ga0207704_10317554 Ga0207704_103175542 245
1104 3300025939 Ga0207665_10089990 Ga0207665_100899901 245
1105 3300025939 Ga0207665_10491370 Ga0207665_104913701 245
1106 3300025940 Ga0207691_10000283 Ga0207691_1000028344 245
1107 3300025940 Ga0207691_10070775 Ga0207691_100707752 245
1108 3300025941 Ga0207711_10009170 Ga0207711_100091707 245
1109 3300025942 Ga0207689_10000085 Ga0207689_1000008565 245
1110 3300025944 Ga0207661_10000464 Ga0207661_1000046416 245
1111 3300025944 Ga0207661_10495672 Ga0207661_104956721 245
1112 3300025945 Ga0207679_10000030 Ga0207679_10000030151 245
1113 3300025945 Ga0207679_10441453 Ga0207679_104414532 245
1114 3300025960 Ga0207651_10000422 Ga0207651_100004225 245
1115 3300025960 Ga0207651_10114169 Ga0207651_101141692 245
1116 3300025960 Ga0207651_10327355 Ga0207651_103273552 245
1117 3300025961 Ga0207712_10004682 Ga0207712_100046828 245
1118 3300025972 Ga0207668_10000114 Ga0207668_1000011444 245
1119 3300025972 Ga0207668_10550177 Ga0207668_105501772 245
1120 3300025981 Ga0207640_10000141 Ga0207640_1000014152 245
1121 3300025986 Ga0207658_10155178 Ga0207658_101551783 245
1122 3300026023 Ga0207677_10001776 Ga0207677_100017764 245
1123 3300026035 Ga0207703_10000983 Ga0207703_100009839 245
1124 3300026041 Ga0207639_10000305 Ga0207639_1000030517 245
1125 3300026041 Ga0207639_10341225 Ga0207639_103412252 245
1126 3300026067 Ga0207678_10000125 Ga0207678_1000012551 245
1127 3300026067 Ga0207678_10026095 Ga0207678_100260956 245
1128 3300026067 Ga0207678_10197514 Ga0207678_101975142 245
1129 3300026075 Ga0207708_10000187 Ga0207708_1000018711 245
1130 3300026075 Ga0207708_10014918 Ga0207708_100149186 245
1131 3300026078 Ga0207702_10005437 Ga0207702_100054378 245
1132 3300026078 Ga0207702_10058876 Ga0207702_100588762 245
1133 3300026088 Ga0207641_10003649 Ga0207641_1000364915 245
1134 3300026088 Ga0207641_10055119 Ga0207641_100551194 245
1135 3300026089 Ga0207648_10002168 Ga0207648_1000216816 245
1136 3300026095 Ga0207676_10000074 Ga0207676_1000007415 245
1137 3300026116 Ga0207674_10002501 Ga0207674_1000250111 245
1138 3300026116 Ga0207674_10276142 Ga0207674_102761422 245
1139 3300026118 Ga0207675_100004556 Ga0207675_10000455611 245
1140 3300026121 Ga0207683_10000014 Ga0207683_1000001445 245
1141 3300026121 Ga0207683_10003999 Ga0207683_100039999 245
1142 3300026142 Ga0207698_10001242 Ga0207698_100012428 245
1143 3300027614 Ga0209970_1005489 Ga0209970_10054892 245
1144 3300027665 Ga0209983_1006800 Ga0209983_10068003 245
1145 3300027695 Ga0209966_1006091 Ga0209966_10060911 245
1146 3300027717 Ga0209998_10000361 Ga0209998_1000036111 245
1147 3300027717 Ga0209998_10001516 Ga0209998_100015165 245
1148 3300027876 Ga0209974_10002250 Ga0209974_100022502 245
1149 3300027876 Ga0209974_10012895 Ga0209974_100128953 245
1150 3300027907 Ga0207428_10000467 Ga0207428_1000046733 245
1151 3300027907 Ga0207428_10011322 Ga0207428_100113225 245
1152 3300028379 Ga0268266_10041670 Ga0268266_100416702 245
1153 3300028379 Ga0268266_10502461 Ga0268266_105024612 245
1154 3300028380 Ga0268265_10001371 Ga0268265_100013713 245
1155 3300028380 Ga0268265_10337188 Ga0268265_103371881 245
1156 3300028381 Ga0268264_10000469 Ga0268264_1000046914 245
1157 3300031241 Ga0265325_10000423 Ga0265325_1000042324 245
1158 3300031344 Ga0265316_10048508 Ga0265316_100485083 245
1159 3300031456 Ga0307513_10350860 Ga0307513_103508601 245
1160 3300031595 Ga0265313_10034290 Ga0265313_100342903 245
1161 3300031824 Ga0307413_10301608 Ga0307413_103016082 245
1162 3300031995 Ga0307409_100868698 Ga0307409_1008686981 245
