F493487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1377 | 515 | 1374 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0018250|Ga0495580_0018250_3744_4442 |
| Length | 232 |
| Sequence | MEVRRDLPFRRLAQVQAAHARALIETASAEAGLLAAVLFGTIRAMFFNLPTLFTWARIVAIPLVVGVYYTGLAAETQNIVGTTLFVLFALTDWADGYLARKLRMTSSFGAFLDPVADKFLVTAALLVLVHLGRLHAFIALVIIGREIAISALREWMAQIGASRSVAVHMLGKVKTVVQMIAIPFLLYHGVLFRLIDTQLWGTVLIVVSAVLTIWSMVYYLQKALPEIRARVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 2 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 3 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 132 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 256 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 264 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 268 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 269 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 271 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 272 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 275 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 276 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 280 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 285 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 304 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 305 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 306 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 312 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 313 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 320 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 321 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 322 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 323 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 324 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 325 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 326 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 327 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 328 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 329 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 330 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 331 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 332 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 333 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 334 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 335 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 336 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 337 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 338 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 339 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 340 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 341 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 342 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 343 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 344 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 345 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 346 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 347 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 348 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 349 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 350 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 351 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 352 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 353 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 354 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 355 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 356 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 357 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 358 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 359 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 360 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 361 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 430 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 431 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 432 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 433 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 436 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 441 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 442 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 443 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 444 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 452 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 453 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 454 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 455 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 456 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 457 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 458 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 460 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 463 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 464 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 473 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 474 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 475 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 476 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 487 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 489 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 492 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 494 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 495 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 496 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 497 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 499 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 500 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 501 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 502 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 504 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 505 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 506 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 507 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 508 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 511 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 512 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 513 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 514 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.07 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.29 |
| Nodule | 0.29 |
| Rhizoplane | 2.98 |
| Rhizosphere | 67.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005871 | 3300001979 | Bacteria | 5145 |
| 2 | JGI24744J21845_10035852 | 3300002077 | Bacteria | 938 |
| 3 | JGI25155J39150_1000060 | 3300002704 | Bacteria | 71795 |
| 4 | JGI25156J39149_1000090 | 3300002705 | Bacteria | 67361 |
| 5 | JGI25156J39149_1000446 | 3300002705 | Bacteria | 25215 |
| 6 | JGI25156J39149_1019495 | 3300002705 | Bacteria | 1219 |
| 7 | JGI25154J39366_1000061 | 3300002738 | Bacteria | 105781 |
| 8 | JGI25154J39366_1002660 | 3300002738 | Bacteria | 4394 |
| 9 | JGI25157J39369_1000006 | 3300002741 | Bacteria | 226861 |
| 10 | JGI25157J39369_1000574 | 3300002741 | Bacteria | 21857 |
| 11 | JGI25164J39214_1002617 | 3300002772 | Bacteria | 2642 |
| 12 | JGI25152J39213_1000657 | 3300002773 | Bacteria | 18088 |
| 13 | JGI25152J39213_1020505 | 3300002773 | Bacteria | 1179 |
| 14 | JGI25150J39212_1001192 | 3300002774 | Bacteria | 7702 |
| 15 | JGI25150J39212_1006586 | 3300002774 | Bacteria | 2389 |
| 16 | JGI25150J39212_1011620 | 3300002774 | Bacteria | 1588 |
| 17 | JGI25159J45721_1000203 | 3300002987 | Bacteria | 27623 |
| 18 | JGI25159J45721_1003940 | 3300002987 | Bacteria | 5068 |
| 19 | JGI25159J45721_1005644 | 3300002987 | Bacteria | 3893 |
| 20 | JGI25153J46596_10004330 | 3300003215 | Bacteria | 7671 |
| 21 | rootH1_10000544 | 3300003316 | Bacteria | 5338 |
| 22 | rootH1_10005243 | 3300003316 | Bacteria | 3282 |
| 23 | rootL2_10000757 | 3300003322 | Bacteria | 81071 |
| 24 | rootL2_10007392 | 3300003322 | Bacteria | 6085 |
| 25 | rootL2_10025833 | 3300003322 | Bacteria | 11902 |
| 26 | rootH1_10026981 | 3300003323 | Bacteria | 11646 |
| 27 | rootH1_10071288 | 3300003323 | Bacteria | 1080 |
| 28 | rootH1_10094745 | 3300003323 | Bacteria | 3209 |
| 29 | JGI26128J50194_1000382 | 3300003347 | Bacteria | 2354 |
| 30 | JGI25160J50197_1000071 | 3300003354 | Bacteria | 108301 |
| 31 | JGI26145J50221_1004823 | 3300003371 | Bacteria | 1100 |
| 32 | JGI25161J50226_1000030 | 3300003374 | Bacteria | 142870 |
| 33 | JGI25161J50226_1020127 | 3300003374 | Bacteria | 678 |
| 34 | Ga0055539_1001162 | 3300003752 | Bacteria | 5369 |
| 35 | Ga0055539_1004241 | 3300003752 | Bacteria | 1919 |
| 36 | Ga0055539_1012027 | 3300003752 | Unclassified | 1064 |
| 37 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 38 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 39 | Ga0055525_1000903 | 3300003759 | Bacteria | 8476 |
| 40 | Ga0055535_1000084 | 3300003761 | Bacteria | 104652 |
| 41 | Ga0055535_1001649 | 3300003761 | Bacteria | 10387 |
| 42 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 43 | Ga0055529_1000306 | 3300003763 | Bacteria | 56382 |
| 44 | Ga0055526_1003627 | 3300003771 | Bacteria | 9665 |
| 45 | Ga0055526_1004316 | 3300003771 | Bacteria | 8590 |
| 46 | Ga0055526_1004665 | 3300003771 | Bacteria | 8142 |
| 47 | Ga0055526_1007621 | 3300003771 | Bacteria | 5584 |
| 48 | Ga0055526_1011709 | 3300003771 | Bacteria | 3917 |
| 49 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 50 | Ga0055536_1003229 | 3300003781 | Bacteria | 8839 |
| 51 | Ga0055536_1003340 | 3300003781 | Bacteria | 8680 |
| 52 | Ga0055536_1012350 | 3300003781 | Bacteria | 3177 |
| 53 | Ga0055536_1023112 | 3300003781 | Bacteria | 1836 |
| 54 | Ga0055536_1068159 | 3300003781 | Bacteria | 712 |
| 55 | Ga0055528_1002771 | 3300003790 | Bacteria | 9187 |
| 56 | Ga0055530_10000446 | 3300003791 | Bacteria | 36695 |
| 57 | Ga0055530_10002347 | 3300003791 | Bacteria | 12323 |
| 58 | Ga0055530_10005361 | 3300003791 | Bacteria | 6131 |
| 59 | Ga0055530_10048831 | 3300003791 | Bacteria | 992 |
| 60 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 61 | Ga0055540_1001269 | 3300003792 | Bacteria | 15383 |
| 62 | Ga0055540_1002903 | 3300003792 | Bacteria | 8675 |
| 63 | Ga0055540_1015951 | 3300003792 | Unclassified | 2161 |
| 64 | Ga0055540_1017788 | 3300003792 | Bacteria | 1971 |
| 65 | Ga0055531_10000051 | 3300003794 | Bacteria | 130125 |
| 66 | Ga0055531_10000254 | 3300003794 | Bacteria | 57349 |
| 67 | Ga0055531_10000636 | 3300003794 | Bacteria | 30247 |
| 68 | Ga0055531_10004337 | 3300003794 | Bacteria | 8675 |
| 69 | Ga0055531_10008940 | 3300003794 | Bacteria | 5190 |
| 70 | Ga0055531_10017770 | 3300003794 | Bacteria | 2978 |
| 71 | Ga0055531_10018358 | 3300003794 | Bacteria | 2893 |
| 72 | Ga0055543_1000566 | 3300004625 | Bacteria | 20553 |
| 73 | Ga0055543_1002143 | 3300004625 | Bacteria | 6823 |
| 74 | Ga0065165_1000024 | 3300005262 | Bacteria | 247672 |
| 75 | Ga0065165_1000076 | 3300005262 | Bacteria | 163890 |
| 76 | Ga0065165_1010071 | 3300005262 | Bacteria | 4148 |
| 77 | Ga0065165_1010072 | 3300005262 | Bacteria | 4148 |
| 78 | Ga0065165_1033896 | 3300005262 | Bacteria | 1584 |
| 79 | Ga0065714_10072716 | 3300005288 | Bacteria | 3311 |
| 80 | Ga0065704_10268953 | 3300005289 | Bacteria | 948 |
| 81 | Ga0065712_10351505 | 3300005290 | Bacteria | 787 |
| 82 | Ga0065715_10138494 | 3300005293 | Bacteria | 1891 |
| 83 | Ga0065715_10384488 | 3300005293 | Bacteria | 903 |
| 84 | Ga0070658_10029546 | 3300005327 | Bacteria | 4404 |
| 85 | Ga0070658_10056492 | 3300005327 | Bacteria | 3191 |
| 86 | Ga0070658_10356417 | 3300005327 | Bacteria | 1253 |
| 87 | Ga0070676_10003761 | 3300005328 | Bacteria | 7954 |
| 88 | Ga0070676_10050188 | 3300005328 | Bacteria | 2445 |
| 89 | Ga0070683_100077494 | 3300005329 | Bacteria | 3108 |
| 90 | Ga0070683_100257806 | 3300005329 | Bacteria | 1659 |
| 91 | Ga0070690_100010080 | 3300005330 | Bacteria | 5486 |
| 92 | Ga0070690_100032568 | 3300005330 | Bacteria | 3257 |
| 93 | Ga0070670_100015059 | 3300005331 | Bacteria | 6636 |
| 94 | Ga0070670_100112408 | 3300005331 | Bacteria | 2347 |
| 95 | Ga0070670_100149350 | 3300005331 | Bacteria | 2022 |
| 96 | Ga0070670_100428770 | 3300005331 | Bacteria | 1170 |
| 97 | Ga0070677_10141706 | 3300005333 | Bacteria | 1110 |
| 98 | Ga0070677_10248663 | 3300005333 | Bacteria | 881 |
| 99 | Ga0068869_100004104 | 3300005334 | Bacteria | 9024 |
| 100 | Ga0068869_100009289 | 3300005334 | Bacteria | 6377 |
| 101 | Ga0068869_100034945 | 3300005334 | Bacteria | 3559 |
| 102 | Ga0068869_100213950 | 3300005334 | Bacteria | 1525 |
| 103 | Ga0070666_10005027 | 3300005335 | Bacteria | 8087 |
| 104 | Ga0070680_100050945 | 3300005336 | Bacteria | 3377 |
| 105 | Ga0068868_100001107 | 3300005338 | Bacteria | 18443 |
| 106 | Ga0068868_100075949 | 3300005338 | Bacteria | 2686 |
| 107 | Ga0068868_100079635 | 3300005338 | Bacteria | 2625 |
| 108 | Ga0068868_100091066 | 3300005338 | Bacteria | 2457 |
| 109 | Ga0068868_100539615 | 3300005338 | Bacteria | 1026 |
| 110 | Ga0070660_100078318 | 3300005339 | Bacteria | 2592 |
| 111 | Ga0070660_100120415 | 3300005339 | Bacteria | 2094 |
| 112 | Ga0070689_100025603 | 3300005340 | Bacteria | 4434 |
| 113 | Ga0070689_100259171 | 3300005340 | Bacteria | 1437 |
| 114 | Ga0070687_100515069 | 3300005343 | Bacteria | 808 |
| 115 | Ga0070661_100000913 | 3300005344 | Bacteria | 21208 |
| 116 | Ga0070661_100190810 | 3300005344 | Bacteria | 1563 |
| 117 | Ga0070668_100014374 | 3300005347 | Bacteria | 5915 |
| 118 | Ga0070668_100204637 | 3300005347 | Bacteria | 1621 |
| 119 | Ga0070669_100002267 | 3300005353 | Bacteria | 13955 |
| 120 | Ga0070669_100090749 | 3300005353 | Bacteria | 2290 |
| 121 | Ga0070669_100294627 | 3300005353 | Bacteria | 1303 |
| 122 | Ga0070675_100002227 | 3300005354 | Bacteria | 14391 |
| 123 | Ga0070675_100049735 | 3300005354 | Bacteria | 3441 |
| 124 | Ga0070675_100058734 | 3300005354 | Bacteria | 3172 |
| 125 | Ga0070675_100161327 | 3300005354 | Bacteria | 1928 |
| 126 | Ga0070671_100014404 | 3300005355 | Bacteria | 6388 |
| 127 | Ga0070671_100020411 | 3300005355 | Bacteria | 5404 |
| 128 | Ga0070671_100020422 | 3300005355 | Bacteria | 5402 |
| 129 | Ga0070671_100027479 | 3300005355 | Bacteria | 4683 |
| 130 | Ga0070671_100063154 | 3300005355 | Bacteria | 3084 |
| 131 | Ga0070671_100119561 | 3300005355 | Bacteria | 2217 |
| 132 | Ga0070671_100162656 | 3300005355 | Bacteria | 1887 |
| 133 | Ga0070671_100182144 | 3300005355 | Bacteria | 1779 |
| 134 | Ga0070671_100201544 | 3300005355 | Bacteria | 1687 |
| 135 | Ga0070671_100336480 | 3300005355 | Bacteria | 1287 |
| 136 | Ga0070671_100400835 | 3300005355 | Bacteria | 1173 |
| 137 | Ga0070671_100877957 | 3300005355 | Bacteria | 783 |
| 138 | Ga0070674_100007082 | 3300005356 | Bacteria | 6594 |
| 139 | Ga0070674_100036182 | 3300005356 | Bacteria | 3311 |
| 140 | Ga0070674_100067910 | 3300005356 | Bacteria | 2509 |
| 141 | Ga0070674_100151580 | 3300005356 | Bacteria | 1750 |
| 142 | Ga0070674_100468161 | 3300005356 | Bacteria | 1043 |
| 143 | Ga0070674_100785591 | 3300005356 | Bacteria | 821 |
| 144 | Ga0070673_100002560 | 3300005364 | Bacteria | 11099 |
| 145 | Ga0070673_100005364 | 3300005364 | Bacteria | 8192 |
| 146 | Ga0070673_100041899 | 3300005364 | Bacteria | 3525 |
| 147 | Ga0070673_100078662 | 3300005364 | Bacteria | 2668 |
| 148 | Ga0070673_100083124 | 3300005364 | Bacteria | 2600 |
| 149 | Ga0070673_100097421 | 3300005364 | Bacteria | 2415 |
| 150 | Ga0070673_100119712 | 3300005364 | Bacteria | 2194 |
| 151 | Ga0070673_100982161 | 3300005364 | Bacteria | 786 |
| 152 | Ga0070688_100137864 | 3300005365 | Bacteria | 1654 |
| 153 | Ga0070688_100763308 | 3300005365 | Bacteria | 754 |
| 154 | Ga0070659_100007755 | 3300005366 | Bacteria | 7807 |
| 155 | Ga0070659_100395079 | 3300005366 | Bacteria | 1166 |
| 156 | Ga0070659_100484617 | 3300005366 | Bacteria | 1053 |
| 157 | Ga0070659_100791063 | 3300005366 | Bacteria | 824 |
| 158 | Ga0070667_100000558 | 3300005367 | Bacteria | 36933 |
| 159 | Ga0070667_100002446 | 3300005367 | Bacteria | 16231 |
| 160 | Ga0070667_100006752 | 3300005367 | Bacteria | 9531 |
| 161 | Ga0070667_100204508 | 3300005367 | Bacteria | 1753 |
| 162 | Ga0070700_100024061 | 3300005441 | Bacteria | 3571 |
| 163 | Ga0070708_100149153 | 3300005445 | Bacteria | 2174 |
| 164 | Ga0070708_100438633 | 3300005445 | Bacteria | 1232 |
| 165 | Ga0070663_100000823 | 3300005455 | Bacteria | 16841 |
| 166 | Ga0070663_100072590 | 3300005455 | Bacteria | 2508 |
| 167 | Ga0070663_100525373 | 3300005455 | Bacteria | 986 |
| 168 | Ga0070678_100001192 | 3300005456 | Bacteria | 13834 |
| 169 | Ga0070678_100003107 | 3300005456 | Bacteria | 9204 |
| 170 | Ga0070678_100033765 | 3300005456 | Bacteria | 3556 |
| 171 | Ga0070678_100072669 | 3300005456 | Bacteria | 2579 |
| 172 | Ga0070678_100075202 | 3300005456 | Bacteria | 2540 |
| 173 | Ga0070678_100093756 | 3300005456 | Bacteria | 2309 |
| 174 | Ga0070678_100116878 | 3300005456 | Bacteria | 2097 |
| 175 | Ga0070662_100034511 | 3300005457 | Bacteria | 3567 |
| 176 | Ga0070662_100069882 | 3300005457 | Bacteria | 2586 |
| 177 | Ga0070662_100156369 | 3300005457 | Bacteria | 1780 |
| 178 | Ga0070662_100403410 | 3300005457 | Bacteria | 1128 |
| 179 | Ga0070681_10085061 | 3300005458 | Bacteria | 3116 |
| 180 | Ga0070681_11058395 | 3300005458 | Bacteria | 732 |
| 181 | Ga0068867_100000048 | 3300005459 | Bacteria | 73813 |
| 182 | Ga0068867_100007404 | 3300005459 | Bacteria | 7763 |
| 183 | Ga0068867_100011068 | 3300005459 | Bacteria | 6364 |
| 184 | Ga0068867_100013726 | 3300005459 | Bacteria | 5737 |
| 185 | Ga0068867_100016023 | 3300005459 | Bacteria | 5322 |
| 186 | Ga0068867_100150041 | 3300005459 | Bacteria | 1830 |
| 187 | Ga0068867_100360054 | 3300005459 | Bacteria | 1216 |
| 188 | Ga0070685_10024014 | 3300005466 | Bacteria | 3345 |
| 189 | Ga0070685_10108274 | 3300005466 | Bacteria | 1708 |
| 190 | Ga0070706_100000774 | 3300005467 | Bacteria | 35777 |
| 191 | Ga0070706_100262752 | 3300005467 | Bacteria | 1611 |
| 192 | Ga0070707_100085399 | 3300005468 | Bacteria | 3051 |
| 193 | Ga0070698_100040093 | 3300005471 | Bacteria | 4815 |
| 194 | Ga0070679_100011754 | 3300005530 | Bacteria | 8345 |
| 195 | Ga0070679_100046985 | 3300005530 | Bacteria | 4304 |
| 196 | Ga0070679_100059287 | 3300005530 | Bacteria | 3815 |
| 197 | Ga0070684_100006585 | 3300005535 | Bacteria | 8997 |
| 198 | Ga0068853_100021739 | 3300005539 | Bacteria | 5352 |
| 199 | Ga0068853_100113834 | 3300005539 | Bacteria | 2406 |
| 200 | Ga0068853_100181940 | 3300005539 | Bacteria | 1906 |
| 201 | Ga0068853_100481012 | 3300005539 | Bacteria | 1170 |
| 202 | Ga0068853_100573972 | 3300005539 | Bacteria | 1070 |
| 203 | Ga0070672_100014873 | 3300005543 | Bacteria | 5525 |
| 204 | Ga0070672_100042207 | 3300005543 | Bacteria | 3511 |
| 205 | Ga0070672_100124619 | 3300005543 | Bacteria | 2112 |
| 206 | Ga0070672_100133094 | 3300005543 | Bacteria | 2045 |
| 207 | Ga0070672_100221664 | 3300005543 | Bacteria | 1586 |
| 208 | Ga0070672_100269444 | 3300005543 | Bacteria | 1437 |
| 209 | Ga0070693_100125650 | 3300005547 | Bacteria | 1597 |
| 210 | Ga0070665_100020551 | 3300005548 | Bacteria | 6634 |
| 211 | Ga0070665_100271196 | 3300005548 | Bacteria | 1699 |
| 212 | Ga0068855_100019410 | 3300005563 | Bacteria | 8168 |
| 213 | Ga0068855_100030912 | 3300005563 | Bacteria | 6399 |
| 214 | Ga0068855_100173411 | 3300005563 | Bacteria | 2441 |
| 215 | Ga0068855_100358734 | 3300005563 | Bacteria | 1604 |
| 216 | Ga0070664_100000282 | 3300005564 | Bacteria | 36692 |
| 217 | Ga0070664_100015244 | 3300005564 | Bacteria | 6282 |
| 218 | Ga0070664_100151346 | 3300005564 | Bacteria | 2049 |
| 219 | Ga0070664_100165027 | 3300005564 | Bacteria | 1962 |
| 220 | Ga0070664_100424815 | 3300005564 | Bacteria | 1218 |
| 221 | Ga0068857_100003322 | 3300005577 | Bacteria | 13375 |
| 222 | Ga0068857_100033057 | 3300005577 | Bacteria | 4573 |
| 223 | Ga0068857_100034604 | 3300005577 | Bacteria | 4468 |
| 224 | Ga0068857_100378163 | 3300005577 | Bacteria | 1315 |
| 225 | Ga0068854_100019180 | 3300005578 | Bacteria | 4605 |
| 226 | Ga0068854_100044202 | 3300005578 | Bacteria | 3160 |
| 227 | Ga0068854_100091076 | 3300005578 | Bacteria | 2269 |
| 228 | Ga0068854_100508371 | 3300005578 | Bacteria | 1016 |
| 229 | Ga0068854_100562155 | 3300005578 | Bacteria | 969 |
| 230 | Ga0068854_100902107 | 3300005578 | Bacteria | 777 |
| 231 | Ga0068856_100000686 | 3300005614 | Bacteria | 36805 |
| 232 | Ga0068856_100097570 | 3300005614 | Bacteria | 2928 |
| 233 | Ga0068856_100180712 | 3300005614 | Bacteria | 2122 |
| 234 | Ga0068856_101284807 | 3300005614 | Bacteria | 747 |
| 235 | Ga0070702_100144168 | 3300005615 | Bacteria | 1521 |
| 236 | Ga0068852_100062991 | 3300005616 | Bacteria | 3227 |
| 237 | Ga0068852_100106095 | 3300005616 | Bacteria | 2546 |
| 238 | Ga0068852_100440860 | 3300005616 | Bacteria | 1288 |
| 239 | Ga0068852_100499820 | 3300005616 | Bacteria | 1211 |
| 240 | Ga0068852_100573368 | 3300005616 | Bacteria | 1131 |
| 241 | Ga0068859_100016554 | 3300005617 | Bacteria | 7402 |
| 242 | Ga0068859_100028793 | 3300005617 | Bacteria | 5570 |
| 243 | Ga0068859_100048826 | 3300005617 | Bacteria | 4252 |
| 244 | Ga0068859_100073274 | 3300005617 | Bacteria | 3463 |
| 245 | Ga0068864_100002807 | 3300005618 | Bacteria | 14385 |
| 246 | Ga0068864_100020328 | 3300005618 | Bacteria | 5554 |
| 247 | Ga0068864_100028924 | 3300005618 | Bacteria | 4689 |
| 248 | Ga0068864_100114994 | 3300005618 | Bacteria | 2399 |
| 249 | Ga0068864_100172842 | 3300005618 | Bacteria | 1971 |
| 250 | Ga0068864_100175368 | 3300005618 | Bacteria | 1957 |
| 251 | Ga0068864_100698866 | 3300005618 | Bacteria | 991 |
| 252 | Ga0068866_10006943 | 3300005718 | Bacteria | 4730 |
| 253 | Ga0068866_10011759 | 3300005718 | Bacteria | 3797 |
| 254 | Ga0068866_10181828 | 3300005718 | Bacteria | 1243 |
| 255 | Ga0068861_100006804 | 3300005719 | Bacteria | 7809 |
| 256 | Ga0068861_100017152 | 3300005719 | Bacteria | 5135 |
| 257 | Ga0068851_10007694 | 3300005834 | Bacteria | 4954 |
| 258 | Ga0068851_10034428 | 3300005834 | Bacteria | 2528 |
| 259 | Ga0068851_10035492 | 3300005834 | Bacteria | 2493 |
| 260 | Ga0068851_10087439 | 3300005834 | Bacteria | 1636 |
| 261 | Ga0068870_10245884 | 3300005840 | Bacteria | 1107 |
| 262 | Ga0068870_10261681 | 3300005840 | Bacteria | 1077 |
| 263 | Ga0068870_10558751 | 3300005840 | Bacteria | 772 |
| 264 | Ga0068863_100017712 | 3300005841 | Bacteria | 6819 |
| 265 | Ga0068863_100040341 | 3300005841 | Bacteria | 4439 |
| 266 | Ga0068863_100281378 | 3300005841 | Bacteria | 1612 |
| 267 | Ga0068863_100464468 | 3300005841 | Bacteria | 1243 |
| 268 | Ga0068858_100002948 | 3300005842 | Bacteria | 17114 |
| 269 | Ga0068858_100015770 | 3300005842 | Bacteria | 7106 |
| 270 | Ga0068860_100000524 | 3300005843 | Bacteria | 46839 |
| 271 | Ga0068860_100014939 | 3300005843 | Bacteria | 7591 |
| 272 | Ga0068860_100239250 | 3300005843 | Bacteria | 1765 |
| 273 | Ga0068860_100272332 | 3300005843 | Bacteria | 1653 |
| 274 | Ga0068862_100028727 | 3300005844 | Bacteria | 4683 |
| 275 | Ga0068862_100033542 | 3300005844 | Bacteria | 4340 |
| 276 | Ga0068862_100056196 | 3300005844 | Bacteria | 3372 |
| 277 | Ga0068862_100089601 | 3300005844 | Bacteria | 2678 |
| 278 | Ga0081455_10049895 | 3300005937 | Bacteria | 3604 |
| 279 | Ga0075365_10004475 | 3300006038 | Bacteria | 7408 |
| 280 | Ga0075365_10027584 | 3300006038 | Bacteria | 3614 |
| 281 | Ga0075365_10171385 | 3300006038 | Bacteria | 1515 |
| 282 | Ga0075365_10311035 | 3300006038 | Bacteria | 1109 |
| 283 | Ga0075368_10001001 | 3300006042 | Bacteria | 8839 |
| 284 | Ga0075363_100000527 | 3300006048 | Bacteria | 12335 |
| 285 | Ga0075363_100085262 | 3300006048 | Bacteria | 1733 |