1163 3300034816 Ga0373930_0000150 Ga0373930_0000150_4779_5516 245
1164 3300034817 Ga0373948_0000307 Ga0373948_0000307_4076_4813 245
1165 3300034818 Ga0373950_0002075 Ga0373950_0002075_1410_2147 245
1166 3300034819 Ga0373958_0001702 Ga0373958_0001702_694_1431 245
1167 3300034820 Ga0373959_0001657 Ga0373959_0001657_2409_3146 245
1168 3300035083 Ga0373926_0027180 Ga0373926_0027180_1251_1988 245
1169 3300035084 Ga0373928_0000222 Ga0373928_0000222_8611_9348 245
1170 3300035084 Ga0373928_0063198 Ga0373928_0063198_40_777 245
1171 3300035085 Ga0373929_0002112 Ga0373929_0002112_2829_3566 245
1172 3300035086 Ga0373934_0137209 Ga0373934_0137209_119_856 245
1173 3300035088 Ga0373940_0012698 Ga0373940_0012698_841_1578 245
1174 3300035089 Ga0373944_0001828 Ga0373944_0001828_3550_4287 245
1175 3300035089 Ga0373944_0080792 Ga0373944_0080792_209_946 245
1176 3300035090 Ga0373949_0006107 Ga0373949_0006107_1125_1862 245
1177 3300035090 Ga0373949_0050996 Ga0373949_0050996_243_980 245
1178 3300035092 Ga0373952_0000029 Ga0373952_0000029_3137_3874 245
1179 3300035111 Ga0373923_0038247 Ga0373923_0038247_400_1137 245
1180 3300035112 Ga0373932_0001251 Ga0373932_0001251_2983_3720 245
1181 3300035113 Ga0373936_0006326 Ga0373936_0006326_2960_3697 245
1182 3300035113 Ga0373936_0033686 Ga0373936_0033686_726_1463 245
1183 3300035114 Ga0373939_0002855 Ga0373939_0002855_2864_3601 245
1184 3300035116 Ga0373945_0058939 Ga0373945_0058939_614_1351 245
1185 3300035117 Ga0373953_0023666 Ga0373953_0023666_1572_2309 245
1186 3300035117 Ga0373953_0028414 Ga0373953_0028414_1154_1891 245
1187 3300035118 Ga0373954_0090293 Ga0373954_0090293_474_1211 245
1188 3300035118 Ga0373954_0093987 Ga0373954_0093987_355_1092 245
1189 3300035118 Ga0373954_0118861 Ga0373954_0118861_476_1213 245
1190 3300035119 Ga0373956_0117071 Ga0373956_0117071_168_905 245
1191 3300035119 Ga0373956_0118830 Ga0373956_0118830_118_855 245
1192 3300035120 Ga0373957_0006384 Ga0373957_0006384_1970_2707 245
1193 3300035121 Ga0373960_0000372 Ga0373960_0000372_4111_4848 245
1194 3300035170 Ga0373943_0042125 Ga0373943_0042125_735_1472 245
1195 3300035170 Ga0373943_0042928 Ga0373943_0042928_1129_1866 245
1196 3300035170 Ga0373943_0301588 Ga0373943_0301588_82_819 245
1197 3300035171 Ga0373946_0006340 Ga0373946_0006340_2917_3654 245
1198 3300035172 Ga0373955_0001269 Ga0373955_0001269_6278_7015 245
1199 3300035172 Ga0373955_0001523 Ga0373955_0001523_3310_4047 245
1200 3300035172 Ga0373955_0004969 Ga0373955_0004969_4169_4906 245
1201 3300035207 Ga0373942_0000767 Ga0373942_0000767_3807_4544 245
1202 3300035241 Ga0373961_0001835 Ga0373961_0001835_1754_2491 245
1203 3300035242 Ga0373962_0005930 Ga0373962_0005930_1369_2106 245
1204 3300035410 Ga0373924_0023997 Ga0373924_0023997_900_1637 245
1205 3300035691 Ga0373931_0068208 Ga0373931_0068208_461_1198 245
1206 3300035692 Ga0373935_0020667 Ga0373935_0020667_2549_3286 245
1207 3300035692 Ga0373935_0073204 Ga0373935_0073204_1149_1886 245
1208 3300035695 Ga0373927_0050616 Ga0373927_0050616_147_884 245
1209 3300035724 Ga0373933_0001124 Ga0373933_0001124_14277_15014 245
1210 3300035724 Ga0373933_0005311 Ga0373933_0005311_4644_5381 245
1211 3300035724 Ga0373933_0017906 Ga0373933_0017906_2081_2818 245
1212 3300035725 Ga0373947_0038674 Ga0373947_0038674_1496_2233 245
1213 3300035725 Ga0373947_0244013 Ga0373947_0244013_148_885 245
1214 3300036401 Ga0373937_0004918 Ga0373937_0004918_709_1446 245
1215 3300036401 Ga0373937_0012121 Ga0373937_0012121_954_1691 245
1216 3300036401 Ga0373937_0049021 Ga0373937_0049021_1415_2152 245