| 286 | Ga0075364_10044341 | 3300006051 | Bacteria | 2892 |
| 287 | Ga0075364_10446391 | 3300006051 | Bacteria | 884 |
| 288 | Ga0075432_10002462 | 3300006058 | Bacteria | 6158 |
| 289 | Ga0075362_10005340 | 3300006177 | Bacteria | 4694 |
| 290 | Ga0075362_10082489 | 3300006177 | Bacteria | 1483 |
| 291 | Ga0075367_10008057 | 3300006178 | Bacteria | 5435 |
| 292 | Ga0075367_10008095 | 3300006178 | Bacteria | 5427 |
| 293 | Ga0075367_10014712 | 3300006178 | Bacteria | 4237 |
| 294 | Ga0075367_10029539 | 3300006178 | Bacteria | 3136 |
| 295 | Ga0075367_10039733 | 3300006178 | Bacteria | 2745 |
| 296 | Ga0075367_10054621 | 3300006178 | Bacteria | 2369 |
| 297 | Ga0075367_10074012 | 3300006178 | Bacteria | 2054 |
| 298 | Ga0075367_10240091 | 3300006178 | Bacteria | 1135 |
| 299 | Ga0075367_10338594 | 3300006178 | Bacteria | 949 |
| 300 | Ga0075369_10029119 | 3300006186 | Bacteria | 2318 |
| 301 | Ga0075369_10047505 | 3300006186 | Bacteria | 1851 |
| 302 | Ga0075366_10000121 | 3300006195 | Bacteria | 32479 |
| 303 | Ga0075366_10003151 | 3300006195 | Bacteria | 8632 |
| 304 | Ga0075366_10007517 | 3300006195 | Bacteria | 6023 |
| 305 | Ga0075366_10008186 | 3300006195 | Bacteria | 5801 |
| 306 | Ga0075366_10008213 | 3300006195 | Bacteria | 5792 |
| 307 | Ga0075366_10019512 | 3300006195 | Bacteria | 3924 |
| 308 | Ga0075366_10024246 | 3300006195 | Bacteria | 3539 |
| 309 | Ga0075366_10036116 | 3300006195 | Bacteria | 2913 |
| 310 | Ga0075366_10041313 | 3300006195 | Bacteria | 2730 |
| 311 | Ga0075366_10060919 | 3300006195 | Bacteria | 2242 |
| 312 | Ga0075366_10102326 | 3300006195 | Bacteria | 1719 |
| 313 | Ga0075366_10128036 | 3300006195 | Bacteria | 1532 |
| 314 | Ga0075366_10163882 | 3300006195 | Bacteria | 1347 |
| 315 | Ga0075366_10269044 | 3300006195 | Bacteria | 1041 |
| 316 | Ga0097621_100053922 | 3300006237 | Bacteria | 3278 |
| 317 | Ga0097621_100091208 | 3300006237 | Bacteria | 2550 |
| 318 | Ga0097621_100243696 | 3300006237 | Bacteria | 1572 |
| 319 | Ga0097621_100486869 | 3300006237 | Bacteria | 1116 |
| 320 | Ga0097621_100649335 | 3300006237 | Bacteria | 968 |
| 321 | Ga0075370_10001812 | 3300006353 | Bacteria | 9566 |
| 322 | Ga0075370_10005989 | 3300006353 | Bacteria | 6088 |
| 323 | Ga0075370_10006507 | 3300006353 | Bacteria | 5883 |
| 324 | Ga0075370_10006767 | 3300006353 | Bacteria | 5792 |
| 325 | Ga0075370_10007526 | 3300006353 | Bacteria | 5549 |
| 326 | Ga0075370_10008461 | 3300006353 | Bacteria | 5295 |
| 327 | Ga0075370_10009708 | 3300006353 | Bacteria | 5010 |
| 328 | Ga0075370_10014180 | 3300006353 | Bacteria | 4246 |
| 329 | Ga0075370_10075172 | 3300006353 | Bacteria | 1936 |
| 330 | Ga0075370_10283283 | 3300006353 | Bacteria | 985 |
| 331 | Ga0075370_10409557 | 3300006353 | Bacteria | 814 |
| 332 | Ga0068871_100015012 | 3300006358 | Bacteria | 5792 |
| 333 | Ga0068871_100053399 | 3300006358 | Bacteria | 3275 |
| 334 | Ga0068871_100181401 | 3300006358 | Bacteria | 1809 |
| 335 | Ga0068871_100528012 | 3300006358 | Bacteria | 1066 |
| 336 | Ga0075428_100349496 | 3300006844 | Bacteria | 1587 |
| 337 | Ga0075428_100564817 | 3300006844 | Bacteria | 1216 |
| 338 | Ga0075430_100171601 | 3300006846 | Bacteria | 1804 |
| 339 | Ga0075429_100373744 | 3300006880 | Bacteria | 1248 |
| 340 | Ga0068865_100015592 | 3300006881 | Bacteria | 4848 |
| 341 | Ga0068865_100115666 | 3300006881 | Bacteria | 1985 |
| 342 | Ga0068865_100520457 | 3300006881 | Bacteria | 995 |
| 343 | Ga0068865_100618087 | 3300006881 | Bacteria | 918 |
| 344 | Ga0097620_100016554 | 3300006931 | Bacteria | 7402 |
| 345 | Ga0097620_100028793 | 3300006931 | Bacteria | 5570 |
| 346 | Ga0097620_100048825 | 3300006931 | Bacteria | 4252 |
| 347 | Ga0097620_100073277 | 3300006931 | Bacteria | 3463 |
| 348 | Ga0099823_1000769 | 3300006944 | Bacteria | 23642 |
| 349 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 350 | Ga0105244_10003895 | 3300009036 | Bacteria | 10497 |
| 351 | Ga0105240_10002994 | 3300009093 | Bacteria | 26583 |
| 352 | Ga0105240_10003519 | 3300009093 | Bacteria | 24297 |
| 353 | Ga0105240_10066177 | 3300009093 | Bacteria | 4484 |
| 354 | Ga0105240_10146167 | 3300009093 | Bacteria | 2821 |
| 355 | Ga0105240_10428881 | 3300009093 | Bacteria | 1484 |
| 356 | Ga0105245_10057323 | 3300009098 | Bacteria | 3504 |
| 357 | Ga0105245_10066044 | 3300009098 | Bacteria | 3273 |
| 358 | Ga0105245_10126770 | 3300009098 | Bacteria | 2390 |
| 359 | Ga0105245_10240577 | 3300009098 | Bacteria | 1754 |
| 360 | Ga0105245_10485001 | 3300009098 | Bacteria | 1250 |
| 361 | Ga0105245_11556127 | 3300009098 | Bacteria | 713 |
| 362 | Ga0114129_10143287 | 3300009147 | Bacteria | 3274 |
| 363 | Ga0105243_10000547 | 3300009148 | Bacteria | 37977 |
| 364 | Ga0105243_10002013 | 3300009148 | Bacteria | 17274 |
| 365 | Ga0105243_10004862 | 3300009148 | Bacteria | 10548 |
| 366 | Ga0105243_10032690 | 3300009148 | Bacteria | 4021 |
| 367 | Ga0105243_10230660 | 3300009148 | Bacteria | 1642 |
| 368 | Ga0105243_10249258 | 3300009148 | Bacteria | 1585 |
| 369 | Ga0105241_10125305 | 3300009174 | Bacteria | 2074 |
| 370 | Ga0105242_10026946 | 3300009176 | Bacteria | 4559 |
| 371 | Ga0105242_10258681 | 3300009176 | Bacteria | 1571 |
| 372 | Ga0105242_10653349 | 3300009176 | Bacteria | 1023 |
| 373 | Ga0105248_10047810 | 3300009177 | Bacteria | 4798 |
| 374 | Ga0105248_10059405 | 3300009177 | Bacteria | 4295 |
| 375 | Ga0105248_10073255 | 3300009177 | Bacteria | 3849 |
| 376 | Ga0105248_10216044 | 3300009177 | Bacteria | 2159 |
| 377 | Ga0105248_10431456 | 3300009177 | Bacteria | 1484 |
| 378 | Ga0105248_10454554 | 3300009177 | Bacteria | 1443 |
| 379 | Ga0105237_10000373 | 3300009545 | Bacteria | 63672 |
| 380 | Ga0105237_10092611 | 3300009545 | Bacteria | 3012 |
| 381 | Ga0105237_10467623 | 3300009545 | Bacteria | 1267 |
| 382 | Ga0105237_10506604 | 3300009545 | Bacteria | 1214 |
| 383 | Ga0105238_10034361 | 3300009551 | Bacteria | 5159 |
| 384 | Ga0105238_10100161 | 3300009551 | Bacteria | 2881 |
| 385 | Ga0105238_10635581 | 3300009551 | Bacteria | 1077 |
| 386 | Ga0105238_10645309 | 3300009551 | Bacteria | 1068 |
| 387 | Ga0105249_10112011 | 3300009553 | Bacteria | 2580 |
| 388 | Ga0105249_10156143 | 3300009553 | Bacteria | 2201 |
| 389 | Ga0105249_10184195 | 3300009553 | Bacteria | 2034 |
| 390 | Ga0105249_10269005 | 3300009553 | Bacteria | 1697 |
| 391 | Ga0105239_10000153 | 3300010375 | Bacteria | 99169 |
| 392 | Ga0105239_10027477 | 3300010375 | Bacteria | 6264 |
| 393 | Ga0105239_10065796 | 3300010375 | Bacteria | 3982 |
| 394 | Ga0105239_10638552 | 3300010375 | Bacteria | 1216 |
| 395 | Ga0105239_10741747 | 3300010375 | Bacteria | 1124 |
| 396 | Ga0105239_10881657 | 3300010375 | Bacteria | 1027 |
| 397 | Ga0105246_10016278 | 3300011119 | Bacteria | 4707 |
| 398 | Ga0105246_10407444 | 3300011119 | Bacteria | 1131 |
| 399 | Ga0105246_10803278 | 3300011119 | Bacteria | 835 |
| 400 | Ga0157317_1008911 | 3300012475 | Bacteria | 745 |
| 401 | Ga0157319_1000051 | 3300012497 | Bacteria | 14478 |
| 402 | Ga0157373_10488174 | 3300013100 | Bacteria | 889 |
| 403 | Ga0157371_10162956 | 3300013102 | Bacteria | 1592 |
| 404 | Ga0157371_10498939 | 3300013102 | Bacteria | 899 |
| 405 | Ga0157370_11019640 | 3300013104 | Bacteria | 749 |
| 406 | Ga0157369_10004791 | 3300013105 | Bacteria | 15906 |
| 407 | Ga0157369_10495143 | 3300013105 | Bacteria | 1265 |
| 408 | Ga0157374_10077081 | 3300013296 | Bacteria | 3154 |
| 409 | Ga0157374_10091368 | 3300013296 | Bacteria | 2903 |
| 410 | Ga0157374_10119941 | 3300013296 | Bacteria | 2537 |
| 411 | Ga0157378_10002312 | 3300013297 | Bacteria | 16951 |
| 412 | Ga0157378_10061950 | 3300013297 | Bacteria | 3340 |
| 413 | Ga0157378_10168586 | 3300013297 | Bacteria | 2052 |
| 414 | Ga0157378_11164734 | 3300013297 | Bacteria | 809 |
| 415 | Ga0163162_10003717 | 3300013306 | Bacteria | 14623 |
| 416 | Ga0163162_10008368 | 3300013306 | Bacteria | 10084 |
| 417 | Ga0163162_10017839 | 3300013306 | Bacteria | 6944 |
| 418 | Ga0163162_10085186 | 3300013306 | Bacteria | 3237 |
| 419 | Ga0163162_10110354 | 3300013306 | Bacteria | 2848 |
| 420 | Ga0163162_10145491 | 3300013306 | Bacteria | 2486 |
| 421 | Ga0163162_10400644 | 3300013306 | Bacteria | 1505 |
| 422 | Ga0163162_10514644 | 3300013306 | Bacteria | 1327 |
| 423 | Ga0163162_11271222 | 3300013306 | Bacteria | 836 |
| 424 | Ga0157372_10114535 | 3300013307 | Bacteria | 3091 |
| 425 | Ga0157372_10294396 | 3300013307 | Bacteria | 1888 |
| 426 | Ga0157372_10368036 | 3300013307 | Bacteria | 1675 |
| 427 | Ga0157372_11184716 | 3300013307 | Bacteria | 883 |
| 428 | Ga0157375_10022181 | 3300013308 | Bacteria | 5842 |
| 429 | Ga0157375_10066799 | 3300013308 | Bacteria | 3591 |
| 430 | Ga0157375_10305370 | 3300013308 | Bacteria | 1755 |
| 431 | Ga0157375_10448713 | 3300013308 | Bacteria | 1455 |
| 432 | Ga0157375_10735456 | 3300013308 | Bacteria | 1139 |
| 433 | Ga0163163_10005658 | 3300014325 | Bacteria | 10837 |
| 434 | Ga0163163_10349873 | 3300014325 | Bacteria | 1534 |
| 435 | Ga0163163_11317779 | 3300014325 | Bacteria | 784 |
| 436 | Ga0157380_10046314 | 3300014326 | Bacteria | 3415 |
| 437 | Ga0157380_10124121 | 3300014326 | Bacteria | 2192 |
| 438 | Ga0157380_10211411 | 3300014326 | Bacteria | 1729 |
| 439 | Ga0157380_10361832 | 3300014326 | Bacteria | 1362 |
| 440 | Ga0157380_10632274 | 3300014326 | Bacteria | 1064 |
| 441 | Ga0157380_10971067 | 3300014326 | Bacteria | 881 |
| 442 | Ga0182008_10004585 | 3300014497 | Bacteria | 8044 |
| 443 | Ga0182008_10013739 | 3300014497 | Bacteria | 4254 |
| 444 | Ga0157377_10000056 | 3300014745 | Bacteria | 87608 |
| 445 | Ga0157379_10008560 | 3300014968 | Bacteria | 8902 |
| 446 | Ga0157379_10026383 | 3300014968 | Bacteria | 5172 |
| 447 | Ga0157379_10058113 | 3300014968 | Bacteria | 3457 |
| 448 | Ga0157379_10139011 | 3300014968 | Bacteria | 2189 |
| 449 | Ga0157379_10320740 | 3300014968 | Bacteria | 1414 |
| 450 | Ga0157379_10497823 | 3300014968 | Bacteria | 1129 |
| 451 | Ga0157379_10873065 | 3300014968 | Bacteria | 852 |
| 452 | Ga0157376_10004932 | 3300014969 | Bacteria | 9305 |
| 453 | Ga0157376_10642253 | 3300014969 | Bacteria | 1061 |
| 454 | Ga0157376_11118535 | 3300014969 | Bacteria | 814 |
| 455 | Ga0182006_1004724 | 3300015261 | Bacteria | 6660 |
| 456 | Ga0182006_1064109 | 3300015261 | Bacteria | 1378 |
| 457 | Ga0182007_10000940 | 3300015262 | Bacteria | 16048 |
| 458 | Ga0182007_10001688 | 3300015262 | Bacteria | 11666 |
| 459 | Ga0182007_10195197 | 3300015262 | Bacteria | 705 |
| 460 | Ga0182005_1077544 | 3300015265 | Bacteria | 916 |
| 461 | Ga0163161_10025431 | 3300017792 | Bacteria | 4190 |
| 462 | Ga0163161_10030741 | 3300017792 | Bacteria | 3824 |
| 463 | Ga0163161_10383246 | 3300017792 | Bacteria | 1124 |
| 464 | Ga0213872_10000236 | 3300021361 | Bacteria | 48593 |
| 465 | Ga0213872_10000354 | 3300021361 | Bacteria | 38778 |
| 466 | Ga0213872_10000496 | 3300021361 | Bacteria | 31478 |
| 467 | Ga0213872_10000535 | 3300021361 | Bacteria | 29790 |
| 468 | Ga0213872_10025704 | 3300021361 | Bacteria | 2706 |
| 469 | Ga0213872_10028967 | 3300021361 | Bacteria | 2540 |
| 470 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 471 | Ga0209436_115643 | 3300025208 | Bacteria | 1165 |
| 472 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 473 | Ga0209672_100228 | 3300025228 | Bacteria | 42777 |
| 474 | Ga0209672_102765 | 3300025228 | Bacteria | 4037 |
| 475 | Ga0209147_107112 | 3300025229 | Bacteria | 1486 |
| 476 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 477 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 478 | Ga0207427_101838 | 3300025231 | Bacteria | 6751 |
| 479 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 480 | Ga0209258_100162 | 3300025242 | Bacteria | 151725 |
| 481 | Ga0209258_100601 | 3300025242 | Bacteria | 29487 |
| 482 | Ga0207425_1000744 | 3300025245 | Bacteria | 17015 |
| 483 | Ga0207425_1001690 | 3300025245 | Bacteria | 8779 |
| 484 | Ga0207425_1002357 | 3300025245 | Bacteria | 6737 |
| 485 | Ga0207425_1006971 | 3300025245 | Bacteria | 3039 |
| 486 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 487 | Ga0209646_1000142 | 3300025246 | Bacteria | 106607 |
| 488 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 489 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 490 | Ga0209026_1017368 | 3300025250 | Bacteria | 1152 |
| 491 | Ga0209677_100083 | 3300025253 | Bacteria | 117063 |
| 492 | Ga0209677_100154 | 3300025253 | Bacteria | 62985 |
| 493 | Ga0209677_100929 | 3300025253 | Bacteria | 14346 |
| 494 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 495 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 496 | Ga0209759_1000240 | 3300025256 | Bacteria | 81549 |
| 497 | Ga0209759_1001021 | 3300025256 | Bacteria | 18791 |
| 498 | Ga0209759_1002002 | 3300025256 | Bacteria | 9701 |
| 499 | Ga0209759_1006796 | 3300025256 | Bacteria | 3791 |
| 500 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 501 | Ga0209129_1000033 | 3300025258 | Bacteria | 336894 |
| 502 | Ga0209129_1008754 | 3300025258 | Bacteria | 2766 |
| 503 | Ga0209129_1010003 | 3300025258 | Bacteria | 2416 |
| 504 | Ga0209129_1011842 | 3300025258 | Bacteria | 2051 |
| 505 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 506 | Ga0209565_1000626 | 3300025263 | Bacteria | 23268 |
| 507 | Ga0209565_1000828 | 3300025263 | Bacteria | 17495 |
| 508 | Ga0209565_1022326 | 3300025263 | Bacteria | 1311 |
| 509 | Ga0209455_1000128 | 3300025272 | Bacteria | 162413 |
| 510 | Ga0209673_1000372 | 3300025273 | Bacteria | 80748 |
| 511 | Ga0209673_1000450 | 3300025273 | Bacteria | 69939 |
| 512 | Ga0209673_1007083 | 3300025273 | Bacteria | 5255 |
| 513 | Ga0209673_1007737 | 3300025273 | Bacteria | 4892 |
| 514 | Ga0209673_1016574 | 3300025273 | Bacteria | 2748 |
| 515 | Ga0209673_1041361 | 3300025273 | Bacteria | 1309 |
| 516 | Ga0209130_1000060 | 3300025284 | Bacteria | 201501 |
| 517 | Ga0209130_1000105 | 3300025284 | Bacteria | 135199 |
| 518 | Ga0209130_1000114 | 3300025284 | Bacteria | 130381 |
| 519 | Ga0209130_1000615 | 3300025284 | Bacteria | 34069 |
| 520 | Ga0209130_1004346 | 3300025284 | Bacteria | 5437 |
| 521 | Ga0209130_1055609 | 3300025284 | Bacteria | 704 |
| 522 | Ga0209675_1000096 | 3300025291 | Bacteria | 133284 |
| 523 | Ga0209675_1001018 | 3300025291 | Bacteria | 17523 |
| 524 | Ga0209675_1001425 | 3300025291 | Bacteria | 13815 |
| 525 | Ga0209675_1002059 | 3300025291 | Bacteria | 10733 |
| 526 | Ga0209675_1002439 | 3300025291 | Bacteria | 9555 |
| 527 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 528 | Ga0209676_1000179 | 3300025292 | Bacteria | 150096 |
| 529 | Ga0209676_1000624 | 3300025292 | Bacteria | 51430 |
| 530 | Ga0209676_1005017 | 3300025292 | Bacteria | 7087 |
| 531 | Ga0209676_1006159 | 3300025292 | Bacteria | 6013 |
| 532 | Ga0209025_1000221 | 3300025294 | Bacteria | 135793 |
| 533 | Ga0209025_1000732 | 3300025294 | Bacteria | 55664 |
| 534 | Ga0209025_1012320 | 3300025294 | Bacteria | 5499 |
| 535 | Ga0209025_1015340 | 3300025294 | Bacteria | 4630 |
| 536 | Ga0209025_1018086 | 3300025294 | Bacteria | 4026 |
| 537 | Ga0209025_1027824 | 3300025294 | Bacteria | 2790 |
| 538 | Ga0209025_1065738 | 3300025294 | Bacteria | 1322 |
| 539 | Ga0209025_1117694 | 3300025294 | Bacteria | 800 |
| 540 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 541 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 542 | Ga0209564_1000151 | 3300025295 | Bacteria | 168783 |
| 543 | Ga0209564_1000246 | 3300025295 | Bacteria | 117096 |
| 544 | Ga0209564_1000495 | 3300025295 | Bacteria | 65018 |
| 545 | Ga0209564_1000677 | 3300025295 | Bacteria | 50407 |
| 546 | Ga0209564_1006113 | 3300025295 | Bacteria | 6608 |
| 547 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 548 | Ga0209758_1000196 | 3300025297 | Bacteria | 133816 |
| 549 | Ga0209758_1034255 | 3300025297 | Bacteria | 2024 |
| 550 | Ga0209758_1050722 | 3300025297 | Bacteria | 1452 |
| 551 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 552 | Ga0209050_1000172 | 3300025298 | Bacteria | 150096 |
| 553 | Ga0209050_1003833 | 3300025298 | Bacteria | 10720 |
| 554 | Ga0209050_1004037 | 3300025298 | Bacteria | 10311 |
| 555 | Ga0209050_1009307 | 3300025298 | Bacteria | 5050 |
| 556 | Ga0209050_1009881 | 3300025298 | Bacteria | 4794 |
| 557 | Ga0209050_1022647 | 3300025298 | Bacteria | 2245 |
| 558 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 559 | Ga0209256_1000069 | 3300025299 | Bacteria | 245640 |
| 560 | Ga0209256_1000161 | 3300025299 | Bacteria | 138270 |
| 561 | Ga0209256_1007820 | 3300025299 | Bacteria | 5145 |
| 562 | Ga0209256_1008436 | 3300025299 | Bacteria | 4778 |
| 563 | Ga0209256_1030237 | 3300025299 | Bacteria | 1497 |
| 564 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 565 | Ga0207426_1000115 | 3300025302 | Bacteria | 227423 |
| 566 | Ga0207426_1000308 | 3300025302 | Bacteria | 96061 |
| 567 | Ga0207426_1004804 | 3300025302 | Bacteria | 6413 |
| 568 | Ga0207426_1074086 | 3300025302 | Bacteria | 941 |
| 569 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 570 | Ga0209051_1000046 | 3300025303 | Bacteria | 296424 |
| 571 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 572 | Ga0209051_1000808 | 3300025303 | Bacteria | 32707 |
| 573 | Ga0209051_1000971 | 3300025303 | Bacteria | 27947 |
| 574 | Ga0209051_1001642 | 3300025303 | Bacteria | 18112 |
| 575 | Ga0209051_1003378 | 3300025303 | Bacteria | 10493 |
| 576 | Ga0209051_1008817 | 3300025303 | Bacteria | 5284 |
| 577 | Ga0209051_1027305 | 3300025303 | Bacteria | 2277 |
| 578 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 579 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 580 | Ga0209257_1000103 | 3300025304 | Bacteria | 245859 |
| 581 | Ga0209257_1000281 | 3300025304 | Bacteria | 114413 |
| 582 | Ga0209257_1000450 | 3300025304 | Bacteria | 77403 |
| 583 | Ga0209257_1001146 | 3300025304 | Bacteria | 33810 |
| 584 | Ga0209257_1002049 | 3300025304 | Bacteria | 21423 |
| 585 | Ga0209257_1005295 | 3300025304 | Bacteria | 9178 |
| 586 | Ga0209257_1043372 | 3300025304 | Bacteria | 1320 |
| 587 | Ga0209257_1047666 | 3300025304 | Bacteria | 1231 |
| 588 | Ga0207697_10008136 | 3300025315 | Bacteria | 4617 |
| 589 | Ga0207656_10011149 | 3300025321 | Bacteria | 3389 |
| 590 | Ga0207656_10017313 | 3300025321 | Bacteria | 2820 |
| 591 | Ga0207656_10061200 | 3300025321 | Bacteria | 1652 |
| 592 | Ga0207656_10125001 | 3300025321 | Bacteria | 1201 |
| 593 | Ga0207696_1010665 | 3300025711 | Bacteria | 3355 |
| 594 | Ga0207655_1000566 | 3300025728 | Bacteria | 45937 |
| 595 | Ga0207682_10004030 | 3300025893 | Bacteria | 6246 |
| 596 | Ga0207682_10032112 | 3300025893 | Bacteria | 2110 |
| 597 | Ga0207682_10035708 | 3300025893 | Bacteria | 2008 |
| 598 | Ga0207642_10003492 | 3300025899 | Bacteria | 4964 |
| 599 | Ga0207642_10028660 | 3300025899 | Bacteria | 2295 |
| 600 | Ga0207642_10111466 | 3300025899 | Bacteria | 1394 |
| 601 | Ga0207688_10071922 | 3300025901 | Bacteria | 1964 |
| 602 | Ga0207688_10073246 | 3300025901 | Bacteria | 1947 |
| 603 | Ga0207688_10115706 | 3300025901 | Bacteria | 1561 |
| 604 | Ga0207688_10206683 | 3300025901 | Bacteria | 1179 |
| 605 | Ga0207680_10007763 | 3300025903 | Bacteria | 5241 |
| 606 | Ga0207645_10005522 | 3300025907 | Bacteria | 9160 |
| 607 | Ga0207645_10017863 | 3300025907 | Bacteria | 4677 |
| 608 | Ga0207645_10216721 | 3300025907 | Bacteria | 1261 |
| 609 | Ga0207645_10314972 | 3300025907 | Bacteria | 1043 |
| 610 | Ga0207645_10370676 | 3300025907 | Bacteria | 960 |
| 611 | Ga0207645_10426018 | 3300025907 | Bacteria | 894 |
| 612 | Ga0207643_10045044 | 3300025908 | Bacteria | 2491 |
| 613 | Ga0207643_10077754 | 3300025908 | Bacteria | 1919 |
| 614 | Ga0207643_10454759 | 3300025908 | Bacteria | 815 |
| 615 | Ga0207705_10162819 | 3300025909 | Bacteria | 1676 |
| 616 | Ga0207705_10259472 | 3300025909 | Bacteria | 1326 |
| 617 | Ga0207705_10287483 | 3300025909 | Bacteria | 1259 |
| 618 | Ga0207705_10382976 | 3300025909 | Bacteria | 1086 |
| 619 | Ga0207684_10006187 | 3300025910 | Bacteria | 10933 |
| 620 | Ga0207695_10012332 | 3300025913 | Bacteria | 10268 |
| 621 | Ga0207695_10125208 | 3300025913 | Bacteria | 2533 |
| 622 | Ga0207695_10131491 | 3300025913 | Bacteria | 2460 |
| 623 | Ga0207671_10003108 | 3300025914 | Bacteria | 16882 |
| 624 | Ga0207671_10226861 | 3300025914 | Bacteria | 1464 |
| 625 | Ga0207671_10230478 | 3300025914 | Bacteria | 1453 |
| 626 | Ga0207660_10002058 | 3300025917 | Bacteria | 13362 |
| 627 | Ga0207660_10208836 | 3300025917 | Bacteria | 1528 |
| 628 | Ga0207662_10145067 | 3300025918 | Bacteria | 1506 |
| 629 | Ga0207657_10043973 | 3300025919 | Bacteria | 3931 |
| 630 | Ga0207657_10085185 | 3300025919 | Bacteria | 2648 |
| 631 | Ga0207657_10138674 | 3300025919 | Bacteria | 1988 |
| 632 | Ga0207657_10341044 | 3300025919 | Bacteria | 1183 |
| 633 | Ga0207649_10001452 | 3300025920 | Bacteria | 13956 |
| 634 | Ga0207649_10081913 | 3300025920 | Bacteria | 2091 |
| 635 | Ga0207652_10026534 | 3300025921 | Bacteria | 4826 |
| 636 | Ga0207652_10087228 | 3300025921 | Bacteria | 2737 |
| 637 | Ga0207652_10150609 | 3300025921 | Bacteria | 2083 |
| 638 | Ga0207681_10004661 | 3300025923 | Bacteria | 8432 |
| 639 | Ga0207681_10372383 | 3300025923 | Bacteria | 1148 |
| 640 | Ga0207681_10539038 | 3300025923 | Bacteria | 959 |
| 641 | Ga0207694_10017688 | 3300025924 | Bacteria | 5387 |
| 642 | Ga0207694_10035849 | 3300025924 | Bacteria | 3806 |
| 643 | Ga0207694_10076029 | 3300025924 | Bacteria | 2629 |
| 644 | Ga0207694_10127467 | 3300025924 | Bacteria | 2037 |
| 645 | Ga0207650_10001129 | 3300025925 | Bacteria | 19633 |
| 646 | Ga0207650_10020864 | 3300025925 | Bacteria | 4627 |
| 647 | Ga0207650_10048272 | 3300025925 | Bacteria | 3140 |
| 648 | Ga0207650_10062301 | 3300025925 | Bacteria | 2786 |
| 649 | Ga0207650_10155881 | 3300025925 | Bacteria | 1806 |
| 650 | Ga0207650_10925578 | 3300025925 | Bacteria | 740 |
| 651 | Ga0207659_10000725 | 3300025926 | Bacteria | 19531 |
| 652 | Ga0207659_10022818 | 3300025926 | Bacteria | 4171 |
| 653 | Ga0207659_10028803 | 3300025926 | Bacteria | 3777 |
| 654 | Ga0207659_10045089 | 3300025926 | Bacteria | 3106 |
| 655 | Ga0207659_10322783 | 3300025926 | Bacteria | 1274 |
| 656 | Ga0207659_10422653 | 3300025926 | Bacteria | 1118 |
| 657 | Ga0207659_10783518 | 3300025926 | Bacteria | 819 |
| 658 | Ga0207659_10978741 | 3300025926 | Bacteria | 728 |
| 659 | Ga0207687_10014932 | 3300025927 | Bacteria | 5086 |
| 660 | Ga0207687_10193463 | 3300025927 | Bacteria | 1585 |
| 661 | Ga0207687_10202260 | 3300025927 | Bacteria | 1553 |
| 662 | Ga0207644_10002875 | 3300025931 | Bacteria | 11100 |
| 663 | Ga0207644_10023515 | 3300025931 | Bacteria | 4222 |
| 664 | Ga0207644_10052328 | 3300025931 | Bacteria | 2934 |
| 665 | Ga0207644_10085948 | 3300025931 | Bacteria | 2334 |
| 666 | Ga0207644_10093758 | 3300025931 | Bacteria | 2242 |
| 667 | Ga0207644_10409754 | 3300025931 | Bacteria | 1109 |
| 668 | Ga0207644_10756057 | 3300025931 | Bacteria | 812 |
| 669 | Ga0207690_10005112 | 3300025932 | Bacteria | 7748 |
| 670 | Ga0207690_10404450 | 3300025932 | Bacteria | 1089 |
| 671 | Ga0207690_10836137 | 3300025932 | Bacteria | 762 |
| 672 | Ga0207706_10028023 | 3300025933 | Bacteria | 5033 |
| 673 | Ga0207706_10050549 | 3300025933 | Bacteria | 3673 |
| 674 | Ga0207706_10061572 | 3300025933 | Bacteria | 3305 |
| 675 | Ga0207706_10062327 | 3300025933 | Bacteria | 3284 |
| 676 | Ga0207706_10117286 | 3300025933 | Bacteria | 2341 |
| 677 | Ga0207706_10557383 | 3300025933 | Bacteria | 986 |
| 678 | Ga0207706_10599674 | 3300025933 | Bacteria | 946 |
| 679 | Ga0207686_10021892 | 3300025934 | Bacteria | 3675 |
| 680 | Ga0207686_10468970 | 3300025934 | Bacteria | 972 |
| 681 | Ga0207686_10493706 | 3300025934 | Bacteria | 949 |
| 682 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 683 | Ga0207709_10000230 | 3300025935 | Bacteria | 70768 |
| 684 | Ga0207709_10003289 | 3300025935 | Bacteria | 9698 |