1217 3300037068 Ga0373925_0105557 Ga0373925_0105557_259_996 245
1218 3300037068 Ga0373925_0183511 Ga0373925_0183511_626_1363 245
1219 3300037418 Ga0395900_0187123 Ga0395900_0187123_1146_1898 245
1220 3300037418 Ga0395900_0352299 Ga0395900_0352299_445_1197 245
1221 3300037466 Ga0395898_0123799 Ga0395898_0123799_574_1326 245
1222 3300038996 Ga0242420_012515 Ga0242420_012515_530_1267 245
1223 3300042001 Ga0439441_003611 Ga0439441_003611_1337_2074 245
1224 3300042005 Ga0439448_0019150 Ga0439448_0019150_872_1609 245
1225 3300042008 Ga0439450_006022 Ga0439450_006022_1006_1743 245
1226 3300042439 Ga0439464_0001894 Ga0439464_0001894_3191_3973 245
1227 3300042439 Ga0439464_0043627 Ga0439464_0043627_79_816 245
1228 3300042461 Ga0439460_0058121 Ga0439460_0058121_189_926 245
1229 3300044712 Ga0453684_0037028 Ga0453684_0037028_4541_5278 245
1230 3300045051 Ga0451576_0033369 Ga0451576_0033369_958_1695 245
1231 3300046452 Ga0495617_070130 Ga0495617_070130_269_1006 245
1232 3300046454 Ga0495592_0024186 Ga0495592_0024186_1359_2096 245
1233 3300046454 Ga0495592_0040848 Ga0495592_0040848_2037_2774 245
1234 3300046455 Ga0495603_0272938 Ga0495603_0272938_117_854 245
1235 3300046458 Ga0495591_067573 Ga0495591_067573_150_887 245
1236 3300046459 Ga0495629_0262307 Ga0495629_0262307_295_1032 245
1237 3300046460 Ga0495638_0161544 Ga0495638_0161544_127_879 245
1238 3300046461 Ga0495641_0019259 Ga0495641_0019259_2142_2879 245
1239 3300046462 Ga0495651_0011021 Ga0495651_0011021_3039_3776 245
1240 3300046462 Ga0495651_0011844 Ga0495651_0011844_5696_6433 245
1241 3300046463 Ga0495653_0008326 Ga0495653_0008326_7058_7795 245
1242 3300046463 Ga0495653_0012564 Ga0495653_0012564_4252_4989 245
1243 3300046472 Ga0495580_0023721 Ga0495580_0023721_3647_4384 245
1244 3300046473 Ga0495582_0039312 Ga0495582_0039312_1625_2362 245
1245 3300046475 Ga0495639_0029697 Ga0495639_0029697_1414_2151 245
1246 3300046476 Ga0495662_0010283 Ga0495662_0010283_2958_3695 245
1247 3300046477 Ga0495664_0003537 Ga0495664_0003537_7179_7916 245
1248 3300046477 Ga0495664_0066458 Ga0495664_0066458_795_1532 245
1249 3300046492 Ga0495585_0008366 Ga0495585_0008366_4177_4914 245
1250 3300046499 Ga0495594_0042775 Ga0495594_0042775_910_1647 245
1251 3300046499 Ga0495594_0043598 Ga0495594_0043598_557_1294 245
1252 3300046501 Ga0495607_0048620 Ga0495607_0048620_1396_2133 245
1253 3300046511 Ga0495608_0001474 Ga0495608_0001474_1224_1961 245
1254 3300046511 Ga0495608_0055452 Ga0495608_0055452_339_1076 245
1255 3300046511 Ga0495608_0141830 Ga0495608_0141830_656_1393 245
1256 3300046514 Ga0495618_0004984 Ga0495618_0004984_3512_4249 245
1257 3300046516 Ga0495628_0001927 Ga0495628_0001927_8022_8759 245
1258 3300046516 Ga0495628_0023873 Ga0495628_0023873_1544_2281 245
1259 3300046516 Ga0495628_0244742 Ga0495628_0244742_356_1093 245
1260 3300046517 Ga0495630_0121732 Ga0495630_0121732_289_1026 245
1261 3300046518 Ga0495631_0024362 Ga0495631_0024362_33_770 245
1262 3300046523 Ga0495644_0002701 Ga0495644_0002701_2299_3036 245
1263 3300046529 Ga0495652_0022449 Ga0495652_0022449_3515_4252 245
1264 3300046529 Ga0495652_0048857 Ga0495652_0048857_526_1263 245
1265 3300046529 Ga0495652_0087560 Ga0495652_0087560_328_1065 245
1266 3300046529 Ga0495652_0218826 Ga0495652_0218826_225_962 245
1267 3300046531 Ga0495665_0023481 Ga0495665_0023481_34_771 245
1268 3300046533 Ga0495640_0027462 Ga0495640_0027462_3029_3766 245
1269 3300046533 Ga0495640_0295102 Ga0495640_0295102_88_825 245
1270 3300046535 Ga0495586_0036479 Ga0495586_0036479_109_846 245