| 685 | Ga0207709_10007670 | 3300025935 | Bacteria | 5986 |
| 686 | Ga0207709_10252337 | 3300025935 | Bacteria | 1289 |
| 687 | Ga0207709_10371934 | 3300025935 | Bacteria | 1085 |
| 688 | Ga0207670_10087229 | 3300025936 | Bacteria | 2198 |
| 689 | Ga0207669_10006230 | 3300025937 | Bacteria | 5433 |
| 690 | Ga0207669_10023729 | 3300025937 | Bacteria | 3282 |
| 691 | Ga0207669_10042005 | 3300025937 | Bacteria | 2666 |
| 692 | Ga0207669_10058706 | 3300025937 | Bacteria | 2349 |
| 693 | Ga0207669_10062500 | 3300025937 | Bacteria | 2294 |
| 694 | Ga0207669_10389578 | 3300025937 | Bacteria | 1088 |
| 695 | Ga0207669_10765960 | 3300025937 | Bacteria | 798 |
| 696 | Ga0207704_10251440 | 3300025938 | Bacteria | 1327 |
| 697 | Ga0207704_10751772 | 3300025938 | Bacteria | 811 |
| 698 | Ga0207665_10142248 | 3300025939 | Bacteria | 1712 |
| 699 | Ga0207691_10001003 | 3300025940 | Bacteria | 28006 |
| 700 | Ga0207691_10032968 | 3300025940 | Bacteria | 4826 |
| 701 | Ga0207691_10039555 | 3300025940 | Bacteria | 4362 |
| 702 | Ga0207691_10066609 | 3300025940 | Bacteria | 3258 |
| 703 | Ga0207691_10083381 | 3300025940 | Bacteria | 2870 |
| 704 | Ga0207691_10120713 | 3300025940 | Bacteria | 2323 |
| 705 | Ga0207691_10237223 | 3300025940 | Bacteria | 1577 |
| 706 | Ga0207691_10278650 | 3300025940 | Bacteria | 1439 |
| 707 | Ga0207691_10324298 | 3300025940 | Bacteria | 1320 |
| 708 | Ga0207691_10355247 | 3300025940 | Bacteria | 1253 |
| 709 | Ga0207711_10008951 | 3300025941 | Bacteria | 8369 |
| 710 | Ga0207711_10138781 | 3300025941 | Bacteria | 2186 |
| 711 | Ga0207711_10217615 | 3300025941 | Bacteria | 1746 |
| 712 | Ga0207711_10240063 | 3300025941 | Bacteria | 1661 |
| 713 | Ga0207711_10572061 | 3300025941 | Bacteria | 1054 |
| 714 | Ga0207689_10005991 | 3300025942 | Bacteria | 10752 |
| 715 | Ga0207689_10016929 | 3300025942 | Bacteria | 6167 |
| 716 | Ga0207689_10076742 | 3300025942 | Bacteria | 2747 |
| 717 | Ga0207689_10241177 | 3300025942 | Bacteria | 1494 |
| 718 | Ga0207689_10428290 | 3300025942 | Bacteria | 1104 |
| 719 | Ga0207661_10215610 | 3300025944 | Bacteria | 1694 |
| 720 | Ga0207679_10000225 | 3300025945 | Bacteria | 44668 |
| 721 | Ga0207679_10074108 | 3300025945 | Bacteria | 2578 |
| 722 | Ga0207679_10129823 | 3300025945 | Bacteria | 2020 |
| 723 | Ga0207679_10178779 | 3300025945 | Bacteria | 1753 |
| 724 | Ga0207679_10257600 | 3300025945 | Bacteria | 1486 |
| 725 | Ga0207679_10402682 | 3300025945 | Bacteria | 1204 |
| 726 | Ga0207667_10031173 | 3300025949 | Bacteria | 5758 |
| 727 | Ga0207667_10053192 | 3300025949 | Bacteria | 4261 |
| 728 | Ga0207667_10174234 | 3300025949 | Bacteria | 2211 |
| 729 | Ga0207651_10004166 | 3300025960 | Bacteria | 7235 |
| 730 | Ga0207651_10020668 | 3300025960 | Bacteria | 3980 |
| 731 | Ga0207651_10037615 | 3300025960 | Bacteria | 3172 |
| 732 | Ga0207651_10041840 | 3300025960 | Bacteria | 3045 |
| 733 | Ga0207651_10070181 | 3300025960 | Bacteria | 2477 |
| 734 | Ga0207651_10426499 | 3300025960 | Bacteria | 1133 |
| 735 | Ga0207651_10593435 | 3300025960 | Bacteria | 967 |
| 736 | Ga0207712_10077662 | 3300025961 | Bacteria | 2407 |
| 737 | Ga0207712_10087314 | 3300025961 | Bacteria | 2287 |
| 738 | Ga0207668_10071736 | 3300025972 | Bacteria | 2475 |
| 739 | Ga0207640_10003481 | 3300025981 | Bacteria | 8480 |
| 740 | Ga0207640_10010736 | 3300025981 | Bacteria | 5166 |
| 741 | Ga0207640_10496696 | 3300025981 | Bacteria | 1015 |
| 742 | Ga0207640_10690991 | 3300025981 | Bacteria | 874 |
| 743 | Ga0207658_10000412 | 3300025986 | Bacteria | 40643 |
| 744 | Ga0207658_10008870 | 3300025986 | Bacteria | 6824 |
| 745 | Ga0207658_10018001 | 3300025986 | Bacteria | 4870 |
| 746 | Ga0207658_10282793 | 3300025986 | Bacteria | 1423 |
| 747 | Ga0207658_10486981 | 3300025986 | Bacteria | 1097 |
| 748 | Ga0207677_10003460 | 3300026023 | Bacteria | 8367 |
| 749 | Ga0207677_10038300 | 3300026023 | Bacteria | 3143 |
| 750 | Ga0207677_10048693 | 3300026023 | Bacteria | 2855 |
| 751 | Ga0207677_10067429 | 3300026023 | Bacteria | 2507 |
| 752 | Ga0207677_10152954 | 3300026023 | Bacteria | 1782 |
| 753 | Ga0207677_10461635 | 3300026023 | Bacteria | 1090 |
| 754 | Ga0207677_11128300 | 3300026023 | Bacteria | 716 |
| 755 | Ga0207703_10004923 | 3300026035 | Bacteria | 10836 |
| 756 | Ga0207703_10018286 | 3300026035 | Bacteria | 5473 |
| 757 | Ga0207639_10102084 | 3300026041 | Bacteria | 2321 |
| 758 | Ga0207639_10191120 | 3300026041 | Bacteria | 1749 |
| 759 | Ga0207639_10344956 | 3300026041 | Bacteria | 1328 |
| 760 | Ga0207678_10014066 | 3300026067 | Bacteria | 7037 |
| 761 | Ga0207678_10142149 | 3300026067 | Bacteria | 2048 |
| 762 | Ga0207678_10558119 | 3300026067 | Bacteria | 1002 |
| 763 | Ga0207708_10030964 | 3300026075 | Bacteria | 4060 |
| 764 | Ga0207708_10064806 | 3300026075 | Bacteria | 2792 |
| 765 | Ga0207708_10515026 | 3300026075 | Bacteria | 1004 |
| 766 | Ga0207702_10021374 | 3300026078 | Bacteria | 5357 |
| 767 | Ga0207702_10193215 | 3300026078 | Bacteria | 1882 |
| 768 | Ga0207702_10621139 | 3300026078 | Bacteria | 1061 |
| 769 | Ga0207702_10892896 | 3300026078 | Bacteria | 880 |
| 770 | Ga0207641_10002951 | 3300026088 | Bacteria | 15383 |
| 771 | Ga0207641_10020843 | 3300026088 | Bacteria | 5387 |
| 772 | Ga0207641_10391479 | 3300026088 | Bacteria | 1333 |
| 773 | Ga0207648_10001142 | 3300026089 | Bacteria | 29820 |
| 774 | Ga0207648_10004128 | 3300026089 | Bacteria | 15023 |
| 775 | Ga0207648_10007320 | 3300026089 | Bacteria | 10877 |
| 776 | Ga0207648_10063005 | 3300026089 | Bacteria | 3232 |
| 777 | Ga0207648_10076766 | 3300026089 | Bacteria | 2912 |
| 778 | Ga0207648_10106098 | 3300026089 | Bacteria | 2465 |
| 779 | Ga0207648_10180983 | 3300026089 | Bacteria | 1866 |
| 780 | Ga0207648_10201255 | 3300026089 | Bacteria | 1766 |
| 781 | Ga0207648_10258908 | 3300026089 | Bacteria | 1552 |
| 782 | Ga0207648_10322856 | 3300026089 | Bacteria | 1387 |
| 783 | Ga0207648_10616973 | 3300026089 | Bacteria | 1001 |
| 784 | Ga0207676_10001271 | 3300026095 | Bacteria | 18758 |
| 785 | Ga0207676_10046806 | 3300026095 | Bacteria | 3349 |
| 786 | Ga0207676_10047313 | 3300026095 | Bacteria | 3333 |
| 787 | Ga0207676_10168583 | 3300026095 | Bacteria | 1905 |
| 788 | Ga0207676_10194569 | 3300026095 | Bacteria | 1787 |
| 789 | Ga0207676_10266423 | 3300026095 | Bacteria | 1549 |
| 790 | Ga0207674_10032904 | 3300026116 | Bacteria | 5434 |
| 791 | Ga0207674_10036445 | 3300026116 | Bacteria | 5125 |
| 792 | Ga0207674_10055624 | 3300026116 | Bacteria | 4022 |
| 793 | Ga0207675_100022248 | 3300026118 | Bacteria | 5903 |
| 794 | Ga0207675_100036654 | 3300026118 | Bacteria | 4574 |
| 795 | Ga0207675_100058473 | 3300026118 | Bacteria | 3597 |
| 796 | Ga0207675_100235059 | 3300026118 | Bacteria | 1769 |
| 797 | Ga0207675_100347515 | 3300026118 | Bacteria | 1453 |
| 798 | Ga0207675_100405476 | 3300026118 | Bacteria | 1344 |
| 799 | Ga0207683_10017025 | 3300026121 | Bacteria | 6187 |
| 800 | Ga0207683_10042627 | 3300026121 | Bacteria | 3964 |
| 801 | Ga0207683_10052282 | 3300026121 | Bacteria | 3579 |
| 802 | Ga0207683_10053693 | 3300026121 | Bacteria | 3533 |
| 803 | Ga0207683_10056428 | 3300026121 | Bacteria | 3445 |
| 804 | Ga0207683_10091182 | 3300026121 | Bacteria | 2714 |
| 805 | Ga0207683_10173803 | 3300026121 | Bacteria | 1952 |
| 806 | Ga0207683_10177495 | 3300026121 | Bacteria | 1931 |
| 807 | Ga0207683_10220879 | 3300026121 | Bacteria | 1726 |
| 808 | Ga0207683_10534447 | 3300026121 | Bacteria | 1084 |
| 809 | Ga0207683_10666892 | 3300026121 | Bacteria | 964 |
| 810 | Ga0207698_10030878 | 3300026142 | Bacteria | 3860 |
| 811 | Ga0207698_10173888 | 3300026142 | Bacteria | 1899 |
| 812 | Ga0207698_10554737 | 3300026142 | Bacteria | 1127 |
| 813 | Ga0207698_10741701 | 3300026142 | Bacteria | 980 |
| 814 | Ga0207698_11452636 | 3300026142 | Bacteria | 701 |
| 815 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 816 | Ga0209389_1006568 | 3300027296 | Bacteria | 10123 |
| 817 | Ga0209969_1010297 | 3300027360 | Bacteria | 1337 |
| 818 | Ga0209968_1000332 | 3300027526 | Bacteria | 7886 |
| 819 | Ga0209999_1006616 | 3300027543 | Bacteria | 2083 |
| 820 | Ga0209966_1000014 | 3300027695 | Bacteria | 81913 |
| 821 | Ga0209813_10046379 | 3300027866 | Bacteria | 1342 |
| 822 | Ga0209974_10001693 | 3300027876 | Bacteria | 7987 |
| 823 | Ga0209974_10011142 | 3300027876 | Bacteria | 3025 |
| 824 | Ga0209974_10027736 | 3300027876 | Bacteria | 1874 |
| 825 | Ga0209974_10030489 | 3300027876 | Bacteria | 1787 |
| 826 | Ga0207428_10095604 | 3300027907 | Bacteria | 2302 |
| 827 | Ga0268266_10137528 | 3300028379 | Bacteria | 2189 |
| 828 | Ga0268266_10315015 | 3300028379 | Bacteria | 1463 |
| 829 | Ga0268266_10352229 | 3300028379 | Bacteria | 1384 |
| 830 | Ga0268266_10900904 | 3300028379 | Bacteria | 855 |
| 831 | Ga0268266_11568120 | 3300028379 | Bacteria | 634 |
| 832 | Ga0268265_10019736 | 3300028380 | Bacteria | 4692 |
| 833 | Ga0268264_10001666 | 3300028381 | Bacteria | 20465 |
| 834 | Ga0268264_10005463 | 3300028381 | Bacteria | 10772 |
| 835 | Ga0268264_10483730 | 3300028381 | Bacteria | 1204 |
| 836 | Ga0268264_11030019 | 3300028381 | Bacteria | 830 |
| 837 | Ga0265318_10122019 | 3300028577 | Bacteria | 958 |
| 838 | Ga0307517_10003097 | 3300028786 | Bacteria | 26244 |
| 839 | Ga0307517_10172222 | 3300028786 | Bacteria | 1420 |
| 840 | Ga0307517_10209718 | 3300028786 | Bacteria | 1202 |
| 841 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 842 | Ga0307515_10000944 | 3300028794 | Bacteria | 66492 |
| 843 | Ga0307515_10001534 | 3300028794 | Bacteria | 51647 |
| 844 | Ga0307515_10001963 | 3300028794 | Bacteria | 45524 |
| 845 | Ga0307515_10005581 | 3300028794 | Bacteria | 25423 |
| 846 | Ga0307515_10016830 | 3300028794 | Bacteria | 13366 |
| 847 | Ga0307515_10246527 | 3300028794 | Bacteria | 1547 |
| 848 | Ga0307515_10418300 | 3300028794 | Bacteria | 961 |
| 849 | Ga0268256_1054495 | 3300030500 | Bacteria | 827 |
| 850 | Ga0316182_1413366 | 3300030745 | Bacteria | 2183 |
| 851 | Ga0265330_10001548 | 3300031235 | Bacteria | 13225 |
| 852 | Ga0265330_10097367 | 3300031235 | Bacteria | 1261 |
| 853 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 854 | Ga0265332_10000072 | 3300031238 | Bacteria | 86029 |
| 855 | Ga0265328_10010794 | 3300031239 | Bacteria | 3668 |
| 856 | Ga0265325_10002224 | 3300031241 | Bacteria | 13173 |
| 857 | Ga0265329_10045504 | 3300031242 | Bacteria | 1403 |
| 858 | Ga0265331_10008333 | 3300031250 | Bacteria | 5901 |
| 859 | Ga0265327_10000223 | 3300031251 | Bacteria | 115759 |
| 860 | Ga0265327_10002338 | 3300031251 | Bacteria | 20225 |
| 861 | Ga0265327_10003808 | 3300031251 | Bacteria | 13948 |
| 862 | Ga0265327_10210350 | 3300031251 | Bacteria | 878 |
| 863 | Ga0265316_10000115 | 3300031344 | Bacteria | 86934 |
| 864 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 865 | Ga0307513_10000094 | 3300031456 | Bacteria | 127685 |
| 866 | Ga0307513_10003659 | 3300031456 | Bacteria | 20801 |
| 867 | Ga0307513_10015349 | 3300031456 | Bacteria | 9288 |
| 868 | Ga0307513_10046752 | 3300031456 | Bacteria | 4714 |
| 869 | Ga0307513_10058530 | 3300031456 | Bacteria | 4094 |
| 870 | Ga0307513_10152820 | 3300031456 | Bacteria | 2213 |
| 871 | Ga0307509_10000120 | 3300031507 | Bacteria | 114238 |
| 872 | Ga0307509_10015361 | 3300031507 | Bacteria | 8934 |
| 873 | Ga0307509_10072514 | 3300031507 | Bacteria | 3587 |
| 874 | Ga0307509_10074997 | 3300031507 | Bacteria | 3514 |
| 875 | Ga0307509_10115949 | 3300031507 | Bacteria | 2669 |
| 876 | Ga0307509_10149664 | 3300031507 | Bacteria | 2253 |
| 877 | Ga0307408_100000064 | 3300031548 | Bacteria | 122509 |
| 878 | Ga0307408_100198160 | 3300031548 | Bacteria | 1623 |
| 879 | Ga0307408_100546902 | 3300031548 | Bacteria | 1021 |
| 880 | Ga0307408_100571011 | 3300031548 | Bacteria | 1001 |
| 881 | Ga0307508_10000017 | 3300031616 | Bacteria | 203567 |
| 882 | Ga0307508_10000163 | 3300031616 | Bacteria | 80086 |
| 883 | Ga0307508_10022852 | 3300031616 | Bacteria | 5682 |
| 884 | Ga0307508_10360829 | 3300031616 | Bacteria | 1044 |
| 885 | Ga0307514_10000823 | 3300031649 | Bacteria | 50357 |
| 886 | Ga0307514_10008501 | 3300031649 | Bacteria | 8734 |
| 887 | Ga0307514_10009567 | 3300031649 | Bacteria | 8140 |
| 888 | Ga0307514_10167877 | 3300031649 | Bacteria | 1439 |
| 889 | Ga0265314_10000516 | 3300031711 | Bacteria | 49905 |
| 890 | Ga0265314_10004171 | 3300031711 | Bacteria | 13583 |
| 891 | Ga0265342_10016086 | 3300031712 | Bacteria | 4899 |
| 892 | Ga0307516_10002019 | 3300031730 | Bacteria | 27686 |
| 893 | Ga0307516_10006850 | 3300031730 | Bacteria | 13279 |
| 894 | Ga0307516_10019640 | 3300031730 | Bacteria | 6994 |
| 895 | Ga0307516_10085135 | 3300031730 | Bacteria | 2999 |
| 896 | Ga0307516_10093094 | 3300031730 | Bacteria | 2840 |
| 897 | Ga0307405_10130348 | 3300031731 | Bacteria | 1736 |
| 898 | Ga0307413_10071919 | 3300031824 | Bacteria | 2181 |
| 899 | Ga0307413_10101510 | 3300031824 | Bacteria | 1902 |
| 900 | Ga0307406_10000879 | 3300031901 | Bacteria | 16916 |
| 901 | Ga0307406_10002603 | 3300031901 | Bacteria | 9832 |
| 902 | Ga0307406_10221578 | 3300031901 | Bacteria | 1406 |
| 903 | Ga0307406_10482539 | 3300031901 | Bacteria | 1001 |
| 904 | Ga0307407_10500375 | 3300031903 | Bacteria | 891 |
| 905 | Ga0307412_10027193 | 3300031911 | Bacteria | 3564 |
| 906 | Ga0307412_10195468 | 3300031911 | Bacteria | 1532 |
| 907 | Ga0307412_10236230 | 3300031911 | Bacteria | 1411 |
| 908 | Ga0307412_10358085 | 3300031911 | Bacteria | 1174 |
| 909 | Ga0307412_10468440 | 3300031911 | Bacteria | 1042 |
| 910 | Ga0307409_100004624 | 3300031995 | Bacteria | 7773 |
| 911 | Ga0307409_100433094 | 3300031995 | Bacteria | 1265 |
| 912 | Ga0307409_100487284 | 3300031995 | Bacteria | 1198 |
| 913 | Ga0307416_100022102 | 3300032002 | Bacteria | 4583 |
| 914 | Ga0307416_100035014 | 3300032002 | Bacteria | 3829 |
| 915 | Ga0307416_100235907 | 3300032002 | Bacteria | 1768 |
| 916 | Ga0307416_100795898 | 3300032002 | Bacteria | 1041 |
| 917 | Ga0307414_10033235 | 3300032004 | Bacteria | 3407 |
| 918 | Ga0307411_10001625 | 3300032005 | Bacteria | 9372 |
| 919 | Ga0307411_10015641 | 3300032005 | Bacteria | 4269 |
| 920 | Ga0307411_10217791 | 3300032005 | Bacteria | 1479 |
| 921 | Ga0307411_10786059 | 3300032005 | Bacteria | 837 |
| 922 | Ga0307415_100002068 | 3300032126 | Bacteria | 9920 |
| 923 | Ga0307507_10127164 | 3300033179 | Bacteria | 2010 |
| 924 | Ga0307510_10002394 | 3300033180 | Bacteria | 21269 |
| 925 | Ga0307510_10034941 | 3300033180 | Bacteria | 5619 |
| 926 | Ga0307510_10181925 | 3300033180 | Bacteria | 1663 |
| 927 | Ga0307510_10188421 | 3300033180 | Bacteria | 1614 |
| 928 | Ga0307510_10450594 | 3300033180 | Bacteria | 728 |
| 929 | Ga0373930_0015531 | 3300034816 | Bacteria | 1430 |
| 930 | Ga0373959_0011991 | 3300034820 | Bacteria | 1540 |
| 931 | Ga0373959_0032709 | 3300034820 | Bacteria | 1058 |
| 932 | Ga0373934_0033147 | 3300035086 | Bacteria | 2028 |
| 933 | Ga0373951_0016954 | 3300035091 | Bacteria | 1646 |
| 934 | Ga0373923_0126041 | 3300035111 | Bacteria | 1148 |
| 935 | Ga0373923_0261321 | 3300035111 | Bacteria | 812 |
| 936 | Ga0373932_0006153 | 3300035112 | Bacteria | 2834 |
| 937 | Ga0373932_0047369 | 3300035112 | Bacteria | 1264 |
| 938 | Ga0373936_0201448 | 3300035113 | Bacteria | 879 |
| 939 | Ga0373939_0000308 | 3300035114 | Bacteria | 12720 |
| 940 | Ga0373939_0093593 | 3300035114 | Bacteria | 1020 |
| 941 | Ga0373957_0179471 | 3300035120 | Bacteria | 877 |
| 942 | Ga0373960_0001221 | 3300035121 | Bacteria | 5624 |
| 943 | Ga0373943_0076009 | 3300035170 | Bacteria | 1712 |
| 944 | Ga0373955_0137995 | 3300035172 | Bacteria | 1428 |
| 945 | Ga0373924_0020497 | 3300035410 | Bacteria | 2571 |
| 946 | Ga0373931_0001161 | 3300035691 | Bacteria | 11196 |
| 947 | Ga0373931_0122405 | 3300035691 | Bacteria | 1488 |
| 948 | Ga0373931_0476487 | 3300035691 | Bacteria | 802 |
| 949 | Ga0373935_0165026 | 3300035692 | Bacteria | 1512 |
| 950 | Ga0373927_0008971 | 3300035695 | Bacteria | 6713 |
| 951 | Ga0373947_0125985 | 3300035725 | Bacteria | 1631 |
| 952 | Ga0373937_0018511 | 3300036401 | Bacteria | 6222 |
| 953 | Ga0373937_0027901 | 3300036401 | Bacteria | 5108 |
| 954 | Ga0373937_0253126 | 3300036401 | Bacteria | 1660 |
| 955 | Ga0373925_0102065 | 3300037068 | Bacteria | 2206 |
| 956 | Ga0373925_0168777 | 3300037068 | Bacteria | 1727 |
| 957 | Ga0373925_0360260 | 3300037068 | Bacteria | 1182 |
| 958 | Ga0373925_0456791 | 3300037068 | Bacteria | 1046 |
| 959 | Ga0395899_0001877 | 3300037312 | Bacteria | 17349 |
| 960 | Ga0395899_0221413 | 3300037312 | Bacteria | 1311 |
| 961 | Ga0395899_0361911 | 3300037312 | Bacteria | 968 |
| 962 | Ga0395900_0052840 | 3300037418 | Bacteria | 4182 |
| 963 | Ga0395900_0097042 | 3300037418 | Bacteria | 3028 |
| 964 | Ga0395900_0121734 | 3300037418 | Bacteria | 2677 |
| 965 | Ga0395900_0405808 | 3300037418 | Bacteria | 1326 |
| 966 | Ga0395898_0022468 | 3300037466 | Bacteria | 6388 |
| 967 | Ga0395898_0023515 | 3300037466 | Bacteria | 6226 |
| 968 | Ga0395898_0047602 | 3300037466 | Bacteria | 4207 |
| 969 | Ga0395898_0707332 | 3300037466 | Bacteria | 949 |
| 970 | Ga0395905_0000138 | 3300037471 | Bacteria | 120373 |
| 971 | Ga0395905_0000837 | 3300037471 | Bacteria | 40181 |
| 972 | Ga0395905_0013525 | 3300037471 | Bacteria | 7819 |
| 973 | Ga0395905_0014971 | 3300037471 | Bacteria | 7396 |
| 974 | Ga0395905_0018633 | 3300037471 | Bacteria | 6584 |
| 975 | Ga0395905_0026790 | 3300037471 | Bacteria | 5436 |
| 976 | Ga0395905_0039665 | 3300037471 | Bacteria | 4418 |
| 977 | Ga0395905_0042156 | 3300037471 | Bacteria | 4282 |
| 978 | Ga0395905_0059945 | 3300037471 | Bacteria | 3558 |
| 979 | Ga0395905_0123613 | 3300037471 | Bacteria | 2433 |
| 980 | Ga0395905_0135924 | 3300037471 | Bacteria | 2312 |
| 981 | Ga0395905_0150426 | 3300037471 | Bacteria | 2190 |
| 982 | Ga0395905_0221071 | 3300037471 | Bacteria | 1772 |
| 983 | Ga0395905_0252730 | 3300037471 | Bacteria | 1646 |
| 984 | Ga0395905_0538143 | 3300037471 | Bacteria | 1069 |
| 985 | Ga0395901_0036782 | 3300038443 | Bacteria | 5061 |
| 986 | Ga0395901_0069944 | 3300038443 | Bacteria | 3656 |
| 987 | Ga0395901_0141911 | 3300038443 | Bacteria | 2524 |
| 988 | Ga0395901_0175935 | 3300038443 | Bacteria | 2245 |
| 989 | Ga0395901_0260777 | 3300038443 | Bacteria | 1804 |
| 990 | Ga0395901_0364843 | 3300038443 | Bacteria | 1489 |
| 991 | Ga0395901_0843729 | 3300038443 | Bacteria | 902 |
| 992 | Ga0436365_1871400 | 3300039437 | Bacteria | 1060 |
| 993 | Ga0436361_0146317 | 3300039447 | Bacteria | 92155 |
| 994 | Ga0436361_0231085 | 3300039447 | Bacteria | 2027 |
| 995 | Ga0436361_0315951 | 3300039447 | Bacteria | 32136 |
| 996 | Ga0436361_0343816 | 3300039447 | Bacteria | 22925 |
| 997 | Ga0436361_0382345 | 3300039447 | Bacteria | 19107 |
| 998 | Ga0436361_0502840 | 3300039447 | Bacteria | 2212 |
| 999 | Ga0436361_1025974 | 3300039447 | Bacteria | 1623 |
| 1000 | Ga0436361_1052556 | 3300039447 | Bacteria | 39885 |
| 1001 | Ga0436361_1132349 | 3300039447 | Bacteria | 2370 |
| 1002 | Ga0436363_0424328 | 3300039450 | Bacteria | 752 |
| 1003 | Ga0439436_0019770 | 3300041404 | Bacteria | 2008 |
| 1004 | Ga0439466_0013982 | 3300041411 | Bacteria | 2930 |
| 1005 | Ga0451789_0792101 | 3300041443 | Bacteria | 1786 |
| 1006 | Ga0451793_0084455 | 3300041452 | Bacteria | 2603 |
| 1007 | Ga0451797_0514269 | 3300041453 | Bacteria | 3031 |
| 1008 | Ga0451795_1492822 | 3300041456 | Bacteria | 725 |
| 1009 | Ga0451798_0308381 | 3300041458 | Bacteria | 1277 |
| 1010 | Ga0451807_2595932 | 3300041486 | Bacteria | 746 |
| 1011 | Ga0451835_0681653 | 3300041492 | Bacteria | 823 |
| 1012 | Ga0451839_0245472 | 3300041496 | Bacteria | 1335 |
| 1013 | Ga0451841_0499384 | 3300041498 | Bacteria | 1416 |
| 1014 | Ga0451853_3545225 | 3300041512 | Bacteria | 901 |
| 1015 | Ga0439431_0011003 | 3300041997 | Bacteria | 2062 |
| 1016 | Ga0439431_0022002 | 3300041997 | Bacteria | 1534 |
| 1017 | Ga0439437_007626 | 3300042000 | Bacteria | 1210 |
| 1018 | Ga0439437_009888 | 3300042000 | Bacteria | 1083 |
| 1019 | Ga0439442_021007 | 3300042002 | Bacteria | 1353 |
| 1020 | Ga0439445_0016186 | 3300042004 | Bacteria | 1832 |
| 1021 | Ga0439445_0106099 | 3300042004 | Bacteria | 799 |
| 1022 | Ga0439449_0004755 | 3300042007 | Bacteria | 5241 |
| 1023 | Ga0450911_001967 | 3300042115 | Bacteria | 4285 |
| 1024 | Ga0450911_027936 | 3300042115 | Bacteria | 731 |
| 1025 | Ga0450914_001866 | 3300042118 | Bacteria | 1413 |
| 1026 | Ga0450919_002745 | 3300042121 | Bacteria | 2268 |
| 1027 | Ga0450920_001884 | 3300042122 | Bacteria | 3518 |
| 1028 | Ga0450923_003416 | 3300042125 | Bacteria | 2395 |
| 1029 | Ga0450890_001708 | 3300042127 | Bacteria | 3128 |
| 1030 | Ga0450890_001931 | 3300042127 | Bacteria | 2931 |
| 1031 | Ga0450897_011066 | 3300042128 | Bacteria | 875 |
| 1032 | Ga0450891_000279 | 3300042129 | Bacteria | 5183 |
| 1033 | Ga0450892_000564 | 3300042130 | Bacteria | 4253 |
| 1034 | Ga0450898_012015 | 3300042134 | Bacteria | 1425 |
| 1035 | Ga0450898_016930 | 3300042134 | Bacteria | 1249 |
| 1036 | Ga0450898_023528 | 3300042134 | Bacteria | 1096 |
| 1037 | Ga0450889_000263 | 3300042144 | Bacteria | 5821 |
| 1038 | Ga0439446_0002464 | 3300042156 | Bacteria | 4447 |
| 1039 | Ga0439434_0006244 | 3300042435 | Bacteria | 3477 |
| 1040 | Ga0439435_0063316 | 3300042436 | Bacteria | 1082 |
| 1041 | Ga0439459_0001287 | 3300042438 | Bacteria | 3660 |
| 1042 | Ga0439459_0016582 | 3300042438 | Bacteria | 1363 |
| 1043 | Ga0439464_0020171 | 3300042439 | Bacteria | 1824 |
| 1044 | Ga0450918_000139 | 3300042531 | Bacteria | 15860 |
| 1045 | Ga0450918_000288 | 3300042531 | Bacteria | 11374 |
| 1046 | Ga0450893_0001499 | 3300042532 | Bacteria | 3584 |
| 1047 | Ga0450893_0001662 | 3300042532 | Bacteria | 3423 |
| 1048 | Ga0451577_0022252 | 3300042876 | Bacteria | 5788 |
| 1049 | Ga0451577_0042165 | 3300042876 | Bacteria | 4093 |
| 1050 | Ga0451577_0293797 | 3300042876 | Bacteria | 1473 |
| 1051 | Ga0451577_0540710 | 3300042876 | Bacteria | 1058 |
| 1052 | Ga0466969_0017037 | 3300044656 | Bacteria | 3797 |
| 1053 | Ga0466969_0033787 | 3300044656 | Bacteria | 2594 |
| 1054 | Ga0453683_0002835 | 3300044673 | Bacteria | 13148 |
| 1055 | Ga0466965_0006955 | 3300044683 | Bacteria | 5177 |
| 1056 | Ga0466966_0002595 | 3300044684 | Bacteria | 11841 |
| 1057 | Ga0466966_0013446 | 3300044684 | Bacteria | 5417 |
| 1058 | Ga0466966_0263175 | 3300044684 | Bacteria | 1038 |
| 1059 | Ga0466961_0002324 | 3300044693 | Bacteria | 11811 |
| 1060 | Ga0466961_0012371 | 3300044693 | Bacteria | 5456 |
| 1061 | Ga0466963_0134608 | 3300044694 | Bacteria | 1709 |
| 1062 | Ga0466963_0190015 | 3300044694 | Bacteria | 1435 |
| 1063 | Ga0466963_0223238 | 3300044694 | Bacteria | 1320 |
| 1064 | Ga0466964_0012092 | 3300044706 | Bacteria | 3265 |
| 1065 | Ga0453684_0000121 | 3300044712 | Bacteria | 341067 |
| 1066 | Ga0453684_0011391 | 3300044712 | Bacteria | 14933 |
| 1067 | Ga0453684_0058580 | 3300044712 | Bacteria | 4974 |
| 1068 | Ga0453684_0067005 | 3300044712 | Bacteria | 4568 |
| 1069 | Ga0453684_0144168 | 3300044712 | Bacteria | 2840 |
| 1070 | Ga0453684_0363247 | 3300044712 | Bacteria | 1629 |
| 1071 | Ga0453684_0388449 | 3300044712 | Bacteria | 1566 |
| 1072 | Ga0453684_0399728 | 3300044712 | Bacteria | 1539 |
| 1073 | Ga0453684_0760905 | 3300044712 | Bacteria | 1048 |
| 1074 | Ga0466971_0014882 | 3300044719 | Bacteria | 3423 |
| 1075 | Ga0466968_0003831 | 3300044735 | Bacteria | 5581 |
| 1076 | Ga0466968_0013720 | 3300044735 | Bacteria | 3189 |
| 1077 | Ga0466970_0007496 | 3300044765 | Bacteria | 5474 |
| 1078 | Ga0466970_0082348 | 3300044765 | Bacteria | 1740 |
| 1079 | Ga0466957_0002248 | 3300044842 | Bacteria | 10347 |
| 1080 | Ga0466957_0017319 | 3300044842 | Bacteria | 4218 |
| 1081 | Ga0466957_0602790 | 3300044842 | Bacteria | 769 |
| 1082 | Ga0466959_0006996 | 3300045049 | Bacteria | 7884 |