1271 3300046535 Ga0495586_0068990 Ga0495586_0068990_655_1392 245
1272 3300046536 Ga0495587_0002240 Ga0495587_0002240_9463_10200 245
1273 3300046536 Ga0495587_0047875 Ga0495587_0047875_1657_2394 245
1274 3300046536 Ga0495587_0111209 Ga0495587_0111209_754_1491 245
1275 3300046537 Ga0495598_0007286 Ga0495598_0007286_1173_1910 245
1276 3300046538 Ga0495609_0058799 Ga0495609_0058799_36_773 245
1277 3300046543 Ga0495645_0002539 Ga0495645_0002539_9091_9828 245
1278 3300046543 Ga0495645_0019854 Ga0495645_0019854_1082_1819 245
1279 3300046543 Ga0495645_0297721 Ga0495645_0297721_185_922 245
1280 3300046557 Ga0495622_0015565 Ga0495622_0015565_1507_2244 245
1281 3300046558 Ga0495633_0002969 Ga0495633_0002969_9676_10413 245
1282 3300046559 Ga0495667_0026523 Ga0495667_0026523_456_1193 245
1283 3300046559 Ga0495667_0099693 Ga0495667_0099693_366_1103 245
1284 3300046615 Ga0495656_0002822 Ga0495656_0002822_4113_4850 245
1285 3300046642 Ga0495634_0026079 Ga0495634_0026079_2957_3694 245
1286 3300046648 Ga0495611_0081731 Ga0495611_0081731_519_1256 245
1287 3300046663 Ga0495635_0003881 Ga0495635_0003881_1777_2514 245
1288 3300046663 Ga0495635_0021401 Ga0495635_0021401_2421_3158 245
1289 3300046663 Ga0495635_0398033 Ga0495635_0398033_116_874 245
1290 3300046664 Ga0495659_0001458 Ga0495659_0001458_6322_7059 245
1291 3300046664 Ga0495659_0057268 Ga0495659_0057268_357_1094 245
1292 3300046665 Ga0495661_0044928 Ga0495661_0044928_538_1275 245
1293 3300046674 Ga0495588_0045221 Ga0495588_0045221_1289_2026 245
1294 3300046675 Ga0495657_0010946 Ga0495657_0010946_2443_3180 245
1295 3300046678 Ga0495599_0004481 Ga0495599_0004481_3183_3920 245
1296 3300046678 Ga0495599_0017530 Ga0495599_0017530_1617_2354 245
1297 3300046679 Ga0495623_0000420 Ga0495623_0000420_26690_27427 245
1298 3300046679 Ga0495623_0007330 Ga0495623_0007330_2729_3466 245
1299 3300046680 Ga0495646_0020687 Ga0495646_0020687_874_1611 245
1300 3300046683 Ga0495658_0006062 Ga0495658_0006062_3074_3811 245
1301 3300046683 Ga0495658_0009215 Ga0495658_0009215_2622_3359 245
1302 3300046689 Ga0495613_0264446 Ga0495613_0264446_119_856 245
1303 3300046690 Ga0495624_0026468 Ga0495624_0026468_30_767 245
1304 3300046690 Ga0495624_0051811 Ga0495624_0051811_1145_1882 245
1305 3300046690 Ga0495624_0091076 Ga0495624_0091076_259_996 245
1306 3300046691 Ga0495670_0000291 Ga0495670_0000291_15111_15848 245
1307 3300046809 Ga0495600_0001326 Ga0495600_0001326_1713_2450 245
1308 3300046809 Ga0495600_0011214 Ga0495600_0011214_335_1072 245
1309 3300047315 Ga0495581_0049705 Ga0495581_0049705_1056_1793 245
1310 3300047315 Ga0495581_0055269 Ga0495581_0055269_327_1064 245
1311 3300047317 Ga0495604_0003891 Ga0495604_0003891_7841_8578 245
1312 3300047317 Ga0495604_0009082 Ga0495604_0009082_1575_2312 245
1313 3300047318 Ga0495636_0122156 Ga0495636_0122156_229_966 245
1314 3300047319 Ga0495674_0015363 Ga0495674_0015363_1878_2615 245
1315 3300047319 Ga0495674_0027169 Ga0495674_0027169_1194_1931 245
1316 3300047319 Ga0495674_0069524 Ga0495674_0069524_2189_2926 245
1317 3300047321 Ga0495676_0332651 Ga0495676_0332651_128_865 245
1318 3300047322 Ga0495680_0012959 Ga0495680_0012959_1973_2710 245
1319 3300047322 Ga0495680_0044687 Ga0495680_0044687_2544_3281 245
1320 3300047322 Ga0495680_0062737 Ga0495680_0062737_295_1032 245
1321 3300047444 Ga0495675_0001544 Ga0495675_0001544_10003_10740 245
1322 3300047445 Ga0495677_0032250 Ga0495677_0032250_379_1116 245
1323 3300047471 Ga0495684_0002087 Ga0495684_0002087_7856_8593 245
1324 3300047471 Ga0495684_0282601 Ga0495684_0282601_313_1050 245