| 1083 | Ga0466959_0028726 | 3300045049 | Bacteria | 4122 |
| 1084 | Ga0451576_0005731 | 3300045051 | Bacteria | 15465 |
| 1085 | Ga0451576_0007989 | 3300045051 | Bacteria | 12512 |
| 1086 | Ga0451576_0050947 | 3300045051 | Bacteria | 4342 |
| 1087 | Ga0451576_0115320 | 3300045051 | Bacteria | 2797 |
| 1088 | Ga0451576_0211312 | 3300045051 | Bacteria | 2026 |
| 1089 | Ga0451576_0236417 | 3300045051 | Bacteria | 1908 |
| 1090 | Ga0451576_0513705 | 3300045051 | Bacteria | 1258 |
| 1091 | Ga0451576_0719101 | 3300045051 | Bacteria | 1049 |
| 1092 | Ga0451576_1294723 | 3300045051 | Bacteria | 760 |
| 1093 | Ga0451576_1527780 | 3300045051 | Bacteria | 693 |
| 1094 | Ga0466958_0013315 | 3300045836 | Bacteria | 4680 |
| 1095 | Ga0466967_0330751 | 3300045976 | Bacteria | 1471 |
| 1096 | Ga0495592_0001471 | 3300046454 | Bacteria | 16387 |
| 1097 | Ga0495603_0252585 | 3300046455 | Bacteria | 1015 |
| 1098 | Ga0495603_0318981 | 3300046455 | Bacteria | 892 |
| 1099 | Ga0495590_0001744 | 3300046457 | Bacteria | 9222 |
| 1100 | Ga0495590_0040706 | 3300046457 | Bacteria | 1620 |
| 1101 | Ga0495629_0018252 | 3300046459 | Bacteria | 5024 |
| 1102 | Ga0495629_0300743 | 3300046459 | Bacteria | 1099 |
| 1103 | Ga0495629_0304188 | 3300046459 | Bacteria | 1092 |
| 1104 | Ga0495580_0018250 | 3300046472 | Bacteria | 5226 |
| 1105 | Ga0495639_0010899 | 3300046475 | Bacteria | 3915 |
| 1106 | Ga0495583_0000171 | 3300046506 | Bacteria | 110806 |
| 1107 | Ga0495583_0105022 | 3300046506 | Bacteria | 1202 |
| 1108 | Ga0495606_0000868 | 3300046507 | Bacteria | 45273 |
| 1109 | Ga0495606_0257462 | 3300046507 | Bacteria | 965 |
| 1110 | Ga0495610_0028601 | 3300046512 | Bacteria | 2945 |
| 1111 | Ga0495610_0194121 | 3300046512 | Bacteria | 836 |
| 1112 | Ga0495616_0003352 | 3300046513 | Bacteria | 10300 |
| 1113 | Ga0495618_0153996 | 3300046514 | Bacteria | 1468 |
| 1114 | Ga0495620_0052894 | 3300046515 | Bacteria | 1722 |
| 1115 | Ga0495628_0286553 | 3300046516 | Bacteria | 1222 |
| 1116 | Ga0495630_0451462 | 3300046517 | Bacteria | 985 |
| 1117 | Ga0495632_0017466 | 3300046519 | Bacteria | 3958 |
| 1118 | Ga0495632_0021852 | 3300046519 | Bacteria | 3439 |
| 1119 | Ga0495643_0040950 | 3300046522 | Bacteria | 2528 |
| 1120 | Ga0495648_0109826 | 3300046524 | Bacteria | 1503 |
| 1121 | Ga0495648_0117071 | 3300046524 | Bacteria | 1439 |
| 1122 | Ga0495663_0007358 | 3300046525 | Bacteria | 3042 |
| 1123 | Ga0495663_0090555 | 3300046525 | Bacteria | 997 |
| 1124 | Ga0495666_0105369 | 3300046526 | Bacteria | 1327 |
| 1125 | Ga0495666_0218393 | 3300046526 | Bacteria | 874 |
| 1126 | Ga0495642_0096254 | 3300046528 | Bacteria | 1256 |
| 1127 | Ga0495652_0293532 | 3300046529 | Bacteria | 1185 |
| 1128 | Ga0495654_0007324 | 3300046530 | Bacteria | 6182 |
| 1129 | Ga0495654_0020611 | 3300046530 | Bacteria | 3435 |
| 1130 | Ga0495586_0138276 | 3300046535 | Bacteria | 1366 |
| 1131 | Ga0495586_0222545 | 3300046535 | Bacteria | 1073 |
| 1132 | Ga0495598_0024276 | 3300046537 | Bacteria | 1642 |
| 1133 | Ga0495598_0245660 | 3300046537 | Bacteria | 661 |
| 1134 | Ga0495621_0156307 | 3300046539 | Bacteria | 900 |
| 1135 | Ga0495597_0000393 | 3300046542 | Bacteria | 38017 |
| 1136 | Ga0495597_0060189 | 3300046542 | Bacteria | 1657 |
| 1137 | Ga0495645_0119906 | 3300046543 | Bacteria | 1853 |
| 1138 | Ga0495622_0132809 | 3300046557 | Bacteria | 1133 |
| 1139 | Ga0495668_0098130 | 3300046616 | Bacteria | 1603 |
| 1140 | Ga0495625_0000903 | 3300046660 | Bacteria | 39973 |
| 1141 | Ga0495625_0003716 | 3300046660 | Bacteria | 14882 |
| 1142 | Ga0495625_0029597 | 3300046660 | Bacteria | 4093 |
| 1143 | Ga0495625_0114565 | 3300046660 | Bacteria | 1840 |
| 1144 | Ga0495661_0220853 | 3300046665 | Bacteria | 982 |
| 1145 | Ga0495588_0016294 | 3300046674 | Bacteria | 3591 |
| 1146 | Ga0495599_0228371 | 3300046678 | Bacteria | 1137 |
| 1147 | Ga0495599_0298484 | 3300046678 | Bacteria | 973 |
| 1148 | Ga0495623_0186156 | 3300046679 | Bacteria | 1203 |
| 1149 | Ga0495658_0021538 | 3300046683 | Bacteria | 3399 |
| 1150 | Ga0495658_0023401 | 3300046683 | Bacteria | 3279 |
| 1151 | Ga0495658_0108305 | 3300046683 | Bacteria | 1668 |
| 1152 | Ga0495658_0205463 | 3300046683 | Bacteria | 1229 |
| 1153 | Ga0495658_0213829 | 3300046683 | Bacteria | 1205 |
| 1154 | Ga0495669_0029390 | 3300046684 | Bacteria | 2410 |
| 1155 | Ga0495613_0090441 | 3300046689 | Bacteria | 2217 |
| 1156 | Ga0495624_0254131 | 3300046690 | Bacteria | 1063 |
| 1157 | Ga0495670_0338216 | 3300046691 | Bacteria | 809 |
| 1158 | Ga0495649_0001001 | 3300046694 | Bacteria | 22213 |
| 1159 | Ga0495589_0012815 | 3300046794 | Bacteria | 4334 |
| 1160 | Ga0495600_0048587 | 3300046809 | Bacteria | 2768 |
| 1161 | Ga0495660_0035115 | 3300046810 | Bacteria | 2803 |
| 1162 | Ga0495660_0119487 | 3300046810 | Bacteria | 1335 |
| 1163 | Ga0495636_0031425 | 3300047318 | Bacteria | 2176 |
| 1164 | Ga0495676_0013187 | 3300047321 | Bacteria | 7434 |
| 1165 | Ga0495676_0093425 | 3300047321 | Bacteria | 2243 |
| 1166 | Ga0495680_0041698 | 3300047322 | Bacteria | 3648 |
| 1167 | Ga0495680_0299860 | 3300047322 | Bacteria | 1128 |
| 1168 | Ga0495687_000138 | 3300047443 | Bacteria | 110840 |
| 1169 | Ga0495687_017456 | 3300047443 | Bacteria | 3580 |
| 1170 | Ga0495677_0174221 | 3300047445 | Bacteria | 833 |
| 1171 | Ga0495685_008881 | 3300047447 | Bacteria | 3351 |
| 1172 | Ga0495686_0002281 | 3300047472 | Bacteria | 18444 |
| 1173 | Ga0495686_0219370 | 3300047472 | Bacteria | 1083 |
| 1174 | Ga0495593_0000578 | 3300047673 | Bacteria | 20838 |
| 1175 | Ga0495602_0452775 | 3300048088 | Bacteria | 906 |
| 1176 | Ga0495615_0082489 | 3300048090 | Bacteria | 884 |
| 1177 | Ga0495626_0024171 | 3300048091 | Bacteria | 2982 |
| 1178 | Ga0496100_0012386 | 3300048903 | Bacteria | 4888 |
| 1179 | Ga0496100_0201179 | 3300048903 | Bacteria | 1452 |
| 1180 | Ga0496101_0009863 | 3300048904 | Bacteria | 6291 |
| 1181 | Ga0496102_0009115 | 3300048905 | Bacteria | 8513 |
| 1182 | Ga0496103_0022029 | 3300048906 | Bacteria | 3835 |
| 1183 | Ga0496104_0018679 | 3300048907 | Bacteria | 6329 |
| 1184 | Ga0496104_0018814 | 3300048907 | Bacteria | 6309 |
| 1185 | Ga0496104_0467807 | 3300048907 | Bacteria | 1172 |
| 1186 | Ga0496104_1279501 | 3300048907 | Bacteria | 637 |
| 1187 | Ga0496105_0000491 | 3300048908 | Bacteria | 26041 |
| 1188 | Ga0496105_0108748 | 3300048908 | Bacteria | 2289 |
| 1189 | Ga0496105_0342113 | 3300048908 | Bacteria | 1196 |
| 1190 | Ga0496106_0030765 | 3300048909 | Bacteria | 4001 |
| 1191 | Ga0496107_0025475 | 3300048910 | Bacteria | 4188 |
| 1192 | Ga0496108_0102989 | 3300048911 | Bacteria | 2436 |
| 1193 | Ga0496108_0204071 | 3300048911 | Bacteria | 1715 |
| 1194 | Ga0496108_0206051 | 3300048911 | Bacteria | 1707 |
| 1195 | Ga0496108_0453892 | 3300048911 | Bacteria | 1120 |
| 1196 | Ga0496108_0466732 | 3300048911 | Bacteria | 1103 |
| 1197 | Ga0496108_0631471 | 3300048911 | Bacteria | 932 |
| 1198 | Ga0496109_0072463 | 3300048912 | Bacteria | 3165 |
| 1199 | Ga0496109_0195971 | 3300048912 | Bacteria | 1899 |
| 1200 | Ga0496109_0293333 | 3300048912 | Bacteria | 1533 |
| 1201 | Ga0496109_0385275 | 3300048912 | Bacteria | 1324 |
| 1202 | Ga0496109_1039908 | 3300048912 | Bacteria | 756 |
| 1203 | Ga0496110_0106051 | 3300048913 | Bacteria | 2521 |
| 1204 | Ga0496110_0353816 | 3300048913 | Bacteria | 1338 |
| 1205 | Ga0496111_0089830 | 3300048914 | Bacteria | 2250 |
| 1206 | Ga0496111_0425011 | 3300048914 | Bacteria | 981 |
| 1207 | Ga0496111_0682362 | 3300048914 | Bacteria | 748 |
| 1208 | Ga0496113_0084087 | 3300048916 | Bacteria | 2443 |
| 1209 | Ga0496113_0184162 | 3300048916 | Bacteria | 1656 |
| 1210 | Ga0496114_0043366 | 3300048917 | Bacteria | 3730 |
| 1211 | Ga0496114_0101809 | 3300048917 | Bacteria | 2453 |
| 1212 | Ga0496114_0191340 | 3300048917 | Bacteria | 1790 |
| 1213 | Ga0496116_0020177 | 3300048919 | Bacteria | 5070 |
| 1214 | Ga0496116_0054208 | 3300048919 | Bacteria | 2643 |
| 1215 | Ga0496117_0025714 | 3300048920 | Bacteria | 4621 |
| 1216 | Ga0496117_0068573 | 3300048920 | Bacteria | 2393 |
| 1217 | Ga0496118_0074272 | 3300048921 | Bacteria | 2431 |
| 1218 | Ga0496118_0074389 | 3300048921 | Bacteria | 2428 |
| 1219 | Ga0496121_0052832 | 3300048924 | Bacteria | 3408 |
| 1220 | Ga0496121_0061500 | 3300048924 | Bacteria | 3081 |
| 1221 | Ga0496121_0079849 | 3300048924 | Bacteria | 2595 |
| 1222 | Ga0496121_0389875 | 3300048924 | Bacteria | 916 |
| 1223 | Ga0496122_0178075 | 3300048925 | Bacteria | 1272 |
| 1224 | Ga0496124_0004176 | 3300048927 | Bacteria | 17021 |
| 1225 | Ga0496124_0340435 | 3300048927 | Bacteria | 1065 |
| 1226 | Ga0496125_0014470 | 3300048928 | Bacteria | 7683 |
| 1227 | Ga0496125_0031049 | 3300048928 | Bacteria | 4768 |
| 1228 | Ga0496125_0035225 | 3300048928 | Bacteria | 4397 |
| 1229 | Ga0496125_0103076 | 3300048928 | Bacteria | 2094 |
| 1230 | Ga0496125_0301771 | 3300048928 | Bacteria | 981 |
| 1231 | Ga0496126_0285135 | 3300048929 | Bacteria | 1367 |
| 1232 | Ga0501308_003654 | 3300049128 | Bacteria | 1438 |
| 1233 | Ga0501292_000723 | 3300049515 | Bacteria | 4000 |
| 1234 | Ga0501293_010564 | 3300049516 | Bacteria | 800 |
| 1235 | Ga0501297_038232 | 3300049520 | Bacteria | 665 |
| 1236 | Ga0501298_015327 | 3300049521 | Bacteria | 1379 |
| 1237 | Ga0501031_0404328 | 3300049568 | Bacteria | 883 |
| 1238 | Ga0501037_0106857 | 3300049573 | Bacteria | 2017 |
| 1239 | Ga0501038_0020423 | 3300049574 | Bacteria | 5954 |
| 1240 | Ga0501042_0704410 | 3300049578 | Bacteria | 734 |
| 1241 | Ga0501043_0001706 | 3300049579 | Bacteria | 19026 |
| 1242 | Ga0501043_0283736 | 3300049579 | Bacteria | 1269 |
| 1243 | Ga0501046_0000132 | 3300049580 | Bacteria | 79506 |
| 1244 | Ga0501046_0593376 | 3300049580 | Bacteria | 786 |
| 1245 | Ga0501047_0000026 | 3300049581 | Bacteria | 225296 |
| 1246 | Ga0501047_0032393 | 3300049581 | Bacteria | 5045 |
| 1247 | Ga0501047_0167836 | 3300049581 | Bacteria | 2065 |
| 1248 | Ga0501198_000021 | 3300049649 | Bacteria | 70854 |
| 1249 | Ga0501199_012287 | 3300049650 | Bacteria | 934 |
| 1250 | Ga0501211_001974 | 3300049658 | Bacteria | 2190 |
| 1251 | Ga0501222_000018 | 3300049662 | Bacteria | 71805 |
| 1252 | Ga0501222_003183 | 3300049662 | Bacteria | 2255 |
| 1253 | Ga0501235_018379 | 3300049669 | Bacteria | 1550 |
| 1254 | Ga0501235_028209 | 3300049669 | Bacteria | 1261 |
| 1255 | Ga0501239_009032 | 3300049672 | Bacteria | 1076 |
| 1256 | Ga0501253_006788 | 3300049683 | Bacteria | 1569 |
| 1257 | Ga0501258_013651 | 3300049687 | Bacteria | 894 |
| 1258 | Ga0501225_0045954 | 3300049705 | Bacteria | 1209 |
| 1259 | Ga0501229_017995 | 3300049706 | Bacteria | 924 |
| 1260 | Ga0501080_0133122 | 3300049742 | Bacteria | 2301 |
| 1261 | Ga0501265_002087 | 3300049762 | Bacteria | 2278 |
| 1262 | Ga0501266_000160 | 3300049763 | Bacteria | 8622 |
| 1263 | Ga0501281_02232 | 3300049777 | Bacteria | 1427 |
| 1264 | Ga0501035_0032810 | 3300049822 | Bacteria | 4723 |
| 1265 | Ga0501035_0185222 | 3300049822 | Bacteria | 1792 |
| 1266 | Ga0501044_0036845 | 3300049823 | Bacteria | 5116 |
| 1267 | Ga0501044_0082197 | 3300049823 | Bacteria | 3260 |
| 1268 | Ga0501044_0101166 | 3300049823 | Bacteria | 2900 |
| 1269 | Ga0501045_0059792 | 3300049824 | Bacteria | 2792 |
| 1270 | nmdc:mga03683_137854_c1 | 3300050489 | Bacteria | 1095 |
| 1271 | nmdc:mga03683_141194_c1 | 3300050489 | Bacteria | 1083 |
| 1272 | nmdc:mga03683_19169_c1 | 3300050489 | Bacteria | 2609 |
| 1273 | nmdc:mga03683_49573_c1 | 3300050489 | Bacteria | 1749 |
| 1274 | nmdc:mga03683_5206_c1 | 3300050489 | Bacteria | 4376 |
| 1275 | nmdc:mga03n38_87079_c1 | 3300050490 | Bacteria | 1479 |
| 1276 | nmdc:mga00v17_296495_c1 | 3300050491 | Bacteria | 1050 |
| 1277 | nmdc:mga0yw44_29443_c1 | 3300050492 | Bacteria | 3170 |
| 1278 | nmdc:mga0yw44_93412_c1 | 3300050492 | Bacteria | 1905 |
| 1279 | nmdc:mga0k408_155897_c1 | 3300050493 | Bacteria | 1360 |
| 1280 | nmdc:mga0k408_157062_c1 | 3300050493 | Bacteria | 1355 |
| 1281 | nmdc:mga0k408_17025_c1 | 3300050493 | Bacteria | 4041 |
| 1282 | nmdc:mga0k408_17761_c1 | 3300050493 | Bacteria | 3965 |
| 1283 | nmdc:mga0k408_215715_c1 | 3300050493 | Bacteria | 1146 |
| 1284 | nmdc:mga0k408_235462_c1 | 3300050493 | Bacteria | 1093 |
| 1285 | nmdc:mga0k408_239917_c1 | 3300050493 | Bacteria | 1082 |
| 1286 | nmdc:mga0k408_24224_c1 | 3300050493 | Bacteria | 3430 |
| 1287 | nmdc:mga0k408_278_c1 | 3300050493 | Bacteria | 27806 |
| 1288 | nmdc:mga0k408_33886_c1 | 3300050493 | Bacteria | 2922 |
| 1289 | nmdc:mga0k408_353822_c1 | 3300050493 | Bacteria | 875 |
| 1290 | nmdc:mga0k408_36489_c1 | 3300050493 | Bacteria | 2822 |
| 1291 | nmdc:mga0k408_38309_c1 | 3300050493 | Bacteria | 2751 |
| 1292 | nmdc:mga0k408_4736_c1 | 3300050493 | Bacteria | 7209 |
| 1293 | nmdc:mga0k408_58330_c1 | 3300050493 | Bacteria | 2242 |
| 1294 | nmdc:mga0k408_60110_c1 | 3300050493 | Bacteria | 2208 |
| 1295 | nmdc:mga0k408_61535_c1 | 3300050493 | Bacteria | 2182 |
| 1296 | nmdc:mga0k408_7186_c1 | 3300050493 | Bacteria | 5952 |
| 1297 | nmdc:mga0k408_7557_c1 | 3300050493 | Bacteria | 5806 |
| 1298 | nmdc:mga06z11_132048_c1 | 3300050494 | Bacteria | 1403 |
| 1299 | nmdc:mga06z11_149157_c1 | 3300050494 | Bacteria | 1328 |
| 1300 | nmdc:mga06z11_154872_c1 | 3300050494 | Bacteria | 1306 |
| 1301 | nmdc:mga06z11_257385_c1 | 3300050494 | Bacteria | 1029 |
| 1302 | nmdc:mga06z11_523475_c1 | 3300050494 | Bacteria | 719 |
| 1303 | nmdc:mga06z11_6097_c1 | 3300050494 | Bacteria | 4879 |
| 1304 | nmdc:mga06z11_71471_c1 | 3300050494 | Bacteria | 1837 |
| 1305 | nmdc:mga04h51_53128_c1 | 3300050495 | Bacteria | 1366 |
| 1306 | nmdc:mga07m45_157481_c1 | 3300050496 | Bacteria | 1318 |
| 1307 | nmdc:mga07m45_165333_c1 | 3300050496 | Bacteria | 1285 |
| 1308 | nmdc:mga07m45_202_c1 | 3300050496 | Bacteria | 23538 |
| 1309 | nmdc:mga07m45_2873_c1 | 3300050496 | Bacteria | 8162 |
| 1310 | nmdc:mga07m45_299_c1 | 3300050496 | Bacteria | 20012 |
| 1311 | nmdc:mga07m45_3013_c2 | 3300050496 | Bacteria | 3794 |
| 1312 | nmdc:mga07m45_37512_c1 | 3300050496 | Bacteria | 2703 |
| 1313 | nmdc:mga07m45_451045_c1 | 3300050496 | Bacteria | 746 |
| 1314 | nmdc:mga07m45_5574_c1 | 3300050496 | Bacteria | 6283 |
| 1315 | nmdc:mga07m45_7454_c1 | 3300050496 | Bacteria | 5594 |
| 1316 | nmdc:mga07m45_9954_c1 | 3300050496 | Bacteria | 4949 |
| 1317 | nmdc:mga09592_6905_c1 | 3300050508 | Bacteria | 9232 |
| 1318 | nmdc:mga0qj67_485454_c1 | 3300050509 | Bacteria | 994 |
| 1319 | Ga0495612_0043903 | 3300053078 | Bacteria | 1828 |
| 1320 | Ga0500635_0000003 | 3300053080 | Bacteria | 216927 |
| 1321 | Ga0495619_0131144 | 3300053085 | Bacteria | 1722 |
| 1322 | Ga0495619_0720940 | 3300053085 | Bacteria | 677 |
| 1323 | Ga0500644_0001962 | 3300053088 | Bacteria | 5250 |
| 1324 | Ga0500644_0012871 | 3300053088 | Bacteria | 2324 |
| 1325 | Ga0500646_0020574 | 3300053090 | Bacteria | 1753 |
| 1326 | Ga0500651_0000024 | 3300053093 | Bacteria | 129450 |
| 1327 | Ga0500651_0002535 | 3300053093 | Bacteria | 9686 |
| 1328 | Ga0500651_0022441 | 3300053093 | Bacteria | 3942 |
| 1329 | Ga0500566_0022570 | 3300053094 | Bacteria | 3697 |
| 1330 | Ga0500566_0194079 | 3300053094 | Bacteria | 1031 |
| 1331 | Ga0500650_0229769 | 3300053098 | Bacteria | 837 |
| 1332 | Ga0500569_017007 | 3300053109 | Bacteria | 1852 |
| 1333 | Ga0500571_000051 | 3300053110 | Bacteria | 35723 |
| 1334 | Ga0500594_0000438 | 3300053118 | Bacteria | 9196 |
| 1335 | Ga0500594_0023544 | 3300053118 | Bacteria | 1562 |
| 1336 | Ga0500597_045680 | 3300053120 | Bacteria | 1853 |
| 1337 | Ga0500608_144311 | 3300053122 | Bacteria | 1051 |
| 1338 | Ga0500614_037736 | 3300053123 | Bacteria | 1214 |
| 1339 | Ga0500623_131793 | 3300053127 | Bacteria | 1070 |
| 1340 | Ga0500628_001903 | 3300053129 | Bacteria | 3513 |
| 1341 | Ga0500628_013419 | 3300053129 | Bacteria | 1529 |
| 1342 | Ga0500642_0004580 | 3300053130 | Bacteria | 4351 |
| 1343 | Ga0500652_000824 | 3300053131 | Bacteria | 10329 |
| 1344 | Ga0500652_020607 | 3300053131 | Bacteria | 2469 |
| 1345 | Ga0500655_000309 | 3300053133 | Bacteria | 11087 |
| 1346 | Ga0500655_005756 | 3300053133 | Bacteria | 2230 |
| 1347 | Ga0500658_0001156 | 3300053134 | Bacteria | 10726 |
| 1348 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 1349 | Ga0500568_0005643 | 3300053139 | Bacteria | 6440 |
| 1350 | Ga0500568_0021372 | 3300053139 | Bacteria | 2785 |
| 1351 | Ga0500577_0037596 | 3300053142 | Bacteria | 1742 |
| 1352 | Ga0500579_129131 | 3300053143 | Bacteria | 1190 |
| 1353 | Ga0500590_089978 | 3300053148 | Bacteria | 1491 |
| 1354 | Ga0500604_0114593 | 3300053151 | Bacteria | 897 |
| 1355 | Ga0500616_0121851 | 3300053153 | Bacteria | 1245 |
| 1356 | Ga0500619_000035 | 3300053154 | Bacteria | 41663 |
| 1357 | Ga0500622_0000974 | 3300053156 | Bacteria | 24254 |
| 1358 | Ga0500622_0001057 | 3300053156 | Bacteria | 22962 |
| 1359 | Ga0500624_006130 | 3300053157 | Bacteria | 1620 |
| 1360 | Ga0500634_0019452 | 3300053161 | Bacteria | 3658 |
| 1361 | Ga0500634_0043046 | 3300053161 | Bacteria | 2449 |
| 1362 | Ga0500636_0016831 | 3300053177 | Bacteria | 4311 |
| 1363 | Ga0500636_0074749 | 3300053177 | Bacteria | 1961 |
| 1364 | Ga0500645_000210 | 3300053730 | Bacteria | 44912 |
| 1365 | Ga0500645_000489 | 3300053730 | Bacteria | 26784 |
| 1366 | Ga0500645_000501 | 3300053730 | Bacteria | 26443 |
| 1367 | Ga0500661_001805 | 3300055283 | Bacteria | 4034 |
| 1368 | Ga0500661_009884 | 3300055283 | Bacteria | 1740 |
| 1369 | Ga0590071_000508 | 3300059421 | Bacteria | 11379 |
| 1370 | Ga0590075_046372 | 3300059424 | Bacteria | 1113 |
| 1371 | Ga0590075_050115 | 3300059424 | Bacteria | 1071 |
| 1372 | Ga0501082_0902416 | 3300060353 | Bacteria | 773 |
| 1373 | Ga0466962_0010092 | 3300061719 | Bacteria | 4530 |
| 1374 | Ga0466962_0506199 | 3300061719 | Bacteria | 611 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10240577 | Ga0105245_102405772 | 166 |
| 2 | 3300005356 | Ga0070674_100785591 | Ga0070674_1007855911 | 172 |
| 3 | 3300025937 | Ga0207669_10765960 | Ga0207669_107659601 | 172 |
| 4 | 3300031239 | Ga0265328_10010794 | Ga0265328_100107943 | 174 |
| 5 | 3300031344 | Ga0265316_10000115 | Ga0265316_100001158 | 174 |
| 6 | 3300037471 | Ga0395905_0018633 | Ga0395905_0018633_1884_2450 | 174 |
| 7 | 3300038443 | Ga0395901_0843729 | Ga0395901_0843729_196_762 | 174 |
| 8 | 3300045051 | Ga0451576_0719101 | Ga0451576_0719101_271_837 | 174 |
| 9 | 3300045051 | Ga0451576_1527780 | Ga0451576_1527780_59_625 | 174 |
| 10 | 3300048911 | Ga0496108_0466732 | Ga0496108_0466732_325_891 | 174 |
| 11 | 3300048912 | Ga0496109_0072463 | Ga0496109_0072463_781_1347 | 174 |
| 12 | 3300048912 | Ga0496109_0293333 | Ga0496109_0293333_305_871 | 174 |
| 13 | 3300048914 | Ga0496111_0425011 | Ga0496111_0425011_189_755 | 174 |
| 14 | 3300031238 | Ga0265332_10000003 | Ga0265332_10000003147 | 176 |
| 15 | 3300003759 | Ga0055525_1000013 | Ga0055525_100001378 | 177 |
| 16 | 3300003792 | Ga0055540_1015951 | Ga0055540_10159514 | 177 |
| 17 | 3300005364 | Ga0070673_100982161 | Ga0070673_1009821612 | 177 |
| 18 | 3300009147 | Ga0114129_10143287 | Ga0114129_101432873 | 177 |
| 19 | 3300010375 | Ga0105239_10881657 | Ga0105239_108816571 | 177 |
| 20 | 3300021361 | Ga0213872_10000354 | Ga0213872_1000035414 | 177 |
| 21 | 3300021361 | Ga0213872_10000496 | Ga0213872_1000049615 | 177 |
| 22 | 3300021361 | Ga0213872_10028967 | Ga0213872_100289674 | 177 |
| 23 | 3300025230 | Ga0209563_100025 | Ga0209563_100025508 | 177 |
| 24 | 3300025303 | Ga0209051_1000808 | Ga0209051_100080817 | 177 |
| 25 | 3300031507 | Ga0307509_10072514 | Ga0307509_100725141 | 177 |
| 26 | 3300039447 | Ga0436361_0315951 | Ga0436361_0315951_16729_17292 | 177 |
| 27 | 3300039447 | Ga0436361_0382345 | Ga0436361_0382345_3173_3736 | 177 |
| 28 | 3300039447 | Ga0436361_0502840 | Ga0436361_0502840_673_1236 | 177 |
| 29 | 3300039447 | Ga0436361_1025974 | Ga0436361_1025974_720_1283 | 177 |
| 30 | 3300048911 | Ga0496108_0631471 | Ga0496108_0631471_175_738 | 177 |
| 31 | 3300048912 | Ga0496109_0195971 | Ga0496109_0195971_954_1517 | 177 |
| 32 | 3300049822 | Ga0501035_0185222 | Ga0501035_0185222_160_726 | 177 |
| 33 | iso_pu_bacteria | 2643221585 | 2643935496 | 177 |
| 34 | iso_pu_bacteria | 2643221656 | 2644317279 | 177 |
| 35 | iso_pu_bacteria | 2721755523 | 2722884484 | 177 |
| 36 | 3300002077 | JGI24744J21845_10035852 | JGI24744J21845_100358522 | 178 |
| 37 | 3300002704 | JGI25155J39150_1000060 | JGI25155J39150_100006046 | 178 |
| 38 | 3300002705 | JGI25156J39149_1000090 | JGI25156J39149_100009038 | 178 |
| 39 | 3300002705 | JGI25156J39149_1000446 | JGI25156J39149_100044623 | 178 |
| 40 | 3300002705 | JGI25156J39149_1019495 | JGI25156J39149_10194952 | 178 |
| 41 | 3300002738 | JGI25154J39366_1000061 | JGI25154J39366_100006176 | 178 |
| 42 | 3300002738 | JGI25154J39366_1002660 | JGI25154J39366_10026603 | 178 |
| 43 | 3300002741 | JGI25157J39369_1000006 | JGI25157J39369_1000006105 | 178 |
| 44 | 3300002741 | JGI25157J39369_1000574 | JGI25157J39369_10005743 | 178 |
| 45 | 3300002772 | JGI25164J39214_1002617 | JGI25164J39214_10026172 | 178 |
| 46 | 3300002773 | JGI25152J39213_1000657 | JGI25152J39213_10006572 | 178 |
| 47 | 3300002773 | JGI25152J39213_1020505 | JGI25152J39213_10205052 | 178 |
| 48 | 3300002774 | JGI25150J39212_1001192 | JGI25150J39212_10011923 | 178 |
| 49 | 3300002774 | JGI25150J39212_1006586 | JGI25150J39212_10065862 | 178 |
| 50 | 3300002774 | JGI25150J39212_1011620 | JGI25150J39212_10116202 | 178 |
| 51 | 3300002987 | JGI25159J45721_1000203 | JGI25159J45721_100020324 | 178 |
| 52 | 3300002987 | JGI25159J45721_1003940 | JGI25159J45721_10039403 | 178 |
| 53 | 3300002987 | JGI25159J45721_1005644 | JGI25159J45721_10056441 | 178 |
| 54 | 3300003215 | JGI25153J46596_10004330 | JGI25153J46596_100043303 | 178 |
| 55 | 3300003316 | rootH1_10000544 | rootH1_100005443 | 178 |
| 56 | 3300003316 | rootH1_10005243 | rootH1_100052432 | 178 |
| 57 | 3300003322 | rootL2_10000757 | rootL2_1000075753 | 178 |
| 58 | 3300003322 | rootL2_10007392 | rootL2_100073929 | 178 |
| 59 | 3300003322 | rootL2_10025833 | rootL2_100258336 | 178 |
| 60 | 3300003323 | rootH1_10026981 | rootH1_100269813 | 178 |
| 61 | 3300003323 | rootH1_10071288 | rootH1_100712882 | 178 |
| 62 | 3300003323 | rootH1_10094745 | rootH1_100947455 | 178 |
| 63 | 3300003347 | JGI26128J50194_1000382 | JGI26128J50194_10003823 | 178 |
| 64 | 3300003354 | JGI25160J50197_1000071 | JGI25160J50197_100007157 | 178 |
| 65 | 3300003371 | JGI26145J50221_1004823 | JGI26145J50221_10048231 | 178 |
| 66 | 3300003374 | JGI25161J50226_1000030 | JGI25161J50226_1000030110 | 178 |
| 67 | 3300003374 | JGI25161J50226_1020127 | JGI25161J50226_10201271 | 178 |
| 68 | 3300003752 | Ga0055539_1001162 | Ga0055539_10011621 | 178 |
| 69 | 3300003752 | Ga0055539_1004241 | Ga0055539_10042413 | 178 |
| 70 | 3300003752 | Ga0055539_1012027 | Ga0055539_10120272 | 178 |
| 71 | 3300003756 | Ga0055533_1000011 | Ga0055533_1000011147 | 178 |
| 72 | 3300003759 | Ga0055525_1000903 | Ga0055525_10009036 | 178 |
| 73 | 3300003761 | Ga0055535_1000084 | Ga0055535_100008457 | 178 |
| 74 | 3300003761 | Ga0055535_1001649 | Ga0055535_10016495 | 178 |
| 75 | 3300003762 | Ga0055542_1000033 | Ga0055542_1000033132 | 178 |
| 76 | 3300003763 | Ga0055529_1000306 | Ga0055529_100030616 | 178 |
| 77 | 3300003771 | Ga0055526_1003627 | Ga0055526_100362713 | 178 |
| 78 | 3300003771 | Ga0055526_1004316 | Ga0055526_10043163 | 178 |
| 79 | 3300003771 | Ga0055526_1004665 | Ga0055526_10046652 | 178 |
| 80 | 3300003771 | Ga0055526_1007621 | Ga0055526_10076212 | 178 |
| 81 | 3300003771 | Ga0055526_1011709 | Ga0055526_10117091 | 178 |
| 82 | 3300003775 | Ga0055524_1000006 | Ga0055524_1000006190 | 178 |
| 83 | 3300003781 | Ga0055536_1003229 | Ga0055536_10032294 | 178 |
| 84 | 3300003781 | Ga0055536_1003340 | Ga0055536_10033404 | 178 |
| 85 | 3300003781 | Ga0055536_1012350 | Ga0055536_10123503 | 178 |
| 86 | 3300003781 | Ga0055536_1023112 | Ga0055536_10231122 | 178 |