1325 3300047673 Ga0495593_0004626 Ga0495593_0004626_4865_5602 245
1326 3300048088 Ga0495602_0000740 Ga0495602_0000740_25764_26501 245
1327 3300048088 Ga0495602_0005526 Ga0495602_0005526_10098_10835 245
1328 3300048089 Ga0495614_0031402 Ga0495614_0031402_708_1445 245
1329 3300048089 Ga0495614_0114701 Ga0495614_0114701_387_1124 245
1330 3300048903 Ga0496100_0002951 Ga0496100_0002951_3394_4131 245
1331 3300048904 Ga0496101_0020995 Ga0496101_0020995_2724_3461 245
1332 3300048904 Ga0496101_0137951 Ga0496101_0137951_153_890 245
1333 3300048905 Ga0496102_0019045 Ga0496102_0019045_3058_3795 245
1334 3300048905 Ga0496102_0039093 Ga0496102_0039093_1390_2127 245
1335 3300048907 Ga0496104_0005547 Ga0496104_0005547_225_962 245
1336 3300048908 Ga0496105_0193026 Ga0496105_0193026_173_910 245
1337 3300048909 Ga0496106_0012172 Ga0496106_0012172_1952_2689 245
1338 3300048909 Ga0496106_0013964 Ga0496106_0013964_1383_2120 245
1339 3300048910 Ga0496107_0034213 Ga0496107_0034213_2138_2875 245
1340 3300048910 Ga0496107_0037809 Ga0496107_0037809_2142_2879 245
1341 3300048910 Ga0496107_0041516 Ga0496107_0041516_1054_1791 245
1342 3300048911 Ga0496108_0046748 Ga0496108_0046748_873_1610 245
1343 3300048912 Ga0496109_0072253 Ga0496109_0072253_2375_3112 245
1344 3300048914 Ga0496111_0113348 Ga0496111_0113348_477_1214 245
1345 3300048915 Ga0496112_0661226 Ga0496112_0661226_127_864 245
1346 3300048916 Ga0496113_0010789 Ga0496113_0010789_3012_3749 245
1347 3300048917 Ga0496114_0399786 Ga0496114_0399786_63_800 245
1348 3300048918 Ga0496115_0094696 Ga0496115_0094696_1448_2185 245
1349 3300048918 Ga0496115_0155608 Ga0496115_0155608_709_1446 245
1350 3300048918 Ga0496115_0471745 Ga0496115_0471745_36_773 245
1351 3300048919 Ga0496116_0236119 Ga0496116_0236119_52_852 245
1352 3300048927 Ga0496124_0368877 Ga0496124_0368877_138_938 245
1353 3300049583 Ga0501067_0075382 Ga0501067_0075382_95_832 245
1354 3300049585 Ga0501069_0000283 Ga0501069_0000283_5778_6593 245
1355 3300049585 Ga0501069_0220208 Ga0501069_0220208_132_869 245
1356 3300049586 Ga0501070_0312239 Ga0501070_0312239_496_1263 245
1357 3300049593 Ga0501077_0019577 Ga0501077_0019577_3495_4232 245
1358 3300050511 nmdc:mga08y16_10784_c1 nmdc:mga08y16_10784_c1_5934_6671 245
1359 3300050511 nmdc:mga08y16_610118_c1 nmdc:mga08y16_610118_c1_251_988 245
1360 3300053077 Ga0495601_0000360 Ga0495601_0000360_15289_16026 245
1361 3300053077 Ga0495601_0001260 Ga0495601_0001260_1713_2450 245
1362 3300053077 Ga0495601_0070227 Ga0495601_0070227_689_1426 245
1363 3300053077 Ga0495601_0282707 Ga0495601_0282707_243_980 245
1364 3300053078 Ga0495612_0000964 Ga0495612_0000964_1532_2269 245
1365 3300053078 Ga0495612_0002659 Ga0495612_0002659_3925_4662 245
1366 3300053078 Ga0495612_0008741 Ga0495612_0008741_2829_3566 245
1367 3300053078 Ga0495612_0009169 Ga0495612_0009169_315_1052 245
1368 3300053084 Ga0495595_0000969 Ga0495595_0000969_10195_10932 245
1369 3300053084 Ga0495595_0001276 Ga0495595_0001276_6495_7232 245
1370 3300053085 Ga0495619_0000581 Ga0495619_0000581_9441_10178 245
1371 3300053085 Ga0495619_0001851 Ga0495619_0001851_10719_11456 245
1372 3300053090 Ga0500646_0000891 Ga0500646_0000891_3727_4545 245
1373 3300053094 Ga0500566_0103442 Ga0500566_0103442_735_1472 245
1374 3300053094 Ga0500566_0130230 Ga0500566_0130230_97_834 245
1375 3300053727 Ga0500611_017475 Ga0500611_017475_481_1233 245
1376 3300054114 Ga0501084_0427144 Ga0501084_0427144_271_1008 245
1377 iso_pu_bacteria 2939582691 2939585354 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