| 87 | 3300003781 | Ga0055536_1068159 | Ga0055536_10681592 | 178 |
| 88 | 3300003790 | Ga0055528_1002771 | Ga0055528_10027716 | 178 |
| 89 | 3300003791 | Ga0055530_10000446 | Ga0055530_100004468 | 178 |
| 90 | 3300003791 | Ga0055530_10002347 | Ga0055530_100023477 | 178 |
| 91 | 3300003791 | Ga0055530_10005361 | Ga0055530_100053614 | 178 |
| 92 | 3300003791 | Ga0055530_10048831 | Ga0055530_100488311 | 178 |
| 93 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005123 | 178 |
| 94 | 3300003792 | Ga0055540_1001269 | Ga0055540_10012692 | 178 |
| 95 | 3300003792 | Ga0055540_1002903 | Ga0055540_10029034 | 178 |
| 96 | 3300003792 | Ga0055540_1017788 | Ga0055540_10177883 | 178 |
| 97 | 3300003794 | Ga0055531_10000254 | Ga0055531_1000025423 | 178 |
| 98 | 3300003794 | Ga0055531_10000636 | Ga0055531_1000063616 | 178 |
| 99 | 3300003794 | Ga0055531_10004337 | Ga0055531_100043374 | 178 |
| 100 | 3300003794 | Ga0055531_10008940 | Ga0055531_100089402 | 178 |
| 101 | 3300003794 | Ga0055531_10017770 | Ga0055531_100177703 | 178 |
| 102 | 3300004625 | Ga0055543_1000566 | Ga0055543_10005661 | 178 |
| 103 | 3300004625 | Ga0055543_1002143 | Ga0055543_10021433 | 178 |
| 104 | 3300005262 | Ga0065165_1000024 | Ga0065165_1000024237 | 178 |
| 105 | 3300005262 | Ga0065165_1000076 | Ga0065165_100007626 | 178 |
| 106 | 3300005262 | Ga0065165_1010071 | Ga0065165_10100713 | 178 |
| 107 | 3300005262 | Ga0065165_1010072 | Ga0065165_10100721 | 178 |
| 108 | 3300005262 | Ga0065165_1033896 | Ga0065165_10338962 | 178 |
| 109 | 3300005288 | Ga0065714_10072716 | Ga0065714_100727163 | 178 |
| 110 | 3300005289 | Ga0065704_10268953 | Ga0065704_102689532 | 178 |
| 111 | 3300005290 | Ga0065712_10351505 | Ga0065712_103515051 | 178 |
| 112 | 3300005293 | Ga0065715_10138494 | Ga0065715_101384941 | 178 |
| 113 | 3300005293 | Ga0065715_10384488 | Ga0065715_103844882 | 178 |
| 114 | 3300005327 | Ga0070658_10029546 | Ga0070658_100295463 | 178 |
| 115 | 3300005327 | Ga0070658_10056492 | Ga0070658_100564922 | 178 |
| 116 | 3300005327 | Ga0070658_10356417 | Ga0070658_103564172 | 178 |
| 117 | 3300005328 | Ga0070676_10003761 | Ga0070676_100037617 | 178 |
| 118 | 3300005328 | Ga0070676_10050188 | Ga0070676_100501882 | 178 |
| 119 | 3300005329 | Ga0070683_100077494 | Ga0070683_1000774942 | 178 |
| 120 | 3300005329 | Ga0070683_100257806 | Ga0070683_1002578062 | 178 |
| 121 | 3300005330 | Ga0070690_100010080 | Ga0070690_1000100807 | 178 |
| 122 | 3300005330 | Ga0070690_100032568 | Ga0070690_1000325683 | 178 |
| 123 | 3300005331 | Ga0070670_100015059 | Ga0070670_1000150596 | 178 |
| 124 | 3300005331 | Ga0070670_100112408 | Ga0070670_1001124083 | 178 |
| 125 | 3300005331 | Ga0070670_100149350 | Ga0070670_1001493503 | 178 |
| 126 | 3300005331 | Ga0070670_100428770 | Ga0070670_1004287702 | 178 |
| 127 | 3300005333 | Ga0070677_10141706 | Ga0070677_101417062 | 178 |
| 128 | 3300005333 | Ga0070677_10248663 | Ga0070677_102486631 | 178 |
| 129 | 3300005334 | Ga0068869_100004104 | Ga0068869_1000041048 | 178 |
| 130 | 3300005334 | Ga0068869_100034945 | Ga0068869_1000349453 | 178 |
| 131 | 3300005334 | Ga0068869_100213950 | Ga0068869_1002139502 | 178 |
| 132 | 3300005335 | Ga0070666_10005027 | Ga0070666_100050273 | 178 |
| 133 | 3300005336 | Ga0070680_100050945 | Ga0070680_1000509452 | 178 |
| 134 | 3300005338 | Ga0068868_100001107 | Ga0068868_1000011073 | 178 |
| 135 | 3300005338 | Ga0068868_100075949 | Ga0068868_1000759493 | 178 |
| 136 | 3300005338 | Ga0068868_100079635 | Ga0068868_1000796352 | 178 |
| 137 | 3300005338 | Ga0068868_100091066 | Ga0068868_1000910664 | 178 |
| 138 | 3300005338 | Ga0068868_100539615 | Ga0068868_1005396151 | 178 |
| 139 | 3300005339 | Ga0070660_100078318 | Ga0070660_1000783183 | 178 |
| 140 | 3300005339 | Ga0070660_100120415 | Ga0070660_1001204154 | 178 |
| 141 | 3300005340 | Ga0070689_100025603 | Ga0070689_1000256033 | 178 |
| 142 | 3300005340 | Ga0070689_100259171 | Ga0070689_1002591712 | 178 |
| 143 | 3300005343 | Ga0070687_100515069 | Ga0070687_1005150691 | 178 |
| 144 | 3300005344 | Ga0070661_100000913 | Ga0070661_10000091322 | 178 |
| 145 | 3300005344 | Ga0070661_100190810 | Ga0070661_1001908102 | 178 |
| 146 | 3300005347 | Ga0070668_100014374 | Ga0070668_1000143748 | 178 |
| 147 | 3300005347 | Ga0070668_100204637 | Ga0070668_1002046372 | 178 |
| 148 | 3300005353 | Ga0070669_100002267 | Ga0070669_10000226710 | 178 |
| 149 | 3300005353 | Ga0070669_100090749 | Ga0070669_1000907493 | 178 |
| 150 | 3300005353 | Ga0070669_100294627 | Ga0070669_1002946271 | 178 |
| 151 | 3300005354 | Ga0070675_100002227 | Ga0070675_10000222716 | 178 |
| 152 | 3300005354 | Ga0070675_100049735 | Ga0070675_1000497354 | 178 |
| 153 | 3300005354 | Ga0070675_100161327 | Ga0070675_1001613272 | 178 |
| 154 | 3300005355 | Ga0070671_100014404 | Ga0070671_1000144045 | 178 |
| 155 | 3300005355 | Ga0070671_100020422 | Ga0070671_1000204226 | 178 |
| 156 | 3300005355 | Ga0070671_100027479 | Ga0070671_1000274795 | 178 |
| 157 | 3300005355 | Ga0070671_100063154 | Ga0070671_1000631543 | 178 |
| 158 | 3300005355 | Ga0070671_100119561 | Ga0070671_1001195612 | 178 |
| 159 | 3300005355 | Ga0070671_100162656 | Ga0070671_1001626562 | 178 |
| 160 | 3300005355 | Ga0070671_100182144 | Ga0070671_1001821442 | 178 |
| 161 | 3300005355 | Ga0070671_100201544 | Ga0070671_1002015442 | 178 |
| 162 | 3300005355 | Ga0070671_100336480 | Ga0070671_1003364802 | 178 |
| 163 | 3300005355 | Ga0070671_100400835 | Ga0070671_1004008352 | 178 |
| 164 | 3300005355 | Ga0070671_100877957 | Ga0070671_1008779571 | 178 |
| 165 | 3300005356 | Ga0070674_100007082 | Ga0070674_1000070824 | 178 |
| 166 | 3300005356 | Ga0070674_100036182 | Ga0070674_1000361824 | 178 |
| 167 | 3300005356 | Ga0070674_100067910 | Ga0070674_1000679103 | 178 |
| 168 | 3300005356 | Ga0070674_100151580 | Ga0070674_1001515803 | 178 |
| 169 | 3300005356 | Ga0070674_100468161 | Ga0070674_1004681612 | 178 |
| 170 | 3300005364 | Ga0070673_100002560 | Ga0070673_1000025604 | 178 |
| 171 | 3300005364 | Ga0070673_100005364 | Ga0070673_10000536410 | 178 |
| 172 | 3300005364 | Ga0070673_100041899 | Ga0070673_1000418991 | 178 |
| 173 | 3300005364 | Ga0070673_100078662 | Ga0070673_1000786622 | 178 |
| 174 | 3300005364 | Ga0070673_100083124 | Ga0070673_1000831243 | 178 |
| 175 | 3300005364 | Ga0070673_100097421 | Ga0070673_1000974213 | 178 |
| 176 | 3300005364 | Ga0070673_100119712 | Ga0070673_1001197122 | 178 |
| 177 | 3300005365 | Ga0070688_100763308 | Ga0070688_1007633081 | 178 |
| 178 | 3300005366 | Ga0070659_100007755 | Ga0070659_1000077555 | 178 |
| 179 | 3300005366 | Ga0070659_100395079 | Ga0070659_1003950791 | 178 |
| 180 | 3300005366 | Ga0070659_100484617 | Ga0070659_1004846172 | 178 |
| 181 | 3300005366 | Ga0070659_100791063 | Ga0070659_1007910631 | 178 |
| 182 | 3300005367 | Ga0070667_100000558 | Ga0070667_1000005585 | 178 |
| 183 | 3300005367 | Ga0070667_100002446 | Ga0070667_10000244614 | 178 |
| 184 | 3300005367 | Ga0070667_100006752 | Ga0070667_1000067528 | 178 |
| 185 | 3300005367 | Ga0070667_100204508 | Ga0070667_1002045082 | 178 |
| 186 | 3300005441 | Ga0070700_100024061 | Ga0070700_1000240613 | 178 |
| 187 | 3300005445 | Ga0070708_100149153 | Ga0070708_1001491532 | 178 |
| 188 | 3300005445 | Ga0070708_100438633 | Ga0070708_1004386332 | 178 |
| 189 | 3300005455 | Ga0070663_100000823 | Ga0070663_10000082315 | 178 |
| 190 | 3300005455 | Ga0070663_100525373 | Ga0070663_1005253732 | 178 |
| 191 | 3300005456 | Ga0070678_100001192 | Ga0070678_10000119213 | 178 |
| 192 | 3300005456 | Ga0070678_100003107 | Ga0070678_10000310712 | 178 |
| 193 | 3300005456 | Ga0070678_100033765 | Ga0070678_1000337653 | 178 |
| 194 | 3300005456 | Ga0070678_100072669 | Ga0070678_1000726693 | 178 |
| 195 | 3300005456 | Ga0070678_100075202 | Ga0070678_1000752023 | 178 |
| 196 | 3300005456 | Ga0070678_100093756 | Ga0070678_1000937563 | 178 |
| 197 | 3300005457 | Ga0070662_100069882 | Ga0070662_1000698822 | 178 |
| 198 | 3300005457 | Ga0070662_100156369 | Ga0070662_1001563692 | 178 |
| 199 | 3300005457 | Ga0070662_100403410 | Ga0070662_1004034102 | 178 |
| 200 | 3300005458 | Ga0070681_10085061 | Ga0070681_100850613 | 178 |
| 201 | 3300005458 | Ga0070681_11058395 | Ga0070681_110583951 | 178 |
| 202 | 3300005459 | Ga0068867_100000048 | Ga0068867_10000004846 | 178 |
| 203 | 3300005459 | Ga0068867_100007404 | Ga0068867_1000074042 | 178 |
| 204 | 3300005459 | Ga0068867_100011068 | Ga0068867_1000110683 | 178 |
| 205 | 3300005459 | Ga0068867_100013726 | Ga0068867_1000137264 | 178 |
| 206 | 3300005459 | Ga0068867_100150041 | Ga0068867_1001500413 | 178 |
| 207 | 3300005459 | Ga0068867_100360054 | Ga0068867_1003600542 | 178 |
| 208 | 3300005466 | Ga0070685_10024014 | Ga0070685_100240142 | 178 |
| 209 | 3300005466 | Ga0070685_10108274 | Ga0070685_101082742 | 178 |
| 210 | 3300005467 | Ga0070706_100000774 | Ga0070706_10000077421 | 178 |
| 211 | 3300005468 | Ga0070707_100085399 | Ga0070707_1000853992 | 178 |
| 212 | 3300005471 | Ga0070698_100040093 | Ga0070698_1000400937 | 178 |
| 213 | 3300005530 | Ga0070679_100011754 | Ga0070679_1000117543 | 178 |
| 214 | 3300005530 | Ga0070679_100046985 | Ga0070679_1000469853 | 178 |
| 215 | 3300005530 | Ga0070679_100059287 | Ga0070679_1000592872 | 178 |
| 216 | 3300005535 | Ga0070684_100006585 | Ga0070684_1000065856 | 178 |
| 217 | 3300005539 | Ga0068853_100021739 | Ga0068853_1000217392 | 178 |
| 218 | 3300005539 | Ga0068853_100113834 | Ga0068853_1001138344 | 178 |
| 219 | 3300005539 | Ga0068853_100181940 | Ga0068853_1001819403 | 178 |
| 220 | 3300005539 | Ga0068853_100481012 | Ga0068853_1004810122 | 178 |
| 221 | 3300005539 | Ga0068853_100573972 | Ga0068853_1005739722 | 178 |
| 222 | 3300005543 | Ga0070672_100014873 | Ga0070672_1000148733 | 178 |
| 223 | 3300005543 | Ga0070672_100042207 | Ga0070672_1000422073 | 178 |
| 224 | 3300005543 | Ga0070672_100124619 | Ga0070672_1001246192 | 178 |
| 225 | 3300005543 | Ga0070672_100133094 | Ga0070672_1001330942 | 178 |
| 226 | 3300005543 | Ga0070672_100221664 | Ga0070672_1002216642 | 178 |
| 227 | 3300005543 | Ga0070672_100269444 | Ga0070672_1002694442 | 178 |
| 228 | 3300005547 | Ga0070693_100125650 | Ga0070693_1001256502 | 178 |
| 229 | 3300005548 | Ga0070665_100020551 | Ga0070665_1000205518 | 178 |
| 230 | 3300005548 | Ga0070665_100271196 | Ga0070665_1002711962 | 178 |
| 231 | 3300005563 | Ga0068855_100019410 | Ga0068855_1000194107 | 178 |
| 232 | 3300005563 | Ga0068855_100030912 | Ga0068855_1000309123 | 178 |
| 233 | 3300005563 | Ga0068855_100173411 | Ga0068855_1001734113 | 178 |
| 234 | 3300005563 | Ga0068855_100358734 | Ga0068855_1003587343 | 178 |
| 235 | 3300005564 | Ga0070664_100000282 | Ga0070664_10000028211 | 178 |
| 236 | 3300005564 | Ga0070664_100015244 | Ga0070664_1000152443 | 178 |
| 237 | 3300005564 | Ga0070664_100151346 | Ga0070664_1001513463 | 178 |
| 238 | 3300005564 | Ga0070664_100165027 | Ga0070664_1001650272 | 178 |
| 239 | 3300005564 | Ga0070664_100424815 | Ga0070664_1004248152 | 178 |
| 240 | 3300005577 | Ga0068857_100003322 | Ga0068857_1000033221 | 178 |
| 241 | 3300005577 | Ga0068857_100378163 | Ga0068857_1003781632 | 178 |
| 242 | 3300005578 | Ga0068854_100019180 | Ga0068854_1000191804 | 178 |
| 243 | 3300005578 | Ga0068854_100044202 | Ga0068854_1000442023 | 178 |
| 244 | 3300005578 | Ga0068854_100091076 | Ga0068854_1000910762 | 178 |
| 245 | 3300005578 | Ga0068854_100508371 | Ga0068854_1005083711 | 178 |
| 246 | 3300005578 | Ga0068854_100562155 | Ga0068854_1005621552 | 178 |
| 247 | 3300005578 | Ga0068854_100902107 | Ga0068854_1009021071 | 178 |
| 248 | 3300005614 | Ga0068856_100000686 | Ga0068856_1000006866 | 178 |
| 249 | 3300005614 | Ga0068856_100097570 | Ga0068856_1000975702 | 178 |
| 250 | 3300005614 | Ga0068856_100180712 | Ga0068856_1001807122 | 178 |
| 251 | 3300005614 | Ga0068856_101284807 | Ga0068856_1012848071 | 178 |
| 252 | 3300005615 | Ga0070702_100144168 | Ga0070702_1001441682 | 178 |
| 253 | 3300005616 | Ga0068852_100062991 | Ga0068852_1000629912 | 178 |
| 254 | 3300005616 | Ga0068852_100106095 | Ga0068852_1001060953 | 178 |
| 255 | 3300005616 | Ga0068852_100440860 | Ga0068852_1004408602 | 178 |
| 256 | 3300005616 | Ga0068852_100499820 | Ga0068852_1004998202 | 178 |
| 257 | 3300005616 | Ga0068852_100573368 | Ga0068852_1005733681 | 178 |
| 258 | 3300005617 | Ga0068859_100016554 | Ga0068859_1000165543 | 178 |
| 259 | 3300005617 | Ga0068859_100028793 | Ga0068859_1000287938 | 178 |
| 260 | 3300005617 | Ga0068859_100048826 | Ga0068859_1000488264 | 178 |
| 261 | 3300005617 | Ga0068859_100073274 | Ga0068859_1000732743 | 178 |
| 262 | 3300005618 | Ga0068864_100002807 | Ga0068864_1000028073 | 178 |
| 263 | 3300005618 | Ga0068864_100020328 | Ga0068864_1000203284 | 178 |
| 264 | 3300005618 | Ga0068864_100028924 | Ga0068864_1000289244 | 178 |
| 265 | 3300005618 | Ga0068864_100114994 | Ga0068864_1001149943 | 178 |
| 266 | 3300005618 | Ga0068864_100172842 | Ga0068864_1001728422 | 178 |
| 267 | 3300005618 | Ga0068864_100175368 | Ga0068864_1001753683 | 178 |
| 268 | 3300005618 | Ga0068864_100698866 | Ga0068864_1006988662 | 178 |
| 269 | 3300005718 | Ga0068866_10006943 | Ga0068866_100069436 | 178 |
| 270 | 3300005718 | Ga0068866_10011759 | Ga0068866_100117592 | 178 |
| 271 | 3300005718 | Ga0068866_10181828 | Ga0068866_101818282 | 178 |
| 272 | 3300005719 | Ga0068861_100006804 | Ga0068861_10000680411 | 178 |
| 273 | 3300005719 | Ga0068861_100017152 | Ga0068861_1000171523 | 178 |
| 274 | 3300005834 | Ga0068851_10007694 | Ga0068851_100076943 | 178 |
| 275 | 3300005834 | Ga0068851_10034428 | Ga0068851_100344284 | 178 |
| 276 | 3300005834 | Ga0068851_10035492 | Ga0068851_100354922 | 178 |
| 277 | 3300005834 | Ga0068851_10087439 | Ga0068851_100874392 | 178 |
| 278 | 3300005840 | Ga0068870_10261681 | Ga0068870_102616812 | 178 |
| 279 | 3300005840 | Ga0068870_10558751 | Ga0068870_105587511 | 178 |
| 280 | 3300005841 | Ga0068863_100017712 | Ga0068863_1000177125 | 178 |
| 281 | 3300005841 | Ga0068863_100040341 | Ga0068863_1000403413 | 178 |
| 282 | 3300005841 | Ga0068863_100281378 | Ga0068863_1002813782 | 178 |
| 283 | 3300005841 | Ga0068863_100464468 | Ga0068863_1004644682 | 178 |
| 284 | 3300005842 | Ga0068858_100002948 | Ga0068858_1000029483 | 178 |
| 285 | 3300005842 | Ga0068858_100015770 | Ga0068858_1000157705 | 178 |
| 286 | 3300005843 | Ga0068860_100000524 | Ga0068860_10000052448 | 178 |
| 287 | 3300005843 | Ga0068860_100014939 | Ga0068860_1000149394 | 178 |
| 288 | 3300005843 | Ga0068860_100239250 | Ga0068860_1002392502 | 178 |
| 289 | 3300005843 | Ga0068860_100272332 | Ga0068860_1002723322 | 178 |
| 290 | 3300005844 | Ga0068862_100028727 | Ga0068862_1000287275 | 178 |
| 291 | 3300005844 | Ga0068862_100033542 | Ga0068862_1000335422 | 178 |
| 292 | 3300005844 | Ga0068862_100056196 | Ga0068862_1000561963 | 178 |
| 293 | 3300005844 | Ga0068862_100089601 | Ga0068862_1000896013 | 178 |
| 294 | 3300005937 | Ga0081455_10049895 | Ga0081455_100498955 | 178 |
| 295 | 3300006038 | Ga0075365_10004475 | Ga0075365_100044757 | 178 |
| 296 | 3300006038 | Ga0075365_10027584 | Ga0075365_100275844 | 178 |
| 297 | 3300006038 | Ga0075365_10171385 | Ga0075365_101713852 | 178 |
| 298 | 3300006038 | Ga0075365_10311035 | Ga0075365_103110352 | 178 |
| 299 | 3300006042 | Ga0075368_10001001 | Ga0075368_100010019 | 178 |
| 300 | 3300006048 | Ga0075363_100000527 | Ga0075363_1000005273 | 178 |
| 301 | 3300006048 | Ga0075363_100085262 | Ga0075363_1000852622 | 178 |
| 302 | 3300006051 | Ga0075364_10446391 | Ga0075364_104463912 | 178 |
| 303 | 3300006058 | Ga0075432_10002462 | Ga0075432_100024622 | 178 |
| 304 | 3300006177 | Ga0075362_10005340 | Ga0075362_100053402 | 178 |
| 305 | 3300006177 | Ga0075362_10082489 | Ga0075362_100824892 | 178 |
| 306 | 3300006178 | Ga0075367_10008057 | Ga0075367_100080572 | 178 |
| 307 | 3300006178 | Ga0075367_10008095 | Ga0075367_100080952 | 178 |
| 308 | 3300006178 | Ga0075367_10029539 | Ga0075367_100295391 | 178 |
| 309 | 3300006178 | Ga0075367_10039733 | Ga0075367_100397333 | 178 |
| 310 | 3300006178 | Ga0075367_10054621 | Ga0075367_100546213 | 178 |
| 311 | 3300006178 | Ga0075367_10074012 | Ga0075367_100740123 | 178 |
| 312 | 3300006178 | Ga0075367_10240091 | Ga0075367_102400912 | 178 |
| 313 | 3300006178 | Ga0075367_10338594 | Ga0075367_103385942 | 178 |
| 314 | 3300006186 | Ga0075369_10029119 | Ga0075369_100291193 | 178 |
| 315 | 3300006186 | Ga0075369_10047505 | Ga0075369_100475052 | 178 |
| 316 | 3300006195 | Ga0075366_10003151 | Ga0075366_100031512 | 178 |
| 317 | 3300006195 | Ga0075366_10007517 | Ga0075366_100075173 | 178 |
| 318 | 3300006195 | Ga0075366_10008186 | Ga0075366_100081865 | 178 |
| 319 | 3300006195 | Ga0075366_10008213 | Ga0075366_100082133 | 178 |
| 320 | 3300006195 | Ga0075366_10019512 | Ga0075366_100195125 | 178 |
| 321 | 3300006195 | Ga0075366_10036116 | Ga0075366_100361163 | 178 |
| 322 | 3300006195 | Ga0075366_10041313 | Ga0075366_100413133 | 178 |
| 323 | 3300006195 | Ga0075366_10060919 | Ga0075366_100609193 | 178 |
| 324 | 3300006195 | Ga0075366_10102326 | Ga0075366_101023262 | 178 |
| 325 | 3300006195 | Ga0075366_10163882 | Ga0075366_101638822 | 178 |
| 326 | 3300006195 | Ga0075366_10269044 | Ga0075366_102690441 | 178 |
| 327 | 3300006237 | Ga0097621_100053922 | Ga0097621_1000539223 | 178 |
| 328 | 3300006237 | Ga0097621_100091208 | Ga0097621_1000912083 | 178 |
| 329 | 3300006237 | Ga0097621_100243696 | Ga0097621_1002436961 | 178 |
| 330 | 3300006237 | Ga0097621_100486869 | Ga0097621_1004868692 | 178 |
| 331 | 3300006237 | Ga0097621_100649335 | Ga0097621_1006493352 | 178 |
| 332 | 3300006353 | Ga0075370_10005989 | Ga0075370_100059893 | 178 |
| 333 | 3300006353 | Ga0075370_10006507 | Ga0075370_100065074 | 178 |
| 334 | 3300006353 | Ga0075370_10006767 | Ga0075370_100067673 | 178 |
| 335 | 3300006353 | Ga0075370_10007526 | Ga0075370_100075262 | 178 |
| 336 | 3300006353 | Ga0075370_10008461 | Ga0075370_100084614 | 178 |
| 337 | 3300006353 | Ga0075370_10009708 | Ga0075370_100097086 | 178 |
| 338 | 3300006353 | Ga0075370_10014180 | Ga0075370_100141802 | 178 |
| 339 | 3300006353 | Ga0075370_10075172 | Ga0075370_100751722 | 178 |
| 340 | 3300006353 | Ga0075370_10283283 | Ga0075370_102832832 | 178 |
| 341 | 3300006353 | Ga0075370_10409557 | Ga0075370_104095572 | 178 |
| 342 | 3300006358 | Ga0068871_100015012 | Ga0068871_1000150125 | 178 |
| 343 | 3300006358 | Ga0068871_100053399 | Ga0068871_1000533994 | 178 |
| 344 | 3300006358 | Ga0068871_100181401 | Ga0068871_1001814013 | 178 |
| 345 | 3300006358 | Ga0068871_100528012 | Ga0068871_1005280122 | 178 |
| 346 | 3300006844 | Ga0075428_100349496 | Ga0075428_1003494962 | 178 |
| 347 | 3300006844 | Ga0075428_100564817 | Ga0075428_1005648172 | 178 |
| 348 | 3300006846 | Ga0075430_100171601 | Ga0075430_1001716011 | 178 |
| 349 | 3300006880 | Ga0075429_100373744 | Ga0075429_1003737441 | 178 |
| 350 | 3300006881 | Ga0068865_100015592 | Ga0068865_1000155923 | 178 |
| 351 | 3300006881 | Ga0068865_100115666 | Ga0068865_1001156663 | 178 |
| 352 | 3300006881 | Ga0068865_100520457 | Ga0068865_1005204571 | 178 |
| 353 | 3300006881 | Ga0068865_100618087 | Ga0068865_1006180871 | 178 |
| 354 | 3300006931 | Ga0097620_100016554 | Ga0097620_1000165543 | 178 |
| 355 | 3300006931 | Ga0097620_100028793 | Ga0097620_1000287932 | 178 |
| 356 | 3300006931 | Ga0097620_100048825 | Ga0097620_1000488253 | 178 |
| 357 | 3300006931 | Ga0097620_100073277 | Ga0097620_1000732773 | 178 |
| 358 | 3300006944 | Ga0099823_1000769 | Ga0099823_100076921 | 178 |
| 359 | 3300009036 | Ga0105244_10003895 | Ga0105244_100038956 | 178 |
| 360 | 3300009093 | Ga0105240_10002994 | Ga0105240_1000299420 | 178 |
| 361 | 3300009093 | Ga0105240_10003519 | Ga0105240_100035195 | 178 |
| 362 | 3300009093 | Ga0105240_10146167 | Ga0105240_101461673 | 178 |
| 363 | 3300009093 | Ga0105240_10428881 | Ga0105240_104288812 | 178 |
| 364 | 3300009098 | Ga0105245_10057323 | Ga0105245_100573234 | 178 |
| 365 | 3300009098 | Ga0105245_10066044 | Ga0105245_100660443 | 178 |
| 366 | 3300009098 | Ga0105245_10485001 | Ga0105245_104850012 | 178 |
| 367 | 3300009098 | Ga0105245_11556127 | Ga0105245_115561271 | 178 |
| 368 | 3300009148 | Ga0105243_10002013 | Ga0105243_1000201318 | 178 |
| 369 | 3300009148 | Ga0105243_10004862 | Ga0105243_1000486210 | 178 |
| 370 | 3300009148 | Ga0105243_10032690 | Ga0105243_100326903 | 178 |
| 371 | 3300009148 | Ga0105243_10230660 | Ga0105243_102306602 | 178 |
| 372 | 3300009148 | Ga0105243_10249258 | Ga0105243_102492582 | 178 |
| 373 | 3300009174 | Ga0105241_10125305 | Ga0105241_101253052 | 178 |
| 374 | 3300009176 | Ga0105242_10026946 | Ga0105242_100269461 | 178 |
| 375 | 3300009176 | Ga0105242_10258681 | Ga0105242_102586812 | 178 |
| 376 | 3300009176 | Ga0105242_10653349 | Ga0105242_106533491 | 178 |
| 377 | 3300009177 | Ga0105248_10047810 | Ga0105248_100478103 | 178 |
| 378 | 3300009177 | Ga0105248_10059405 | Ga0105248_100594053 | 178 |
| 379 | 3300009177 | Ga0105248_10073255 | Ga0105248_100732553 | 178 |
| 380 | 3300009177 | Ga0105248_10216044 | Ga0105248_102160441 | 178 |
| 381 | 3300009177 | Ga0105248_10431456 | Ga0105248_104314562 | 178 |
| 382 | 3300009177 | Ga0105248_10454554 | Ga0105248_104545542 | 178 |
| 383 | 3300009545 | Ga0105237_10000373 | Ga0105237_1000037326 | 178 |
| 384 | 3300009545 | Ga0105237_10092611 | Ga0105237_100926113 | 178 |
| 385 | 3300009545 | Ga0105237_10467623 | Ga0105237_104676232 | 178 |
| 386 | 3300009545 | Ga0105237_10506604 | Ga0105237_105066042 | 178 |
| 387 | 3300009551 | Ga0105238_10034361 | Ga0105238_100343615 | 178 |
| 388 | 3300009551 | Ga0105238_10100161 | Ga0105238_101001612 | 178 |
| 389 | 3300009551 | Ga0105238_10635581 | Ga0105238_106355812 | 178 |
| 390 | 3300009551 | Ga0105238_10645309 | Ga0105238_106453092 | 178 |
| 391 | 3300009553 | Ga0105249_10112011 | Ga0105249_101120112 | 178 |
| 392 | 3300009553 | Ga0105249_10156143 | Ga0105249_101561432 | 178 |
| 393 | 3300009553 | Ga0105249_10184195 | Ga0105249_101841953 | 178 |
| 394 | 3300009553 | Ga0105249_10269005 | Ga0105249_102690052 | 178 |
| 395 | 3300010375 | Ga0105239_10000153 | Ga0105239_1000015322 | 178 |
| 396 | 3300010375 | Ga0105239_10065796 | Ga0105239_100657964 | 178 |
| 397 | 3300010375 | Ga0105239_10638552 | Ga0105239_106385522 | 178 |
| 398 | 3300010375 | Ga0105239_10741747 | Ga0105239_107417472 | 178 |
| 399 | 3300011119 | Ga0105246_10016278 | Ga0105246_100162783 | 178 |
| 400 | 3300011119 | Ga0105246_10407444 | Ga0105246_104074442 | 178 |
| 401 | 3300011119 | Ga0105246_10803278 | Ga0105246_108032782 | 178 |
| 402 | 3300012475 | Ga0157317_1008911 | Ga0157317_10089111 | 178 |
| 403 | 3300012497 | Ga0157319_1000051 | Ga0157319_100005114 | 178 |
| 404 | 3300013100 | Ga0157373_10488174 | Ga0157373_104881742 | 178 |
| 405 | 3300013102 | Ga0157371_10162956 | Ga0157371_101629561 | 178 |
| 406 | 3300013102 | Ga0157371_10498939 | Ga0157371_104989391 | 178 |
| 407 | 3300013104 | Ga0157370_11019640 | Ga0157370_110196402 | 178 |
| 408 | 3300013105 | Ga0157369_10004791 | Ga0157369_100047914 | 178 |
| 409 | 3300013105 | Ga0157369_10495143 | Ga0157369_104951431 | 178 |
| 410 | 3300013296 | Ga0157374_10077081 | Ga0157374_100770812 | 178 |
| 411 | 3300013296 | Ga0157374_10091368 | Ga0157374_100913683 | 178 |
| 412 | 3300013296 | Ga0157374_10119941 | Ga0157374_101199413 | 178 |
| 413 | 3300013297 | Ga0157378_10002312 | Ga0157378_100023123 | 178 |
| 414 | 3300013297 | Ga0157378_10061950 | Ga0157378_100619504 | 178 |
| 415 | 3300013297 | Ga0157378_10168586 | Ga0157378_101685863 | 178 |
| 416 | 3300013297 | Ga0157378_11164734 | Ga0157378_111647341 | 178 |
| 417 | 3300013306 | Ga0163162_10003717 | Ga0163162_100037174 | 178 |
| 418 | 3300013306 | Ga0163162_10008368 | Ga0163162_1000836810 | 178 |
| 419 | 3300013306 | Ga0163162_10017839 | Ga0163162_100178395 | 178 |
| 420 | 3300013306 | Ga0163162_10085186 | Ga0163162_100851863 | 178 |
| 421 | 3300013306 | Ga0163162_10110354 | Ga0163162_101103543 | 178 |
| 422 | 3300013306 | Ga0163162_10145491 | Ga0163162_101454912 | 178 |
| 423 | 3300013306 | Ga0163162_10400644 | Ga0163162_104006442 | 178 |
| 424 | 3300013306 | Ga0163162_10514644 | Ga0163162_105146442 | 178 |
| 425 | 3300013306 | Ga0163162_11271222 | Ga0163162_112712221 | 178 |
| 426 | 3300013307 | Ga0157372_10114535 | Ga0157372_101145352 | 178 |
| 427 | 3300013307 | Ga0157372_10294396 | Ga0157372_102943962 | 178 |
| 428 | 3300013307 | Ga0157372_10368036 | Ga0157372_103680362 | 178 |
| 429 | 3300013307 | Ga0157372_11184716 | Ga0157372_111847162 | 178 |
| 430 | 3300013308 | Ga0157375_10022181 | Ga0157375_100221813 | 178 |
| 431 | 3300013308 | Ga0157375_10066799 | Ga0157375_100667994 | 178 |
| 432 | 3300013308 | Ga0157375_10305370 | Ga0157375_103053703 | 178 |
| 433 | 3300013308 | Ga0157375_10448713 | Ga0157375_104487131 | 178 |
| 434 | 3300013308 | Ga0157375_10735456 | Ga0157375_107354562 | 178 |
| 435 | 3300014325 | Ga0163163_10005658 | Ga0163163_1000565814 | 178 |
| 436 | 3300014325 | Ga0163163_10349873 | Ga0163163_103498732 | 178 |
| 437 | 3300014325 | Ga0163163_11317779 | Ga0163163_113177791 | 178 |
| 438 | 3300014326 | Ga0157380_10046314 | Ga0157380_100463142 | 178 |
| 439 | 3300014326 | Ga0157380_10124121 | Ga0157380_101241213 | 178 |
| 440 | 3300014326 | Ga0157380_10211411 | Ga0157380_102114113 | 178 |
| 441 | 3300014326 | Ga0157380_10361832 | Ga0157380_103618322 | 178 |
| 442 | 3300014326 | Ga0157380_10632274 | Ga0157380_106322741 | 178 |
| 443 | 3300014326 | Ga0157380_10971067 | Ga0157380_109710672 | 178 |
| 444 | 3300014497 | Ga0182008_10004585 | Ga0182008_100045853 | 178 |
| 445 | 3300014497 | Ga0182008_10013739 | Ga0182008_100137391 | 178 |
| 446 | 3300014745 | Ga0157377_10000056 | Ga0157377_1000005636 | 178 |
| 447 | 3300014968 | Ga0157379_10008560 | Ga0157379_100085602 | 178 |
| 448 | 3300014968 | Ga0157379_10026383 | Ga0157379_100263833 | 178 |
| 449 | 3300014968 | Ga0157379_10139011 | Ga0157379_101390112 | 178 |
| 450 | 3300014968 | Ga0157379_10320740 | Ga0157379_103207401 | 178 |
| 451 | 3300014968 | Ga0157379_10497823 | Ga0157379_104978232 | 178 |
| 452 | 3300014968 | Ga0157379_10873065 | Ga0157379_108730652 | 178 |
| 453 | 3300014969 | Ga0157376_10004932 | Ga0157376_100049326 | 178 |
| 454 | 3300014969 | Ga0157376_10642253 | Ga0157376_106422532 | 178 |
| 455 | 3300014969 | Ga0157376_11118535 | Ga0157376_111185351 | 178 |
| 456 | 3300015261 | Ga0182006_1004724 | Ga0182006_10047245 | 178 |
| 457 | 3300015261 | Ga0182006_1064109 | Ga0182006_10641091 | 178 |
| 458 | 3300015262 | Ga0182007_10000940 | Ga0182007_1000094019 | 178 |
| 459 | 3300015262 | Ga0182007_10001688 | Ga0182007_100016888 | 178 |
| 460 | 3300015262 | Ga0182007_10195197 | Ga0182007_101951971 | 178 |
| 461 | 3300015265 | Ga0182005_1077544 | Ga0182005_10775442 | 178 |
| 462 | 3300017792 | Ga0163161_10025431 | Ga0163161_100254314 | 178 |
| 463 | 3300017792 | Ga0163161_10030741 | Ga0163161_100307413 | 178 |
| 464 | 3300017792 | Ga0163161_10383246 | Ga0163161_103832462 | 178 |
| 465 | 3300021361 | Ga0213872_10000236 | Ga0213872_100002367 | 178 |
| 466 | 3300021361 | Ga0213872_10025704 | Ga0213872_100257043 | 178 |
| 467 | 3300025206 | Ga0209435_100001 | Ga0209435_100001142 | 178 |
| 468 | 3300025208 | Ga0209436_115643 | Ga0209436_1156432 | 178 |
| 469 | 3300025226 | Ga0209674_100003 | Ga0209674_100003449 | 178 |
| 470 | 3300025228 | Ga0209672_100228 | Ga0209672_1002283 | 178 |
| 471 | 3300025228 | Ga0209672_102765 | Ga0209672_1027654 | 178 |
| 472 | 3300025229 | Ga0209147_107112 | Ga0209147_1071122 | 178 |
| 473 | 3300025230 | Ga0209563_100010 | Ga0209563_100010178 | 178 |
| 474 | 3300025231 | Ga0207427_101838 | Ga0207427_1018385 | 178 |
| 475 | 3300025242 | Ga0209258_100089 | Ga0209258_100089131 | 178 |
| 476 | 3300025242 | Ga0209258_100162 | Ga0209258_1001625 | 178 |
| 477 | 3300025242 | Ga0209258_100601 | Ga0209258_10060125 | 178 |
| 478 | 3300025245 | Ga0207425_1000744 | Ga0207425_100074415 | 178 |
| 479 | 3300025245 | Ga0207425_1001690 | Ga0207425_10016905 | 178 |
| 480 | 3300025245 | Ga0207425_1002357 | Ga0207425_10023572 | 178 |
| 481 | 3300025245 | Ga0207425_1006971 | Ga0207425_10069713 | 178 |
| 482 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001511 | 178 |
| 483 | 3300025246 | Ga0209646_1000142 | Ga0209646_100014284 | 178 |
| 484 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003142 | 178 |
| 485 | 3300025250 | Ga0209026_1000027 | Ga0209026_100002784 | 178 |
| 486 | 3300025250 | Ga0209026_1017368 | Ga0209026_10173682 | 178 |
| 487 | 3300025253 | Ga0209677_100083 | Ga0209677_10008356 | 178 |
| 488 | 3300025253 | Ga0209677_100154 | Ga0209677_10015414 | 178 |
| 489 | 3300025253 | Ga0209677_100929 | Ga0209677_10092912 | 178 |
| 490 | 3300025254 | Ga0209148_1000097 | Ga0209148_1000097131 | 178 |
| 491 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001142 | 178 |
| 492 | 3300025256 | Ga0209759_1000240 | Ga0209759_10002407 | 178 |
| 493 | 3300025256 | Ga0209759_1001021 | Ga0209759_100102119 | 178 |
| 494 | 3300025256 | Ga0209759_1002002 | Ga0209759_10020023 | 178 |
| 495 | 3300025256 | Ga0209759_1006796 | Ga0209759_10067962 | 178 |
| 496 | 3300025258 | Ga0209129_1000025 | Ga0209129_1000025122 | 178 |
| 497 | 3300025258 | Ga0209129_1000033 | Ga0209129_1000033201 | 178 |
| 498 | 3300025258 | Ga0209129_1008754 | Ga0209129_10087542 | 178 |
| 499 | 3300025258 | Ga0209129_1011842 | Ga0209129_10118422 | 178 |
| 500 | 3300025263 | Ga0209565_1000004 | Ga0209565_100000427 | 178 |
| 501 | 3300025263 | Ga0209565_1000626 | Ga0209565_100062617 | 178 |
| 502 | 3300025263 | Ga0209565_1000828 | Ga0209565_10008283 | 178 |
| 503 | 3300025263 | Ga0209565_1022326 | Ga0209565_10223262 | 178 |
| 504 | 3300025272 | Ga0209455_1000128 | Ga0209455_1000128143 | 178 |
| 505 | 3300025273 | Ga0209673_1000372 | Ga0209673_100037287 | 178 |
| 506 | 3300025273 | Ga0209673_1000450 | Ga0209673_10004506 | 178 |
| 507 | 3300025273 | Ga0209673_1007083 | Ga0209673_10070831 | 178 |
| 508 | 3300025273 | Ga0209673_1007737 | Ga0209673_10077376 | 178 |
| 509 | 3300025273 | Ga0209673_1016574 | Ga0209673_10165742 | 178 |
| 510 | 3300025273 | Ga0209673_1041361 | Ga0209673_10413612 | 178 |
| 511 | 3300025284 | Ga0209130_1000060 | Ga0209130_100006073 | 178 |
| 512 | 3300025284 | Ga0209130_1000105 | Ga0209130_100010520 | 178 |
| 513 | 3300025284 | Ga0209130_1000114 | Ga0209130_100011425 | 178 |
| 514 | 3300025284 | Ga0209130_1000615 | Ga0209130_10006156 | 178 |
| 515 | 3300025284 | Ga0209130_1004346 | Ga0209130_10043463 | 178 |
| 516 | 3300025291 | Ga0209675_1000096 | Ga0209675_1000096124 | 178 |
| 517 | 3300025291 | Ga0209675_1001018 | Ga0209675_10010183 | 178 |
| 518 | 3300025291 | Ga0209675_1001425 | Ga0209675_100142518 | 178 |
| 519 | 3300025291 | Ga0209675_1002059 | Ga0209675_10020599 | 178 |
| 520 | 3300025291 | Ga0209675_1002439 | Ga0209675_10024393 | 178 |
| 521 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007573 | 178 |
| 522 | 3300025292 | Ga0209676_1000179 | Ga0209676_1000179130 | 178 |
| 523 | 3300025292 | Ga0209676_1000624 | Ga0209676_100062467 | 178 |
| 524 | 3300025292 | Ga0209676_1005017 | Ga0209676_10050172 | 178 |
| 525 | 3300025292 | Ga0209676_1006159 | Ga0209676_10061594 | 178 |
| 526 | 3300025294 | Ga0209025_1000221 | Ga0209025_100022120 | 178 |
| 527 | 3300025294 | Ga0209025_1012320 | Ga0209025_10123205 | 178 |
| 528 | 3300025294 | Ga0209025_1015340 | Ga0209025_10153404 | 178 |
| 529 | 3300025294 | Ga0209025_1018086 | Ga0209025_10180862 | 178 |
| 530 | 3300025294 | Ga0209025_1027824 | Ga0209025_10278242 | 178 |
| 531 | 3300025294 | Ga0209025_1065738 | Ga0209025_10657381 | 178 |
| 532 | 3300025294 | Ga0209025_1117694 | Ga0209025_11176942 | 178 |
| 533 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005817 | 178 |
| 534 | 3300025295 | Ga0209564_1000039 | Ga0209564_1000039122 | 178 |
| 535 | 3300025295 | Ga0209564_1000151 | Ga0209564_100015149 | 178 |
| 536 | 3300025295 | Ga0209564_1000246 | Ga0209564_100024655 | 178 |
| 537 | 3300025295 | Ga0209564_1000495 | Ga0209564_100049518 | 178 |
| 538 | 3300025295 | Ga0209564_1000677 | Ga0209564_100067750 | 178 |
| 539 | 3300025295 | Ga0209564_1006113 | Ga0209564_10061135 | 178 |
| 540 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027201 | 178 |
| 541 | 3300025297 | Ga0209758_1000196 | Ga0209758_10001963 | 178 |
| 542 | 3300025297 | Ga0209758_1034255 | Ga0209758_10342552 | 178 |
| 543 | 3300025297 | Ga0209758_1050722 | Ga0209758_10507222 | 178 |
| 544 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003935 | 178 |
| 545 | 3300025298 | Ga0209050_1000172 | Ga0209050_100017221 | 178 |
| 546 | 3300025298 | Ga0209050_1003833 | Ga0209050_10038336 | 178 |
| 547 | 3300025298 | Ga0209050_1009307 | Ga0209050_10093074 | 178 |
| 548 | 3300025298 | Ga0209050_1009881 | Ga0209050_10098814 | 178 |
| 549 | 3300025298 | Ga0209050_1022647 | Ga0209050_10226472 | 178 |
| 550 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001941 | 178 |
| 551 | 3300025299 | Ga0209256_1000069 | Ga0209256_1000069166 | 178 |
| 552 | 3300025299 | Ga0209256_1000161 | Ga0209256_100016187 | 178 |
| 553 | 3300025299 | Ga0209256_1008436 | Ga0209256_10084362 | 178 |
| 554 | 3300025299 | Ga0209256_1030237 | Ga0209256_10302372 | 178 |
| 555 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027161 | 178 |
| 556 | 3300025302 | Ga0207426_1000115 | Ga0207426_100011520 | 178 |
| 557 | 3300025302 | Ga0207426_1000308 | Ga0207426_10003088 | 178 |
| 558 | 3300025302 | Ga0207426_1004804 | Ga0207426_10048045 | 178 |
| 559 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003935 | 178 |
| 560 | 3300025303 | Ga0209051_1000046 | Ga0209051_100004621 | 178 |
| 561 | 3300025303 | Ga0209051_1000055 | Ga0209051_100005555 | 178 |
| 562 | 3300025303 | Ga0209051_1000971 | Ga0209051_100097123 | 178 |
| 563 | 3300025303 | Ga0209051_1001642 | Ga0209051_10016427 | 178 |
| 564 | 3300025303 | Ga0209051_1027305 | Ga0209051_10273052 | 178 |
| 565 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020573 | 178 |
| 566 | 3300025304 | Ga0209257_1000101 | Ga0209257_100010129 | 178 |
| 567 | 3300025304 | Ga0209257_1000281 | Ga0209257_100028186 | 178 |
| 568 | 3300025304 | Ga0209257_1001146 | Ga0209257_100114647 | 178 |
| 569 | 3300025304 | Ga0209257_1002049 | Ga0209257_10020496 | 178 |
| 570 | 3300025304 | Ga0209257_1005295 | Ga0209257_10052956 | 178 |
| 571 | 3300025304 | Ga0209257_1043372 | Ga0209257_10433722 | 178 |
| 572 | 3300025304 | Ga0209257_1047666 | Ga0209257_10476662 | 178 |
| 573 | 3300025315 | Ga0207697_10008136 | Ga0207697_100081362 | 178 |
| 574 | 3300025321 | Ga0207656_10011149 | Ga0207656_100111493 | 178 |
| 575 | 3300025321 | Ga0207656_10017313 | Ga0207656_100173133 | 178 |
| 576 | 3300025321 | Ga0207656_10061200 | Ga0207656_100612002 | 178 |
| 577 | 3300025321 | Ga0207656_10125001 | Ga0207656_101250012 | 178 |
| 578 | 3300025728 | Ga0207655_1000566 | Ga0207655_100056612 | 178 |
| 579 | 3300025893 | Ga0207682_10004030 | Ga0207682_100040306 | 178 |
| 580 | 3300025893 | Ga0207682_10032112 | Ga0207682_100321122 | 178 |
| 581 | 3300025893 | Ga0207682_10035708 | Ga0207682_100357081 | 178 |
| 582 | 3300025899 | Ga0207642_10003492 | Ga0207642_100034923 | 178 |
| 583 | 3300025899 | Ga0207642_10028660 | Ga0207642_100286603 | 178 |
| 584 | 3300025899 | Ga0207642_10111466 | Ga0207642_101114662 | 178 |
| 585 | 3300025901 | Ga0207688_10071922 | Ga0207688_100719222 | 178 |
| 586 | 3300025901 | Ga0207688_10073246 | Ga0207688_100732462 | 178 |
| 587 | 3300025901 | Ga0207688_10115706 | Ga0207688_101157062 | 178 |
| 588 | 3300025901 | Ga0207688_10206683 | Ga0207688_102066832 | 178 |
| 589 | 3300025903 | Ga0207680_10007763 | Ga0207680_100077637 | 178 |
| 590 | 3300025907 | Ga0207645_10005522 | Ga0207645_1000552210 | 178 |
| 591 | 3300025907 | Ga0207645_10216721 | Ga0207645_102167212 | 178 |
| 592 | 3300025907 | Ga0207645_10314972 | Ga0207645_103149722 | 178 |
| 593 | 3300025907 | Ga0207645_10370676 | Ga0207645_103706761 | 178 |
| 594 | 3300025907 | Ga0207645_10426018 | Ga0207645_104260182 | 178 |
| 595 | 3300025908 | Ga0207643_10045044 | Ga0207643_100450441 | 178 |
| 596 | 3300025909 | Ga0207705_10162819 | Ga0207705_101628191 | 178 |
| 597 | 3300025909 | Ga0207705_10259472 | Ga0207705_102594721 | 178 |
| 598 | 3300025909 | Ga0207705_10287483 | Ga0207705_102874832 | 178 |
| 599 | 3300025909 | Ga0207705_10382976 | Ga0207705_103829762 | 178 |
| 600 | 3300025910 | Ga0207684_10006187 | Ga0207684_1000618710 | 178 |
| 601 | 3300025913 | Ga0207695_10012332 | Ga0207695_100123326 | 178 |
| 602 | 3300025913 | Ga0207695_10131491 | Ga0207695_101314912 | 178 |
| 603 | 3300025914 | Ga0207671_10003108 | Ga0207671_100031088 | 178 |
| 604 | 3300025914 | Ga0207671_10226861 | Ga0207671_102268612 | 178 |
| 605 | 3300025917 | Ga0207660_10002058 | Ga0207660_1000205815 | 178 |
| 606 | 3300025917 | Ga0207660_10208836 | Ga0207660_102088362 | 178 |
| 607 | 3300025918 | Ga0207662_10145067 | Ga0207662_101450673 | 178 |
| 608 | 3300025919 | Ga0207657_10043973 | Ga0207657_100439733 | 178 |
| 609 | 3300025919 | Ga0207657_10085185 | Ga0207657_100851853 | 178 |
| 610 | 3300025919 | Ga0207657_10138674 | Ga0207657_101386742 | 178 |
| 611 | 3300025919 | Ga0207657_10341044 | Ga0207657_103410442 | 178 |
| 612 | 3300025920 | Ga0207649_10001452 | Ga0207649_1000145210 | 178 |
| 613 | 3300025920 | Ga0207649_10081913 | Ga0207649_100819132 | 178 |
| 614 | 3300025921 | Ga0207652_10026534 | Ga0207652_100265342 | 178 |
| 615 | 3300025921 | Ga0207652_10087228 | Ga0207652_100872282 | 178 |
| 616 | 3300025921 | Ga0207652_10150609 | Ga0207652_101506092 | 178 |
| 617 | 3300025923 | Ga0207681_10004661 | Ga0207681_100046616 | 178 |
| 618 | 3300025923 | Ga0207681_10372383 | Ga0207681_103723832 | 178 |
| 619 | 3300025923 | Ga0207681_10539038 | Ga0207681_105390382 | 178 |
| 620 | 3300025924 | Ga0207694_10017688 | Ga0207694_100176883 | 178 |
| 621 | 3300025924 | Ga0207694_10035849 | Ga0207694_100358493 | 178 |
| 622 | 3300025924 | Ga0207694_10076029 | Ga0207694_100760293 | 178 |
| 623 | 3300025924 | Ga0207694_10127467 | Ga0207694_101274672 | 178 |
| 624 | 3300025925 | Ga0207650_10001129 | Ga0207650_1000112916 | 178 |
| 625 | 3300025925 | Ga0207650_10020864 | Ga0207650_100208643 | 178 |
| 626 | 3300025925 | Ga0207650_10062301 | Ga0207650_100623013 | 178 |
| 627 | 3300025925 | Ga0207650_10155881 | Ga0207650_101558812 | 178 |
| 628 | 3300025925 | Ga0207650_10925578 | Ga0207650_109255781 | 178 |
| 629 | 3300025926 | Ga0207659_10000725 | Ga0207659_1000072517 | 178 |
| 630 | 3300025926 | Ga0207659_10022818 | Ga0207659_100228182 | 178 |
| 631 | 3300025926 | Ga0207659_10028803 | Ga0207659_100288035 | 178 |
| 632 | 3300025926 | Ga0207659_10322783 | Ga0207659_103227832 | 178 |
| 633 | 3300025926 | Ga0207659_10422653 | Ga0207659_104226532 | 178 |
| 634 | 3300025926 | Ga0207659_10783518 | Ga0207659_107835181 | 178 |
| 635 | 3300025926 | Ga0207659_10978741 | Ga0207659_109787411 | 178 |
| 636 | 3300025927 | Ga0207687_10014932 | Ga0207687_100149324 | 178 |
| 637 | 3300025927 | Ga0207687_10193463 | Ga0207687_101934632 | 178 |
| 638 | 3300025927 | Ga0207687_10202260 | Ga0207687_102022602 | 178 |
| 639 | 3300025931 | Ga0207644_10002875 | Ga0207644_100028754 | 178 |
| 640 | 3300025931 | Ga0207644_10023515 | Ga0207644_100235153 | 178 |
| 641 | 3300025931 | Ga0207644_10052328 | Ga0207644_100523283 | 178 |
| 642 | 3300025931 | Ga0207644_10085948 | Ga0207644_100859482 | 178 |
| 643 | 3300025931 | Ga0207644_10093758 | Ga0207644_100937582 | 178 |
| 644 | 3300025931 | Ga0207644_10409754 | Ga0207644_104097542 | 178 |
| 645 | 3300025931 | Ga0207644_10756057 | Ga0207644_107560572 | 178 |
| 646 | 3300025932 | Ga0207690_10005112 | Ga0207690_100051125 | 178 |
| 647 | 3300025932 | Ga0207690_10404450 | Ga0207690_104044502 | 178 |
| 648 | 3300025932 | Ga0207690_10836137 | Ga0207690_108361372 | 178 |
| 649 | 3300025933 | Ga0207706_10028023 | Ga0207706_100280234 | 178 |
| 650 | 3300025933 | Ga0207706_10050549 | Ga0207706_100505492 | 178 |
| 651 | 3300025933 | Ga0207706_10062327 | Ga0207706_100623272 | 178 |
| 652 | 3300025933 | Ga0207706_10117286 | Ga0207706_101172862 | 178 |
| 653 | 3300025933 | Ga0207706_10557383 | Ga0207706_105573832 | 178 |
| 654 | 3300025933 | Ga0207706_10599674 | Ga0207706_105996742 | 178 |
| 655 | 3300025934 | Ga0207686_10021892 | Ga0207686_100218922 | 178 |
| 656 | 3300025934 | Ga0207686_10468970 | Ga0207686_104689702 | 178 |
| 657 | 3300025934 | Ga0207686_10493706 | Ga0207686_104937061 | 178 |
| 658 | 3300025935 | Ga0207709_10000230 | Ga0207709_1000023012 | 178 |
| 659 | 3300025935 | Ga0207709_10003289 | Ga0207709_100032899 | 178 |
| 660 | 3300025935 | Ga0207709_10007670 | Ga0207709_100076706 | 178 |
| 661 | 3300025935 | Ga0207709_10252337 | Ga0207709_102523372 | 178 |
| 662 | 3300025935 | Ga0207709_10371934 | Ga0207709_103719342 | 178 |
| 663 | 3300025936 | Ga0207670_10087229 | Ga0207670_100872292 | 178 |
| 664 | 3300025937 | Ga0207669_10006230 | Ga0207669_100062304 | 178 |
| 665 | 3300025937 | Ga0207669_10023729 | Ga0207669_100237294 | 178 |
| 666 | 3300025937 | Ga0207669_10042005 | Ga0207669_100420052 | 178 |
| 667 | 3300025937 | Ga0207669_10058706 | Ga0207669_100587063 | 178 |
| 668 | 3300025937 | Ga0207669_10062500 | Ga0207669_100625002 | 178 |
| 669 | 3300025937 | Ga0207669_10389578 | Ga0207669_103895782 | 178 |
| 670 | 3300025938 | Ga0207704_10251440 | Ga0207704_102514401 | 178 |
| 671 | 3300025938 | Ga0207704_10751772 | Ga0207704_107517722 | 178 |
| 672 | 3300025939 | Ga0207665_10142248 | Ga0207665_101422482 | 178 |
| 673 | 3300025940 | Ga0207691_10001003 | Ga0207691_100010036 | 178 |
| 674 | 3300025940 | Ga0207691_10032968 | Ga0207691_100329683 | 178 |
| 675 | 3300025940 | Ga0207691_10039555 | Ga0207691_100395553 | 178 |
| 676 | 3300025940 | Ga0207691_10066609 | Ga0207691_100666093 | 178 |
| 677 | 3300025940 | Ga0207691_10083381 | Ga0207691_100833813 | 178 |
| 678 | 3300025940 | Ga0207691_10237223 | Ga0207691_102372232 | 178 |
| 679 | 3300025940 | Ga0207691_10278650 | Ga0207691_102786502 | 178 |
| 680 | 3300025940 | Ga0207691_10324298 | Ga0207691_103242982 | 178 |
| 681 | 3300025940 | Ga0207691_10355247 | Ga0207691_103552472 | 178 |
| 682 | 3300025941 | Ga0207711_10008951 | Ga0207711_100089514 | 178 |
| 683 | 3300025941 | Ga0207711_10138781 | Ga0207711_101387812 | 178 |
| 684 | 3300025941 | Ga0207711_10217615 | Ga0207711_102176152 | 178 |
| 685 | 3300025941 | Ga0207711_10240063 | Ga0207711_102400632 | 178 |
| 686 | 3300025941 | Ga0207711_10572061 | Ga0207711_105720612 | 178 |
| 687 | 3300025942 | Ga0207689_10016929 | Ga0207689_100169296 | 178 |
| 688 | 3300025942 | Ga0207689_10076742 | Ga0207689_100767423 | 178 |
| 689 | 3300025942 | Ga0207689_10241177 | Ga0207689_102411772 | 178 |
| 690 | 3300025942 | Ga0207689_10428290 | Ga0207689_104282902 | 178 |
| 691 | 3300025944 | Ga0207661_10215610 | Ga0207661_102156103 | 178 |
| 692 | 3300025945 | Ga0207679_10000225 | Ga0207679_1000022532 | 178 |
| 693 | 3300025945 | Ga0207679_10129823 | Ga0207679_101298232 | 178 |
| 694 | 3300025945 | Ga0207679_10178779 | Ga0207679_101787793 | 178 |
| 695 | 3300025945 | Ga0207679_10257600 | Ga0207679_102576002 | 178 |
| 696 | 3300025945 | Ga0207679_10402682 | Ga0207679_104026821 | 178 |
| 697 | 3300025949 | Ga0207667_10031173 | Ga0207667_100311733 | 178 |
| 698 | 3300025949 | Ga0207667_10053192 | Ga0207667_100531924 | 178 |
| 699 | 3300025949 | Ga0207667_10174234 | Ga0207667_101742342 | 178 |
| 700 | 3300025960 | Ga0207651_10004166 | Ga0207651_100041663 | 178 |
| 701 | 3300025960 | Ga0207651_10037615 | Ga0207651_100376152 | 178 |
| 702 | 3300025960 | Ga0207651_10041840 | Ga0207651_100418402 | 178 |
| 703 | 3300025960 | Ga0207651_10070181 | Ga0207651_100701813 | 178 |
| 704 | 3300025960 | Ga0207651_10426499 | Ga0207651_104264991 | 178 |
| 705 | 3300025960 | Ga0207651_10593435 | Ga0207651_105934352 | 178 |
| 706 | 3300025961 | Ga0207712_10077662 | Ga0207712_100776623 | 178 |
| 707 | 3300025961 | Ga0207712_10087314 | Ga0207712_100873142 | 178 |
| 708 | 3300025972 | Ga0207668_10071736 | Ga0207668_100717362 | 178 |
| 709 | 3300025981 | Ga0207640_10003481 | Ga0207640_100034815 | 178 |
| 710 | 3300025981 | Ga0207640_10010736 | Ga0207640_100107362 | 178 |
| 711 | 3300025981 | Ga0207640_10496696 | Ga0207640_104966962 | 178 |
| 712 | 3300025981 | Ga0207640_10690991 | Ga0207640_106909912 | 178 |
| 713 | 3300025986 | Ga0207658_10000412 | Ga0207658_100004125 | 178 |
| 714 | 3300025986 | Ga0207658_10008870 | Ga0207658_100088705 | 178 |
| 715 | 3300025986 | Ga0207658_10018001 | Ga0207658_100180014 | 178 |
| 716 | 3300025986 | Ga0207658_10282793 | Ga0207658_102827931 | 178 |
| 717 | 3300025986 | Ga0207658_10486981 | Ga0207658_104869812 | 178 |
| 718 | 3300026023 | Ga0207677_10003460 | Ga0207677_100034603 | 178 |
| 719 | 3300026023 | Ga0207677_10038300 | Ga0207677_100383003 | 178 |
| 720 | 3300026023 | Ga0207677_10048693 | Ga0207677_100486933 | 178 |
| 721 | 3300026023 | Ga0207677_10067429 | Ga0207677_100674292 | 178 |
| 722 | 3300026023 | Ga0207677_10152954 | Ga0207677_101529542 | 178 |
| 723 | 3300026023 | Ga0207677_10461635 | Ga0207677_104616352 | 178 |
| 724 | 3300026035 | Ga0207703_10004923 | Ga0207703_100049237 | 178 |
| 725 | 3300026035 | Ga0207703_10018286 | Ga0207703_100182862 | 178 |
| 726 | 3300026041 | Ga0207639_10102084 | Ga0207639_101020842 | 178 |
| 727 | 3300026041 | Ga0207639_10191120 | Ga0207639_101911203 | 178 |
| 728 | 3300026041 | Ga0207639_10344956 | Ga0207639_103449562 | 178 |
| 729 | 3300026067 | Ga0207678_10014066 | Ga0207678_100140663 | 178 |
| 730 | 3300026067 | Ga0207678_10142149 | Ga0207678_101421492 | 178 |
| 731 | 3300026067 | Ga0207678_10558119 | Ga0207678_105581192 | 178 |
| 732 | 3300026075 | Ga0207708_10030964 | Ga0207708_100309643 | 178 |
| 733 | 3300026075 | Ga0207708_10064806 | Ga0207708_100648062 | 178 |
| 734 | 3300026075 | Ga0207708_10515026 | Ga0207708_105150262 | 178 |
| 735 | 3300026078 | Ga0207702_10021374 | Ga0207702_100213743 | 178 |
| 736 | 3300026078 | Ga0207702_10193215 | Ga0207702_101932152 | 178 |
| 737 | 3300026078 | Ga0207702_10621139 | Ga0207702_106211392 | 178 |
| 738 | 3300026078 | Ga0207702_10892896 | Ga0207702_108928962 | 178 |
| 739 | 3300026088 | Ga0207641_10002951 | Ga0207641_100029519 | 178 |
| 740 | 3300026088 | Ga0207641_10020843 | Ga0207641_100208434 | 178 |
| 741 | 3300026088 | Ga0207641_10391479 | Ga0207641_103914792 | 178 |
| 742 | 3300026089 | Ga0207648_10001142 | Ga0207648_1000114224 | 178 |
| 743 | 3300026089 | Ga0207648_10004128 | Ga0207648_100041285 | 178 |
| 744 | 3300026089 | Ga0207648_10007320 | Ga0207648_100073206 | 178 |
| 745 | 3300026089 | Ga0207648_10063005 | Ga0207648_100630052 | 178 |
| 746 | 3300026089 | Ga0207648_10076766 | Ga0207648_100767663 | 178 |
| 747 | 3300026089 | Ga0207648_10106098 | Ga0207648_101060983 | 178 |
| 748 | 3300026089 | Ga0207648_10180983 | Ga0207648_101809833 | 178 |
| 749 | 3300026089 | Ga0207648_10201255 | Ga0207648_102012552 | 178 |
| 750 | 3300026089 | Ga0207648_10322856 | Ga0207648_103228562 | 178 |
| 751 | 3300026089 | Ga0207648_10616973 | Ga0207648_106169732 | 178 |
| 752 | 3300026095 | Ga0207676_10001271 | Ga0207676_100012714 | 178 |
| 753 | 3300026095 | Ga0207676_10046806 | Ga0207676_100468063 | 178 |
| 754 | 3300026095 | Ga0207676_10047313 | Ga0207676_100473133 | 178 |
| 755 | 3300026095 | Ga0207676_10168583 | Ga0207676_101685832 | 178 |
| 756 | 3300026095 | Ga0207676_10194569 | Ga0207676_101945693 | 178 |
| 757 | 3300026095 | Ga0207676_10266423 | Ga0207676_102664232 | 178 |
| 758 | 3300026116 | Ga0207674_10032904 | Ga0207674_100329047 | 178 |
| 759 | 3300026116 | Ga0207674_10055624 | Ga0207674_100556243 | 178 |
| 760 | 3300026118 | Ga0207675_100022248 | Ga0207675_1000222485 | 178 |
| 761 | 3300026118 | Ga0207675_100036654 | Ga0207675_1000366544 | 178 |
| 762 | 3300026118 | Ga0207675_100058473 | Ga0207675_1000584732 | 178 |
| 763 | 3300026118 | Ga0207675_100235059 | Ga0207675_1002350592 | 178 |
| 764 | 3300026118 | Ga0207675_100347515 | Ga0207675_1003475152 | 178 |