239

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

288

0.93

PF08659

KR

KR domain

41

227

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

247

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jig-assembly1.cif.gz_A crystal structure of a putative dehydrogenase from burkholderia cenocepacia 0.9866 3 245
8bci-assembly2.cif.gz_C crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 0.9865 3 245
4iqg-assembly1.cif.gz_B crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form 0.9861 4 245
4e3z-assembly1.cif.gz_B crystal structure of a oxidoreductase from rhizobium etli cfn 42 0.984 4 245
8bcj-assembly2.cif.gz_D crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ 0.9827 3 245
ID Description Score Start End Superfamily
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9866 3 245 3.40.50.720
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 3 245 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 4 244 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 4 245 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 4 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A345ZSW4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9976 1 245 GO:0016614
AF-A0A1W7D5N1-F1-model_v4 Oxidoreductase 0.9932 1 245 GO:0016616
GO:0030497
AF-A0A2D9YDP4-F1-model_v4 NAD(P)-dependent oxidoreductase (EC 1.1.1.47) 0.993 3 245 GO:0047936
AF-A0A1Q2M9D9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9911 3 245
AF-A0A7X3YCA1-F1-model_v4 SDR family oxidoreductase 0.9904 3 245

Feature Viewer

pLDDT pTM Quality
96.37 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map