| 765 | 3300026118 | Ga0207675_100405476 | Ga0207675_1004054762 | 178 |
| 766 | 3300026121 | Ga0207683_10017025 | Ga0207683_100170255 | 178 |
| 767 | 3300026121 | Ga0207683_10042627 | Ga0207683_100426274 | 178 |
| 768 | 3300026121 | Ga0207683_10052282 | Ga0207683_100522822 | 178 |
| 769 | 3300026121 | Ga0207683_10053693 | Ga0207683_100536933 | 178 |
| 770 | 3300026121 | Ga0207683_10056428 | Ga0207683_100564283 | 178 |
| 771 | 3300026121 | Ga0207683_10091182 | Ga0207683_100911823 | 178 |
| 772 | 3300026121 | Ga0207683_10177495 | Ga0207683_101774953 | 178 |
| 773 | 3300026121 | Ga0207683_10220879 | Ga0207683_102208792 | 178 |
| 774 | 3300026121 | Ga0207683_10534447 | Ga0207683_105344472 | 178 |
| 775 | 3300026121 | Ga0207683_10666892 | Ga0207683_106668922 | 178 |
| 776 | 3300026142 | Ga0207698_10030878 | Ga0207698_100308782 | 178 |
| 777 | 3300026142 | Ga0207698_10554737 | Ga0207698_105547372 | 178 |
| 778 | 3300026142 | Ga0207698_10741701 | Ga0207698_107417012 | 178 |
| 779 | 3300026142 | Ga0207698_11452636 | Ga0207698_114526361 | 178 |
| 780 | 3300027296 | Ga0209389_1006568 | Ga0209389_10065689 | 178 |
| 781 | 3300027360 | Ga0209969_1010297 | Ga0209969_10102972 | 178 |
| 782 | 3300027526 | Ga0209968_1000332 | Ga0209968_10003325 | 178 |
| 783 | 3300027543 | Ga0209999_1006616 | Ga0209999_10066163 | 178 |
| 784 | 3300027695 | Ga0209966_1000014 | Ga0209966_100001443 | 178 |
| 785 | 3300027866 | Ga0209813_10046379 | Ga0209813_100463792 | 178 |
| 786 | 3300027876 | Ga0209974_10001693 | Ga0209974_100016931 | 178 |
| 787 | 3300027876 | Ga0209974_10011142 | Ga0209974_100111422 | 178 |
| 788 | 3300027876 | Ga0209974_10027736 | Ga0209974_100277363 | 178 |
| 789 | 3300027876 | Ga0209974_10030489 | Ga0209974_100304892 | 178 |
| 790 | 3300027907 | Ga0207428_10095604 | Ga0207428_100956041 | 178 |
| 791 | 3300028379 | Ga0268266_10137528 | Ga0268266_101375283 | 178 |
| 792 | 3300028379 | Ga0268266_10315015 | Ga0268266_103150152 | 178 |
| 793 | 3300028379 | Ga0268266_10352229 | Ga0268266_103522292 | 178 |
| 794 | 3300028379 | Ga0268266_10900904 | Ga0268266_109009042 | 178 |
| 795 | 3300028379 | Ga0268266_11568120 | Ga0268266_115681201 | 178 |
| 796 | 3300028380 | Ga0268265_10019736 | Ga0268265_100197365 | 178 |
| 797 | 3300028381 | Ga0268264_10001666 | Ga0268264_1000166621 | 178 |
| 798 | 3300028381 | Ga0268264_10005463 | Ga0268264_100054632 | 178 |
| 799 | 3300028381 | Ga0268264_10483730 | Ga0268264_104837302 | 178 |
| 800 | 3300028381 | Ga0268264_11030019 | Ga0268264_110300192 | 178 |
| 801 | 3300028577 | Ga0265318_10122019 | Ga0265318_101220192 | 178 |
| 802 | 3300028786 | Ga0307517_10003097 | Ga0307517_1000309713 | 178 |
| 803 | 3300028786 | Ga0307517_10172222 | Ga0307517_101722222 | 178 |
| 804 | 3300028786 | Ga0307517_10209718 | Ga0307517_102097182 | 178 |
| 805 | 3300028794 | Ga0307515_10000006 | Ga0307515_1000000639 | 178 |
| 806 | 3300028794 | Ga0307515_10000944 | Ga0307515_1000094437 | 178 |
| 807 | 3300028794 | Ga0307515_10001534 | Ga0307515_1000153444 | 178 |
| 808 | 3300028794 | Ga0307515_10001963 | Ga0307515_1000196318 | 178 |
| 809 | 3300028794 | Ga0307515_10005581 | Ga0307515_1000558128 | 178 |
| 810 | 3300028794 | Ga0307515_10016830 | Ga0307515_1001683012 | 178 |
| 811 | 3300028794 | Ga0307515_10246527 | Ga0307515_102465272 | 178 |
| 812 | 3300028794 | Ga0307515_10418300 | Ga0307515_104183002 | 178 |
| 813 | 3300030745 | Ga0316182_1413366 | Ga0316182_14133663 | 178 |
| 814 | 3300031235 | Ga0265330_10001548 | Ga0265330_100015484 | 178 |
| 815 | 3300031235 | Ga0265330_10097367 | Ga0265330_100973672 | 178 |
| 816 | 3300031238 | Ga0265332_10000072 | Ga0265332_1000007280 | 178 |
| 817 | 3300031241 | Ga0265325_10002224 | Ga0265325_100022249 | 178 |
| 818 | 3300031242 | Ga0265329_10045504 | Ga0265329_100455042 | 178 |
| 819 | 3300031251 | Ga0265327_10210350 | Ga0265327_102103502 | 178 |
| 820 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006199 | 178 |
| 821 | 3300031456 | Ga0307513_10000094 | Ga0307513_1000009466 | 178 |
| 822 | 3300031456 | Ga0307513_10003659 | Ga0307513_1000365912 | 178 |
| 823 | 3300031456 | Ga0307513_10015349 | Ga0307513_100153495 | 178 |
| 824 | 3300031456 | Ga0307513_10046752 | Ga0307513_100467522 | 178 |
| 825 | 3300031456 | Ga0307513_10058530 | Ga0307513_100585303 | 178 |
| 826 | 3300031456 | Ga0307513_10152820 | Ga0307513_101528203 | 178 |
| 827 | 3300031507 | Ga0307509_10000120 | Ga0307509_1000012082 | 178 |
| 828 | 3300031507 | Ga0307509_10015361 | Ga0307509_100153613 | 178 |
| 829 | 3300031507 | Ga0307509_10074997 | Ga0307509_100749973 | 178 |
| 830 | 3300031507 | Ga0307509_10115949 | Ga0307509_101159493 | 178 |
| 831 | 3300031507 | Ga0307509_10149664 | Ga0307509_101496642 | 178 |
| 832 | 3300031548 | Ga0307408_100000064 | Ga0307408_10000006420 | 178 |
| 833 | 3300031548 | Ga0307408_100198160 | Ga0307408_1001981602 | 178 |
| 834 | 3300031548 | Ga0307408_100546902 | Ga0307408_1005469022 | 178 |
| 835 | 3300031548 | Ga0307408_100571011 | Ga0307408_1005710112 | 178 |
| 836 | 3300031616 | Ga0307508_10000017 | Ga0307508_1000001730 | 178 |
| 837 | 3300031616 | Ga0307508_10000163 | Ga0307508_1000016323 | 178 |
| 838 | 3300031616 | Ga0307508_10022852 | Ga0307508_100228527 | 178 |
| 839 | 3300031616 | Ga0307508_10360829 | Ga0307508_103608292 | 178 |
| 840 | 3300031649 | Ga0307514_10000823 | Ga0307514_1000082317 | 178 |
| 841 | 3300031649 | Ga0307514_10008501 | Ga0307514_100085013 | 178 |
| 842 | 3300031649 | Ga0307514_10009567 | Ga0307514_100095675 | 178 |
| 843 | 3300031649 | Ga0307514_10167877 | Ga0307514_101678772 | 178 |
| 844 | 3300031711 | Ga0265314_10000516 | Ga0265314_1000051615 | 178 |
| 845 | 3300031711 | Ga0265314_10004171 | Ga0265314_100041714 | 178 |
| 846 | 3300031712 | Ga0265342_10016086 | Ga0265342_100160867 | 178 |
| 847 | 3300031730 | Ga0307516_10002019 | Ga0307516_1000201920 | 178 |
| 848 | 3300031730 | Ga0307516_10006850 | Ga0307516_1000685014 | 178 |
| 849 | 3300031730 | Ga0307516_10019640 | Ga0307516_100196405 | 178 |
| 850 | 3300031730 | Ga0307516_10085135 | Ga0307516_100851354 | 178 |
| 851 | 3300031730 | Ga0307516_10093094 | Ga0307516_100930943 | 178 |
| 852 | 3300031731 | Ga0307405_10130348 | Ga0307405_101303482 | 178 |
| 853 | 3300031824 | Ga0307413_10101510 | Ga0307413_101015102 | 178 |
| 854 | 3300031901 | Ga0307406_10000879 | Ga0307406_100008795 | 178 |
| 855 | 3300031901 | Ga0307406_10002603 | Ga0307406_100026032 | 178 |
| 856 | 3300031901 | Ga0307406_10221578 | Ga0307406_102215783 | 178 |
| 857 | 3300031901 | Ga0307406_10482539 | Ga0307406_104825391 | 178 |
| 858 | 3300031903 | Ga0307407_10500375 | Ga0307407_105003752 | 178 |
| 859 | 3300031911 | Ga0307412_10195468 | Ga0307412_101954682 | 178 |
| 860 | 3300031911 | Ga0307412_10358085 | Ga0307412_103580852 | 178 |
| 861 | 3300031911 | Ga0307412_10468440 | Ga0307412_104684402 | 178 |
| 862 | 3300031995 | Ga0307409_100004624 | Ga0307409_1000046246 | 178 |
| 863 | 3300031995 | Ga0307409_100433094 | Ga0307409_1004330942 | 178 |
| 864 | 3300032002 | Ga0307416_100022102 | Ga0307416_1000221023 | 178 |
| 865 | 3300032002 | Ga0307416_100035014 | Ga0307416_1000350142 | 178 |
| 866 | 3300032002 | Ga0307416_100235907 | Ga0307416_1002359071 | 178 |
| 867 | 3300032002 | Ga0307416_100795898 | Ga0307416_1007958982 | 178 |
| 868 | 3300032005 | Ga0307411_10015641 | Ga0307411_100156412 | 178 |
| 869 | 3300032005 | Ga0307411_10217791 | Ga0307411_102177911 | 178 |
| 870 | 3300032005 | Ga0307411_10786059 | Ga0307411_107860592 | 178 |
| 871 | 3300032126 | Ga0307415_100002068 | Ga0307415_1000020685 | 178 |
| 872 | 3300033179 | Ga0307507_10127164 | Ga0307507_101271643 | 178 |
| 873 | 3300033180 | Ga0307510_10002394 | Ga0307510_1000239415 | 178 |
| 874 | 3300033180 | Ga0307510_10034941 | Ga0307510_100349415 | 178 |
| 875 | 3300033180 | Ga0307510_10181925 | Ga0307510_101819253 | 178 |
| 876 | 3300033180 | Ga0307510_10188421 | Ga0307510_101884212 | 178 |
| 877 | 3300033180 | Ga0307510_10450594 | Ga0307510_104505941 | 178 |
| 878 | 3300034816 | Ga0373930_0015531 | Ga0373930_0015531_126_692 | 178 |
| 879 | 3300034820 | Ga0373959_0011991 | Ga0373959_0011991_387_953 | 178 |
| 880 | 3300034820 | Ga0373959_0032709 | Ga0373959_0032709_331_900 | 178 |
| 881 | 3300035086 | Ga0373934_0033147 | Ga0373934_0033147_82_648 | 178 |
| 882 | 3300035111 | Ga0373923_0126041 | Ga0373923_0126041_428_994 | 178 |
| 883 | 3300035111 | Ga0373923_0261321 | Ga0373923_0261321_191_757 | 178 |
| 884 | 3300035112 | Ga0373932_0006153 | Ga0373932_0006153_2039_2605 | 178 |
| 885 | 3300035112 | Ga0373932_0047369 | Ga0373932_0047369_75_650 | 178 |
| 886 | 3300035113 | Ga0373936_0201448 | Ga0373936_0201448_74_640 | 178 |
| 887 | 3300035114 | Ga0373939_0093593 | Ga0373939_0093593_346_915 | 178 |
| 888 | 3300035120 | Ga0373957_0179471 | Ga0373957_0179471_287_853 | 178 |
| 889 | 3300035170 | Ga0373943_0076009 | Ga0373943_0076009_242_808 | 178 |
| 890 | 3300035172 | Ga0373955_0137995 | Ga0373955_0137995_451_1017 | 178 |
| 891 | 3300035410 | Ga0373924_0020497 | Ga0373924_0020497_778_1344 | 178 |
| 892 | 3300035691 | Ga0373931_0122405 | Ga0373931_0122405_373_939 | 178 |
| 893 | 3300035691 | Ga0373931_0476487 | Ga0373931_0476487_34_600 | 178 |
| 894 | 3300035692 | Ga0373935_0165026 | Ga0373935_0165026_52_618 | 178 |
| 895 | 3300035695 | Ga0373927_0008971 | Ga0373927_0008971_3507_4073 | 178 |
| 896 | 3300035725 | Ga0373947_0125985 | Ga0373947_0125985_700_1266 | 178 |
| 897 | 3300036401 | Ga0373937_0018511 | Ga0373937_0018511_4722_5288 | 178 |
| 898 | 3300036401 | Ga0373937_0027901 | Ga0373937_0027901_2214_2780 | 178 |
| 899 | 3300036401 | Ga0373937_0253126 | Ga0373937_0253126_125_691 | 178 |
| 900 | 3300037068 | Ga0373925_0102065 | Ga0373925_0102065_916_1482 | 178 |
| 901 | 3300037068 | Ga0373925_0168777 | Ga0373925_0168777_735_1301 | 178 |
| 902 | 3300037068 | Ga0373925_0360260 | Ga0373925_0360260_81_647 | 178 |
| 903 | 3300037068 | Ga0373925_0456791 | Ga0373925_0456791_204_770 | 178 |
| 904 | 3300037312 | Ga0395899_0001877 | Ga0395899_0001877_14099_14668 | 178 |
| 905 | 3300037312 | Ga0395899_0221413 | Ga0395899_0221413_708_1277 | 178 |
| 906 | 3300037312 | Ga0395899_0361911 | Ga0395899_0361911_52_630 | 178 |
| 907 | 3300037418 | Ga0395900_0052840 | Ga0395900_0052840_1116_1685 | 178 |
| 908 | 3300037418 | Ga0395900_0097042 | Ga0395900_0097042_1079_1648 | 178 |
| 909 | 3300037418 | Ga0395900_0121734 | Ga0395900_0121734_135_704 | 178 |
| 910 | 3300037418 | Ga0395900_0405808 | Ga0395900_0405808_50_619 | 178 |
| 911 | 3300037466 | Ga0395898_0022468 | Ga0395898_0022468_2577_3146 | 178 |
| 912 | 3300037466 | Ga0395898_0023515 | Ga0395898_0023515_2219_2797 | 178 |
| 913 | 3300037466 | Ga0395898_0047602 | Ga0395898_0047602_1970_2539 | 178 |
| 914 | 3300037466 | Ga0395898_0707332 | Ga0395898_0707332_352_921 | 178 |
| 915 | 3300037471 | Ga0395905_0000138 | Ga0395905_0000138_90078_90647 | 178 |
| 916 | 3300037471 | Ga0395905_0000837 | Ga0395905_0000837_4122_4688 | 178 |
| 917 | 3300037471 | Ga0395905_0013525 | Ga0395905_0013525_5375_5944 | 178 |
| 918 | 3300037471 | Ga0395905_0014971 | Ga0395905_0014971_743_1309 | 178 |
| 919 | 3300037471 | Ga0395905_0039665 | Ga0395905_0039665_1780_2349 | 178 |
| 920 | 3300037471 | Ga0395905_0042156 | Ga0395905_0042156_2036_2605 | 178 |
| 921 | 3300037471 | Ga0395905_0059945 | Ga0395905_0059945_2037_2606 | 178 |
| 922 | 3300037471 | Ga0395905_0123613 | Ga0395905_0123613_1247_1816 | 178 |
| 923 | 3300037471 | Ga0395905_0135924 | Ga0395905_0135924_1023_1589 | 178 |
| 924 | 3300037471 | Ga0395905_0150426 | Ga0395905_0150426_1342_1911 | 178 |
| 925 | 3300037471 | Ga0395905_0221071 | Ga0395905_0221071_262_831 | 178 |
| 926 | 3300037471 | Ga0395905_0252730 | Ga0395905_0252730_738_1307 | 178 |
| 927 | 3300037471 | Ga0395905_0538143 | Ga0395905_0538143_325_891 | 178 |
| 928 | 3300038443 | Ga0395901_0036782 | Ga0395901_0036782_2744_3313 | 178 |
| 929 | 3300038443 | Ga0395901_0069944 | Ga0395901_0069944_1870_2448 | 178 |
| 930 | 3300038443 | Ga0395901_0141911 | Ga0395901_0141911_275_844 | 178 |
| 931 | 3300038443 | Ga0395901_0175935 | Ga0395901_0175935_121_687 | 178 |
| 932 | 3300038443 | Ga0395901_0260777 | Ga0395901_0260777_787_1356 | 178 |
| 933 | 3300038443 | Ga0395901_0364843 | Ga0395901_0364843_862_1431 | 178 |
| 934 | 3300039437 | Ga0436365_1871400 | Ga0436365_1871400_331_897 | 178 |
| 935 | 3300039447 | Ga0436361_0146317 | Ga0436361_0146317_40805_41371 | 178 |
| 936 | 3300039447 | Ga0436361_0231085 | Ga0436361_0231085_431_997 | 178 |
| 937 | 3300039447 | Ga0436361_0343816 | Ga0436361_0343816_19850_20416 | 178 |
| 938 | 3300039447 | Ga0436361_1052556 | Ga0436361_1052556_37107_37673 | 178 |
| 939 | 3300039447 | Ga0436361_1132349 | Ga0436361_1132349_1174_1740 | 178 |
| 940 | 3300039450 | Ga0436363_0424328 | Ga0436363_0424328_168_734 | 178 |
| 941 | 3300041404 | Ga0439436_0019770 | Ga0439436_0019770_544_1110 | 178 |
| 942 | 3300041411 | Ga0439466_0013982 | Ga0439466_0013982_1619_2185 | 178 |
| 943 | 3300041443 | Ga0451789_0792101 | Ga0451789_0792101_279_845 | 178 |
| 944 | 3300041452 | Ga0451793_0084455 | Ga0451793_0084455_1619_2185 | 178 |
| 945 | 3300041453 | Ga0451797_0514269 | Ga0451797_0514269_1297_1863 | 178 |
| 946 | 3300041456 | Ga0451795_1492822 | Ga0451795_1492822_69_635 | 178 |
| 947 | 3300041458 | Ga0451798_0308381 | Ga0451798_0308381_431_997 | 178 |
| 948 | 3300041486 | Ga0451807_2595932 | Ga0451807_2595932_61_627 | 178 |
| 949 | 3300041492 | Ga0451835_0681653 | Ga0451835_0681653_111_677 | 178 |
| 950 | 3300041496 | Ga0451839_0245472 | Ga0451839_0245472_100_666 | 178 |
| 951 | 3300041498 | Ga0451841_0499384 | Ga0451841_0499384_561_1127 | 178 |
| 952 | 3300041512 | Ga0451853_3545225 | Ga0451853_3545225_113_679 | 178 |
| 953 | 3300041997 | Ga0439431_0022002 | Ga0439431_0022002_670_1236 | 178 |
| 954 | 3300042000 | Ga0439437_009888 | Ga0439437_009888_166_732 | 178 |
| 955 | 3300042002 | Ga0439442_021007 | Ga0439442_021007_608_1174 | 178 |
| 956 | 3300042004 | Ga0439445_0016186 | Ga0439445_0016186_223_789 | 178 |
| 957 | 3300042004 | Ga0439445_0106099 | Ga0439445_0106099_184_753 | 178 |
| 958 | 3300042007 | Ga0439449_0004755 | Ga0439449_0004755_1221_1790 | 178 |
| 959 | 3300042115 | Ga0450911_027936 | Ga0450911_027936_151_720 | 178 |
| 960 | 3300042121 | Ga0450919_002745 | Ga0450919_002745_461_1027 | 178 |
| 961 | 3300042122 | Ga0450920_001884 | Ga0450920_001884_2162_2731 | 178 |
| 962 | 3300042125 | Ga0450923_003416 | Ga0450923_003416_134_700 | 178 |
| 963 | 3300042134 | Ga0450898_012015 | Ga0450898_012015_369_938 | 178 |
| 964 | 3300042134 | Ga0450898_023528 | Ga0450898_023528_17_583 | 178 |
| 965 | 3300042435 | Ga0439434_0006244 | Ga0439434_0006244_1115_1681 | 178 |
| 966 | 3300042436 | Ga0439435_0063316 | Ga0439435_0063316_470_1036 | 178 |
| 967 | 3300042438 | Ga0439459_0016582 | Ga0439459_0016582_119_688 | 178 |
| 968 | 3300042439 | Ga0439464_0020171 | Ga0439464_0020171_662_1228 | 178 |
| 969 | 3300042531 | Ga0450918_000139 | Ga0450918_000139_10171_10740 | 178 |
| 970 | 3300042531 | Ga0450918_000288 | Ga0450918_000288_1485_2051 | 178 |
| 971 | 3300042532 | Ga0450893_0001499 | Ga0450893_0001499_1362_1928 | 178 |
| 972 | 3300042876 | Ga0451577_0022252 | Ga0451577_0022252_2636_3202 | 178 |
| 973 | 3300042876 | Ga0451577_0042165 | Ga0451577_0042165_2585_3151 | 178 |
| 974 | 3300042876 | Ga0451577_0293797 | Ga0451577_0293797_668_1243 | 178 |
| 975 | 3300042876 | Ga0451577_0540710 | Ga0451577_0540710_38_604 | 178 |
| 976 | 3300044656 | Ga0466969_0017037 | Ga0466969_0017037_2945_3511 | 178 |
| 977 | 3300044656 | Ga0466969_0033787 | Ga0466969_0033787_1232_1801 | 178 |
| 978 | 3300044673 | Ga0453683_0002835 | Ga0453683_0002835_1054_1623 | 178 |
| 979 | 3300044683 | Ga0466965_0006955 | Ga0466965_0006955_563_1129 | 178 |
| 980 | 3300044684 | Ga0466966_0002595 | Ga0466966_0002595_8108_8674 | 178 |
| 981 | 3300044684 | Ga0466966_0013446 | Ga0466966_0013446_2374_2943 | 178 |
| 982 | 3300044684 | Ga0466966_0263175 | Ga0466966_0263175_307_876 | 178 |
| 983 | 3300044693 | Ga0466961_0002324 | Ga0466961_0002324_3389_3955 | 178 |
| 984 | 3300044693 | Ga0466961_0012371 | Ga0466961_0012371_4385_4954 | 178 |
| 985 | 3300044694 | Ga0466963_0134608 | Ga0466963_0134608_601_1173 | 178 |
| 986 | 3300044694 | Ga0466963_0190015 | Ga0466963_0190015_313_879 | 178 |
| 987 | 3300044694 | Ga0466963_0223238 | Ga0466963_0223238_682_1248 | 178 |
| 988 | 3300044706 | Ga0466964_0012092 | Ga0466964_0012092_1066_1632 | 178 |
| 989 | 3300044712 | Ga0453684_0000121 | Ga0453684_0000121_4532_5101 | 178 |
| 990 | 3300044712 | Ga0453684_0011391 | Ga0453684_0011391_10325_10891 | 178 |
| 991 | 3300044712 | Ga0453684_0058580 | Ga0453684_0058580_2047_2613 | 178 |
| 992 | 3300044712 | Ga0453684_0067005 | Ga0453684_0067005_352_918 | 178 |
| 993 | 3300044712 | Ga0453684_0144168 | Ga0453684_0144168_1659_2225 | 178 |
| 994 | 3300044712 | Ga0453684_0363247 | Ga0453684_0363247_246_812 | 178 |
| 995 | 3300044712 | Ga0453684_0388449 | Ga0453684_0388449_891_1457 | 178 |
| 996 | 3300044712 | Ga0453684_0399728 | Ga0453684_0399728_250_825 | 178 |
| 997 | 3300044712 | Ga0453684_0760905 | Ga0453684_0760905_150_716 | 178 |
| 998 | 3300044719 | Ga0466971_0014882 | Ga0466971_0014882_1760_2326 | 178 |
| 999 | 3300044735 | Ga0466968_0003831 | Ga0466968_0003831_5002_5568 | 178 |
| 1000 | 3300044735 | Ga0466968_0013720 | Ga0466968_0013720_177_743 | 178 |
| 1001 | 3300044765 | Ga0466970_0007496 | Ga0466970_0007496_4476_5042 | 178 |
| 1002 | 3300044765 | Ga0466970_0082348 | Ga0466970_0082348_674_1243 | 178 |
| 1003 | 3300044842 | Ga0466957_0002248 | Ga0466957_0002248_7357_7923 | 178 |
| 1004 | 3300044842 | Ga0466957_0017319 | Ga0466957_0017319_879_1445 | 178 |
| 1005 | 3300044842 | Ga0466957_0602790 | Ga0466957_0602790_52_621 | 178 |
| 1006 | 3300045049 | Ga0466959_0006996 | Ga0466959_0006996_5340_5909 | 178 |
| 1007 | 3300045049 | Ga0466959_0028726 | Ga0466959_0028726_1866_2432 | 178 |
| 1008 | 3300045051 | Ga0451576_0005731 | Ga0451576_0005731_4656_5225 | 178 |
| 1009 | 3300045051 | Ga0451576_0007989 | Ga0451576_0007989_5458_6024 | 178 |
| 1010 | 3300045051 | Ga0451576_0050947 | Ga0451576_0050947_3348_3917 | 178 |
| 1011 | 3300045051 | Ga0451576_0115320 | Ga0451576_0115320_972_1538 | 178 |
| 1012 | 3300045051 | Ga0451576_0211312 | Ga0451576_0211312_767_1333 | 178 |
| 1013 | 3300045051 | Ga0451576_0236417 | Ga0451576_0236417_742_1308 | 178 |
| 1014 | 3300045051 | Ga0451576_0513705 | Ga0451576_0513705_263_829 | 178 |
| 1015 | 3300045051 | Ga0451576_1294723 | Ga0451576_1294723_31_597 | 178 |
| 1016 | 3300045836 | Ga0466958_0013315 | Ga0466958_0013315_435_1001 | 178 |
| 1017 | 3300045976 | Ga0466967_0330751 | Ga0466967_0330751_481_1053 | 178 |
| 1018 | 3300046454 | Ga0495592_0001471 | Ga0495592_0001471_39_605 | 178 |
| 1019 | 3300046455 | Ga0495603_0252585 | Ga0495603_0252585_428_994 | 178 |
| 1020 | 3300046455 | Ga0495603_0318981 | Ga0495603_0318981_255_821 | 178 |
| 1021 | 3300046457 | Ga0495590_0001744 | Ga0495590_0001744_8494_9060 | 178 |
| 1022 | 3300046457 | Ga0495590_0040706 | Ga0495590_0040706_226_792 | 178 |
| 1023 | 3300046459 | Ga0495629_0018252 | Ga0495629_0018252_2306_2872 | 178 |
| 1024 | 3300046459 | Ga0495629_0300743 | Ga0495629_0300743_260_826 | 178 |
| 1025 | 3300046459 | Ga0495629_0304188 | Ga0495629_0304188_205_771 | 178 |
| 1026 | 3300046475 | Ga0495639_0010899 | Ga0495639_0010899_3251_3817 | 178 |
| 1027 | 3300046506 | Ga0495583_0000171 | Ga0495583_0000171_49037_49603 | 178 |
| 1028 | 3300046506 | Ga0495583_0105022 | Ga0495583_0105022_62_628 | 178 |
| 1029 | 3300046507 | Ga0495606_0000868 | Ga0495606_0000868_6441_7007 | 178 |
| 1030 | 3300046507 | Ga0495606_0257462 | Ga0495606_0257462_10_576 | 178 |
| 1031 | 3300046512 | Ga0495610_0028601 | Ga0495610_0028601_1345_1911 | 178 |
| 1032 | 3300046512 | Ga0495610_0194121 | Ga0495610_0194121_239_805 | 178 |
| 1033 | 3300046513 | Ga0495616_0003352 | Ga0495616_0003352_6606_7172 | 178 |
| 1034 | 3300046514 | Ga0495618_0153996 | Ga0495618_0153996_542_1108 | 178 |
| 1035 | 3300046515 | Ga0495620_0052894 | Ga0495620_0052894_358_924 | 178 |
| 1036 | 3300046516 | Ga0495628_0286553 | Ga0495628_0286553_581_1147 | 178 |
| 1037 | 3300046517 | Ga0495630_0451462 | Ga0495630_0451462_303_869 | 178 |
| 1038 | 3300046519 | Ga0495632_0017466 | Ga0495632_0017466_1975_2541 | 178 |
| 1039 | 3300046519 | Ga0495632_0021852 | Ga0495632_0021852_773_1339 | 178 |
| 1040 | 3300046522 | Ga0495643_0040950 | Ga0495643_0040950_131_697 | 178 |
| 1041 | 3300046524 | Ga0495648_0109826 | Ga0495648_0109826_136_705 | 178 |
| 1042 | 3300046524 | Ga0495648_0117071 | Ga0495648_0117071_799_1365 | 178 |
| 1043 | 3300046525 | Ga0495663_0007358 | Ga0495663_0007358_2022_2588 | 178 |
| 1044 | 3300046525 | Ga0495663_0090555 | Ga0495663_0090555_26_592 | 178 |
| 1045 | 3300046526 | Ga0495666_0105369 | Ga0495666_0105369_306_872 | 178 |
| 1046 | 3300046526 | Ga0495666_0218393 | Ga0495666_0218393_158_724 | 178 |
| 1047 | 3300046528 | Ga0495642_0096254 | Ga0495642_0096254_102_668 | 178 |
| 1048 | 3300046529 | Ga0495652_0293532 | Ga0495652_0293532_515_1081 | 178 |
| 1049 | 3300046530 | Ga0495654_0007324 | Ga0495654_0007324_481_1047 | 178 |
| 1050 | 3300046530 | Ga0495654_0020611 | Ga0495654_0020611_2225_2791 | 178 |
| 1051 | 3300046535 | Ga0495586_0138276 | Ga0495586_0138276_499_1065 | 178 |
| 1052 | 3300046535 | Ga0495586_0222545 | Ga0495586_0222545_187_753 | 178 |
| 1053 | 3300046537 | Ga0495598_0024276 | Ga0495598_0024276_908_1474 | 178 |
| 1054 | 3300046537 | Ga0495598_0245660 | Ga0495598_0245660_23_589 | 178 |
| 1055 | 3300046539 | Ga0495621_0156307 | Ga0495621_0156307_320_886 | 178 |
| 1056 | 3300046542 | Ga0495597_0000393 | Ga0495597_0000393_10883_11452 | 178 |
| 1057 | 3300046542 | Ga0495597_0060189 | Ga0495597_0060189_46_612 | 178 |
| 1058 | 3300046543 | Ga0495645_0119906 | Ga0495645_0119906_1066_1632 | 178 |
| 1059 | 3300046557 | Ga0495622_0132809 | Ga0495622_0132809_424_990 | 178 |
| 1060 | 3300046616 | Ga0495668_0098130 | Ga0495668_0098130_653_1219 | 178 |
| 1061 | 3300046660 | Ga0495625_0000903 | Ga0495625_0000903_10355_10921 | 178 |
| 1062 | 3300046660 | Ga0495625_0003716 | Ga0495625_0003716_291_857 | 178 |
| 1063 | 3300046660 | Ga0495625_0029597 | Ga0495625_0029597_3488_4054 | 178 |
| 1064 | 3300046660 | Ga0495625_0114565 | Ga0495625_0114565_985_1551 | 178 |
| 1065 | 3300046665 | Ga0495661_0220853 | Ga0495661_0220853_146_712 | 178 |
| 1066 | 3300046674 | Ga0495588_0016294 | Ga0495588_0016294_2718_3284 | 178 |
| 1067 | 3300046678 | Ga0495599_0228371 | Ga0495599_0228371_472_1038 | 178 |
| 1068 | 3300046678 | Ga0495599_0298484 | Ga0495599_0298484_361_927 | 178 |
| 1069 | 3300046679 | Ga0495623_0186156 | Ga0495623_0186156_122_688 | 178 |
| 1070 | 3300046683 | Ga0495658_0021538 | Ga0495658_0021538_1911_2477 | 178 |
| 1071 | 3300046683 | Ga0495658_0023401 | Ga0495658_0023401_1918_2484 | 178 |
| 1072 | 3300046683 | Ga0495658_0108305 | Ga0495658_0108305_627_1193 | 178 |
| 1073 | 3300046683 | Ga0495658_0205463 | Ga0495658_0205463_468_1034 | 178 |
| 1074 | 3300046683 | Ga0495658_0213829 | Ga0495658_0213829_55_621 | 178 |
| 1075 | 3300046684 | Ga0495669_0029390 | Ga0495669_0029390_464_1030 | 178 |
| 1076 | 3300046689 | Ga0495613_0090441 | Ga0495613_0090441_393_959 | 178 |
| 1077 | 3300046690 | Ga0495624_0254131 | Ga0495624_0254131_103_669 | 178 |
| 1078 | 3300046691 | Ga0495670_0338216 | Ga0495670_0338216_93_659 | 178 |
| 1079 | 3300046694 | Ga0495649_0001001 | Ga0495649_0001001_1011_1577 | 178 |
| 1080 | 3300046794 | Ga0495589_0012815 | Ga0495589_0012815_3381_3947 | 178 |
| 1081 | 3300046809 | Ga0495600_0048587 | Ga0495600_0048587_565_1131 | 178 |
| 1082 | 3300046810 | Ga0495660_0035115 | Ga0495660_0035115_28_594 | 178 |
| 1083 | 3300046810 | Ga0495660_0119487 | Ga0495660_0119487_731_1297 | 178 |
| 1084 | 3300047318 | Ga0495636_0031425 | Ga0495636_0031425_1492_2058 | 178 |
| 1085 | 3300047321 | Ga0495676_0013187 | Ga0495676_0013187_3950_4516 | 178 |
| 1086 | 3300047321 | Ga0495676_0093425 | Ga0495676_0093425_1206_1772 | 178 |
| 1087 | 3300047322 | Ga0495680_0041698 | Ga0495680_0041698_974_1540 | 178 |
| 1088 | 3300047322 | Ga0495680_0299860 | Ga0495680_0299860_315_881 | 178 |
| 1089 | 3300047443 | Ga0495687_000138 | Ga0495687_000138_60190_60756 | 178 |
| 1090 | 3300047443 | Ga0495687_017456 | Ga0495687_017456_2541_3107 | 178 |
| 1091 | 3300047445 | Ga0495677_0174221 | Ga0495677_0174221_47_613 | 178 |
| 1092 | 3300047447 | Ga0495685_008881 | Ga0495685_008881_620_1186 | 178 |
| 1093 | 3300047472 | Ga0495686_0002281 | Ga0495686_0002281_16726_17298 | 178 |
| 1094 | 3300047472 | Ga0495686_0219370 | Ga0495686_0219370_120_686 | 178 |
| 1095 | 3300047673 | Ga0495593_0000578 | Ga0495593_0000578_19183_19749 | 178 |
| 1096 | 3300048088 | Ga0495602_0452775 | Ga0495602_0452775_25_591 | 178 |
| 1097 | 3300048090 | Ga0495615_0082489 | Ga0495615_0082489_113_679 | 178 |
| 1098 | 3300048091 | Ga0495626_0024171 | Ga0495626_0024171_621_1187 | 178 |
| 1099 | 3300048903 | Ga0496100_0012386 | Ga0496100_0012386_1242_1808 | 178 |
| 1100 | 3300048903 | Ga0496100_0201179 | Ga0496100_0201179_659_1225 | 178 |
| 1101 | 3300048904 | Ga0496101_0009863 | Ga0496101_0009863_3735_4301 | 178 |
| 1102 | 3300048905 | Ga0496102_0009115 | Ga0496102_0009115_3013_3579 | 178 |
| 1103 | 3300048906 | Ga0496103_0022029 | Ga0496103_0022029_705_1271 | 178 |
| 1104 | 3300048907 | Ga0496104_0018679 | Ga0496104_0018679_3072_3638 | 178 |
| 1105 | 3300048907 | Ga0496104_0018814 | Ga0496104_0018814_4512_5078 | 178 |
| 1106 | 3300048907 | Ga0496104_0467807 | Ga0496104_0467807_564_1136 | 178 |
| 1107 | 3300048907 | Ga0496104_1279501 | Ga0496104_1279501_22_588 | 178 |
| 1108 | 3300048908 | Ga0496105_0000491 | Ga0496105_0000491_9354_9920 | 178 |
| 1109 | 3300048908 | Ga0496105_0108748 | Ga0496105_0108748_737_1303 | 178 |
| 1110 | 3300048908 | Ga0496105_0342113 | Ga0496105_0342113_462_1028 | 178 |
| 1111 | 3300048909 | Ga0496106_0030765 | Ga0496106_0030765_55_621 | 178 |
| 1112 | 3300048910 | Ga0496107_0025475 | Ga0496107_0025475_565_1131 | 178 |
| 1113 | 3300048911 | Ga0496108_0204071 | Ga0496108_0204071_660_1226 | 178 |
| 1114 | 3300048911 | Ga0496108_0206051 | Ga0496108_0206051_452_1018 | 178 |
| 1115 | 3300048911 | Ga0496108_0453892 | Ga0496108_0453892_521_1087 | 178 |
| 1116 | 3300048912 | Ga0496109_0385275 | Ga0496109_0385275_437_1003 | 178 |
| 1117 | 3300048913 | Ga0496110_0106051 | Ga0496110_0106051_1783_2349 | 178 |
| 1118 | 3300048914 | Ga0496111_0089830 | Ga0496111_0089830_173_739 | 178 |
| 1119 | 3300048914 | Ga0496111_0682362 | Ga0496111_0682362_63_629 | 178 |
| 1120 | 3300048916 | Ga0496113_0084087 | Ga0496113_0084087_1359_1925 | 178 |
| 1121 | 3300048917 | Ga0496114_0043366 | Ga0496114_0043366_955_1521 | 178 |
| 1122 | 3300048917 | Ga0496114_0101809 | Ga0496114_0101809_490_1056 | 178 |
| 1123 | 3300048917 | Ga0496114_0191340 | Ga0496114_0191340_1014_1580 | 178 |
| 1124 | 3300048919 | Ga0496116_0020177 | Ga0496116_0020177_2852_3418 | 178 |
| 1125 | 3300048919 | Ga0496116_0054208 | Ga0496116_0054208_582_1148 | 178 |
| 1126 | 3300048920 | Ga0496117_0025714 | Ga0496117_0025714_594_1160 | 178 |
| 1127 | 3300048920 | Ga0496117_0068573 | Ga0496117_0068573_26_592 | 178 |
| 1128 | 3300048921 | Ga0496118_0074272 | Ga0496118_0074272_1498_2064 | 178 |
| 1129 | 3300048921 | Ga0496118_0074389 | Ga0496118_0074389_87_653 | 178 |
| 1130 | 3300048924 | Ga0496121_0052832 | Ga0496121_0052832_673_1239 | 178 |
| 1131 | 3300048924 | Ga0496121_0061500 | Ga0496121_0061500_1744_2310 | 178 |
| 1132 | 3300048924 | Ga0496121_0389875 | Ga0496121_0389875_193_759 | 178 |
| 1133 | 3300048925 | Ga0496122_0178075 | Ga0496122_0178075_691_1257 | 178 |
| 1134 | 3300048927 | Ga0496124_0004176 | Ga0496124_0004176_3258_3824 | 178 |
| 1135 | 3300048927 | Ga0496124_0340435 | Ga0496124_0340435_242_808 | 178 |
| 1136 | 3300048928 | Ga0496125_0031049 | Ga0496125_0031049_1056_1622 | 178 |
| 1137 | 3300048928 | Ga0496125_0035225 | Ga0496125_0035225_1110_1676 | 178 |
| 1138 | 3300048928 | Ga0496125_0301771 | Ga0496125_0301771_156_722 | 178 |
| 1139 | 3300049128 | Ga0501308_003654 | Ga0501308_003654_856_1422 | 178 |
| 1140 | 3300049515 | Ga0501292_000723 | Ga0501292_000723_1323_1889 | 178 |
| 1141 | 3300049516 | Ga0501293_010564 | Ga0501293_010564_78_644 | 178 |
| 1142 | 3300049520 | Ga0501297_038232 | Ga0501297_038232_72_638 | 178 |
| 1143 | 3300049568 | Ga0501031_0404328 | Ga0501031_0404328_235_804 | 178 |
| 1144 | 3300049573 | Ga0501037_0106857 | Ga0501037_0106857_499_1065 | 178 |
| 1145 | 3300049574 | Ga0501038_0020423 | Ga0501038_0020423_3913_4482 | 178 |
| 1146 | 3300049578 | Ga0501042_0704410 | Ga0501042_0704410_65_631 | 178 |
| 1147 | 3300049579 | Ga0501043_0001706 | Ga0501043_0001706_12155_12721 | 178 |
| 1148 | 3300049579 | Ga0501043_0283736 | Ga0501043_0283736_340_909 | 178 |
| 1149 | 3300049580 | Ga0501046_0000132 | Ga0501046_0000132_66785_67351 | 178 |
| 1150 | 3300049580 | Ga0501046_0593376 | Ga0501046_0593376_44_613 | 178 |
| 1151 | 3300049581 | Ga0501047_0000026 | Ga0501047_0000026_12148_12714 | 178 |
| 1152 | 3300049581 | Ga0501047_0032393 | Ga0501047_0032393_4194_4763 | 178 |
| 1153 | 3300049581 | Ga0501047_0167836 | Ga0501047_0167836_920_1489 | 178 |
| 1154 | 3300049649 | Ga0501198_000021 | Ga0501198_000021_49278_49844 | 178 |
| 1155 | 3300049658 | Ga0501211_001974 | Ga0501211_001974_246_812 | 178 |
| 1156 | 3300049662 | Ga0501222_000018 | Ga0501222_000018_20813_21379 | 178 |
| 1157 | 3300049669 | Ga0501235_018379 | Ga0501235_018379_295_861 | 178 |
| 1158 | 3300049669 | Ga0501235_028209 | Ga0501235_028209_144_710 | 178 |
| 1159 | 3300049672 | Ga0501239_009032 | Ga0501239_009032_349_915 | 178 |
| 1160 | 3300049683 | Ga0501253_006788 | Ga0501253_006788_590_1156 | 178 |
| 1161 | 3300049687 | Ga0501258_013651 | Ga0501258_013651_235_801 | 178 |
| 1162 | 3300049705 | Ga0501225_0045954 | Ga0501225_0045954_525_1091 | 178 |
| 1163 | 3300049706 | Ga0501229_017995 | Ga0501229_017995_295_861 | 178 |
| 1164 | 3300049742 | Ga0501080_0133122 | Ga0501080_0133122_1593_2162 | 178 |
| 1165 | 3300049762 | Ga0501265_002087 | Ga0501265_002087_739_1305 | 178 |
| 1166 | 3300049763 | Ga0501266_000160 | Ga0501266_000160_6850_7416 | 178 |
| 1167 | 3300049777 | Ga0501281_02232 | Ga0501281_02232_382_948 | 178 |
| 1168 | 3300049822 | Ga0501035_0032810 | Ga0501035_0032810_172_741 | 178 |
| 1169 | 3300049823 | Ga0501044_0036845 | Ga0501044_0036845_275_844 | 178 |
| 1170 | 3300049823 | Ga0501044_0101166 | Ga0501044_0101166_1964_2530 | 178 |
| 1171 | 3300049824 | Ga0501045_0059792 | Ga0501045_0059792_2176_2742 | 178 |
| 1172 | 3300050489 | nmdc:mga03683_141194_c1 | nmdc:mga03683_141194_c1_60_626 | 178 |
| 1173 | 3300050489 | nmdc:mga03683_19169_c1 | nmdc:mga03683_19169_c1_2033_2599 | 178 |
| 1174 | 3300050489 | nmdc:mga03683_49573_c1 | nmdc:mga03683_49573_c1_1158_1724 | 178 |
| 1175 | 3300050489 | nmdc:mga03683_5206_c1 | nmdc:mga03683_5206_c1_310_876 | 178 |
| 1176 | 3300050490 | nmdc:mga03n38_87079_c1 | nmdc:mga03n38_87079_c1_599_1165 | 178 |
| 1177 | 3300050491 | nmdc:mga00v17_296495_c1 | nmdc:mga00v17_296495_c1_295_861 | 178 |
| 1178 | 3300050492 | nmdc:mga0yw44_29443_c1 | nmdc:mga0yw44_29443_c1_300_866 | 178 |
| 1179 | 3300050492 | nmdc:mga0yw44_93412_c1 | nmdc:mga0yw44_93412_c1_46_612 | 178 |
| 1180 | 3300050493 | nmdc:mga0k408_157062_c1 | nmdc:mga0k408_157062_c1_405_971 | 178 |
| 1181 | 3300050493 | nmdc:mga0k408_17025_c1 | nmdc:mga0k408_17025_c1_1120_1686 | 178 |
| 1182 | 3300050493 | nmdc:mga0k408_17761_c1 | nmdc:mga0k408_17761_c1_2121_2687 | 178 |
| 1183 | 3300050493 | nmdc:mga0k408_235462_c1 | nmdc:mga0k408_235462_c1_192_761 | 178 |
| 1184 | 3300050493 | nmdc:mga0k408_239917_c1 | nmdc:mga0k408_239917_c1_378_944 | 178 |
| 1185 | 3300050493 | nmdc:mga0k408_33886_c1 | nmdc:mga0k408_33886_c1_608_1174 | 178 |
| 1186 | 3300050493 | nmdc:mga0k408_36489_c1 | nmdc:mga0k408_36489_c1_2016_2582 | 178 |
| 1187 | 3300050493 | nmdc:mga0k408_38309_c1 | nmdc:mga0k408_38309_c1_2088_2654 | 178 |
| 1188 | 3300050493 | nmdc:mga0k408_4736_c1 | nmdc:mga0k408_4736_c1_2698_3264 | 178 |
| 1189 | 3300050493 | nmdc:mga0k408_58330_c1 | nmdc:mga0k408_58330_c1_989_1555 | 178 |
| 1190 | 3300050493 | nmdc:mga0k408_60110_c1 | nmdc:mga0k408_60110_c1_976_1542 | 178 |
| 1191 | 3300050493 | nmdc:mga0k408_61535_c1 | nmdc:mga0k408_61535_c1_1526_2092 | 178 |
| 1192 | 3300050493 | nmdc:mga0k408_7186_c1 | nmdc:mga0k408_7186_c1_4102_4668 | 178 |
| 1193 | 3300050493 | nmdc:mga0k408_7557_c1 | nmdc:mga0k408_7557_c1_3963_4529 | 178 |
| 1194 | 3300050494 | nmdc:mga06z11_132048_c1 | nmdc:mga06z11_132048_c1_457_1023 | 178 |
| 1195 | 3300050494 | nmdc:mga06z11_149157_c1 | nmdc:mga06z11_149157_c1_218_784 | 178 |
| 1196 | 3300050494 | nmdc:mga06z11_257385_c1 | nmdc:mga06z11_257385_c1_269_835 | 178 |
| 1197 | 3300050494 | nmdc:mga06z11_523475_c1 | nmdc:mga06z11_523475_c1_40_606 | 178 |
| 1198 | 3300050494 | nmdc:mga06z11_6097_c1 | nmdc:mga06z11_6097_c1_2178_2744 | 178 |
| 1199 | 3300050494 | nmdc:mga06z11_71471_c1 | nmdc:mga06z11_71471_c1_594_1160 | 178 |
| 1200 | 3300050495 | nmdc:mga04h51_53128_c1 | nmdc:mga04h51_53128_c1_595_1161 | 178 |
| 1201 | 3300050496 | nmdc:mga07m45_157481_c1 | nmdc:mga07m45_157481_c1_733_1299 | 178 |
| 1202 | 3300050496 | nmdc:mga07m45_165333_c1 | nmdc:mga07m45_165333_c1_128_694 | 178 |
| 1203 | 3300050496 | nmdc:mga07m45_202_c1 | nmdc:mga07m45_202_c1_21823_22389 | 178 |
| 1204 | 3300050496 | nmdc:mga07m45_299_c1 | nmdc:mga07m45_299_c1_11202_11768 | 178 |
| 1205 | 3300050496 | nmdc:mga07m45_3013_c2 | nmdc:mga07m45_3013_c2_3093_3659 | 178 |
| 1206 | 3300050496 | nmdc:mga07m45_37512_c1 | nmdc:mga07m45_37512_c1_1770_2336 | 178 |
| 1207 | 3300050496 | nmdc:mga07m45_451045_c1 | nmdc:mga07m45_451045_c1_118_684 | 178 |
| 1208 | 3300050496 | nmdc:mga07m45_5574_c1 | nmdc:mga07m45_5574_c1_303_869 | 178 |
| 1209 | 3300050496 | nmdc:mga07m45_7454_c1 | nmdc:mga07m45_7454_c1_658_1224 | 178 |
| 1210 | 3300050496 | nmdc:mga07m45_9954_c1 | nmdc:mga07m45_9954_c1_2515_3081 | 178 |
| 1211 | 3300050508 | nmdc:mga09592_6905_c1 | nmdc:mga09592_6905_c1_2832_3401 | 178 |
| 1212 | 3300050509 | nmdc:mga0qj67_485454_c1 | nmdc:mga0qj67_485454_c1_56_622 | 178 |
| 1213 | 3300053078 | Ga0495612_0043903 | Ga0495612_0043903_860_1426 | 178 |
| 1214 | 3300053080 | Ga0500635_0000003 | Ga0500635_0000003_13094_13660 | 178 |
| 1215 | 3300053085 | Ga0495619_0131144 | Ga0495619_0131144_281_847 | 178 |
| 1216 | 3300053085 | Ga0495619_0720940 | Ga0495619_0720940_72_638 | 178 |
| 1217 | 3300053088 | Ga0500644_0001962 | Ga0500644_0001962_737_1303 | 178 |
| 1218 | 3300053088 | Ga0500644_0012871 | Ga0500644_0012871_225_791 | 178 |
| 1219 | 3300053090 | Ga0500646_0020574 | Ga0500646_0020574_242_808 | 178 |
| 1220 | 3300053093 | Ga0500651_0000024 | Ga0500651_0000024_23457_24023 | 178 |
| 1221 | 3300053093 | Ga0500651_0002535 | Ga0500651_0002535_6196_6762 | 178 |
| 1222 | 3300053093 | Ga0500651_0022441 | Ga0500651_0022441_2219_2785 | 178 |
| 1223 | 3300053094 | Ga0500566_0022570 | Ga0500566_0022570_2206_2772 | 178 |
| 1224 | 3300053094 | Ga0500566_0194079 | Ga0500566_0194079_414_980 | 178 |
| 1225 | 3300053098 | Ga0500650_0229769 | Ga0500650_0229769_229_795 | 178 |
| 1226 | 3300053109 | Ga0500569_017007 | Ga0500569_017007_936_1502 | 178 |
| 1227 | 3300053110 | Ga0500571_000051 | Ga0500571_000051_6038_6604 | 178 |
| 1228 | 3300053118 | Ga0500594_0000438 | Ga0500594_0000438_7174_7740 | 178 |
| 1229 | 3300053118 | Ga0500594_0023544 | Ga0500594_0023544_913_1479 | 178 |
| 1230 | 3300053120 | Ga0500597_045680 | Ga0500597_045680_783_1349 | 178 |
| 1231 | 3300053122 | Ga0500608_144311 | Ga0500608_144311_35_601 | 178 |
| 1232 | 3300053123 | Ga0500614_037736 | Ga0500614_037736_410_976 | 178 |
| 1233 | 3300053127 | Ga0500623_131793 | Ga0500623_131793_253_819 | 178 |
| 1234 | 3300053129 | Ga0500628_001903 | Ga0500628_001903_2201_2767 | 178 |
| 1235 | 3300053129 | Ga0500628_013419 | Ga0500628_013419_650_1216 | 178 |
| 1236 | 3300053130 | Ga0500642_0004580 | Ga0500642_0004580_2240_2806 | 178 |
| 1237 | 3300053131 | Ga0500652_000824 | Ga0500652_000824_3736_4302 | 178 |
| 1238 | 3300053131 | Ga0500652_020607 | Ga0500652_020607_1437_2003 | 178 |
| 1239 | 3300053133 | Ga0500655_000309 | Ga0500655_000309_3434_4000 | 178 |
| 1240 | 3300053133 | Ga0500655_005756 | Ga0500655_005756_328_894 | 178 |
| 1241 | 3300053134 | Ga0500658_0001156 | Ga0500658_0001156_4162_4728 | 178 |
| 1242 | 3300053136 | Ga0500559_0000011 | Ga0500559_0000011_68747_69313 | 178 |
| 1243 | 3300053139 | Ga0500568_0005643 | Ga0500568_0005643_2393_2959 | 178 |
| 1244 | 3300053139 | Ga0500568_0021372 | Ga0500568_0021372_1734_2300 | 178 |
| 1245 | 3300053142 | Ga0500577_0037596 | Ga0500577_0037596_898_1464 | 178 |
| 1246 | 3300053143 | Ga0500579_129131 | Ga0500579_129131_267_833 | 178 |
| 1247 | 3300053148 | Ga0500590_089978 | Ga0500590_089978_433_999 | 178 |
| 1248 | 3300053151 | Ga0500604_0114593 | Ga0500604_0114593_310_876 | 178 |
| 1249 | 3300053153 | Ga0500616_0121851 | Ga0500616_0121851_595_1161 | 178 |
| 1250 | 3300053154 | Ga0500619_000035 | Ga0500619_000035_19939_20505 | 178 |
| 1251 | 3300053156 | Ga0500622_0000974 | Ga0500622_0000974_6075_6641 | 178 |
| 1252 | 3300053156 | Ga0500622_0001057 | Ga0500622_0001057_16579_17145 | 178 |
| 1253 | 3300053157 | Ga0500624_006130 | Ga0500624_006130_856_1422 | 178 |
| 1254 | 3300053161 | Ga0500634_0019452 | Ga0500634_0019452_2440_3006 | 178 |
| 1255 | 3300053161 | Ga0500634_0043046 | Ga0500634_0043046_314_880 | 178 |
| 1256 | 3300053177 | Ga0500636_0016831 | Ga0500636_0016831_569_1135 | 178 |
| 1257 | 3300053177 | Ga0500636_0074749 | Ga0500636_0074749_291_857 | 178 |
| 1258 | 3300053730 | Ga0500645_000210 | Ga0500645_000210_3973_4539 | 178 |
| 1259 | 3300053730 | Ga0500645_000489 | Ga0500645_000489_5146_5712 | 178 |
| 1260 | 3300053730 | Ga0500645_000501 | Ga0500645_000501_3514_4080 | 178 |
| 1261 | 3300055283 | Ga0500661_001805 | Ga0500661_001805_433_999 | 178 |
| 1262 | 3300055283 | Ga0500661_009884 | Ga0500661_009884_725_1291 | 178 |
| 1263 | 3300059421 | Ga0590071_000508 | Ga0590071_000508_2557_3135 | 178 |
| 1264 | 3300059424 | Ga0590075_046372 | Ga0590075_046372_373_939 | 178 |
| 1265 | 3300059424 | Ga0590075_050115 | Ga0590075_050115_212_781 | 178 |
| 1266 | 3300060353 | Ga0501082_0902416 | Ga0501082_0902416_153_719 | 178 |
| 1267 | 3300061719 | Ga0466962_0010092 | Ga0466962_0010092_2552_3118 | 178 |
| 1268 | 3300061719 | Ga0466962_0506199 | Ga0466962_0506199_15_584 | 178 |
| 1269 | 3300005365 | Ga0070688_100137864 | Ga0070688_1001378641 | 180 |
| 1270 | 3300006946 | Ga0079104_1000004 | Ga0079104_100000475 | 180 |
| 1271 | 3300009148 | Ga0105243_10000547 | Ga0105243_100005477 | 180 |
| 1272 | 3300025711 | Ga0207696_1010665 | Ga0207696_10106654 | 180 |
| 1273 | 3300025935 | Ga0207709_10000019 | Ga0207709_10000019187 | 180 |
| 1274 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005276 | 180 |
| 1275 | 3300031824 | Ga0307413_10071919 | Ga0307413_100719193 | 180 |
| 1276 | 3300031911 | Ga0307412_10236230 | Ga0307412_102362302 | 180 |
| 1277 | 3300031995 | Ga0307409_100487284 | Ga0307409_1004872842 | 180 |
| 1278 | 3300048913 | Ga0496110_0353816 | Ga0496110_0353816_415_1005 | 180 |
| 1279 | 3300049823 | Ga0501044_0082197 | Ga0501044_0082197_576_1166 | 180 |
| 1280 | 3300003794 | Ga0055531_10000051 | Ga0055531_1000005114 | 181 |
| 1281 | 3300003794 | Ga0055531_10018358 | Ga0055531_100183583 | 181 |
| 1282 | 3300006195 | Ga0075366_10024246 | Ga0075366_100242463 | 181 |
| 1283 | 3300006353 | Ga0075370_10001812 | Ga0075370_100018129 | 181 |
| 1284 | 3300014968 | Ga0157379_10058113 | Ga0157379_100581132 | 181 |
| 1285 | 3300025298 | Ga0209050_1004037 | Ga0209050_10040378 | 181 |
| 1286 | 3300025299 | Ga0209256_1007820 | Ga0209256_10078205 | 181 |
| 1287 | 3300025303 | Ga0209051_1003378 | Ga0209051_10033788 | 181 |
| 1288 | 3300025303 | Ga0209051_1008817 | Ga0209051_10088176 | 181 |
| 1289 | 3300025304 | Ga0209257_1000103 | Ga0209257_10001033 | 181 |
| 1290 | 3300025304 | Ga0209257_1000450 | Ga0209257_1000450104 | 181 |
| 1291 | 3300026023 | Ga0207677_11128300 | Ga0207677_111283001 | 181 |
| 1292 | 3300030500 | Ga0268256_1054495 | Ga0268256_10544952 | 181 |
| 1293 | 3300032004 | Ga0307414_10033235 | Ga0307414_100332353 | 181 |
| 1294 | 3300032005 | Ga0307411_10001625 | Ga0307411_100016253 | 181 |
| 1295 | 3300035091 | Ga0373951_0016954 | Ga0373951_0016954_648_1223 | 181 |
| 1296 | 3300035114 | Ga0373939_0000308 | Ga0373939_0000308_5368_5943 | 181 |
| 1297 | 3300035121 | Ga0373960_0001221 | Ga0373960_0001221_2505_3080 | 181 |
| 1298 | 3300035691 | Ga0373931_0001161 | Ga0373931_0001161_5211_5786 | 181 |
| 1299 | 3300042000 | Ga0439437_007626 | Ga0439437_007626_455_1030 | 181 |
| 1300 | 3300042115 | Ga0450911_001967 | Ga0450911_001967_1356_1931 | 181 |
| 1301 | 3300042118 | Ga0450914_001866 | Ga0450914_001866_666_1241 | 181 |
| 1302 | 3300042127 | Ga0450890_001708 | Ga0450890_001708_915_1490 | 181 |
| 1303 | 3300042127 | Ga0450890_001931 | Ga0450890_001931_1214_1789 | 181 |
| 1304 | 3300042129 | Ga0450891_000279 | Ga0450891_000279_2359_2934 | 181 |
| 1305 | 3300042130 | Ga0450892_000564 | Ga0450892_000564_815_1390 | 181 |
| 1306 | 3300042144 | Ga0450889_000263 | Ga0450889_000263_2363_2938 | 181 |
| 1307 | 3300042438 | Ga0439459_0001287 | Ga0439459_0001287_1774_2349 | 181 |
| 1308 | 3300042532 | Ga0450893_0001662 | Ga0450893_0001662_1043_1618 | 181 |
| 1309 | 3300048911 | Ga0496108_0102989 | Ga0496108_0102989_1373_2017 | 181 |
| 1310 | 3300048912 | Ga0496109_1039908 | Ga0496109_1039908_32_676 | 181 |
| 1311 | 3300048924 | Ga0496121_0079849 | Ga0496121_0079849_1212_1787 | 181 |
| 1312 | 3300048928 | Ga0496125_0014470 | Ga0496125_0014470_5866_6441 | 181 |
| 1313 | 3300048928 | Ga0496125_0103076 | Ga0496125_0103076_991_1566 | 181 |
| 1314 | 3300048929 | Ga0496126_0285135 | Ga0496126_0285135_116_691 | 181 |
| 1315 | 3300049521 | Ga0501298_015327 | Ga0501298_015327_382_957 | 181 |
| 1316 | 3300049650 | Ga0501199_012287 | Ga0501199_012287_318_893 | 181 |
| 1317 | 3300049662 | Ga0501222_003183 | Ga0501222_003183_131_706 | 181 |
| 1318 | 3300031251 | Ga0265327_10000223 | Ga0265327_1000022334 | 182 |
| 1319 | 3300037471 | Ga0395905_0026790 | Ga0395905_0026790_4072_4650 | 182 |
| 1320 | 3300048916 | Ga0496113_0184162 | Ga0496113_0184162_650_1228 | 182 |
| 1321 | 3300050489 | nmdc:mga03683_137854_c1 | nmdc:mga03683_137854_c1_319_897 | 182 |
| 1322 | 3300050496 | nmdc:mga07m45_2873_c1 | nmdc:mga07m45_2873_c1_2771_3349 | 182 |
| 1323 | 3300025284 | Ga0209130_1055609 | Ga0209130_10556091 | 183 |
| 1324 | 3300025302 | Ga0207426_1074086 | Ga0207426_10740862 | 183 |
| 1325 | 3300031911 | Ga0307412_10027193 | Ga0307412_100271932 | 183 |
| 1326 | 3300050493 | nmdc:mga0k408_155897_c1 | nmdc:mga0k408_155897_c1_510_1091 | 183 |
| 1327 | 3300005455 | Ga0070663_100072590 | Ga0070663_1000725903 | 184 |
| 1328 | 3300005457 | Ga0070662_100034511 | Ga0070662_1000345112 | 184 |
| 1329 | 3300005459 | Ga0068867_100016023 | Ga0068867_1000160237 | 184 |
| 1330 | 3300005577 | Ga0068857_100034604 | Ga0068857_1000346043 | 184 |
| 1331 | 3300005840 | Ga0068870_10245884 | Ga0068870_102458842 | 184 |
| 1332 | 3300006051 | Ga0075364_10044341 | Ga0075364_100443413 | 184 |
| 1333 | 3300006178 | Ga0075367_10014712 | Ga0075367_100147123 | 184 |
| 1334 | 3300009093 | Ga0105240_10066177 | Ga0105240_100661773 | 184 |
| 1335 | 3300010375 | Ga0105239_10027477 | Ga0105239_100274777 | 184 |
| 1336 | 3300021361 | Ga0213872_10000535 | Ga0213872_1000053516 | 184 |
| 1337 | 3300025908 | Ga0207643_10454759 | Ga0207643_104547592 | 184 |
| 1338 | 3300025913 | Ga0207695_10125208 | Ga0207695_101252083 | 184 |
| 1339 | 3300025914 | Ga0207671_10230478 | Ga0207671_102304782 | 184 |
| 1340 | 3300025933 | Ga0207706_10061572 | Ga0207706_100615723 | 184 |
| 1341 | 3300026089 | Ga0207648_10258908 | Ga0207648_102589083 | 184 |
| 1342 | 3300026142 | Ga0207698_10173888 | Ga0207698_101738882 | 184 |
| 1343 | 3300031251 | Ga0265327_10003808 | Ga0265327_100038087 | 184 |
| 1344 | 3300050493 | nmdc:mga0k408_24224_c1 | nmdc:mga0k408_24224_c1_1227_1832 | 184 |
| 1345 | 3300050494 | nmdc:mga06z11_154872_c1 | nmdc:mga06z11_154872_c1_252_857 | 184 |
| 1346 | 3300031250 | Ga0265331_10008333 | Ga0265331_100083336 | 185 |
| 1347 | 3300031251 | Ga0265327_10002338 | Ga0265327_100023386 | 185 |
| 1348 | 3300005334 | Ga0068869_100009289 | Ga0068869_1000092897 | 186 |
| 1349 | 3300005354 | Ga0070675_100058734 | Ga0070675_1000587343 | 186 |
| 1350 | 3300005355 | Ga0070671_100020411 | Ga0070671_1000204115 | 186 |
| 1351 | 3300005456 | Ga0070678_100116878 | Ga0070678_1001168783 | 186 |
| 1352 | 3300005467 | Ga0070706_100262752 | Ga0070706_1002627522 | 186 |
| 1353 | 3300005577 | Ga0068857_100033057 | Ga0068857_1000330573 | 186 |
| 1354 | 3300006195 | Ga0075366_10000121 | Ga0075366_1000012124 | 186 |
| 1355 | 3300006195 | Ga0075366_10128036 | Ga0075366_101280362 | 186 |
| 1356 | 3300009098 | Ga0105245_10126770 | Ga0105245_101267703 | 186 |
| 1357 | 3300025258 | Ga0209129_1010003 | Ga0209129_10100032 | 186 |
| 1358 | 3300025294 | Ga0209025_1000732 | Ga0209025_100073243 | 186 |
| 1359 | 3300025907 | Ga0207645_10017863 | Ga0207645_100178633 | 186 |
| 1360 | 3300025908 | Ga0207643_10077754 | Ga0207643_100777543 | 186 |
| 1361 | 3300025925 | Ga0207650_10048272 | Ga0207650_100482722 | 186 |
| 1362 | 3300025926 | Ga0207659_10045089 | Ga0207659_100450893 | 186 |
| 1363 | 3300025940 | Ga0207691_10120713 | Ga0207691_101207132 | 186 |
| 1364 | 3300025942 | Ga0207689_10005991 | Ga0207689_100059916 | 186 |
| 1365 | 3300025945 | Ga0207679_10074108 | Ga0207679_100741084 | 186 |
| 1366 | 3300025960 | Ga0207651_10020668 | Ga0207651_100206683 | 186 |
| 1367 | 3300026116 | Ga0207674_10036445 | Ga0207674_100364453 | 186 |
| 1368 | 3300026121 | Ga0207683_10173803 | Ga0207683_101738033 | 186 |
| 1369 | 3300041997 | Ga0439431_0011003 | Ga0439431_0011003_1108_1713 | 186 |
| 1370 | 3300042128 | Ga0450897_011066 | Ga0450897_011066_128_742 | 186 |
| 1371 | 3300042134 | Ga0450898_016930 | Ga0450898_016930_610_1215 | 186 |
| 1372 | 3300042156 | Ga0439446_0002464 | Ga0439446_0002464_1757_2362 | 186 |
| 1373 | 3300050493 | nmdc:mga0k408_215715_c1 | nmdc:mga0k408_215715_c1_373_984 | 186 |
| 1374 | 3300050493 | nmdc:mga0k408_278_c1 | nmdc:mga0k408_278_c1_14796_15407 | 186 |
| 1375 | 3300050493 | nmdc:mga0k408_353822_c1 | nmdc:mga0k408_353822_c1_69_692 | 186 |
| 1376 | 3300001979 | JGI24740J21852_10005871 | JGI24740J21852_100058715 | 187 |
| 1377 | 3300046472 | Ga0495580_0018250 | Ga0495580_0018250_3744_4442 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.7706 | 13 | 177 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.693 | 13 | 177 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.622 | 15 | 174 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.6203 | 15 | 174 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.6184 | 15 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8238 | 13 | 181 | 1.20.120.1760 |
| af_P9WPG5_6_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7957 | 7 | 183 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7927 | 8 | 182 | 1.20.120.1760 |
| af_Q2FZ11_2_191_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7912 | 13 | 183 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7851 | 13 | 181 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5E4Q3-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.898 | 13 | 183 |
GO:0008444
GO:0016020 GO:0046474 |
| AF-A0A1S1X4S4-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.8963 | 12 | 183 |
GO:0008444
GO:0016020 GO:0046474 |
| AF-A0A1S3QYL7-F1-model_v4 | cardiolipin synthase (CMP-forming) (EC 2.7.8.41) | 0.8866 | 13 | 166 |
GO:0008444
GO:0016020 GO:0046474 |
| AF-A0A537BT42-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.8864 | 13 | 182 |
GO:0008444
GO:0016020 GO:0046474 |
| AF-A0A7Z7RHK8-F1-model_v4 | deleted | 0.8845 | 12 | 164 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar