F493487

General Info

Members Datasets Scaffolds Average Seq Length
1377 515 1374 189

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0018250|Ga0495580_0018250_3744_4442
Length 232
Sequence MEVRRDLPFRRLAQVQAAHARALIETASAEAGLLAAVLFGTIRAMFFNLPTLFTWARIVAIPLVVGVYYTGLAAETQNIVGTTLFVLFALTDWADGYLARKLRMTSSFGAFLDPVADKFLVTAALLVLVHLGRLHAFIALVIIGREIAISALREWMAQIGASRSVAVHMLGKVKTVVQMIAIPFLLYHGVLFRLIDTQLWGTVLIVVSAVLTIWSMVYYLQKALPEIRARVR

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221656 Pelomonas sp. Root405 Isolate Unclassified
3 2721755523 Delftia sp. HK171 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
117 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
132 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
240 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
241 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
255 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
256 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
257 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
258 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
263 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
268 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
275 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
276 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
285 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
286 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
304 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
305 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
306 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
312 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
313 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
316 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
317 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
320 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
321 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
322 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
323 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
324 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
325 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
326 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
327 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
328 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
329 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
330 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
331 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
332 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
333 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
334 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
335 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
336 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
337 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
338 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
339 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
340 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
341 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
342 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
343 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
344 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
345 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
346 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
347 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
348 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
354 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
355 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
356 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
357 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
361 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
364 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
365 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
366 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
367 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
368 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
379 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
380 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
381 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
382 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
383 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
384 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
385 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
386 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
387 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
388 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
389 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
390 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
400 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
401 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
406 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
407 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
408 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
409 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
410 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
411 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
414 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
415 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
416 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
421 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
422 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
423 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
424 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
425 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
441 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
442 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
443 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
444 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
452 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
453 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
454 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
455 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
456 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
457 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
458 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
459 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
460 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
463 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
464 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
468 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
469 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
470 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
473 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
474 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
475 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
476 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
477 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
485 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
486 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
487 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
488 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
489 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
490 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
491 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
492 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
493 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
496 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
497 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
498 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
499 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
500 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
501 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
502 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
503 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
504 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
505 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
506 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
507 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
508 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
511 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
512 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
513 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
514 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
515 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.07
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.29
Nodule 0.29
Rhizoplane 2.98
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005871 3300001979 Bacteria 5145
2 JGI24744J21845_10035852 3300002077 Bacteria 938
3 JGI25155J39150_1000060 3300002704 Bacteria 71795
4 JGI25156J39149_1000090 3300002705 Bacteria 67361
5 JGI25156J39149_1000446 3300002705 Bacteria 25215
6 JGI25156J39149_1019495 3300002705 Bacteria 1219
7 JGI25154J39366_1000061 3300002738 Bacteria 105781
8 JGI25154J39366_1002660 3300002738 Bacteria 4394
9 JGI25157J39369_1000006 3300002741 Bacteria 226861
10 JGI25157J39369_1000574 3300002741 Bacteria 21857
11 JGI25164J39214_1002617 3300002772 Bacteria 2642
12 JGI25152J39213_1000657 3300002773 Bacteria 18088
13 JGI25152J39213_1020505 3300002773 Bacteria 1179
14 JGI25150J39212_1001192 3300002774 Bacteria 7702
15 JGI25150J39212_1006586 3300002774 Bacteria 2389
16 JGI25150J39212_1011620 3300002774 Bacteria 1588
17 JGI25159J45721_1000203 3300002987 Bacteria 27623
18 JGI25159J45721_1003940 3300002987 Bacteria 5068
19 JGI25159J45721_1005644 3300002987 Bacteria 3893
20 JGI25153J46596_10004330 3300003215 Bacteria 7671
21 rootH1_10000544 3300003316 Bacteria 5338
22 rootH1_10005243 3300003316 Bacteria 3282
23 rootL2_10000757 3300003322 Bacteria 81071
24 rootL2_10007392 3300003322 Bacteria 6085
25 rootL2_10025833 3300003322 Bacteria 11902
26 rootH1_10026981 3300003323 Bacteria 11646
27 rootH1_10071288 3300003323 Bacteria 1080
28 rootH1_10094745 3300003323 Bacteria 3209
29 JGI26128J50194_1000382 3300003347 Bacteria 2354
30 JGI25160J50197_1000071 3300003354 Bacteria 108301
31 JGI26145J50221_1004823 3300003371 Bacteria 1100
32 JGI25161J50226_1000030 3300003374 Bacteria 142870
33 JGI25161J50226_1020127 3300003374 Bacteria 678
34 Ga0055539_1001162 3300003752 Bacteria 5369
35 Ga0055539_1004241 3300003752 Bacteria 1919
36 Ga0055539_1012027 3300003752 Unclassified 1064
37 Ga0055533_1000011 3300003756 Bacteria 467893
38 Ga0055525_1000013 3300003759 Bacteria 440870
39 Ga0055525_1000903 3300003759 Bacteria 8476
40 Ga0055535_1000084 3300003761 Bacteria 104652
41 Ga0055535_1001649 3300003761 Bacteria 10387
42 Ga0055542_1000033 3300003762 Bacteria 233997
43 Ga0055529_1000306 3300003763 Bacteria 56382
44 Ga0055526_1003627 3300003771 Bacteria 9665
45 Ga0055526_1004316 3300003771 Bacteria 8590
46 Ga0055526_1004665 3300003771 Bacteria 8142
47 Ga0055526_1007621 3300003771 Bacteria 5584
48 Ga0055526_1011709 3300003771 Bacteria 3917
49 Ga0055524_1000006 3300003775 Bacteria 324702
50 Ga0055536_1003229 3300003781 Bacteria 8839
51 Ga0055536_1003340 3300003781 Bacteria 8680
52 Ga0055536_1012350 3300003781 Bacteria 3177
53 Ga0055536_1023112 3300003781 Bacteria 1836
54 Ga0055536_1068159 3300003781 Bacteria 712
55 Ga0055528_1002771 3300003790 Bacteria 9187
56 Ga0055530_10000446 3300003791 Bacteria 36695
57 Ga0055530_10002347 3300003791 Bacteria 12323
58 Ga0055530_10005361 3300003791 Bacteria 6131
59 Ga0055530_10048831 3300003791 Bacteria 992
60 Ga0055540_1000005 3300003792 Bacteria 378126
61 Ga0055540_1001269 3300003792 Bacteria 15383
62 Ga0055540_1002903 3300003792 Bacteria 8675
63 Ga0055540_1015951 3300003792 Unclassified 2161
64 Ga0055540_1017788 3300003792 Bacteria 1971
65 Ga0055531_10000051 3300003794 Bacteria 130125
66 Ga0055531_10000254 3300003794 Bacteria 57349
67 Ga0055531_10000636 3300003794 Bacteria 30247
68 Ga0055531_10004337 3300003794 Bacteria 8675
69 Ga0055531_10008940 3300003794 Bacteria 5190
70 Ga0055531_10017770 3300003794 Bacteria 2978
71 Ga0055531_10018358 3300003794 Bacteria 2893
72 Ga0055543_1000566 3300004625 Bacteria 20553
73 Ga0055543_1002143 3300004625 Bacteria 6823
74 Ga0065165_1000024 3300005262 Bacteria 247672
75 Ga0065165_1000076 3300005262 Bacteria 163890
76 Ga0065165_1010071 3300005262 Bacteria 4148
77 Ga0065165_1010072 3300005262 Bacteria 4148
78 Ga0065165_1033896 3300005262 Bacteria 1584
79 Ga0065714_10072716 3300005288 Bacteria 3311
80 Ga0065704_10268953 3300005289 Bacteria 948
81 Ga0065712_10351505 3300005290 Bacteria 787
82 Ga0065715_10138494 3300005293 Bacteria 1891
83 Ga0065715_10384488 3300005293 Bacteria 903
84 Ga0070658_10029546 3300005327 Bacteria 4404
85 Ga0070658_10056492 3300005327 Bacteria 3191
86 Ga0070658_10356417 3300005327 Bacteria 1253
87 Ga0070676_10003761 3300005328 Bacteria 7954
88 Ga0070676_10050188 3300005328 Bacteria 2445
89 Ga0070683_100077494 3300005329 Bacteria 3108
90 Ga0070683_100257806 3300005329 Bacteria 1659
91 Ga0070690_100010080 3300005330 Bacteria 5486
92 Ga0070690_100032568 3300005330 Bacteria 3257
93 Ga0070670_100015059 3300005331 Bacteria 6636
94 Ga0070670_100112408 3300005331 Bacteria 2347
95 Ga0070670_100149350 3300005331 Bacteria 2022
96 Ga0070670_100428770 3300005331 Bacteria 1170
97 Ga0070677_10141706 3300005333 Bacteria 1110
98 Ga0070677_10248663 3300005333 Bacteria 881
99 Ga0068869_100004104 3300005334 Bacteria 9024
100 Ga0068869_100009289 3300005334 Bacteria 6377
101 Ga0068869_100034945 3300005334 Bacteria 3559
102 Ga0068869_100213950 3300005334 Bacteria 1525
103 Ga0070666_10005027 3300005335 Bacteria 8087
104 Ga0070680_100050945 3300005336 Bacteria 3377
105 Ga0068868_100001107 3300005338 Bacteria 18443
106 Ga0068868_100075949 3300005338 Bacteria 2686
107 Ga0068868_100079635 3300005338 Bacteria 2625
108 Ga0068868_100091066 3300005338 Bacteria 2457
109 Ga0068868_100539615 3300005338 Bacteria 1026
110 Ga0070660_100078318 3300005339 Bacteria 2592
111 Ga0070660_100120415 3300005339 Bacteria 2094
112 Ga0070689_100025603 3300005340 Bacteria 4434
113 Ga0070689_100259171 3300005340 Bacteria 1437
114 Ga0070687_100515069 3300005343 Bacteria 808
115 Ga0070661_100000913 3300005344 Bacteria 21208
116 Ga0070661_100190810 3300005344 Bacteria 1563
117 Ga0070668_100014374 3300005347 Bacteria 5915
118 Ga0070668_100204637 3300005347 Bacteria 1621
119 Ga0070669_100002267 3300005353 Bacteria 13955
120 Ga0070669_100090749 3300005353 Bacteria 2290
121 Ga0070669_100294627 3300005353 Bacteria 1303
122 Ga0070675_100002227 3300005354 Bacteria 14391
123 Ga0070675_100049735 3300005354 Bacteria 3441
124 Ga0070675_100058734 3300005354 Bacteria 3172
125 Ga0070675_100161327 3300005354 Bacteria 1928
126 Ga0070671_100014404 3300005355 Bacteria 6388
127 Ga0070671_100020411 3300005355 Bacteria 5404
128 Ga0070671_100020422 3300005355 Bacteria 5402
129 Ga0070671_100027479 3300005355 Bacteria 4683
130 Ga0070671_100063154 3300005355 Bacteria 3084
131 Ga0070671_100119561 3300005355 Bacteria 2217
132 Ga0070671_100162656 3300005355 Bacteria 1887
133 Ga0070671_100182144 3300005355 Bacteria 1779
134 Ga0070671_100201544 3300005355 Bacteria 1687
135 Ga0070671_100336480 3300005355 Bacteria 1287
136 Ga0070671_100400835 3300005355 Bacteria 1173
137 Ga0070671_100877957 3300005355 Bacteria 783
138 Ga0070674_100007082 3300005356 Bacteria 6594
139 Ga0070674_100036182 3300005356 Bacteria 3311
140 Ga0070674_100067910 3300005356 Bacteria 2509
141 Ga0070674_100151580 3300005356 Bacteria 1750
142 Ga0070674_100468161 3300005356 Bacteria 1043
143 Ga0070674_100785591 3300005356 Bacteria 821
144 Ga0070673_100002560 3300005364 Bacteria 11099
145 Ga0070673_100005364 3300005364 Bacteria 8192
146 Ga0070673_100041899 3300005364 Bacteria 3525
147 Ga0070673_100078662 3300005364 Bacteria 2668
148 Ga0070673_100083124 3300005364 Bacteria 2600
149 Ga0070673_100097421 3300005364 Bacteria 2415
150 Ga0070673_100119712 3300005364 Bacteria 2194
151 Ga0070673_100982161 3300005364 Bacteria 786
152 Ga0070688_100137864 3300005365 Bacteria 1654
153 Ga0070688_100763308 3300005365 Bacteria 754
154 Ga0070659_100007755 3300005366 Bacteria 7807
155 Ga0070659_100395079 3300005366 Bacteria 1166
156 Ga0070659_100484617 3300005366 Bacteria 1053
157 Ga0070659_100791063 3300005366 Bacteria 824
158 Ga0070667_100000558 3300005367 Bacteria 36933
159 Ga0070667_100002446 3300005367 Bacteria 16231
160 Ga0070667_100006752 3300005367 Bacteria 9531
161 Ga0070667_100204508 3300005367 Bacteria 1753
162 Ga0070700_100024061 3300005441 Bacteria 3571
163 Ga0070708_100149153 3300005445 Bacteria 2174
164 Ga0070708_100438633 3300005445 Bacteria 1232
165 Ga0070663_100000823 3300005455 Bacteria 16841
166 Ga0070663_100072590 3300005455 Bacteria 2508
167 Ga0070663_100525373 3300005455 Bacteria 986
168 Ga0070678_100001192 3300005456 Bacteria 13834
169 Ga0070678_100003107 3300005456 Bacteria 9204
170 Ga0070678_100033765 3300005456 Bacteria 3556
171 Ga0070678_100072669 3300005456 Bacteria 2579
172 Ga0070678_100075202 3300005456 Bacteria 2540
173 Ga0070678_100093756 3300005456 Bacteria 2309
174 Ga0070678_100116878 3300005456 Bacteria 2097
175 Ga0070662_100034511 3300005457 Bacteria 3567
176 Ga0070662_100069882 3300005457 Bacteria 2586
177 Ga0070662_100156369 3300005457 Bacteria 1780
178 Ga0070662_100403410 3300005457 Bacteria 1128
179 Ga0070681_10085061 3300005458 Bacteria 3116
180 Ga0070681_11058395 3300005458 Bacteria 732
181 Ga0068867_100000048 3300005459 Bacteria 73813
182 Ga0068867_100007404 3300005459 Bacteria 7763
183 Ga0068867_100011068 3300005459 Bacteria 6364
184 Ga0068867_100013726 3300005459 Bacteria 5737
185 Ga0068867_100016023 3300005459 Bacteria 5322
186 Ga0068867_100150041 3300005459 Bacteria 1830
187 Ga0068867_100360054 3300005459 Bacteria 1216
188 Ga0070685_10024014 3300005466 Bacteria 3345
189 Ga0070685_10108274 3300005466 Bacteria 1708
190 Ga0070706_100000774 3300005467 Bacteria 35777
191 Ga0070706_100262752 3300005467 Bacteria 1611
192 Ga0070707_100085399 3300005468 Bacteria 3051
193 Ga0070698_100040093 3300005471 Bacteria 4815
194 Ga0070679_100011754 3300005530 Bacteria 8345
195 Ga0070679_100046985 3300005530 Bacteria 4304
196 Ga0070679_100059287 3300005530 Bacteria 3815
197 Ga0070684_100006585 3300005535 Bacteria 8997
198 Ga0068853_100021739 3300005539 Bacteria 5352
199 Ga0068853_100113834 3300005539 Bacteria 2406
200 Ga0068853_100181940 3300005539 Bacteria 1906
201 Ga0068853_100481012 3300005539 Bacteria 1170
202 Ga0068853_100573972 3300005539 Bacteria 1070
203 Ga0070672_100014873 3300005543 Bacteria 5525
204 Ga0070672_100042207 3300005543 Bacteria 3511
205 Ga0070672_100124619 3300005543 Bacteria 2112
206 Ga0070672_100133094 3300005543 Bacteria 2045
207 Ga0070672_100221664 3300005543 Bacteria 1586
208 Ga0070672_100269444 3300005543 Bacteria 1437
209 Ga0070693_100125650 3300005547 Bacteria 1597
210 Ga0070665_100020551 3300005548 Bacteria 6634
211 Ga0070665_100271196 3300005548 Bacteria 1699
212 Ga0068855_100019410 3300005563 Bacteria 8168
213 Ga0068855_100030912 3300005563 Bacteria 6399
214 Ga0068855_100173411 3300005563 Bacteria 2441
215 Ga0068855_100358734 3300005563 Bacteria 1604
216 Ga0070664_100000282 3300005564 Bacteria 36692
217 Ga0070664_100015244 3300005564 Bacteria 6282
218 Ga0070664_100151346 3300005564 Bacteria 2049
219 Ga0070664_100165027 3300005564 Bacteria 1962
220 Ga0070664_100424815 3300005564 Bacteria 1218
221 Ga0068857_100003322 3300005577 Bacteria 13375
222 Ga0068857_100033057 3300005577 Bacteria 4573
223 Ga0068857_100034604 3300005577 Bacteria 4468
224 Ga0068857_100378163 3300005577 Bacteria 1315
225 Ga0068854_100019180 3300005578 Bacteria 4605
226 Ga0068854_100044202 3300005578 Bacteria 3160
227 Ga0068854_100091076 3300005578 Bacteria 2269
228 Ga0068854_100508371 3300005578 Bacteria 1016
229 Ga0068854_100562155 3300005578 Bacteria 969
230 Ga0068854_100902107 3300005578 Bacteria 777
231 Ga0068856_100000686 3300005614 Bacteria 36805
232 Ga0068856_100097570 3300005614 Bacteria 2928
233 Ga0068856_100180712 3300005614 Bacteria 2122
234 Ga0068856_101284807 3300005614 Bacteria 747
235 Ga0070702_100144168 3300005615 Bacteria 1521
236 Ga0068852_100062991 3300005616 Bacteria 3227
237 Ga0068852_100106095 3300005616 Bacteria 2546
238 Ga0068852_100440860 3300005616 Bacteria 1288
239 Ga0068852_100499820 3300005616 Bacteria 1211
240 Ga0068852_100573368 3300005616 Bacteria 1131
241 Ga0068859_100016554 3300005617 Bacteria 7402
242 Ga0068859_100028793 3300005617 Bacteria 5570
243 Ga0068859_100048826 3300005617 Bacteria 4252
244 Ga0068859_100073274 3300005617 Bacteria 3463
245 Ga0068864_100002807 3300005618 Bacteria 14385
246 Ga0068864_100020328 3300005618 Bacteria 5554
247 Ga0068864_100028924 3300005618 Bacteria 4689
248 Ga0068864_100114994 3300005618 Bacteria 2399
249 Ga0068864_100172842 3300005618 Bacteria 1971
250 Ga0068864_100175368 3300005618 Bacteria 1957
251 Ga0068864_100698866 3300005618 Bacteria 991
252 Ga0068866_10006943 3300005718 Bacteria 4730
253 Ga0068866_10011759 3300005718 Bacteria 3797
254 Ga0068866_10181828 3300005718 Bacteria 1243
255 Ga0068861_100006804 3300005719 Bacteria 7809
256 Ga0068861_100017152 3300005719 Bacteria 5135
257 Ga0068851_10007694 3300005834 Bacteria 4954
258 Ga0068851_10034428 3300005834 Bacteria 2528
259 Ga0068851_10035492 3300005834 Bacteria 2493
260 Ga0068851_10087439 3300005834 Bacteria 1636
261 Ga0068870_10245884 3300005840 Bacteria 1107
262 Ga0068870_10261681 3300005840 Bacteria 1077
263 Ga0068870_10558751 3300005840 Bacteria 772
264 Ga0068863_100017712 3300005841 Bacteria 6819
265 Ga0068863_100040341 3300005841 Bacteria 4439
266 Ga0068863_100281378 3300005841 Bacteria 1612
267 Ga0068863_100464468 3300005841 Bacteria 1243
268 Ga0068858_100002948 3300005842 Bacteria 17114
269 Ga0068858_100015770 3300005842 Bacteria 7106
270 Ga0068860_100000524 3300005843 Bacteria 46839
271 Ga0068860_100014939 3300005843 Bacteria 7591
272 Ga0068860_100239250 3300005843 Bacteria 1765
273 Ga0068860_100272332 3300005843 Bacteria 1653
274 Ga0068862_100028727 3300005844 Bacteria 4683
275 Ga0068862_100033542 3300005844 Bacteria 4340
276 Ga0068862_100056196 3300005844 Bacteria 3372
277 Ga0068862_100089601 3300005844 Bacteria 2678
278 Ga0081455_10049895 3300005937 Bacteria 3604
279 Ga0075365_10004475 3300006038 Bacteria 7408
280 Ga0075365_10027584 3300006038 Bacteria 3614
281 Ga0075365_10171385 3300006038 Bacteria 1515
282 Ga0075365_10311035 3300006038 Bacteria 1109
283 Ga0075368_10001001 3300006042 Bacteria 8839
284 Ga0075363_100000527 3300006048 Bacteria 12335
285 Ga0075363_100085262 3300006048 Bacteria 1733
286 Ga0075364_10044341 3300006051 Bacteria 2892
287 Ga0075364_10446391 3300006051 Bacteria 884
288 Ga0075432_10002462 3300006058 Bacteria 6158
289 Ga0075362_10005340 3300006177 Bacteria 4694
290 Ga0075362_10082489 3300006177 Bacteria 1483
291 Ga0075367_10008057 3300006178 Bacteria 5435
292 Ga0075367_10008095 3300006178 Bacteria 5427
293 Ga0075367_10014712 3300006178 Bacteria 4237
294 Ga0075367_10029539 3300006178 Bacteria 3136
295 Ga0075367_10039733 3300006178 Bacteria 2745
296 Ga0075367_10054621 3300006178 Bacteria 2369
297 Ga0075367_10074012 3300006178 Bacteria 2054
298 Ga0075367_10240091 3300006178 Bacteria 1135
299 Ga0075367_10338594 3300006178 Bacteria 949
300 Ga0075369_10029119 3300006186 Bacteria 2318
301 Ga0075369_10047505 3300006186 Bacteria 1851
302 Ga0075366_10000121 3300006195 Bacteria 32479
303 Ga0075366_10003151 3300006195 Bacteria 8632
304 Ga0075366_10007517 3300006195 Bacteria 6023
305 Ga0075366_10008186 3300006195 Bacteria 5801
306 Ga0075366_10008213 3300006195 Bacteria 5792
307 Ga0075366_10019512 3300006195 Bacteria 3924
308 Ga0075366_10024246 3300006195 Bacteria 3539
309 Ga0075366_10036116 3300006195 Bacteria 2913
310 Ga0075366_10041313 3300006195 Bacteria 2730
311 Ga0075366_10060919 3300006195 Bacteria 2242
312 Ga0075366_10102326 3300006195 Bacteria 1719
313 Ga0075366_10128036 3300006195 Bacteria 1532
314 Ga0075366_10163882 3300006195 Bacteria 1347
315 Ga0075366_10269044 3300006195 Bacteria 1041
316 Ga0097621_100053922 3300006237 Bacteria 3278
317 Ga0097621_100091208 3300006237 Bacteria 2550
318 Ga0097621_100243696 3300006237 Bacteria 1572
319 Ga0097621_100486869 3300006237 Bacteria 1116
320 Ga0097621_100649335 3300006237 Bacteria 968
321 Ga0075370_10001812 3300006353 Bacteria 9566
322 Ga0075370_10005989 3300006353 Bacteria 6088
323 Ga0075370_10006507 3300006353 Bacteria 5883
324 Ga0075370_10006767 3300006353 Bacteria 5792
325 Ga0075370_10007526 3300006353 Bacteria 5549
326 Ga0075370_10008461 3300006353 Bacteria 5295
327 Ga0075370_10009708 3300006353 Bacteria 5010
328 Ga0075370_10014180 3300006353 Bacteria 4246
329 Ga0075370_10075172 3300006353 Bacteria 1936
330 Ga0075370_10283283 3300006353 Bacteria 985
331 Ga0075370_10409557 3300006353 Bacteria 814
332 Ga0068871_100015012 3300006358 Bacteria 5792
333 Ga0068871_100053399 3300006358 Bacteria 3275
334 Ga0068871_100181401 3300006358 Bacteria 1809
335 Ga0068871_100528012 3300006358 Bacteria 1066
336 Ga0075428_100349496 3300006844 Bacteria 1587
337 Ga0075428_100564817 3300006844 Bacteria 1216
338 Ga0075430_100171601 3300006846 Bacteria 1804
339 Ga0075429_100373744 3300006880 Bacteria 1248
340 Ga0068865_100015592 3300006881 Bacteria 4848
341 Ga0068865_100115666 3300006881 Bacteria 1985
342 Ga0068865_100520457 3300006881 Bacteria 995
343 Ga0068865_100618087 3300006881 Bacteria 918
344 Ga0097620_100016554 3300006931 Bacteria 7402
345 Ga0097620_100028793 3300006931 Bacteria 5570
346 Ga0097620_100048825 3300006931 Bacteria 4252
347 Ga0097620_100073277 3300006931 Bacteria 3463
348 Ga0099823_1000769 3300006944 Bacteria 23642
349 Ga0079104_1000004 3300006946 Bacteria 444549
350 Ga0105244_10003895 3300009036 Bacteria 10497
351 Ga0105240_10002994 3300009093 Bacteria 26583
352 Ga0105240_10003519 3300009093 Bacteria 24297
353 Ga0105240_10066177 3300009093 Bacteria 4484
354 Ga0105240_10146167 3300009093 Bacteria 2821
355 Ga0105240_10428881 3300009093 Bacteria 1484
356 Ga0105245_10057323 3300009098 Bacteria 3504
357 Ga0105245_10066044 3300009098 Bacteria 3273
358 Ga0105245_10126770 3300009098 Bacteria 2390
359 Ga0105245_10240577 3300009098 Bacteria 1754
360 Ga0105245_10485001 3300009098 Bacteria 1250
361 Ga0105245_11556127 3300009098 Bacteria 713
362 Ga0114129_10143287 3300009147 Bacteria 3274
363 Ga0105243_10000547 3300009148 Bacteria 37977
364 Ga0105243_10002013 3300009148 Bacteria 17274
365 Ga0105243_10004862 3300009148 Bacteria 10548
366 Ga0105243_10032690 3300009148 Bacteria 4021
367 Ga0105243_10230660 3300009148 Bacteria 1642
368 Ga0105243_10249258 3300009148 Bacteria 1585
369 Ga0105241_10125305 3300009174 Bacteria 2074
370 Ga0105242_10026946 3300009176 Bacteria 4559
371 Ga0105242_10258681 3300009176 Bacteria 1571
372 Ga0105242_10653349 3300009176 Bacteria 1023
373 Ga0105248_10047810 3300009177 Bacteria 4798
374 Ga0105248_10059405 3300009177 Bacteria 4295
375 Ga0105248_10073255 3300009177 Bacteria 3849
376 Ga0105248_10216044 3300009177 Bacteria 2159
377 Ga0105248_10431456 3300009177 Bacteria 1484
378 Ga0105248_10454554 3300009177 Bacteria 1443
379 Ga0105237_10000373 3300009545 Bacteria 63672
380 Ga0105237_10092611 3300009545 Bacteria 3012
381 Ga0105237_10467623 3300009545 Bacteria 1267
382 Ga0105237_10506604 3300009545 Bacteria 1214
383 Ga0105238_10034361 3300009551 Bacteria 5159
384 Ga0105238_10100161 3300009551 Bacteria 2881
385 Ga0105238_10635581 3300009551 Bacteria 1077
386 Ga0105238_10645309 3300009551 Bacteria 1068
387 Ga0105249_10112011 3300009553 Bacteria 2580
388 Ga0105249_10156143 3300009553 Bacteria 2201
389 Ga0105249_10184195 3300009553 Bacteria 2034
390 Ga0105249_10269005 3300009553 Bacteria 1697
391 Ga0105239_10000153 3300010375 Bacteria 99169
392 Ga0105239_10027477 3300010375 Bacteria 6264
393 Ga0105239_10065796 3300010375 Bacteria 3982
394 Ga0105239_10638552 3300010375 Bacteria 1216
395 Ga0105239_10741747 3300010375 Bacteria 1124
396 Ga0105239_10881657 3300010375 Bacteria 1027
397 Ga0105246_10016278 3300011119 Bacteria 4707
398 Ga0105246_10407444 3300011119 Bacteria 1131
399 Ga0105246_10803278 3300011119 Bacteria 835
400 Ga0157317_1008911 3300012475 Bacteria 745
401 Ga0157319_1000051 3300012497 Bacteria 14478
402 Ga0157373_10488174 3300013100 Bacteria 889
403 Ga0157371_10162956 3300013102 Bacteria 1592
404 Ga0157371_10498939 3300013102 Bacteria 899
405 Ga0157370_11019640 3300013104 Bacteria 749
406 Ga0157369_10004791 3300013105 Bacteria 15906
407 Ga0157369_10495143 3300013105 Bacteria 1265
408 Ga0157374_10077081 3300013296 Bacteria 3154
409 Ga0157374_10091368 3300013296 Bacteria 2903
410 Ga0157374_10119941 3300013296 Bacteria 2537
411 Ga0157378_10002312 3300013297 Bacteria 16951
412 Ga0157378_10061950 3300013297 Bacteria 3340
413 Ga0157378_10168586 3300013297 Bacteria 2052
414 Ga0157378_11164734 3300013297 Bacteria 809
415 Ga0163162_10003717 3300013306 Bacteria 14623
416 Ga0163162_10008368 3300013306 Bacteria 10084
417 Ga0163162_10017839 3300013306 Bacteria 6944
418 Ga0163162_10085186 3300013306 Bacteria 3237
419 Ga0163162_10110354 3300013306 Bacteria 2848
420 Ga0163162_10145491 3300013306 Bacteria 2486
421 Ga0163162_10400644 3300013306 Bacteria 1505
422 Ga0163162_10514644 3300013306 Bacteria 1327
423 Ga0163162_11271222 3300013306 Bacteria 836
424 Ga0157372_10114535 3300013307 Bacteria 3091
425 Ga0157372_10294396 3300013307 Bacteria 1888
426 Ga0157372_10368036 3300013307 Bacteria 1675
427 Ga0157372_11184716 3300013307 Bacteria 883
428 Ga0157375_10022181 3300013308 Bacteria 5842
429 Ga0157375_10066799 3300013308 Bacteria 3591
430 Ga0157375_10305370 3300013308 Bacteria 1755
431 Ga0157375_10448713 3300013308 Bacteria 1455
432 Ga0157375_10735456 3300013308 Bacteria 1139
433 Ga0163163_10005658 3300014325 Bacteria 10837
434 Ga0163163_10349873 3300014325 Bacteria 1534
435 Ga0163163_11317779 3300014325 Bacteria 784
436 Ga0157380_10046314 3300014326 Bacteria 3415
437 Ga0157380_10124121 3300014326 Bacteria 2192
438 Ga0157380_10211411 3300014326 Bacteria 1729
439 Ga0157380_10361832 3300014326 Bacteria 1362
440 Ga0157380_10632274 3300014326 Bacteria 1064
441 Ga0157380_10971067 3300014326 Bacteria 881
442 Ga0182008_10004585 3300014497 Bacteria 8044
443 Ga0182008_10013739 3300014497 Bacteria 4254
444 Ga0157377_10000056 3300014745 Bacteria 87608
445 Ga0157379_10008560 3300014968 Bacteria 8902
446 Ga0157379_10026383 3300014968 Bacteria 5172
447 Ga0157379_10058113 3300014968 Bacteria 3457
448 Ga0157379_10139011 3300014968 Bacteria 2189
449 Ga0157379_10320740 3300014968 Bacteria 1414
450 Ga0157379_10497823 3300014968 Bacteria 1129
451 Ga0157379_10873065 3300014968 Bacteria 852
452 Ga0157376_10004932 3300014969 Bacteria 9305
453 Ga0157376_10642253 3300014969 Bacteria 1061
454 Ga0157376_11118535 3300014969 Bacteria 814
455 Ga0182006_1004724 3300015261 Bacteria 6660
456 Ga0182006_1064109 3300015261 Bacteria 1378
457 Ga0182007_10000940 3300015262 Bacteria 16048
458 Ga0182007_10001688 3300015262 Bacteria 11666
459 Ga0182007_10195197 3300015262 Bacteria 705
460 Ga0182005_1077544 3300015265 Bacteria 916
461 Ga0163161_10025431 3300017792 Bacteria 4190
462 Ga0163161_10030741 3300017792 Bacteria 3824
463 Ga0163161_10383246 3300017792 Bacteria 1124
464 Ga0213872_10000236 3300021361 Bacteria 48593
465 Ga0213872_10000354 3300021361 Bacteria 38778
466 Ga0213872_10000496 3300021361 Bacteria 31478
467 Ga0213872_10000535 3300021361 Bacteria 29790
468 Ga0213872_10025704 3300021361 Bacteria 2706
469 Ga0213872_10028967 3300021361 Bacteria 2540
470 Ga0209435_100001 3300025206 Bacteria 1424171
471 Ga0209436_115643 3300025208 Bacteria 1165
472 Ga0209674_100003 3300025226 Bacteria 2196646
473 Ga0209672_100228 3300025228 Bacteria 42777
474 Ga0209672_102765 3300025228 Bacteria 4037
475 Ga0209147_107112 3300025229 Bacteria 1486
476 Ga0209563_100010 3300025230 Bacteria 1337457
477 Ga0209563_100025 3300025230 Bacteria 596456
478 Ga0207427_101838 3300025231 Bacteria 6751
479 Ga0209258_100089 3300025242 Bacteria 234040
480 Ga0209258_100162 3300025242 Bacteria 151725
481 Ga0209258_100601 3300025242 Bacteria 29487
482 Ga0207425_1000744 3300025245 Bacteria 17015
483 Ga0207425_1001690 3300025245 Bacteria 8779
484 Ga0207425_1002357 3300025245 Bacteria 6737
485 Ga0207425_1006971 3300025245 Bacteria 3039
486 Ga0209646_1000001 3300025246 Bacteria 3092932
487 Ga0209646_1000142 3300025246 Bacteria 106607
488 Ga0209026_1000003 3300025250 Bacteria 1060571
489 Ga0209026_1000027 3300025250 Bacteria 351282
490 Ga0209026_1017368 3300025250 Bacteria 1152
491 Ga0209677_100083 3300025253 Bacteria 117063
492 Ga0209677_100154 3300025253 Bacteria 62985
493 Ga0209677_100929 3300025253 Bacteria 14346
494 Ga0209148_1000097 3300025254 Bacteria 234049
495 Ga0209759_1000001 3300025256 Bacteria 2799452
496 Ga0209759_1000240 3300025256 Bacteria 81549
497 Ga0209759_1001021 3300025256 Bacteria 18791
498 Ga0209759_1002002 3300025256 Bacteria 9701
499 Ga0209759_1006796 3300025256 Bacteria 3791
500 Ga0209129_1000025 3300025258 Bacteria 413639
501 Ga0209129_1000033 3300025258 Bacteria 336894
502 Ga0209129_1008754 3300025258 Bacteria 2766
503 Ga0209129_1010003 3300025258 Bacteria 2416
504 Ga0209129_1011842 3300025258 Bacteria 2051
505 Ga0209565_1000004 3300025263 Bacteria 983150
506 Ga0209565_1000626 3300025263 Bacteria 23268
507 Ga0209565_1000828 3300025263 Bacteria 17495
508 Ga0209565_1022326 3300025263 Bacteria 1311
509 Ga0209455_1000128 3300025272 Bacteria 162413
510 Ga0209673_1000372 3300025273 Bacteria 80748
511 Ga0209673_1000450 3300025273 Bacteria 69939
512 Ga0209673_1007083 3300025273 Bacteria 5255
513 Ga0209673_1007737 3300025273 Bacteria 4892
514 Ga0209673_1016574 3300025273 Bacteria 2748
515 Ga0209673_1041361 3300025273 Bacteria 1309
516 Ga0209130_1000060 3300025284 Bacteria 201501
517 Ga0209130_1000105 3300025284 Bacteria 135199
518 Ga0209130_1000114 3300025284 Bacteria 130381
519 Ga0209130_1000615 3300025284 Bacteria 34069
520 Ga0209130_1004346 3300025284 Bacteria 5437
521 Ga0209130_1055609 3300025284 Bacteria 704
522 Ga0209675_1000096 3300025291 Bacteria 133284
523 Ga0209675_1001018 3300025291 Bacteria 17523
524 Ga0209675_1001425 3300025291 Bacteria 13815
525 Ga0209675_1002059 3300025291 Bacteria 10733
526 Ga0209675_1002439 3300025291 Bacteria 9555
527 Ga0209676_1000007 3300025292 Bacteria 1029371
528 Ga0209676_1000179 3300025292 Bacteria 150096
529 Ga0209676_1000624 3300025292 Bacteria 51430
530 Ga0209676_1005017 3300025292 Bacteria 7087
531 Ga0209676_1006159 3300025292 Bacteria 6013
532 Ga0209025_1000221 3300025294 Bacteria 135793
533 Ga0209025_1000732 3300025294 Bacteria 55664
534 Ga0209025_1012320 3300025294 Bacteria 5499
535 Ga0209025_1015340 3300025294 Bacteria 4630
536 Ga0209025_1018086 3300025294 Bacteria 4026
537 Ga0209025_1027824 3300025294 Bacteria 2790
538 Ga0209025_1065738 3300025294 Bacteria 1322
539 Ga0209025_1117694 3300025294 Bacteria 800
540 Ga0209564_1000005 3300025295 Bacteria 1147192
541 Ga0209564_1000039 3300025295 Bacteria 413604
542 Ga0209564_1000151 3300025295 Bacteria 168783
543 Ga0209564_1000246 3300025295 Bacteria 117096
544 Ga0209564_1000495 3300025295 Bacteria 65018
545 Ga0209564_1000677 3300025295 Bacteria 50407
546 Ga0209564_1006113 3300025295 Bacteria 6608
547 Ga0209758_1000027 3300025297 Bacteria 549650
548 Ga0209758_1000196 3300025297 Bacteria 133816
549 Ga0209758_1034255 3300025297 Bacteria 2024
550 Ga0209758_1050722 3300025297 Bacteria 1452
551 Ga0209050_1000003 3300025298 Bacteria 1609245
552 Ga0209050_1000172 3300025298 Bacteria 150096
553 Ga0209050_1003833 3300025298 Bacteria 10720
554 Ga0209050_1004037 3300025298 Bacteria 10311
555 Ga0209050_1009307 3300025298 Bacteria 5050
556 Ga0209050_1009881 3300025298 Bacteria 4794
557 Ga0209050_1022647 3300025298 Bacteria 2245
558 Ga0209256_1000001 3300025299 Bacteria 2166974
559 Ga0209256_1000069 3300025299 Bacteria 245640
560 Ga0209256_1000161 3300025299 Bacteria 138270
561 Ga0209256_1007820 3300025299 Bacteria 5145
562 Ga0209256_1008436 3300025299 Bacteria 4778
563 Ga0209256_1030237 3300025299 Bacteria 1497
564 Ga0207426_1000027 3300025302 Bacteria 513176
565 Ga0207426_1000115 3300025302 Bacteria 227423
566 Ga0207426_1000308 3300025302 Bacteria 96061
567 Ga0207426_1004804 3300025302 Bacteria 6413
568 Ga0207426_1074086 3300025302 Bacteria 941
569 Ga0209051_1000003 3300025303 Bacteria 1609245
570 Ga0209051_1000046 3300025303 Bacteria 296424
571 Ga0209051_1000055 3300025303 Bacteria 277194
572 Ga0209051_1000808 3300025303 Bacteria 32707
573 Ga0209051_1000971 3300025303 Bacteria 27947
574 Ga0209051_1001642 3300025303 Bacteria 18112
575 Ga0209051_1003378 3300025303 Bacteria 10493
576 Ga0209051_1008817 3300025303 Bacteria 5284
577 Ga0209051_1027305 3300025303 Bacteria 2277
578 Ga0209257_1000020 3300025304 Bacteria 773356
579 Ga0209257_1000101 3300025304 Bacteria 251553
580 Ga0209257_1000103 3300025304 Bacteria 245859
581 Ga0209257_1000281 3300025304 Bacteria 114413
582 Ga0209257_1000450 3300025304 Bacteria 77403
583 Ga0209257_1001146 3300025304 Bacteria 33810
584 Ga0209257_1002049 3300025304 Bacteria 21423
585 Ga0209257_1005295 3300025304 Bacteria 9178
586 Ga0209257_1043372 3300025304 Bacteria 1320
587 Ga0209257_1047666 3300025304 Bacteria 1231
588 Ga0207697_10008136 3300025315 Bacteria 4617
589 Ga0207656_10011149 3300025321 Bacteria 3389
590 Ga0207656_10017313 3300025321 Bacteria 2820
591 Ga0207656_10061200 3300025321 Bacteria 1652
592 Ga0207656_10125001 3300025321 Bacteria 1201
593 Ga0207696_1010665 3300025711 Bacteria 3355
594 Ga0207655_1000566 3300025728 Bacteria 45937
595 Ga0207682_10004030 3300025893 Bacteria 6246
596 Ga0207682_10032112 3300025893 Bacteria 2110
597 Ga0207682_10035708 3300025893 Bacteria 2008
598 Ga0207642_10003492 3300025899 Bacteria 4964
599 Ga0207642_10028660 3300025899 Bacteria 2295
600 Ga0207642_10111466 3300025899 Bacteria 1394
601 Ga0207688_10071922 3300025901 Bacteria 1964
602 Ga0207688_10073246 3300025901 Bacteria 1947
603 Ga0207688_10115706 3300025901 Bacteria 1561
604 Ga0207688_10206683 3300025901 Bacteria 1179
605 Ga0207680_10007763 3300025903 Bacteria 5241
606 Ga0207645_10005522 3300025907 Bacteria 9160
607 Ga0207645_10017863 3300025907 Bacteria 4677
608 Ga0207645_10216721 3300025907 Bacteria 1261
609 Ga0207645_10314972 3300025907 Bacteria 1043
610 Ga0207645_10370676 3300025907 Bacteria 960
611 Ga0207645_10426018 3300025907 Bacteria 894
612 Ga0207643_10045044 3300025908 Bacteria 2491
613 Ga0207643_10077754 3300025908 Bacteria 1919
614 Ga0207643_10454759 3300025908 Bacteria 815
615 Ga0207705_10162819 3300025909 Bacteria 1676
616 Ga0207705_10259472 3300025909 Bacteria 1326
617 Ga0207705_10287483 3300025909 Bacteria 1259
618 Ga0207705_10382976 3300025909 Bacteria 1086
619 Ga0207684_10006187 3300025910 Bacteria 10933
620 Ga0207695_10012332 3300025913 Bacteria 10268
621 Ga0207695_10125208 3300025913 Bacteria 2533
622 Ga0207695_10131491 3300025913 Bacteria 2460
623 Ga0207671_10003108 3300025914 Bacteria 16882
624 Ga0207671_10226861 3300025914 Bacteria 1464
625 Ga0207671_10230478 3300025914 Bacteria 1453
626 Ga0207660_10002058 3300025917 Bacteria 13362
627 Ga0207660_10208836 3300025917 Bacteria 1528
628 Ga0207662_10145067 3300025918 Bacteria 1506
629 Ga0207657_10043973 3300025919 Bacteria 3931
630 Ga0207657_10085185 3300025919 Bacteria 2648
631 Ga0207657_10138674 3300025919 Bacteria 1988
632 Ga0207657_10341044 3300025919 Bacteria 1183
633 Ga0207649_10001452 3300025920 Bacteria 13956
634 Ga0207649_10081913 3300025920 Bacteria 2091
635 Ga0207652_10026534 3300025921 Bacteria 4826
636 Ga0207652_10087228 3300025921 Bacteria 2737
637 Ga0207652_10150609 3300025921 Bacteria 2083
638 Ga0207681_10004661 3300025923 Bacteria 8432
639 Ga0207681_10372383 3300025923 Bacteria 1148
640 Ga0207681_10539038 3300025923 Bacteria 959
641 Ga0207694_10017688 3300025924 Bacteria 5387
642 Ga0207694_10035849 3300025924 Bacteria 3806
643 Ga0207694_10076029 3300025924 Bacteria 2629
644 Ga0207694_10127467 3300025924 Bacteria 2037
645 Ga0207650_10001129 3300025925 Bacteria 19633
646 Ga0207650_10020864 3300025925 Bacteria 4627
647 Ga0207650_10048272 3300025925 Bacteria 3140
648 Ga0207650_10062301 3300025925 Bacteria 2786
649 Ga0207650_10155881 3300025925 Bacteria 1806
650 Ga0207650_10925578 3300025925 Bacteria 740
651 Ga0207659_10000725 3300025926 Bacteria 19531
652 Ga0207659_10022818 3300025926 Bacteria 4171
653 Ga0207659_10028803 3300025926 Bacteria 3777
654 Ga0207659_10045089 3300025926 Bacteria 3106
655 Ga0207659_10322783 3300025926 Bacteria 1274
656 Ga0207659_10422653 3300025926 Bacteria 1118
657 Ga0207659_10783518 3300025926 Bacteria 819
658 Ga0207659_10978741 3300025926 Bacteria 728
659 Ga0207687_10014932 3300025927 Bacteria 5086
660 Ga0207687_10193463 3300025927 Bacteria 1585
661 Ga0207687_10202260 3300025927 Bacteria 1553
662 Ga0207644_10002875 3300025931 Bacteria 11100
663 Ga0207644_10023515 3300025931 Bacteria 4222
664 Ga0207644_10052328 3300025931 Bacteria 2934
665 Ga0207644_10085948 3300025931 Bacteria 2334
666 Ga0207644_10093758 3300025931 Bacteria 2242
667 Ga0207644_10409754 3300025931 Bacteria 1109
668 Ga0207644_10756057 3300025931 Bacteria 812
669 Ga0207690_10005112 3300025932 Bacteria 7748
670 Ga0207690_10404450 3300025932 Bacteria 1089
671 Ga0207690_10836137 3300025932 Bacteria 762
672 Ga0207706_10028023 3300025933 Bacteria 5033
673 Ga0207706_10050549 3300025933 Bacteria 3673
674 Ga0207706_10061572 3300025933 Bacteria 3305
675 Ga0207706_10062327 3300025933 Bacteria 3284
676 Ga0207706_10117286 3300025933 Bacteria 2341
677 Ga0207706_10557383 3300025933 Bacteria 986
678 Ga0207706_10599674 3300025933 Bacteria 946
679 Ga0207686_10021892 3300025934 Bacteria 3675
680 Ga0207686_10468970 3300025934 Bacteria 972
681 Ga0207686_10493706 3300025934 Bacteria 949
682 Ga0207709_10000019 3300025935 Bacteria 402225
683 Ga0207709_10000230 3300025935 Bacteria 70768
684 Ga0207709_10003289 3300025935 Bacteria 9698
685 Ga0207709_10007670 3300025935 Bacteria 5986
686 Ga0207709_10252337 3300025935 Bacteria 1289
687 Ga0207709_10371934 3300025935 Bacteria 1085
688 Ga0207670_10087229 3300025936 Bacteria 2198
689 Ga0207669_10006230 3300025937 Bacteria 5433
690 Ga0207669_10023729 3300025937 Bacteria 3282
691 Ga0207669_10042005 3300025937 Bacteria 2666
692 Ga0207669_10058706 3300025937 Bacteria 2349
693 Ga0207669_10062500 3300025937 Bacteria 2294
694 Ga0207669_10389578 3300025937 Bacteria 1088
695 Ga0207669_10765960 3300025937 Bacteria 798
696 Ga0207704_10251440 3300025938 Bacteria 1327
697 Ga0207704_10751772 3300025938 Bacteria 811
698 Ga0207665_10142248 3300025939 Bacteria 1712
699 Ga0207691_10001003 3300025940 Bacteria 28006
700 Ga0207691_10032968 3300025940 Bacteria 4826
701 Ga0207691_10039555 3300025940 Bacteria 4362
702 Ga0207691_10066609 3300025940 Bacteria 3258
703 Ga0207691_10083381 3300025940 Bacteria 2870
704 Ga0207691_10120713 3300025940 Bacteria 2323
705 Ga0207691_10237223 3300025940 Bacteria 1577
706 Ga0207691_10278650 3300025940 Bacteria 1439
707 Ga0207691_10324298 3300025940 Bacteria 1320
708 Ga0207691_10355247 3300025940 Bacteria 1253
709 Ga0207711_10008951 3300025941 Bacteria 8369
710 Ga0207711_10138781 3300025941 Bacteria 2186
711 Ga0207711_10217615 3300025941 Bacteria 1746
712 Ga0207711_10240063 3300025941 Bacteria 1661
713 Ga0207711_10572061 3300025941 Bacteria 1054
714 Ga0207689_10005991 3300025942 Bacteria 10752
715 Ga0207689_10016929 3300025942 Bacteria 6167
716 Ga0207689_10076742 3300025942 Bacteria 2747
717 Ga0207689_10241177 3300025942 Bacteria 1494
718 Ga0207689_10428290 3300025942 Bacteria 1104
719 Ga0207661_10215610 3300025944 Bacteria 1694
720 Ga0207679_10000225 3300025945 Bacteria 44668
721 Ga0207679_10074108 3300025945 Bacteria 2578
722 Ga0207679_10129823 3300025945 Bacteria 2020
723 Ga0207679_10178779 3300025945 Bacteria 1753
724 Ga0207679_10257600 3300025945 Bacteria 1486
725 Ga0207679_10402682 3300025945 Bacteria 1204
726 Ga0207667_10031173 3300025949 Bacteria 5758
727 Ga0207667_10053192 3300025949 Bacteria 4261
728 Ga0207667_10174234 3300025949 Bacteria 2211
729 Ga0207651_10004166 3300025960 Bacteria 7235
730 Ga0207651_10020668 3300025960 Bacteria 3980
731 Ga0207651_10037615 3300025960 Bacteria 3172
732 Ga0207651_10041840 3300025960 Bacteria 3045
733 Ga0207651_10070181 3300025960 Bacteria 2477
734 Ga0207651_10426499 3300025960 Bacteria 1133
735 Ga0207651_10593435 3300025960 Bacteria 967
736 Ga0207712_10077662 3300025961 Bacteria 2407
737 Ga0207712_10087314 3300025961 Bacteria 2287
738 Ga0207668_10071736 3300025972 Bacteria 2475
739 Ga0207640_10003481 3300025981 Bacteria 8480
740 Ga0207640_10010736 3300025981 Bacteria 5166
741 Ga0207640_10496696 3300025981 Bacteria 1015
742 Ga0207640_10690991 3300025981 Bacteria 874
743 Ga0207658_10000412 3300025986 Bacteria 40643
744 Ga0207658_10008870 3300025986 Bacteria 6824
745 Ga0207658_10018001 3300025986 Bacteria 4870
746 Ga0207658_10282793 3300025986 Bacteria 1423
747 Ga0207658_10486981 3300025986 Bacteria 1097
748 Ga0207677_10003460 3300026023 Bacteria 8367
749 Ga0207677_10038300 3300026023 Bacteria 3143
750 Ga0207677_10048693 3300026023 Bacteria 2855
751 Ga0207677_10067429 3300026023 Bacteria 2507
752 Ga0207677_10152954 3300026023 Bacteria 1782
753 Ga0207677_10461635 3300026023 Bacteria 1090
754 Ga0207677_11128300 3300026023 Bacteria 716
755 Ga0207703_10004923 3300026035 Bacteria 10836
756 Ga0207703_10018286 3300026035 Bacteria 5473
757 Ga0207639_10102084 3300026041 Bacteria 2321
758 Ga0207639_10191120 3300026041 Bacteria 1749
759 Ga0207639_10344956 3300026041 Bacteria 1328
760 Ga0207678_10014066 3300026067 Bacteria 7037
761 Ga0207678_10142149 3300026067 Bacteria 2048
762 Ga0207678_10558119 3300026067 Bacteria 1002
763 Ga0207708_10030964 3300026075 Bacteria 4060
764 Ga0207708_10064806 3300026075 Bacteria 2792
765 Ga0207708_10515026 3300026075 Bacteria 1004
766 Ga0207702_10021374 3300026078 Bacteria 5357
767 Ga0207702_10193215 3300026078 Bacteria 1882
768 Ga0207702_10621139 3300026078 Bacteria 1061
769 Ga0207702_10892896 3300026078 Bacteria 880
770 Ga0207641_10002951 3300026088 Bacteria 15383
771 Ga0207641_10020843 3300026088 Bacteria 5387
772 Ga0207641_10391479 3300026088 Bacteria 1333
773 Ga0207648_10001142 3300026089 Bacteria 29820
774 Ga0207648_10004128 3300026089 Bacteria 15023
775 Ga0207648_10007320 3300026089 Bacteria 10877
776 Ga0207648_10063005 3300026089 Bacteria 3232
777 Ga0207648_10076766 3300026089 Bacteria 2912
778 Ga0207648_10106098 3300026089 Bacteria 2465
779 Ga0207648_10180983 3300026089 Bacteria 1866
780 Ga0207648_10201255 3300026089 Bacteria 1766
781 Ga0207648_10258908 3300026089 Bacteria 1552
782 Ga0207648_10322856 3300026089 Bacteria 1387
783 Ga0207648_10616973 3300026089 Bacteria 1001
784 Ga0207676_10001271 3300026095 Bacteria 18758
785 Ga0207676_10046806 3300026095 Bacteria 3349
786 Ga0207676_10047313 3300026095 Bacteria 3333
787 Ga0207676_10168583 3300026095 Bacteria 1905
788 Ga0207676_10194569 3300026095 Bacteria 1787
789 Ga0207676_10266423 3300026095 Bacteria 1549
790 Ga0207674_10032904 3300026116 Bacteria 5434
791 Ga0207674_10036445 3300026116 Bacteria 5125
792 Ga0207674_10055624 3300026116 Bacteria 4022
793 Ga0207675_100022248 3300026118 Bacteria 5903
794 Ga0207675_100036654 3300026118 Bacteria 4574
795 Ga0207675_100058473 3300026118 Bacteria 3597
796 Ga0207675_100235059 3300026118 Bacteria 1769
797 Ga0207675_100347515 3300026118 Bacteria 1453
798 Ga0207675_100405476 3300026118 Bacteria 1344
799 Ga0207683_10017025 3300026121 Bacteria 6187
800 Ga0207683_10042627 3300026121 Bacteria 3964
801 Ga0207683_10052282 3300026121 Bacteria 3579
802 Ga0207683_10053693 3300026121 Bacteria 3533
803 Ga0207683_10056428 3300026121 Bacteria 3445
804 Ga0207683_10091182 3300026121 Bacteria 2714
805 Ga0207683_10173803 3300026121 Bacteria 1952
806 Ga0207683_10177495 3300026121 Bacteria 1931
807 Ga0207683_10220879 3300026121 Bacteria 1726
808 Ga0207683_10534447 3300026121 Bacteria 1084
809 Ga0207683_10666892 3300026121 Bacteria 964
810 Ga0207698_10030878 3300026142 Bacteria 3860
811 Ga0207698_10173888 3300026142 Bacteria 1899
812 Ga0207698_10554737 3300026142 Bacteria 1127
813 Ga0207698_10741701 3300026142 Bacteria 980
814 Ga0207698_11452636 3300026142 Bacteria 701
815 Ga0209281_1000005 3300027111 Bacteria 1242284
816 Ga0209389_1006568 3300027296 Bacteria 10123
817 Ga0209969_1010297 3300027360 Bacteria 1337
818 Ga0209968_1000332 3300027526 Bacteria 7886
819 Ga0209999_1006616 3300027543 Bacteria 2083
820 Ga0209966_1000014 3300027695 Bacteria 81913
821 Ga0209813_10046379 3300027866 Bacteria 1342
822 Ga0209974_10001693 3300027876 Bacteria 7987
823 Ga0209974_10011142 3300027876 Bacteria 3025
824 Ga0209974_10027736 3300027876 Bacteria 1874
825 Ga0209974_10030489 3300027876 Bacteria 1787
826 Ga0207428_10095604 3300027907 Bacteria 2302
827 Ga0268266_10137528 3300028379 Bacteria 2189
828 Ga0268266_10315015 3300028379 Bacteria 1463
829 Ga0268266_10352229 3300028379 Bacteria 1384
830 Ga0268266_10900904 3300028379 Bacteria 855
831 Ga0268266_11568120 3300028379 Bacteria 634
832 Ga0268265_10019736 3300028380 Bacteria 4692
833 Ga0268264_10001666 3300028381 Bacteria 20465
834 Ga0268264_10005463 3300028381 Bacteria 10772
835 Ga0268264_10483730 3300028381 Bacteria 1204
836 Ga0268264_11030019 3300028381 Bacteria 830
837 Ga0265318_10122019 3300028577 Bacteria 958
838 Ga0307517_10003097 3300028786 Bacteria 26244
839 Ga0307517_10172222 3300028786 Bacteria 1420
840 Ga0307517_10209718 3300028786 Bacteria 1202
841 Ga0307515_10000006 3300028794 Bacteria 725810
842 Ga0307515_10000944 3300028794 Bacteria 66492
843 Ga0307515_10001534 3300028794 Bacteria 51647
844 Ga0307515_10001963 3300028794 Bacteria 45524
845 Ga0307515_10005581 3300028794 Bacteria 25423
846 Ga0307515_10016830 3300028794 Bacteria 13366
847 Ga0307515_10246527 3300028794 Bacteria 1547
848 Ga0307515_10418300 3300028794 Bacteria 961
849 Ga0268256_1054495 3300030500 Bacteria 827
850 Ga0316182_1413366 3300030745 Bacteria 2183
851 Ga0265330_10001548 3300031235 Bacteria 13225
852 Ga0265330_10097367 3300031235 Bacteria 1261
853 Ga0265332_10000003 3300031238 Bacteria 482849
854 Ga0265332_10000072 3300031238 Bacteria 86029
855 Ga0265328_10010794 3300031239 Bacteria 3668
856 Ga0265325_10002224 3300031241 Bacteria 13173
857 Ga0265329_10045504 3300031242 Bacteria 1403
858 Ga0265331_10008333 3300031250 Bacteria 5901
859 Ga0265327_10000223 3300031251 Bacteria 115759
860 Ga0265327_10002338 3300031251 Bacteria 20225
861 Ga0265327_10003808 3300031251 Bacteria 13948
862 Ga0265327_10210350 3300031251 Bacteria 878
863 Ga0265316_10000115 3300031344 Bacteria 86934
864 Ga0307513_10000006 3300031456 Bacteria 470848
865 Ga0307513_10000094 3300031456 Bacteria 127685
866 Ga0307513_10003659 3300031456 Bacteria 20801
867 Ga0307513_10015349 3300031456 Bacteria 9288
868 Ga0307513_10046752 3300031456 Bacteria 4714
869 Ga0307513_10058530 3300031456 Bacteria 4094
870 Ga0307513_10152820 3300031456 Bacteria 2213
871 Ga0307509_10000120 3300031507 Bacteria 114238
872 Ga0307509_10015361 3300031507 Bacteria 8934
873 Ga0307509_10072514 3300031507 Bacteria 3587
874 Ga0307509_10074997 3300031507 Bacteria 3514
875 Ga0307509_10115949 3300031507 Bacteria 2669
876 Ga0307509_10149664 3300031507 Bacteria 2253
877 Ga0307408_100000064 3300031548 Bacteria 122509
878 Ga0307408_100198160 3300031548 Bacteria 1623
879 Ga0307408_100546902 3300031548 Bacteria 1021
880 Ga0307408_100571011 3300031548 Bacteria 1001
881 Ga0307508_10000017 3300031616 Bacteria 203567
882 Ga0307508_10000163 3300031616 Bacteria 80086
883 Ga0307508_10022852 3300031616 Bacteria 5682
884 Ga0307508_10360829 3300031616 Bacteria 1044
885 Ga0307514_10000823 3300031649 Bacteria 50357
886 Ga0307514_10008501 3300031649 Bacteria 8734
887 Ga0307514_10009567 3300031649 Bacteria 8140
888 Ga0307514_10167877 3300031649 Bacteria 1439
889 Ga0265314_10000516 3300031711 Bacteria 49905
890 Ga0265314_10004171 3300031711 Bacteria 13583
891 Ga0265342_10016086 3300031712 Bacteria 4899
892 Ga0307516_10002019 3300031730 Bacteria 27686
893 Ga0307516_10006850 3300031730 Bacteria 13279
894 Ga0307516_10019640 3300031730 Bacteria 6994
895 Ga0307516_10085135 3300031730 Bacteria 2999
896 Ga0307516_10093094 3300031730 Bacteria 2840
897 Ga0307405_10130348 3300031731 Bacteria 1736
898 Ga0307413_10071919 3300031824 Bacteria 2181
899 Ga0307413_10101510 3300031824 Bacteria 1902
900 Ga0307406_10000879 3300031901 Bacteria 16916
901 Ga0307406_10002603 3300031901 Bacteria 9832
902 Ga0307406_10221578 3300031901 Bacteria 1406
903 Ga0307406_10482539 3300031901 Bacteria 1001
904 Ga0307407_10500375 3300031903 Bacteria 891
905 Ga0307412_10027193 3300031911 Bacteria 3564
906 Ga0307412_10195468 3300031911 Bacteria 1532
907 Ga0307412_10236230 3300031911 Bacteria 1411
908 Ga0307412_10358085 3300031911 Bacteria 1174
909 Ga0307412_10468440 3300031911 Bacteria 1042
910 Ga0307409_100004624 3300031995 Bacteria 7773
911 Ga0307409_100433094 3300031995 Bacteria 1265
912 Ga0307409_100487284 3300031995 Bacteria 1198
913 Ga0307416_100022102 3300032002 Bacteria 4583
914 Ga0307416_100035014 3300032002 Bacteria 3829
915 Ga0307416_100235907 3300032002 Bacteria 1768
916 Ga0307416_100795898 3300032002 Bacteria 1041
917 Ga0307414_10033235 3300032004 Bacteria 3407
918 Ga0307411_10001625 3300032005 Bacteria 9372
919 Ga0307411_10015641 3300032005 Bacteria 4269
920 Ga0307411_10217791 3300032005 Bacteria 1479
921 Ga0307411_10786059 3300032005 Bacteria 837
922 Ga0307415_100002068 3300032126 Bacteria 9920
923 Ga0307507_10127164 3300033179 Bacteria 2010
924 Ga0307510_10002394 3300033180 Bacteria 21269
925 Ga0307510_10034941 3300033180 Bacteria 5619
926 Ga0307510_10181925 3300033180 Bacteria 1663
927 Ga0307510_10188421 3300033180 Bacteria 1614
928 Ga0307510_10450594 3300033180 Bacteria 728
929 Ga0373930_0015531 3300034816 Bacteria 1430
930 Ga0373959_0011991 3300034820 Bacteria 1540
931 Ga0373959_0032709 3300034820 Bacteria 1058
932 Ga0373934_0033147 3300035086 Bacteria 2028
933 Ga0373951_0016954 3300035091 Bacteria 1646
934 Ga0373923_0126041 3300035111 Bacteria 1148
935 Ga0373923_0261321 3300035111 Bacteria 812
936 Ga0373932_0006153 3300035112 Bacteria 2834
937 Ga0373932_0047369 3300035112 Bacteria 1264
938 Ga0373936_0201448 3300035113 Bacteria 879
939 Ga0373939_0000308 3300035114 Bacteria 12720
940 Ga0373939_0093593 3300035114 Bacteria 1020
941 Ga0373957_0179471 3300035120 Bacteria 877
942 Ga0373960_0001221 3300035121 Bacteria 5624
943 Ga0373943_0076009 3300035170 Bacteria 1712
944 Ga0373955_0137995 3300035172 Bacteria 1428
945 Ga0373924_0020497 3300035410 Bacteria 2571
946 Ga0373931_0001161 3300035691 Bacteria 11196
947 Ga0373931_0122405 3300035691 Bacteria 1488
948 Ga0373931_0476487 3300035691 Bacteria 802
949 Ga0373935_0165026 3300035692 Bacteria 1512
950 Ga0373927_0008971 3300035695 Bacteria 6713
951 Ga0373947_0125985 3300035725 Bacteria 1631
952 Ga0373937_0018511 3300036401 Bacteria 6222
953 Ga0373937_0027901 3300036401 Bacteria 5108
954 Ga0373937_0253126 3300036401 Bacteria 1660
955 Ga0373925_0102065 3300037068 Bacteria 2206
956 Ga0373925_0168777 3300037068 Bacteria 1727
957 Ga0373925_0360260 3300037068 Bacteria 1182
958 Ga0373925_0456791 3300037068 Bacteria 1046
959 Ga0395899_0001877 3300037312 Bacteria 17349
960 Ga0395899_0221413 3300037312 Bacteria 1311
961 Ga0395899_0361911 3300037312 Bacteria 968
962 Ga0395900_0052840 3300037418 Bacteria 4182
963 Ga0395900_0097042 3300037418 Bacteria 3028
964 Ga0395900_0121734 3300037418 Bacteria 2677
965 Ga0395900_0405808 3300037418 Bacteria 1326
966 Ga0395898_0022468 3300037466 Bacteria 6388
967 Ga0395898_0023515 3300037466 Bacteria 6226
968 Ga0395898_0047602 3300037466 Bacteria 4207
969 Ga0395898_0707332 3300037466 Bacteria 949
970 Ga0395905_0000138 3300037471 Bacteria 120373
971 Ga0395905_0000837 3300037471 Bacteria 40181
972 Ga0395905_0013525 3300037471 Bacteria 7819
973 Ga0395905_0014971 3300037471 Bacteria 7396
974 Ga0395905_0018633 3300037471 Bacteria 6584
975 Ga0395905_0026790 3300037471 Bacteria 5436
976 Ga0395905_0039665 3300037471 Bacteria 4418
977 Ga0395905_0042156 3300037471 Bacteria 4282
978 Ga0395905_0059945 3300037471 Bacteria 3558
979 Ga0395905_0123613 3300037471 Bacteria 2433
980 Ga0395905_0135924 3300037471 Bacteria 2312
981 Ga0395905_0150426 3300037471 Bacteria 2190
982 Ga0395905_0221071 3300037471 Bacteria 1772
983 Ga0395905_0252730 3300037471 Bacteria 1646
984 Ga0395905_0538143 3300037471 Bacteria 1069
985 Ga0395901_0036782 3300038443 Bacteria 5061
986 Ga0395901_0069944 3300038443 Bacteria 3656
987 Ga0395901_0141911 3300038443 Bacteria 2524
988 Ga0395901_0175935 3300038443 Bacteria 2245
989 Ga0395901_0260777 3300038443 Bacteria 1804
990 Ga0395901_0364843 3300038443 Bacteria 1489
991 Ga0395901_0843729 3300038443 Bacteria 902
992 Ga0436365_1871400 3300039437 Bacteria 1060
993 Ga0436361_0146317 3300039447 Bacteria 92155
994 Ga0436361_0231085 3300039447 Bacteria 2027
995 Ga0436361_0315951 3300039447 Bacteria 32136
996 Ga0436361_0343816 3300039447 Bacteria 22925
997 Ga0436361_0382345 3300039447 Bacteria 19107
998 Ga0436361_0502840 3300039447 Bacteria 2212
999 Ga0436361_1025974 3300039447 Bacteria 1623
1000 Ga0436361_1052556 3300039447 Bacteria 39885
1001 Ga0436361_1132349 3300039447 Bacteria 2370
1002 Ga0436363_0424328 3300039450 Bacteria 752
1003 Ga0439436_0019770 3300041404 Bacteria 2008
1004 Ga0439466_0013982 3300041411 Bacteria 2930
1005 Ga0451789_0792101 3300041443 Bacteria 1786
1006 Ga0451793_0084455 3300041452 Bacteria 2603
1007 Ga0451797_0514269 3300041453 Bacteria 3031
1008 Ga0451795_1492822 3300041456 Bacteria 725
1009 Ga0451798_0308381 3300041458 Bacteria 1277
1010 Ga0451807_2595932 3300041486 Bacteria 746
1011 Ga0451835_0681653 3300041492 Bacteria 823
1012 Ga0451839_0245472 3300041496 Bacteria 1335
1013 Ga0451841_0499384 3300041498 Bacteria 1416
1014 Ga0451853_3545225 3300041512 Bacteria 901
1015 Ga0439431_0011003 3300041997 Bacteria 2062
1016 Ga0439431_0022002 3300041997 Bacteria 1534
1017 Ga0439437_007626 3300042000 Bacteria 1210
1018 Ga0439437_009888 3300042000 Bacteria 1083
1019 Ga0439442_021007 3300042002 Bacteria 1353
1020 Ga0439445_0016186 3300042004 Bacteria 1832
1021 Ga0439445_0106099 3300042004 Bacteria 799
1022 Ga0439449_0004755 3300042007 Bacteria 5241
1023 Ga0450911_001967 3300042115 Bacteria 4285
1024 Ga0450911_027936 3300042115 Bacteria 731
1025 Ga0450914_001866 3300042118 Bacteria 1413
1026 Ga0450919_002745 3300042121 Bacteria 2268
1027 Ga0450920_001884 3300042122 Bacteria 3518
1028 Ga0450923_003416 3300042125 Bacteria 2395
1029 Ga0450890_001708 3300042127 Bacteria 3128
1030 Ga0450890_001931 3300042127 Bacteria 2931
1031 Ga0450897_011066 3300042128 Bacteria 875
1032 Ga0450891_000279 3300042129 Bacteria 5183
1033 Ga0450892_000564 3300042130 Bacteria 4253
1034 Ga0450898_012015 3300042134 Bacteria 1425
1035 Ga0450898_016930 3300042134 Bacteria 1249
1036 Ga0450898_023528 3300042134 Bacteria 1096
1037 Ga0450889_000263 3300042144 Bacteria 5821
1038 Ga0439446_0002464 3300042156 Bacteria 4447
1039 Ga0439434_0006244 3300042435 Bacteria 3477
1040 Ga0439435_0063316 3300042436 Bacteria 1082
1041 Ga0439459_0001287 3300042438 Bacteria 3660
1042 Ga0439459_0016582 3300042438 Bacteria 1363
1043 Ga0439464_0020171 3300042439 Bacteria 1824
1044 Ga0450918_000139 3300042531 Bacteria 15860
1045 Ga0450918_000288 3300042531 Bacteria 11374
1046 Ga0450893_0001499 3300042532 Bacteria 3584
1047 Ga0450893_0001662 3300042532 Bacteria 3423
1048 Ga0451577_0022252 3300042876 Bacteria 5788
1049 Ga0451577_0042165 3300042876 Bacteria 4093
1050 Ga0451577_0293797 3300042876 Bacteria 1473
1051 Ga0451577_0540710 3300042876 Bacteria 1058
1052 Ga0466969_0017037 3300044656 Bacteria 3797
1053 Ga0466969_0033787 3300044656 Bacteria 2594
1054 Ga0453683_0002835 3300044673 Bacteria 13148
1055 Ga0466965_0006955 3300044683 Bacteria 5177
1056 Ga0466966_0002595 3300044684 Bacteria 11841
1057 Ga0466966_0013446 3300044684 Bacteria 5417
1058 Ga0466966_0263175 3300044684 Bacteria 1038
1059 Ga0466961_0002324 3300044693 Bacteria 11811
1060 Ga0466961_0012371 3300044693 Bacteria 5456
1061 Ga0466963_0134608 3300044694 Bacteria 1709
1062 Ga0466963_0190015 3300044694 Bacteria 1435
1063 Ga0466963_0223238 3300044694 Bacteria 1320
1064 Ga0466964_0012092 3300044706 Bacteria 3265
1065 Ga0453684_0000121 3300044712 Bacteria 341067
1066 Ga0453684_0011391 3300044712 Bacteria 14933
1067 Ga0453684_0058580 3300044712 Bacteria 4974
1068 Ga0453684_0067005 3300044712 Bacteria 4568
1069 Ga0453684_0144168 3300044712 Bacteria 2840
1070 Ga0453684_0363247 3300044712 Bacteria 1629
1071 Ga0453684_0388449 3300044712 Bacteria 1566
1072 Ga0453684_0399728 3300044712 Bacteria 1539
1073 Ga0453684_0760905 3300044712 Bacteria 1048
1074 Ga0466971_0014882 3300044719 Bacteria 3423
1075 Ga0466968_0003831 3300044735 Bacteria 5581
1076 Ga0466968_0013720 3300044735 Bacteria 3189
1077 Ga0466970_0007496 3300044765 Bacteria 5474
1078 Ga0466970_0082348 3300044765 Bacteria 1740
1079 Ga0466957_0002248 3300044842 Bacteria 10347
1080 Ga0466957_0017319 3300044842 Bacteria 4218
1081 Ga0466957_0602790 3300044842 Bacteria 769
1082 Ga0466959_0006996 3300045049 Bacteria 7884
1083 Ga0466959_0028726 3300045049 Bacteria 4122
1084 Ga0451576_0005731 3300045051 Bacteria 15465
1085 Ga0451576_0007989 3300045051 Bacteria 12512
1086 Ga0451576_0050947 3300045051 Bacteria 4342
1087 Ga0451576_0115320 3300045051 Bacteria 2797
1088 Ga0451576_0211312 3300045051 Bacteria 2026
1089 Ga0451576_0236417 3300045051 Bacteria 1908
1090 Ga0451576_0513705 3300045051 Bacteria 1258
1091 Ga0451576_0719101 3300045051 Bacteria 1049
1092 Ga0451576_1294723 3300045051 Bacteria 760
1093 Ga0451576_1527780 3300045051 Bacteria 693
1094 Ga0466958_0013315 3300045836 Bacteria 4680
1095 Ga0466967_0330751 3300045976 Bacteria 1471
1096 Ga0495592_0001471 3300046454 Bacteria 16387
1097 Ga0495603_0252585 3300046455 Bacteria 1015
1098 Ga0495603_0318981 3300046455 Bacteria 892
1099 Ga0495590_0001744 3300046457 Bacteria 9222
1100 Ga0495590_0040706 3300046457 Bacteria 1620
1101 Ga0495629_0018252 3300046459 Bacteria 5024
1102 Ga0495629_0300743 3300046459 Bacteria 1099
1103 Ga0495629_0304188 3300046459 Bacteria 1092
1104 Ga0495580_0018250 3300046472 Bacteria 5226
1105 Ga0495639_0010899 3300046475 Bacteria 3915
1106 Ga0495583_0000171 3300046506 Bacteria 110806
1107 Ga0495583_0105022 3300046506 Bacteria 1202
1108 Ga0495606_0000868 3300046507 Bacteria 45273
1109 Ga0495606_0257462 3300046507 Bacteria 965
1110 Ga0495610_0028601 3300046512 Bacteria 2945
1111 Ga0495610_0194121 3300046512 Bacteria 836
1112 Ga0495616_0003352 3300046513 Bacteria 10300
1113 Ga0495618_0153996 3300046514 Bacteria 1468
1114 Ga0495620_0052894 3300046515 Bacteria 1722
1115 Ga0495628_0286553 3300046516 Bacteria 1222
1116 Ga0495630_0451462 3300046517 Bacteria 985
1117 Ga0495632_0017466 3300046519 Bacteria 3958
1118 Ga0495632_0021852 3300046519 Bacteria 3439
1119 Ga0495643_0040950 3300046522 Bacteria 2528
1120 Ga0495648_0109826 3300046524 Bacteria 1503
1121 Ga0495648_0117071 3300046524 Bacteria 1439
1122 Ga0495663_0007358 3300046525 Bacteria 3042
1123 Ga0495663_0090555 3300046525 Bacteria 997
1124 Ga0495666_0105369 3300046526 Bacteria 1327
1125 Ga0495666_0218393 3300046526 Bacteria 874
1126 Ga0495642_0096254 3300046528 Bacteria 1256
1127 Ga0495652_0293532 3300046529 Bacteria 1185
1128 Ga0495654_0007324 3300046530 Bacteria 6182
1129 Ga0495654_0020611 3300046530 Bacteria 3435
1130 Ga0495586_0138276 3300046535 Bacteria 1366
1131 Ga0495586_0222545 3300046535 Bacteria 1073
1132 Ga0495598_0024276 3300046537 Bacteria 1642
1133 Ga0495598_0245660 3300046537 Bacteria 661
1134 Ga0495621_0156307 3300046539 Bacteria 900
1135 Ga0495597_0000393 3300046542 Bacteria 38017
1136 Ga0495597_0060189 3300046542 Bacteria 1657
1137 Ga0495645_0119906 3300046543 Bacteria 1853
1138 Ga0495622_0132809 3300046557 Bacteria 1133
1139 Ga0495668_0098130 3300046616 Bacteria 1603
1140 Ga0495625_0000903 3300046660 Bacteria 39973
1141 Ga0495625_0003716 3300046660 Bacteria 14882
1142 Ga0495625_0029597 3300046660 Bacteria 4093
1143 Ga0495625_0114565 3300046660 Bacteria 1840
1144 Ga0495661_0220853 3300046665 Bacteria 982
1145 Ga0495588_0016294 3300046674 Bacteria 3591
1146 Ga0495599_0228371 3300046678 Bacteria 1137
1147 Ga0495599_0298484 3300046678 Bacteria 973
1148 Ga0495623_0186156 3300046679 Bacteria 1203
1149 Ga0495658_0021538 3300046683 Bacteria 3399
1150 Ga0495658_0023401 3300046683 Bacteria 3279
1151 Ga0495658_0108305 3300046683 Bacteria 1668
1152 Ga0495658_0205463 3300046683 Bacteria 1229
1153 Ga0495658_0213829 3300046683 Bacteria 1205
1154 Ga0495669_0029390 3300046684 Bacteria 2410
1155 Ga0495613_0090441 3300046689 Bacteria 2217
1156 Ga0495624_0254131 3300046690 Bacteria 1063
1157 Ga0495670_0338216 3300046691 Bacteria 809
1158 Ga0495649_0001001 3300046694 Bacteria 22213
1159 Ga0495589_0012815 3300046794 Bacteria 4334
1160 Ga0495600_0048587 3300046809 Bacteria 2768
1161 Ga0495660_0035115 3300046810 Bacteria 2803
1162 Ga0495660_0119487 3300046810 Bacteria 1335
1163 Ga0495636_0031425 3300047318 Bacteria 2176
1164 Ga0495676_0013187 3300047321 Bacteria 7434
1165 Ga0495676_0093425 3300047321 Bacteria 2243
1166 Ga0495680_0041698 3300047322 Bacteria 3648
1167 Ga0495680_0299860 3300047322 Bacteria 1128
1168 Ga0495687_000138 3300047443 Bacteria 110840
1169 Ga0495687_017456 3300047443 Bacteria 3580
1170 Ga0495677_0174221 3300047445 Bacteria 833
1171 Ga0495685_008881 3300047447 Bacteria 3351
1172 Ga0495686_0002281 3300047472 Bacteria 18444
1173 Ga0495686_0219370 3300047472 Bacteria 1083
1174 Ga0495593_0000578 3300047673 Bacteria 20838
1175 Ga0495602_0452775 3300048088 Bacteria 906
1176 Ga0495615_0082489 3300048090 Bacteria 884
1177 Ga0495626_0024171 3300048091 Bacteria 2982
1178 Ga0496100_0012386 3300048903 Bacteria 4888
1179 Ga0496100_0201179 3300048903 Bacteria 1452
1180 Ga0496101_0009863 3300048904 Bacteria 6291
1181 Ga0496102_0009115 3300048905 Bacteria 8513
1182 Ga0496103_0022029 3300048906 Bacteria 3835
1183 Ga0496104_0018679 3300048907 Bacteria 6329
1184 Ga0496104_0018814 3300048907 Bacteria 6309
1185 Ga0496104_0467807 3300048907 Bacteria 1172
1186 Ga0496104_1279501 3300048907 Bacteria 637
1187 Ga0496105_0000491 3300048908 Bacteria 26041
1188 Ga0496105_0108748 3300048908 Bacteria 2289
1189 Ga0496105_0342113 3300048908 Bacteria 1196
1190 Ga0496106_0030765 3300048909 Bacteria 4001
1191 Ga0496107_0025475 3300048910 Bacteria 4188
1192 Ga0496108_0102989 3300048911 Bacteria 2436
1193 Ga0496108_0204071 3300048911 Bacteria 1715
1194 Ga0496108_0206051 3300048911 Bacteria 1707
1195 Ga0496108_0453892 3300048911 Bacteria 1120
1196 Ga0496108_0466732 3300048911 Bacteria 1103
1197 Ga0496108_0631471 3300048911 Bacteria 932
1198 Ga0496109_0072463 3300048912 Bacteria 3165
1199 Ga0496109_0195971 3300048912 Bacteria 1899
1200 Ga0496109_0293333 3300048912 Bacteria 1533
1201 Ga0496109_0385275 3300048912 Bacteria 1324
1202 Ga0496109_1039908 3300048912 Bacteria 756
1203 Ga0496110_0106051 3300048913 Bacteria 2521
1204 Ga0496110_0353816 3300048913 Bacteria 1338
1205 Ga0496111_0089830 3300048914 Bacteria 2250
1206 Ga0496111_0425011 3300048914 Bacteria 981
1207 Ga0496111_0682362 3300048914 Bacteria 748
1208 Ga0496113_0084087 3300048916 Bacteria 2443
1209 Ga0496113_0184162 3300048916 Bacteria 1656
1210 Ga0496114_0043366 3300048917 Bacteria 3730
1211 Ga0496114_0101809 3300048917 Bacteria 2453
1212 Ga0496114_0191340 3300048917 Bacteria 1790
1213 Ga0496116_0020177 3300048919 Bacteria 5070
1214 Ga0496116_0054208 3300048919 Bacteria 2643
1215 Ga0496117_0025714 3300048920 Bacteria 4621
1216 Ga0496117_0068573 3300048920 Bacteria 2393
1217 Ga0496118_0074272 3300048921 Bacteria 2431
1218 Ga0496118_0074389 3300048921 Bacteria 2428
1219 Ga0496121_0052832 3300048924 Bacteria 3408
1220 Ga0496121_0061500 3300048924 Bacteria 3081
1221 Ga0496121_0079849 3300048924 Bacteria 2595
1222 Ga0496121_0389875 3300048924 Bacteria 916
1223 Ga0496122_0178075 3300048925 Bacteria 1272
1224 Ga0496124_0004176 3300048927 Bacteria 17021
1225 Ga0496124_0340435 3300048927 Bacteria 1065
1226 Ga0496125_0014470 3300048928 Bacteria 7683
1227 Ga0496125_0031049 3300048928 Bacteria 4768
1228 Ga0496125_0035225 3300048928 Bacteria 4397
1229 Ga0496125_0103076 3300048928 Bacteria 2094
1230 Ga0496125_0301771 3300048928 Bacteria 981
1231 Ga0496126_0285135 3300048929 Bacteria 1367
1232 Ga0501308_003654 3300049128 Bacteria 1438
1233 Ga0501292_000723 3300049515 Bacteria 4000
1234 Ga0501293_010564 3300049516 Bacteria 800
1235 Ga0501297_038232 3300049520 Bacteria 665
1236 Ga0501298_015327 3300049521 Bacteria 1379
1237 Ga0501031_0404328 3300049568 Bacteria 883
1238 Ga0501037_0106857 3300049573 Bacteria 2017
1239 Ga0501038_0020423 3300049574 Bacteria 5954
1240 Ga0501042_0704410 3300049578 Bacteria 734
1241 Ga0501043_0001706 3300049579 Bacteria 19026
1242 Ga0501043_0283736 3300049579 Bacteria 1269
1243 Ga0501046_0000132 3300049580 Bacteria 79506
1244 Ga0501046_0593376 3300049580 Bacteria 786
1245 Ga0501047_0000026 3300049581 Bacteria 225296
1246 Ga0501047_0032393 3300049581 Bacteria 5045
1247 Ga0501047_0167836 3300049581 Bacteria 2065
1248 Ga0501198_000021 3300049649 Bacteria 70854
1249 Ga0501199_012287 3300049650 Bacteria 934
1250 Ga0501211_001974 3300049658 Bacteria 2190
1251 Ga0501222_000018 3300049662 Bacteria 71805
1252 Ga0501222_003183 3300049662 Bacteria 2255
1253 Ga0501235_018379 3300049669 Bacteria 1550
1254 Ga0501235_028209 3300049669 Bacteria 1261
1255 Ga0501239_009032 3300049672 Bacteria 1076
1256 Ga0501253_006788 3300049683 Bacteria 1569
1257 Ga0501258_013651 3300049687 Bacteria 894
1258 Ga0501225_0045954 3300049705 Bacteria 1209
1259 Ga0501229_017995 3300049706 Bacteria 924
1260 Ga0501080_0133122 3300049742 Bacteria 2301
1261 Ga0501265_002087 3300049762 Bacteria 2278
1262 Ga0501266_000160 3300049763 Bacteria 8622
1263 Ga0501281_02232 3300049777 Bacteria 1427
1264 Ga0501035_0032810 3300049822 Bacteria 4723
1265 Ga0501035_0185222 3300049822 Bacteria 1792
1266 Ga0501044_0036845 3300049823 Bacteria 5116
1267 Ga0501044_0082197 3300049823 Bacteria 3260
1268 Ga0501044_0101166 3300049823 Bacteria 2900
1269 Ga0501045_0059792 3300049824 Bacteria 2792
1270 nmdc:mga03683_137854_c1 3300050489 Bacteria 1095
1271 nmdc:mga03683_141194_c1 3300050489 Bacteria 1083
1272 nmdc:mga03683_19169_c1 3300050489 Bacteria 2609
1273 nmdc:mga03683_49573_c1 3300050489 Bacteria 1749
1274 nmdc:mga03683_5206_c1 3300050489 Bacteria 4376
1275 nmdc:mga03n38_87079_c1 3300050490 Bacteria 1479
1276 nmdc:mga00v17_296495_c1 3300050491 Bacteria 1050
1277 nmdc:mga0yw44_29443_c1 3300050492 Bacteria 3170
1278 nmdc:mga0yw44_93412_c1 3300050492 Bacteria 1905
1279 nmdc:mga0k408_155897_c1 3300050493 Bacteria 1360
1280 nmdc:mga0k408_157062_c1 3300050493 Bacteria 1355
1281 nmdc:mga0k408_17025_c1 3300050493 Bacteria 4041
1282 nmdc:mga0k408_17761_c1 3300050493 Bacteria 3965
1283 nmdc:mga0k408_215715_c1 3300050493 Bacteria 1146
1284 nmdc:mga0k408_235462_c1 3300050493 Bacteria 1093
1285 nmdc:mga0k408_239917_c1 3300050493 Bacteria 1082
1286 nmdc:mga0k408_24224_c1 3300050493 Bacteria 3430
1287 nmdc:mga0k408_278_c1 3300050493 Bacteria 27806
1288 nmdc:mga0k408_33886_c1 3300050493 Bacteria 2922
1289 nmdc:mga0k408_353822_c1 3300050493 Bacteria 875
1290 nmdc:mga0k408_36489_c1 3300050493 Bacteria 2822
1291 nmdc:mga0k408_38309_c1 3300050493 Bacteria 2751
1292 nmdc:mga0k408_4736_c1 3300050493 Bacteria 7209
1293 nmdc:mga0k408_58330_c1 3300050493 Bacteria 2242
1294 nmdc:mga0k408_60110_c1 3300050493 Bacteria 2208
1295 nmdc:mga0k408_61535_c1 3300050493 Bacteria 2182
1296 nmdc:mga0k408_7186_c1 3300050493 Bacteria 5952
1297 nmdc:mga0k408_7557_c1 3300050493 Bacteria 5806
1298 nmdc:mga06z11_132048_c1 3300050494 Bacteria 1403
1299 nmdc:mga06z11_149157_c1 3300050494 Bacteria 1328
1300 nmdc:mga06z11_154872_c1 3300050494 Bacteria 1306
1301 nmdc:mga06z11_257385_c1 3300050494 Bacteria 1029
1302 nmdc:mga06z11_523475_c1 3300050494 Bacteria 719
1303 nmdc:mga06z11_6097_c1 3300050494 Bacteria 4879
1304 nmdc:mga06z11_71471_c1 3300050494 Bacteria 1837
1305 nmdc:mga04h51_53128_c1 3300050495 Bacteria 1366
1306 nmdc:mga07m45_157481_c1 3300050496 Bacteria 1318
1307 nmdc:mga07m45_165333_c1 3300050496 Bacteria 1285
1308 nmdc:mga07m45_202_c1 3300050496 Bacteria 23538
1309 nmdc:mga07m45_2873_c1 3300050496 Bacteria 8162
1310 nmdc:mga07m45_299_c1 3300050496 Bacteria 20012
1311 nmdc:mga07m45_3013_c2 3300050496 Bacteria 3794
1312 nmdc:mga07m45_37512_c1 3300050496 Bacteria 2703
1313 nmdc:mga07m45_451045_c1 3300050496 Bacteria 746
1314 nmdc:mga07m45_5574_c1 3300050496 Bacteria 6283
1315 nmdc:mga07m45_7454_c1 3300050496 Bacteria 5594
1316 nmdc:mga07m45_9954_c1 3300050496 Bacteria 4949
1317 nmdc:mga09592_6905_c1 3300050508 Bacteria 9232
1318 nmdc:mga0qj67_485454_c1 3300050509 Bacteria 994
1319 Ga0495612_0043903 3300053078 Bacteria 1828
1320 Ga0500635_0000003 3300053080 Bacteria 216927
1321 Ga0495619_0131144 3300053085 Bacteria 1722
1322 Ga0495619_0720940 3300053085 Bacteria 677
1323 Ga0500644_0001962 3300053088 Bacteria 5250
1324 Ga0500644_0012871 3300053088 Bacteria 2324
1325 Ga0500646_0020574 3300053090 Bacteria 1753
1326 Ga0500651_0000024 3300053093 Bacteria 129450
1327 Ga0500651_0002535 3300053093 Bacteria 9686
1328 Ga0500651_0022441 3300053093 Bacteria 3942
1329 Ga0500566_0022570 3300053094 Bacteria 3697
1330 Ga0500566_0194079 3300053094 Bacteria 1031
1331 Ga0500650_0229769 3300053098 Bacteria 837
1332 Ga0500569_017007 3300053109 Bacteria 1852
1333 Ga0500571_000051 3300053110 Bacteria 35723
1334 Ga0500594_0000438 3300053118 Bacteria 9196
1335 Ga0500594_0023544 3300053118 Bacteria 1562
1336 Ga0500597_045680 3300053120 Bacteria 1853
1337 Ga0500608_144311 3300053122 Bacteria 1051
1338 Ga0500614_037736 3300053123 Bacteria 1214
1339 Ga0500623_131793 3300053127 Bacteria 1070
1340 Ga0500628_001903 3300053129 Bacteria 3513
1341 Ga0500628_013419 3300053129 Bacteria 1529
1342 Ga0500642_0004580 3300053130 Bacteria 4351
1343 Ga0500652_000824 3300053131 Bacteria 10329
1344 Ga0500652_020607 3300053131 Bacteria 2469
1345 Ga0500655_000309 3300053133 Bacteria 11087
1346 Ga0500655_005756 3300053133 Bacteria 2230
1347 Ga0500658_0001156 3300053134 Bacteria 10726
1348 Ga0500559_0000011 3300053136 Bacteria 164751
1349 Ga0500568_0005643 3300053139 Bacteria 6440
1350 Ga0500568_0021372 3300053139 Bacteria 2785
1351 Ga0500577_0037596 3300053142 Bacteria 1742
1352 Ga0500579_129131 3300053143 Bacteria 1190
1353 Ga0500590_089978 3300053148 Bacteria 1491
1354 Ga0500604_0114593 3300053151 Bacteria 897
1355 Ga0500616_0121851 3300053153 Bacteria 1245
1356 Ga0500619_000035 3300053154 Bacteria 41663
1357 Ga0500622_0000974 3300053156 Bacteria 24254
1358 Ga0500622_0001057 3300053156 Bacteria 22962
1359 Ga0500624_006130 3300053157 Bacteria 1620
1360 Ga0500634_0019452 3300053161 Bacteria 3658
1361 Ga0500634_0043046 3300053161 Bacteria 2449
1362 Ga0500636_0016831 3300053177 Bacteria 4311
1363 Ga0500636_0074749 3300053177 Bacteria 1961
1364 Ga0500645_000210 3300053730 Bacteria 44912
1365 Ga0500645_000489 3300053730 Bacteria 26784
1366 Ga0500645_000501 3300053730 Bacteria 26443
1367 Ga0500661_001805 3300055283 Bacteria 4034
1368 Ga0500661_009884 3300055283 Bacteria 1740
1369 Ga0590071_000508 3300059421 Bacteria 11379
1370 Ga0590075_046372 3300059424 Bacteria 1113
1371 Ga0590075_050115 3300059424 Bacteria 1071
1372 Ga0501082_0902416 3300060353 Bacteria 773
1373 Ga0466962_0010092 3300061719 Bacteria 4530
1374 Ga0466962_0506199 3300061719 Bacteria 611

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10240577 Ga0105245_102405772 166
2 3300005356 Ga0070674_100785591 Ga0070674_1007855911 172
3 3300025937 Ga0207669_10765960 Ga0207669_107659601 172
4 3300031239 Ga0265328_10010794 Ga0265328_100107943 174
5 3300031344 Ga0265316_10000115 Ga0265316_100001158 174
6 3300037471 Ga0395905_0018633 Ga0395905_0018633_1884_2450 174
7 3300038443 Ga0395901_0843729 Ga0395901_0843729_196_762 174
8 3300045051 Ga0451576_0719101 Ga0451576_0719101_271_837 174
9 3300045051 Ga0451576_1527780 Ga0451576_1527780_59_625 174
10 3300048911 Ga0496108_0466732 Ga0496108_0466732_325_891 174
11 3300048912 Ga0496109_0072463 Ga0496109_0072463_781_1347 174
12 3300048912 Ga0496109_0293333 Ga0496109_0293333_305_871 174
13 3300048914 Ga0496111_0425011 Ga0496111_0425011_189_755 174
14 3300031238 Ga0265332_10000003 Ga0265332_10000003147 176
15 3300003759 Ga0055525_1000013 Ga0055525_100001378 177
16 3300003792 Ga0055540_1015951 Ga0055540_10159514 177
17 3300005364 Ga0070673_100982161 Ga0070673_1009821612 177
18 3300009147 Ga0114129_10143287 Ga0114129_101432873 177
19 3300010375 Ga0105239_10881657 Ga0105239_108816571 177
20 3300021361 Ga0213872_10000354 Ga0213872_1000035414 177
21 3300021361 Ga0213872_10000496 Ga0213872_1000049615 177
22 3300021361 Ga0213872_10028967 Ga0213872_100289674 177
23 3300025230 Ga0209563_100025 Ga0209563_100025508 177
24 3300025303 Ga0209051_1000808 Ga0209051_100080817 177
25 3300031507 Ga0307509_10072514 Ga0307509_100725141 177
26 3300039447 Ga0436361_0315951 Ga0436361_0315951_16729_17292 177
27 3300039447 Ga0436361_0382345 Ga0436361_0382345_3173_3736 177
28 3300039447 Ga0436361_0502840 Ga0436361_0502840_673_1236 177
29 3300039447 Ga0436361_1025974 Ga0436361_1025974_720_1283 177
30 3300048911 Ga0496108_0631471 Ga0496108_0631471_175_738 177
31 3300048912 Ga0496109_0195971 Ga0496109_0195971_954_1517 177
32 3300049822 Ga0501035_0185222 Ga0501035_0185222_160_726 177
33 iso_pu_bacteria 2643221585 2643935496 177
34 iso_pu_bacteria 2643221656 2644317279 177
35 iso_pu_bacteria 2721755523 2722884484 177
36 3300002077 JGI24744J21845_10035852 JGI24744J21845_100358522 178
37 3300002704 JGI25155J39150_1000060 JGI25155J39150_100006046 178
38 3300002705 JGI25156J39149_1000090 JGI25156J39149_100009038 178
39 3300002705 JGI25156J39149_1000446 JGI25156J39149_100044623 178
40 3300002705 JGI25156J39149_1019495 JGI25156J39149_10194952 178
41 3300002738 JGI25154J39366_1000061 JGI25154J39366_100006176 178
42 3300002738 JGI25154J39366_1002660 JGI25154J39366_10026603 178
43 3300002741 JGI25157J39369_1000006 JGI25157J39369_1000006105 178
44 3300002741 JGI25157J39369_1000574 JGI25157J39369_10005743 178
45 3300002772 JGI25164J39214_1002617 JGI25164J39214_10026172 178
46 3300002773 JGI25152J39213_1000657 JGI25152J39213_10006572 178
47 3300002773 JGI25152J39213_1020505 JGI25152J39213_10205052 178
48 3300002774 JGI25150J39212_1001192 JGI25150J39212_10011923 178
49 3300002774 JGI25150J39212_1006586 JGI25150J39212_10065862 178
50 3300002774 JGI25150J39212_1011620 JGI25150J39212_10116202 178
51 3300002987 JGI25159J45721_1000203 JGI25159J45721_100020324 178
52 3300002987 JGI25159J45721_1003940 JGI25159J45721_10039403 178
53 3300002987 JGI25159J45721_1005644 JGI25159J45721_10056441 178
54 3300003215 JGI25153J46596_10004330 JGI25153J46596_100043303 178
55 3300003316 rootH1_10000544 rootH1_100005443 178
56 3300003316 rootH1_10005243 rootH1_100052432 178
57 3300003322 rootL2_10000757 rootL2_1000075753 178
58 3300003322 rootL2_10007392 rootL2_100073929 178
59 3300003322 rootL2_10025833 rootL2_100258336 178
60 3300003323 rootH1_10026981 rootH1_100269813 178
61 3300003323 rootH1_10071288 rootH1_100712882 178
62 3300003323 rootH1_10094745 rootH1_100947455 178
63 3300003347 JGI26128J50194_1000382 JGI26128J50194_10003823 178
64 3300003354 JGI25160J50197_1000071 JGI25160J50197_100007157 178
65 3300003371 JGI26145J50221_1004823 JGI26145J50221_10048231 178
66 3300003374 JGI25161J50226_1000030 JGI25161J50226_1000030110 178
67 3300003374 JGI25161J50226_1020127 JGI25161J50226_10201271 178
68 3300003752 Ga0055539_1001162 Ga0055539_10011621 178
69 3300003752 Ga0055539_1004241 Ga0055539_10042413 178
70 3300003752 Ga0055539_1012027 Ga0055539_10120272 178
71 3300003756 Ga0055533_1000011 Ga0055533_1000011147 178
72 3300003759 Ga0055525_1000903 Ga0055525_10009036 178
73 3300003761 Ga0055535_1000084 Ga0055535_100008457 178
74 3300003761 Ga0055535_1001649 Ga0055535_10016495 178
75 3300003762 Ga0055542_1000033 Ga0055542_1000033132 178
76 3300003763 Ga0055529_1000306 Ga0055529_100030616 178
77 3300003771 Ga0055526_1003627 Ga0055526_100362713 178
78 3300003771 Ga0055526_1004316 Ga0055526_10043163 178
79 3300003771 Ga0055526_1004665 Ga0055526_10046652 178
80 3300003771 Ga0055526_1007621 Ga0055526_10076212 178
81 3300003771 Ga0055526_1011709 Ga0055526_10117091 178
82 3300003775 Ga0055524_1000006 Ga0055524_1000006190 178
83 3300003781 Ga0055536_1003229 Ga0055536_10032294 178
84 3300003781 Ga0055536_1003340 Ga0055536_10033404 178
85 3300003781 Ga0055536_1012350 Ga0055536_10123503 178
86 3300003781 Ga0055536_1023112 Ga0055536_10231122 178
87 3300003781 Ga0055536_1068159 Ga0055536_10681592 178
88 3300003790 Ga0055528_1002771 Ga0055528_10027716 178
89 3300003791 Ga0055530_10000446 Ga0055530_100004468 178
90 3300003791 Ga0055530_10002347 Ga0055530_100023477 178
91 3300003791 Ga0055530_10005361 Ga0055530_100053614 178
92 3300003791 Ga0055530_10048831 Ga0055530_100488311 178
93 3300003792 Ga0055540_1000005 Ga0055540_1000005123 178
94 3300003792 Ga0055540_1001269 Ga0055540_10012692 178
95 3300003792 Ga0055540_1002903 Ga0055540_10029034 178
96 3300003792 Ga0055540_1017788 Ga0055540_10177883 178
97 3300003794 Ga0055531_10000254 Ga0055531_1000025423 178
98 3300003794 Ga0055531_10000636 Ga0055531_1000063616 178
99 3300003794 Ga0055531_10004337 Ga0055531_100043374 178
100 3300003794 Ga0055531_10008940 Ga0055531_100089402 178
101 3300003794 Ga0055531_10017770 Ga0055531_100177703 178
102 3300004625 Ga0055543_1000566 Ga0055543_10005661 178
103 3300004625 Ga0055543_1002143 Ga0055543_10021433 178
104 3300005262 Ga0065165_1000024 Ga0065165_1000024237 178
105 3300005262 Ga0065165_1000076 Ga0065165_100007626 178
106 3300005262 Ga0065165_1010071 Ga0065165_10100713 178
107 3300005262 Ga0065165_1010072 Ga0065165_10100721 178
108 3300005262 Ga0065165_1033896 Ga0065165_10338962 178
109 3300005288 Ga0065714_10072716 Ga0065714_100727163 178
110 3300005289 Ga0065704_10268953 Ga0065704_102689532 178
111 3300005290 Ga0065712_10351505 Ga0065712_103515051 178
112 3300005293 Ga0065715_10138494 Ga0065715_101384941 178
113 3300005293 Ga0065715_10384488 Ga0065715_103844882 178
114 3300005327 Ga0070658_10029546 Ga0070658_100295463 178
115 3300005327 Ga0070658_10056492 Ga0070658_100564922 178
116 3300005327 Ga0070658_10356417 Ga0070658_103564172 178
117 3300005328 Ga0070676_10003761 Ga0070676_100037617 178
118 3300005328 Ga0070676_10050188 Ga0070676_100501882 178
119 3300005329 Ga0070683_100077494 Ga0070683_1000774942 178
120 3300005329 Ga0070683_100257806 Ga0070683_1002578062 178
121 3300005330 Ga0070690_100010080 Ga0070690_1000100807 178
122 3300005330 Ga0070690_100032568 Ga0070690_1000325683 178
123 3300005331 Ga0070670_100015059 Ga0070670_1000150596 178
124 3300005331 Ga0070670_100112408 Ga0070670_1001124083 178
125 3300005331 Ga0070670_100149350 Ga0070670_1001493503 178
126 3300005331 Ga0070670_100428770 Ga0070670_1004287702 178
127 3300005333 Ga0070677_10141706 Ga0070677_101417062 178
128 3300005333 Ga0070677_10248663 Ga0070677_102486631 178
129 3300005334 Ga0068869_100004104 Ga0068869_1000041048 178
130 3300005334 Ga0068869_100034945 Ga0068869_1000349453 178
131 3300005334 Ga0068869_100213950 Ga0068869_1002139502 178
132 3300005335 Ga0070666_10005027 Ga0070666_100050273 178
133 3300005336 Ga0070680_100050945 Ga0070680_1000509452 178
134 3300005338 Ga0068868_100001107 Ga0068868_1000011073 178
135 3300005338 Ga0068868_100075949 Ga0068868_1000759493 178
136 3300005338 Ga0068868_100079635 Ga0068868_1000796352 178
137 3300005338 Ga0068868_100091066 Ga0068868_1000910664 178
138 3300005338 Ga0068868_100539615 Ga0068868_1005396151 178
139 3300005339 Ga0070660_100078318 Ga0070660_1000783183 178
140 3300005339 Ga0070660_100120415 Ga0070660_1001204154 178
141 3300005340 Ga0070689_100025603 Ga0070689_1000256033 178
142 3300005340 Ga0070689_100259171 Ga0070689_1002591712 178
143 3300005343 Ga0070687_100515069 Ga0070687_1005150691 178
144 3300005344 Ga0070661_100000913 Ga0070661_10000091322 178
145 3300005344 Ga0070661_100190810 Ga0070661_1001908102 178
146 3300005347 Ga0070668_100014374 Ga0070668_1000143748 178
147 3300005347 Ga0070668_100204637 Ga0070668_1002046372 178
148 3300005353 Ga0070669_100002267 Ga0070669_10000226710 178
149 3300005353 Ga0070669_100090749 Ga0070669_1000907493 178
150 3300005353 Ga0070669_100294627 Ga0070669_1002946271 178
151 3300005354 Ga0070675_100002227 Ga0070675_10000222716 178
152 3300005354 Ga0070675_100049735 Ga0070675_1000497354 178
153 3300005354 Ga0070675_100161327 Ga0070675_1001613272 178
154 3300005355 Ga0070671_100014404 Ga0070671_1000144045 178
155 3300005355 Ga0070671_100020422 Ga0070671_1000204226 178
156 3300005355 Ga0070671_100027479 Ga0070671_1000274795 178
157 3300005355 Ga0070671_100063154 Ga0070671_1000631543 178
158 3300005355 Ga0070671_100119561 Ga0070671_1001195612 178
159 3300005355 Ga0070671_100162656 Ga0070671_1001626562 178
160 3300005355 Ga0070671_100182144 Ga0070671_1001821442 178
161 3300005355 Ga0070671_100201544 Ga0070671_1002015442 178
162 3300005355 Ga0070671_100336480 Ga0070671_1003364802 178
163 3300005355 Ga0070671_100400835 Ga0070671_1004008352 178
164 3300005355 Ga0070671_100877957 Ga0070671_1008779571 178
165 3300005356 Ga0070674_100007082 Ga0070674_1000070824 178
166 3300005356 Ga0070674_100036182 Ga0070674_1000361824 178
167 3300005356 Ga0070674_100067910 Ga0070674_1000679103 178
168 3300005356 Ga0070674_100151580 Ga0070674_1001515803 178
169 3300005356 Ga0070674_100468161 Ga0070674_1004681612 178
170 3300005364 Ga0070673_100002560 Ga0070673_1000025604 178
171 3300005364 Ga0070673_100005364 Ga0070673_10000536410 178
172 3300005364 Ga0070673_100041899 Ga0070673_1000418991 178
173 3300005364 Ga0070673_100078662 Ga0070673_1000786622 178
174 3300005364 Ga0070673_100083124 Ga0070673_1000831243 178
175 3300005364 Ga0070673_100097421 Ga0070673_1000974213 178
176 3300005364 Ga0070673_100119712 Ga0070673_1001197122 178
177 3300005365 Ga0070688_100763308 Ga0070688_1007633081 178
178 3300005366 Ga0070659_100007755 Ga0070659_1000077555 178
179 3300005366 Ga0070659_100395079 Ga0070659_1003950791 178
180 3300005366 Ga0070659_100484617 Ga0070659_1004846172 178
181 3300005366 Ga0070659_100791063 Ga0070659_1007910631 178
182 3300005367 Ga0070667_100000558 Ga0070667_1000005585 178
183 3300005367 Ga0070667_100002446 Ga0070667_10000244614 178
184 3300005367 Ga0070667_100006752 Ga0070667_1000067528 178
185 3300005367 Ga0070667_100204508 Ga0070667_1002045082 178
186 3300005441 Ga0070700_100024061 Ga0070700_1000240613 178
187 3300005445 Ga0070708_100149153 Ga0070708_1001491532 178
188 3300005445 Ga0070708_100438633 Ga0070708_1004386332 178
189 3300005455 Ga0070663_100000823 Ga0070663_10000082315 178
190 3300005455 Ga0070663_100525373 Ga0070663_1005253732 178
191 3300005456 Ga0070678_100001192 Ga0070678_10000119213 178
192 3300005456 Ga0070678_100003107 Ga0070678_10000310712 178
193 3300005456 Ga0070678_100033765 Ga0070678_1000337653 178
194 3300005456 Ga0070678_100072669 Ga0070678_1000726693 178
195 3300005456 Ga0070678_100075202 Ga0070678_1000752023 178
196 3300005456 Ga0070678_100093756 Ga0070678_1000937563 178
197 3300005457 Ga0070662_100069882 Ga0070662_1000698822 178
198 3300005457 Ga0070662_100156369 Ga0070662_1001563692 178
199 3300005457 Ga0070662_100403410 Ga0070662_1004034102 178
200 3300005458 Ga0070681_10085061 Ga0070681_100850613 178
201 3300005458 Ga0070681_11058395 Ga0070681_110583951 178
202 3300005459 Ga0068867_100000048 Ga0068867_10000004846 178
203 3300005459 Ga0068867_100007404 Ga0068867_1000074042 178
204 3300005459 Ga0068867_100011068 Ga0068867_1000110683 178
205 3300005459 Ga0068867_100013726 Ga0068867_1000137264 178
206 3300005459 Ga0068867_100150041 Ga0068867_1001500413 178
207 3300005459 Ga0068867_100360054 Ga0068867_1003600542 178
208 3300005466 Ga0070685_10024014 Ga0070685_100240142 178
209 3300005466 Ga0070685_10108274 Ga0070685_101082742 178
210 3300005467 Ga0070706_100000774 Ga0070706_10000077421 178
211 3300005468 Ga0070707_100085399 Ga0070707_1000853992 178
212 3300005471 Ga0070698_100040093 Ga0070698_1000400937 178
213 3300005530 Ga0070679_100011754 Ga0070679_1000117543 178
214 3300005530 Ga0070679_100046985 Ga0070679_1000469853 178
215 3300005530 Ga0070679_100059287 Ga0070679_1000592872 178
216 3300005535 Ga0070684_100006585 Ga0070684_1000065856 178
217 3300005539 Ga0068853_100021739 Ga0068853_1000217392 178
218 3300005539 Ga0068853_100113834 Ga0068853_1001138344 178
219 3300005539 Ga0068853_100181940 Ga0068853_1001819403 178
220 3300005539 Ga0068853_100481012 Ga0068853_1004810122 178
221 3300005539 Ga0068853_100573972 Ga0068853_1005739722 178
222 3300005543 Ga0070672_100014873 Ga0070672_1000148733 178
223 3300005543 Ga0070672_100042207 Ga0070672_1000422073 178
224 3300005543 Ga0070672_100124619 Ga0070672_1001246192 178
225 3300005543 Ga0070672_100133094 Ga0070672_1001330942 178
226 3300005543 Ga0070672_100221664 Ga0070672_1002216642 178
227 3300005543 Ga0070672_100269444 Ga0070672_1002694442 178
228 3300005547 Ga0070693_100125650 Ga0070693_1001256502 178
229 3300005548 Ga0070665_100020551 Ga0070665_1000205518 178
230 3300005548 Ga0070665_100271196 Ga0070665_1002711962 178
231 3300005563 Ga0068855_100019410 Ga0068855_1000194107 178
232 3300005563 Ga0068855_100030912 Ga0068855_1000309123 178
233 3300005563 Ga0068855_100173411 Ga0068855_1001734113 178
234 3300005563 Ga0068855_100358734 Ga0068855_1003587343 178
235 3300005564 Ga0070664_100000282 Ga0070664_10000028211 178
236 3300005564 Ga0070664_100015244 Ga0070664_1000152443 178
237 3300005564 Ga0070664_100151346 Ga0070664_1001513463 178
238 3300005564 Ga0070664_100165027 Ga0070664_1001650272 178
239 3300005564 Ga0070664_100424815 Ga0070664_1004248152 178
240 3300005577 Ga0068857_100003322 Ga0068857_1000033221 178
241 3300005577 Ga0068857_100378163 Ga0068857_1003781632 178
242 3300005578 Ga0068854_100019180 Ga0068854_1000191804 178
243 3300005578 Ga0068854_100044202 Ga0068854_1000442023 178
244 3300005578 Ga0068854_100091076 Ga0068854_1000910762 178
245 3300005578 Ga0068854_100508371 Ga0068854_1005083711 178
246 3300005578 Ga0068854_100562155 Ga0068854_1005621552 178
247 3300005578 Ga0068854_100902107 Ga0068854_1009021071 178
248 3300005614 Ga0068856_100000686 Ga0068856_1000006866 178
249 3300005614 Ga0068856_100097570 Ga0068856_1000975702 178
250 3300005614 Ga0068856_100180712 Ga0068856_1001807122 178
251 3300005614 Ga0068856_101284807 Ga0068856_1012848071 178
252 3300005615 Ga0070702_100144168 Ga0070702_1001441682 178
253 3300005616 Ga0068852_100062991 Ga0068852_1000629912 178
254 3300005616 Ga0068852_100106095 Ga0068852_1001060953 178
255 3300005616 Ga0068852_100440860 Ga0068852_1004408602 178
256 3300005616 Ga0068852_100499820 Ga0068852_1004998202 178
257 3300005616 Ga0068852_100573368 Ga0068852_1005733681 178
258 3300005617 Ga0068859_100016554 Ga0068859_1000165543 178
259 3300005617 Ga0068859_100028793 Ga0068859_1000287938 178
260 3300005617 Ga0068859_100048826 Ga0068859_1000488264 178
261 3300005617 Ga0068859_100073274 Ga0068859_1000732743 178
262 3300005618 Ga0068864_100002807 Ga0068864_1000028073 178
263 3300005618 Ga0068864_100020328 Ga0068864_1000203284 178
264 3300005618 Ga0068864_100028924 Ga0068864_1000289244 178
265 3300005618 Ga0068864_100114994 Ga0068864_1001149943 178
266 3300005618 Ga0068864_100172842 Ga0068864_1001728422 178
267 3300005618 Ga0068864_100175368 Ga0068864_1001753683 178
268 3300005618 Ga0068864_100698866 Ga0068864_1006988662 178
269 3300005718 Ga0068866_10006943 Ga0068866_100069436 178
270 3300005718 Ga0068866_10011759 Ga0068866_100117592 178
271 3300005718 Ga0068866_10181828 Ga0068866_101818282 178
272 3300005719 Ga0068861_100006804 Ga0068861_10000680411 178
273 3300005719 Ga0068861_100017152 Ga0068861_1000171523 178
274 3300005834 Ga0068851_10007694 Ga0068851_100076943 178
275 3300005834 Ga0068851_10034428 Ga0068851_100344284 178
276 3300005834 Ga0068851_10035492 Ga0068851_100354922 178
277 3300005834 Ga0068851_10087439 Ga0068851_100874392 178
278 3300005840 Ga0068870_10261681 Ga0068870_102616812 178
279 3300005840 Ga0068870_10558751 Ga0068870_105587511 178
280 3300005841 Ga0068863_100017712 Ga0068863_1000177125 178
281 3300005841 Ga0068863_100040341 Ga0068863_1000403413 178
282 3300005841 Ga0068863_100281378 Ga0068863_1002813782 178
283 3300005841 Ga0068863_100464468 Ga0068863_1004644682 178
284 3300005842 Ga0068858_100002948 Ga0068858_1000029483 178
285 3300005842 Ga0068858_100015770 Ga0068858_1000157705 178
286 3300005843 Ga0068860_100000524 Ga0068860_10000052448 178
287 3300005843 Ga0068860_100014939 Ga0068860_1000149394 178
288 3300005843 Ga0068860_100239250 Ga0068860_1002392502 178
289 3300005843 Ga0068860_100272332 Ga0068860_1002723322 178
290 3300005844 Ga0068862_100028727 Ga0068862_1000287275 178
291 3300005844 Ga0068862_100033542 Ga0068862_1000335422 178
292 3300005844 Ga0068862_100056196 Ga0068862_1000561963 178
293 3300005844 Ga0068862_100089601 Ga0068862_1000896013 178
294 3300005937 Ga0081455_10049895 Ga0081455_100498955 178
295 3300006038 Ga0075365_10004475 Ga0075365_100044757 178
296 3300006038 Ga0075365_10027584 Ga0075365_100275844 178
297 3300006038 Ga0075365_10171385 Ga0075365_101713852 178
298 3300006038 Ga0075365_10311035 Ga0075365_103110352 178
299 3300006042 Ga0075368_10001001 Ga0075368_100010019 178
300 3300006048 Ga0075363_100000527 Ga0075363_1000005273 178
301 3300006048 Ga0075363_100085262 Ga0075363_1000852622 178
302 3300006051 Ga0075364_10446391 Ga0075364_104463912 178
303 3300006058 Ga0075432_10002462 Ga0075432_100024622 178
304 3300006177 Ga0075362_10005340 Ga0075362_100053402 178
305 3300006177 Ga0075362_10082489 Ga0075362_100824892 178
306 3300006178 Ga0075367_10008057 Ga0075367_100080572 178
307 3300006178 Ga0075367_10008095 Ga0075367_100080952 178
308 3300006178 Ga0075367_10029539 Ga0075367_100295391 178
309 3300006178 Ga0075367_10039733 Ga0075367_100397333 178
310 3300006178 Ga0075367_10054621 Ga0075367_100546213 178
311 3300006178 Ga0075367_10074012 Ga0075367_100740123 178
312 3300006178 Ga0075367_10240091 Ga0075367_102400912 178
313 3300006178 Ga0075367_10338594 Ga0075367_103385942 178
314 3300006186 Ga0075369_10029119 Ga0075369_100291193 178
315 3300006186 Ga0075369_10047505 Ga0075369_100475052 178
316 3300006195 Ga0075366_10003151 Ga0075366_100031512 178
317 3300006195 Ga0075366_10007517 Ga0075366_100075173 178
318 3300006195 Ga0075366_10008186 Ga0075366_100081865 178
319 3300006195 Ga0075366_10008213 Ga0075366_100082133 178
320 3300006195 Ga0075366_10019512 Ga0075366_100195125 178
321 3300006195 Ga0075366_10036116 Ga0075366_100361163 178
322 3300006195 Ga0075366_10041313 Ga0075366_100413133 178
323 3300006195 Ga0075366_10060919 Ga0075366_100609193 178
324 3300006195 Ga0075366_10102326 Ga0075366_101023262 178
325 3300006195 Ga0075366_10163882 Ga0075366_101638822 178
326 3300006195 Ga0075366_10269044 Ga0075366_102690441 178
327 3300006237 Ga0097621_100053922 Ga0097621_1000539223 178
328 3300006237 Ga0097621_100091208 Ga0097621_1000912083 178
329 3300006237 Ga0097621_100243696 Ga0097621_1002436961 178
330 3300006237 Ga0097621_100486869 Ga0097621_1004868692 178
331 3300006237 Ga0097621_100649335 Ga0097621_1006493352 178
332 3300006353 Ga0075370_10005989 Ga0075370_100059893 178
333 3300006353 Ga0075370_10006507 Ga0075370_100065074 178
334 3300006353 Ga0075370_10006767 Ga0075370_100067673 178
335 3300006353 Ga0075370_10007526 Ga0075370_100075262 178
336 3300006353 Ga0075370_10008461 Ga0075370_100084614 178
337 3300006353 Ga0075370_10009708 Ga0075370_100097086 178
338 3300006353 Ga0075370_10014180 Ga0075370_100141802 178
339 3300006353 Ga0075370_10075172 Ga0075370_100751722 178
340 3300006353 Ga0075370_10283283 Ga0075370_102832832 178
341 3300006353 Ga0075370_10409557 Ga0075370_104095572 178
342 3300006358 Ga0068871_100015012 Ga0068871_1000150125 178
343 3300006358 Ga0068871_100053399 Ga0068871_1000533994 178
344 3300006358 Ga0068871_100181401 Ga0068871_1001814013 178
345 3300006358 Ga0068871_100528012 Ga0068871_1005280122 178
346 3300006844 Ga0075428_100349496 Ga0075428_1003494962 178
347 3300006844 Ga0075428_100564817 Ga0075428_1005648172 178
348 3300006846 Ga0075430_100171601 Ga0075430_1001716011 178
349 3300006880 Ga0075429_100373744 Ga0075429_1003737441 178
350 3300006881 Ga0068865_100015592 Ga0068865_1000155923 178
351 3300006881 Ga0068865_100115666 Ga0068865_1001156663 178
352 3300006881 Ga0068865_100520457 Ga0068865_1005204571 178
353 3300006881 Ga0068865_100618087 Ga0068865_1006180871 178
354 3300006931 Ga0097620_100016554 Ga0097620_1000165543 178
355 3300006931 Ga0097620_100028793 Ga0097620_1000287932 178
356 3300006931 Ga0097620_100048825 Ga0097620_1000488253 178
357 3300006931 Ga0097620_100073277 Ga0097620_1000732773 178
358 3300006944 Ga0099823_1000769 Ga0099823_100076921 178
359 3300009036 Ga0105244_10003895 Ga0105244_100038956 178
360 3300009093 Ga0105240_10002994 Ga0105240_1000299420 178
361 3300009093 Ga0105240_10003519 Ga0105240_100035195 178
362 3300009093 Ga0105240_10146167 Ga0105240_101461673 178
363 3300009093 Ga0105240_10428881 Ga0105240_104288812 178
364 3300009098 Ga0105245_10057323 Ga0105245_100573234 178
365 3300009098 Ga0105245_10066044 Ga0105245_100660443 178
366 3300009098 Ga0105245_10485001 Ga0105245_104850012 178
367 3300009098 Ga0105245_11556127 Ga0105245_115561271 178
368 3300009148 Ga0105243_10002013 Ga0105243_1000201318 178
369 3300009148 Ga0105243_10004862 Ga0105243_1000486210 178
370 3300009148 Ga0105243_10032690 Ga0105243_100326903 178
371 3300009148 Ga0105243_10230660 Ga0105243_102306602 178
372 3300009148 Ga0105243_10249258 Ga0105243_102492582 178
373 3300009174 Ga0105241_10125305 Ga0105241_101253052 178
374 3300009176 Ga0105242_10026946 Ga0105242_100269461 178
375 3300009176 Ga0105242_10258681 Ga0105242_102586812 178
376 3300009176 Ga0105242_10653349 Ga0105242_106533491 178
377 3300009177 Ga0105248_10047810 Ga0105248_100478103 178
378 3300009177 Ga0105248_10059405 Ga0105248_100594053 178
379 3300009177 Ga0105248_10073255 Ga0105248_100732553 178
380 3300009177 Ga0105248_10216044 Ga0105248_102160441 178
381 3300009177 Ga0105248_10431456 Ga0105248_104314562 178
382 3300009177 Ga0105248_10454554 Ga0105248_104545542 178
383 3300009545 Ga0105237_10000373 Ga0105237_1000037326 178
384 3300009545 Ga0105237_10092611 Ga0105237_100926113 178
385 3300009545 Ga0105237_10467623 Ga0105237_104676232 178
386 3300009545 Ga0105237_10506604 Ga0105237_105066042 178
387 3300009551 Ga0105238_10034361 Ga0105238_100343615 178
388 3300009551 Ga0105238_10100161 Ga0105238_101001612 178
389 3300009551 Ga0105238_10635581 Ga0105238_106355812 178
390 3300009551 Ga0105238_10645309 Ga0105238_106453092 178
391 3300009553 Ga0105249_10112011 Ga0105249_101120112 178
392 3300009553 Ga0105249_10156143 Ga0105249_101561432 178
393 3300009553 Ga0105249_10184195 Ga0105249_101841953 178
394 3300009553 Ga0105249_10269005 Ga0105249_102690052 178
395 3300010375 Ga0105239_10000153 Ga0105239_1000015322 178
396 3300010375 Ga0105239_10065796 Ga0105239_100657964 178
397 3300010375 Ga0105239_10638552 Ga0105239_106385522 178
398 3300010375 Ga0105239_10741747 Ga0105239_107417472 178
399 3300011119 Ga0105246_10016278 Ga0105246_100162783 178
400 3300011119 Ga0105246_10407444 Ga0105246_104074442 178
401 3300011119 Ga0105246_10803278 Ga0105246_108032782 178
402 3300012475 Ga0157317_1008911 Ga0157317_10089111 178
403 3300012497 Ga0157319_1000051 Ga0157319_100005114 178
404 3300013100 Ga0157373_10488174 Ga0157373_104881742 178
405 3300013102 Ga0157371_10162956 Ga0157371_101629561 178
406 3300013102 Ga0157371_10498939 Ga0157371_104989391 178
407 3300013104 Ga0157370_11019640 Ga0157370_110196402 178
408 3300013105 Ga0157369_10004791 Ga0157369_100047914 178
409 3300013105 Ga0157369_10495143 Ga0157369_104951431 178
410 3300013296 Ga0157374_10077081 Ga0157374_100770812 178
411 3300013296 Ga0157374_10091368 Ga0157374_100913683 178
412 3300013296 Ga0157374_10119941 Ga0157374_101199413 178
413 3300013297 Ga0157378_10002312 Ga0157378_100023123 178
414 3300013297 Ga0157378_10061950 Ga0157378_100619504 178
415 3300013297 Ga0157378_10168586 Ga0157378_101685863 178
416 3300013297 Ga0157378_11164734 Ga0157378_111647341 178
417 3300013306 Ga0163162_10003717 Ga0163162_100037174 178
418 3300013306 Ga0163162_10008368 Ga0163162_1000836810 178
419 3300013306 Ga0163162_10017839 Ga0163162_100178395 178
420 3300013306 Ga0163162_10085186 Ga0163162_100851863 178
421 3300013306 Ga0163162_10110354 Ga0163162_101103543 178
422 3300013306 Ga0163162_10145491 Ga0163162_101454912 178
423 3300013306 Ga0163162_10400644 Ga0163162_104006442 178
424 3300013306 Ga0163162_10514644 Ga0163162_105146442 178
425 3300013306 Ga0163162_11271222 Ga0163162_112712221 178
426 3300013307 Ga0157372_10114535 Ga0157372_101145352 178
427 3300013307 Ga0157372_10294396 Ga0157372_102943962 178
428 3300013307 Ga0157372_10368036 Ga0157372_103680362 178
429 3300013307 Ga0157372_11184716 Ga0157372_111847162 178
430 3300013308 Ga0157375_10022181 Ga0157375_100221813 178
431 3300013308 Ga0157375_10066799 Ga0157375_100667994 178
432 3300013308 Ga0157375_10305370 Ga0157375_103053703 178
433 3300013308 Ga0157375_10448713 Ga0157375_104487131 178
434 3300013308 Ga0157375_10735456 Ga0157375_107354562 178
435 3300014325 Ga0163163_10005658 Ga0163163_1000565814 178
436 3300014325 Ga0163163_10349873 Ga0163163_103498732 178
437 3300014325 Ga0163163_11317779 Ga0163163_113177791 178
438 3300014326 Ga0157380_10046314 Ga0157380_100463142 178
439 3300014326 Ga0157380_10124121 Ga0157380_101241213 178
440 3300014326 Ga0157380_10211411 Ga0157380_102114113 178
441 3300014326 Ga0157380_10361832 Ga0157380_103618322 178
442 3300014326 Ga0157380_10632274 Ga0157380_106322741 178
443 3300014326 Ga0157380_10971067 Ga0157380_109710672 178
444 3300014497 Ga0182008_10004585 Ga0182008_100045853 178
445 3300014497 Ga0182008_10013739 Ga0182008_100137391 178
446 3300014745 Ga0157377_10000056 Ga0157377_1000005636 178
447 3300014968 Ga0157379_10008560 Ga0157379_100085602 178
448 3300014968 Ga0157379_10026383 Ga0157379_100263833 178
449 3300014968 Ga0157379_10139011 Ga0157379_101390112 178
450 3300014968 Ga0157379_10320740 Ga0157379_103207401 178
451 3300014968 Ga0157379_10497823 Ga0157379_104978232 178
452 3300014968 Ga0157379_10873065 Ga0157379_108730652 178
453 3300014969 Ga0157376_10004932 Ga0157376_100049326 178
454 3300014969 Ga0157376_10642253 Ga0157376_106422532 178
455 3300014969 Ga0157376_11118535 Ga0157376_111185351 178
456 3300015261 Ga0182006_1004724 Ga0182006_10047245 178
457 3300015261 Ga0182006_1064109 Ga0182006_10641091 178
458 3300015262 Ga0182007_10000940 Ga0182007_1000094019 178
459 3300015262 Ga0182007_10001688 Ga0182007_100016888 178
460 3300015262 Ga0182007_10195197 Ga0182007_101951971 178
461 3300015265 Ga0182005_1077544 Ga0182005_10775442 178
462 3300017792 Ga0163161_10025431 Ga0163161_100254314 178
463 3300017792 Ga0163161_10030741 Ga0163161_100307413 178
464 3300017792 Ga0163161_10383246 Ga0163161_103832462 178
465 3300021361 Ga0213872_10000236 Ga0213872_100002367 178
466 3300021361 Ga0213872_10025704 Ga0213872_100257043 178
467 3300025206 Ga0209435_100001 Ga0209435_100001142 178
468 3300025208 Ga0209436_115643 Ga0209436_1156432 178
469 3300025226 Ga0209674_100003 Ga0209674_100003449 178
470 3300025228 Ga0209672_100228 Ga0209672_1002283 178
471 3300025228 Ga0209672_102765 Ga0209672_1027654 178
472 3300025229 Ga0209147_107112 Ga0209147_1071122 178
473 3300025230 Ga0209563_100010 Ga0209563_100010178 178
474 3300025231 Ga0207427_101838 Ga0207427_1018385 178
475 3300025242 Ga0209258_100089 Ga0209258_100089131 178
476 3300025242 Ga0209258_100162 Ga0209258_1001625 178
477 3300025242 Ga0209258_100601 Ga0209258_10060125 178
478 3300025245 Ga0207425_1000744 Ga0207425_100074415 178
479 3300025245 Ga0207425_1001690 Ga0207425_10016905 178
480 3300025245 Ga0207425_1002357 Ga0207425_10023572 178
481 3300025245 Ga0207425_1006971 Ga0207425_10069713 178
482 3300025246 Ga0209646_1000001 Ga0209646_1000001511 178
483 3300025246 Ga0209646_1000142 Ga0209646_100014284 178
484 3300025250 Ga0209026_1000003 Ga0209026_1000003142 178
485 3300025250 Ga0209026_1000027 Ga0209026_100002784 178
486 3300025250 Ga0209026_1017368 Ga0209026_10173682 178
487 3300025253 Ga0209677_100083 Ga0209677_10008356 178
488 3300025253 Ga0209677_100154 Ga0209677_10015414 178
489 3300025253 Ga0209677_100929 Ga0209677_10092912 178
490 3300025254 Ga0209148_1000097 Ga0209148_1000097131 178
491 3300025256 Ga0209759_1000001 Ga0209759_1000001142 178
492 3300025256 Ga0209759_1000240 Ga0209759_10002407 178
493 3300025256 Ga0209759_1001021 Ga0209759_100102119 178
494 3300025256 Ga0209759_1002002 Ga0209759_10020023 178
495 3300025256 Ga0209759_1006796 Ga0209759_10067962 178
496 3300025258 Ga0209129_1000025 Ga0209129_1000025122 178
497 3300025258 Ga0209129_1000033 Ga0209129_1000033201 178
498 3300025258 Ga0209129_1008754 Ga0209129_10087542 178
499 3300025258 Ga0209129_1011842 Ga0209129_10118422 178
500 3300025263 Ga0209565_1000004 Ga0209565_100000427 178
501 3300025263 Ga0209565_1000626 Ga0209565_100062617 178
502 3300025263 Ga0209565_1000828 Ga0209565_10008283 178
503 3300025263 Ga0209565_1022326 Ga0209565_10223262 178
504 3300025272 Ga0209455_1000128 Ga0209455_1000128143 178
505 3300025273 Ga0209673_1000372 Ga0209673_100037287 178
506 3300025273 Ga0209673_1000450 Ga0209673_10004506 178
507 3300025273 Ga0209673_1007083 Ga0209673_10070831 178
508 3300025273 Ga0209673_1007737 Ga0209673_10077376 178
509 3300025273 Ga0209673_1016574 Ga0209673_10165742 178
510 3300025273 Ga0209673_1041361 Ga0209673_10413612 178
511 3300025284 Ga0209130_1000060 Ga0209130_100006073 178
512 3300025284 Ga0209130_1000105 Ga0209130_100010520 178
513 3300025284 Ga0209130_1000114 Ga0209130_100011425 178
514 3300025284 Ga0209130_1000615 Ga0209130_10006156 178
515 3300025284 Ga0209130_1004346 Ga0209130_10043463 178
516 3300025291 Ga0209675_1000096 Ga0209675_1000096124 178
517 3300025291 Ga0209675_1001018 Ga0209675_10010183 178
518 3300025291 Ga0209675_1001425 Ga0209675_100142518 178
519 3300025291 Ga0209675_1002059 Ga0209675_10020599 178
520 3300025291 Ga0209675_1002439 Ga0209675_10024393 178
521 3300025292 Ga0209676_1000007 Ga0209676_1000007573 178
522 3300025292 Ga0209676_1000179 Ga0209676_1000179130 178
523 3300025292 Ga0209676_1000624 Ga0209676_100062467 178
524 3300025292 Ga0209676_1005017 Ga0209676_10050172 178
525 3300025292 Ga0209676_1006159 Ga0209676_10061594 178
526 3300025294 Ga0209025_1000221 Ga0209025_100022120 178
527 3300025294 Ga0209025_1012320 Ga0209025_10123205 178
528 3300025294 Ga0209025_1015340 Ga0209025_10153404 178
529 3300025294 Ga0209025_1018086 Ga0209025_10180862 178
530 3300025294 Ga0209025_1027824 Ga0209025_10278242 178
531 3300025294 Ga0209025_1065738 Ga0209025_10657381 178
532 3300025294 Ga0209025_1117694 Ga0209025_11176942 178
533 3300025295 Ga0209564_1000005 Ga0209564_1000005817 178
534 3300025295 Ga0209564_1000039 Ga0209564_1000039122 178
535 3300025295 Ga0209564_1000151 Ga0209564_100015149 178
536 3300025295 Ga0209564_1000246 Ga0209564_100024655 178
537 3300025295 Ga0209564_1000495 Ga0209564_100049518 178
538 3300025295 Ga0209564_1000677 Ga0209564_100067750 178
539 3300025295 Ga0209564_1006113 Ga0209564_10061135 178
540 3300025297 Ga0209758_1000027 Ga0209758_1000027201 178
541 3300025297 Ga0209758_1000196 Ga0209758_10001963 178
542 3300025297 Ga0209758_1034255 Ga0209758_10342552 178
543 3300025297 Ga0209758_1050722 Ga0209758_10507222 178
544 3300025298 Ga0209050_1000003 Ga0209050_1000003935 178
545 3300025298 Ga0209050_1000172 Ga0209050_100017221 178
546 3300025298 Ga0209050_1003833 Ga0209050_10038336 178
547 3300025298 Ga0209050_1009307 Ga0209050_10093074 178
548 3300025298 Ga0209050_1009881 Ga0209050_10098814 178
549 3300025298 Ga0209050_1022647 Ga0209050_10226472 178
550 3300025299 Ga0209256_1000001 Ga0209256_1000001941 178
551 3300025299 Ga0209256_1000069 Ga0209256_1000069166 178
552 3300025299 Ga0209256_1000161 Ga0209256_100016187 178
553 3300025299 Ga0209256_1008436 Ga0209256_10084362 178
554 3300025299 Ga0209256_1030237 Ga0209256_10302372 178
555 3300025302 Ga0207426_1000027 Ga0207426_1000027161 178
556 3300025302 Ga0207426_1000115 Ga0207426_100011520 178
557 3300025302 Ga0207426_1000308 Ga0207426_10003088 178
558 3300025302 Ga0207426_1004804 Ga0207426_10048045 178
559 3300025303 Ga0209051_1000003 Ga0209051_1000003935 178
560 3300025303 Ga0209051_1000046 Ga0209051_100004621 178
561 3300025303 Ga0209051_1000055 Ga0209051_100005555 178
562 3300025303 Ga0209051_1000971 Ga0209051_100097123 178
563 3300025303 Ga0209051_1001642 Ga0209051_10016427 178
564 3300025303 Ga0209051_1027305 Ga0209051_10273052 178
565 3300025304 Ga0209257_1000020 Ga0209257_1000020573 178
566 3300025304 Ga0209257_1000101 Ga0209257_100010129 178
567 3300025304 Ga0209257_1000281 Ga0209257_100028186 178
568 3300025304 Ga0209257_1001146 Ga0209257_100114647 178
569 3300025304 Ga0209257_1002049 Ga0209257_10020496 178
570 3300025304 Ga0209257_1005295 Ga0209257_10052956 178
571 3300025304 Ga0209257_1043372 Ga0209257_10433722 178
572 3300025304 Ga0209257_1047666 Ga0209257_10476662 178
573 3300025315 Ga0207697_10008136 Ga0207697_100081362 178
574 3300025321 Ga0207656_10011149 Ga0207656_100111493 178
575 3300025321 Ga0207656_10017313 Ga0207656_100173133 178
576 3300025321 Ga0207656_10061200 Ga0207656_100612002 178
577 3300025321 Ga0207656_10125001 Ga0207656_101250012 178
578 3300025728 Ga0207655_1000566 Ga0207655_100056612 178
579 3300025893 Ga0207682_10004030 Ga0207682_100040306 178
580 3300025893 Ga0207682_10032112 Ga0207682_100321122 178
581 3300025893 Ga0207682_10035708 Ga0207682_100357081 178
582 3300025899 Ga0207642_10003492 Ga0207642_100034923 178
583 3300025899 Ga0207642_10028660 Ga0207642_100286603 178
584 3300025899 Ga0207642_10111466 Ga0207642_101114662 178
585 3300025901 Ga0207688_10071922 Ga0207688_100719222 178
586 3300025901 Ga0207688_10073246 Ga0207688_100732462 178
587 3300025901 Ga0207688_10115706 Ga0207688_101157062 178
588 3300025901 Ga0207688_10206683 Ga0207688_102066832 178
589 3300025903 Ga0207680_10007763 Ga0207680_100077637 178
590 3300025907 Ga0207645_10005522 Ga0207645_1000552210 178
591 3300025907 Ga0207645_10216721 Ga0207645_102167212 178
592 3300025907 Ga0207645_10314972 Ga0207645_103149722 178
593 3300025907 Ga0207645_10370676 Ga0207645_103706761 178
594 3300025907 Ga0207645_10426018 Ga0207645_104260182 178
595 3300025908 Ga0207643_10045044 Ga0207643_100450441 178
596 3300025909 Ga0207705_10162819 Ga0207705_101628191 178
597 3300025909 Ga0207705_10259472 Ga0207705_102594721 178
598 3300025909 Ga0207705_10287483 Ga0207705_102874832 178
599 3300025909 Ga0207705_10382976 Ga0207705_103829762 178
600 3300025910 Ga0207684_10006187 Ga0207684_1000618710 178
601 3300025913 Ga0207695_10012332 Ga0207695_100123326 178
602 3300025913 Ga0207695_10131491 Ga0207695_101314912 178
603 3300025914 Ga0207671_10003108 Ga0207671_100031088 178
604 3300025914 Ga0207671_10226861 Ga0207671_102268612 178
605 3300025917 Ga0207660_10002058 Ga0207660_1000205815 178
606 3300025917 Ga0207660_10208836 Ga0207660_102088362 178
607 3300025918 Ga0207662_10145067 Ga0207662_101450673 178
608 3300025919 Ga0207657_10043973 Ga0207657_100439733 178
609 3300025919 Ga0207657_10085185 Ga0207657_100851853 178
610 3300025919 Ga0207657_10138674 Ga0207657_101386742 178
611 3300025919 Ga0207657_10341044 Ga0207657_103410442 178
612 3300025920 Ga0207649_10001452 Ga0207649_1000145210 178
613 3300025920 Ga0207649_10081913 Ga0207649_100819132 178
614 3300025921 Ga0207652_10026534 Ga0207652_100265342 178
615 3300025921 Ga0207652_10087228 Ga0207652_100872282 178
616 3300025921 Ga0207652_10150609 Ga0207652_101506092 178
617 3300025923 Ga0207681_10004661 Ga0207681_100046616 178
618 3300025923 Ga0207681_10372383 Ga0207681_103723832 178
619 3300025923 Ga0207681_10539038 Ga0207681_105390382 178
620 3300025924 Ga0207694_10017688 Ga0207694_100176883 178
621 3300025924 Ga0207694_10035849 Ga0207694_100358493 178
622 3300025924 Ga0207694_10076029 Ga0207694_100760293 178
623 3300025924 Ga0207694_10127467 Ga0207694_101274672 178
624 3300025925 Ga0207650_10001129 Ga0207650_1000112916 178
625 3300025925 Ga0207650_10020864 Ga0207650_100208643 178
626 3300025925 Ga0207650_10062301 Ga0207650_100623013 178
627 3300025925 Ga0207650_10155881 Ga0207650_101558812 178
628 3300025925 Ga0207650_10925578 Ga0207650_109255781 178
629 3300025926 Ga0207659_10000725 Ga0207659_1000072517 178
630 3300025926 Ga0207659_10022818 Ga0207659_100228182 178
631 3300025926 Ga0207659_10028803 Ga0207659_100288035 178
632 3300025926 Ga0207659_10322783 Ga0207659_103227832 178
633 3300025926 Ga0207659_10422653 Ga0207659_104226532 178
634 3300025926 Ga0207659_10783518 Ga0207659_107835181 178
635 3300025926 Ga0207659_10978741 Ga0207659_109787411 178
636 3300025927 Ga0207687_10014932 Ga0207687_100149324 178
637 3300025927 Ga0207687_10193463 Ga0207687_101934632 178
638 3300025927 Ga0207687_10202260 Ga0207687_102022602 178
639 3300025931 Ga0207644_10002875 Ga0207644_100028754 178
640 3300025931 Ga0207644_10023515 Ga0207644_100235153 178
641 3300025931 Ga0207644_10052328 Ga0207644_100523283 178
642 3300025931 Ga0207644_10085948 Ga0207644_100859482 178
643 3300025931 Ga0207644_10093758 Ga0207644_100937582 178
644 3300025931 Ga0207644_10409754 Ga0207644_104097542 178
645 3300025931 Ga0207644_10756057 Ga0207644_107560572 178
646 3300025932 Ga0207690_10005112 Ga0207690_100051125 178
647 3300025932 Ga0207690_10404450 Ga0207690_104044502 178
648 3300025932 Ga0207690_10836137 Ga0207690_108361372 178
649 3300025933 Ga0207706_10028023 Ga0207706_100280234 178
650 3300025933 Ga0207706_10050549 Ga0207706_100505492 178
651 3300025933 Ga0207706_10062327 Ga0207706_100623272 178
652 3300025933 Ga0207706_10117286 Ga0207706_101172862 178
653 3300025933 Ga0207706_10557383 Ga0207706_105573832 178
654 3300025933 Ga0207706_10599674 Ga0207706_105996742 178
655 3300025934 Ga0207686_10021892 Ga0207686_100218922 178
656 3300025934 Ga0207686_10468970 Ga0207686_104689702 178
657 3300025934 Ga0207686_10493706 Ga0207686_104937061 178
658 3300025935 Ga0207709_10000230 Ga0207709_1000023012 178
659 3300025935 Ga0207709_10003289 Ga0207709_100032899 178
660 3300025935 Ga0207709_10007670 Ga0207709_100076706 178
661 3300025935 Ga0207709_10252337 Ga0207709_102523372 178
662 3300025935 Ga0207709_10371934 Ga0207709_103719342 178
663 3300025936 Ga0207670_10087229 Ga0207670_100872292 178
664 3300025937 Ga0207669_10006230 Ga0207669_100062304 178
665 3300025937 Ga0207669_10023729 Ga0207669_100237294 178
666 3300025937 Ga0207669_10042005 Ga0207669_100420052 178
667 3300025937 Ga0207669_10058706 Ga0207669_100587063 178
668 3300025937 Ga0207669_10062500 Ga0207669_100625002 178
669 3300025937 Ga0207669_10389578 Ga0207669_103895782 178
670 3300025938 Ga0207704_10251440 Ga0207704_102514401 178
671 3300025938 Ga0207704_10751772 Ga0207704_107517722 178
672 3300025939 Ga0207665_10142248 Ga0207665_101422482 178
673 3300025940 Ga0207691_10001003 Ga0207691_100010036 178
674 3300025940 Ga0207691_10032968 Ga0207691_100329683 178
675 3300025940 Ga0207691_10039555 Ga0207691_100395553 178
676 3300025940 Ga0207691_10066609 Ga0207691_100666093 178
677 3300025940 Ga0207691_10083381 Ga0207691_100833813 178
678 3300025940 Ga0207691_10237223 Ga0207691_102372232 178
679 3300025940 Ga0207691_10278650 Ga0207691_102786502 178
680 3300025940 Ga0207691_10324298 Ga0207691_103242982 178
681 3300025940 Ga0207691_10355247 Ga0207691_103552472 178
682 3300025941 Ga0207711_10008951 Ga0207711_100089514 178
683 3300025941 Ga0207711_10138781 Ga0207711_101387812 178
684 3300025941 Ga0207711_10217615 Ga0207711_102176152 178
685 3300025941 Ga0207711_10240063 Ga0207711_102400632 178
686 3300025941 Ga0207711_10572061 Ga0207711_105720612 178
687 3300025942 Ga0207689_10016929 Ga0207689_100169296 178
688 3300025942 Ga0207689_10076742 Ga0207689_100767423 178
689 3300025942 Ga0207689_10241177 Ga0207689_102411772 178
690 3300025942 Ga0207689_10428290 Ga0207689_104282902 178
691 3300025944 Ga0207661_10215610 Ga0207661_102156103 178
692 3300025945 Ga0207679_10000225 Ga0207679_1000022532 178
693 3300025945 Ga0207679_10129823 Ga0207679_101298232 178
694 3300025945 Ga0207679_10178779 Ga0207679_101787793 178
695 3300025945 Ga0207679_10257600 Ga0207679_102576002 178
696 3300025945 Ga0207679_10402682 Ga0207679_104026821 178
697 3300025949 Ga0207667_10031173 Ga0207667_100311733 178
698 3300025949 Ga0207667_10053192 Ga0207667_100531924 178
699 3300025949 Ga0207667_10174234 Ga0207667_101742342 178
700 3300025960 Ga0207651_10004166 Ga0207651_100041663 178
701 3300025960 Ga0207651_10037615 Ga0207651_100376152 178
702 3300025960 Ga0207651_10041840 Ga0207651_100418402 178
703 3300025960 Ga0207651_10070181 Ga0207651_100701813 178
704 3300025960 Ga0207651_10426499 Ga0207651_104264991 178
705 3300025960 Ga0207651_10593435 Ga0207651_105934352 178
706 3300025961 Ga0207712_10077662 Ga0207712_100776623 178
707 3300025961 Ga0207712_10087314 Ga0207712_100873142 178
708 3300025972 Ga0207668_10071736 Ga0207668_100717362 178
709 3300025981 Ga0207640_10003481 Ga0207640_100034815 178
710 3300025981 Ga0207640_10010736 Ga0207640_100107362 178
711 3300025981 Ga0207640_10496696 Ga0207640_104966962 178
712 3300025981 Ga0207640_10690991 Ga0207640_106909912 178
713 3300025986 Ga0207658_10000412 Ga0207658_100004125 178
714 3300025986 Ga0207658_10008870 Ga0207658_100088705 178
715 3300025986 Ga0207658_10018001 Ga0207658_100180014 178
716 3300025986 Ga0207658_10282793 Ga0207658_102827931 178
717 3300025986 Ga0207658_10486981 Ga0207658_104869812 178
718 3300026023 Ga0207677_10003460 Ga0207677_100034603 178
719 3300026023 Ga0207677_10038300 Ga0207677_100383003 178
720 3300026023 Ga0207677_10048693 Ga0207677_100486933 178
721 3300026023 Ga0207677_10067429 Ga0207677_100674292 178
722 3300026023 Ga0207677_10152954 Ga0207677_101529542 178
723 3300026023 Ga0207677_10461635 Ga0207677_104616352 178
724 3300026035 Ga0207703_10004923 Ga0207703_100049237 178
725 3300026035 Ga0207703_10018286 Ga0207703_100182862 178
726 3300026041 Ga0207639_10102084 Ga0207639_101020842 178
727 3300026041 Ga0207639_10191120 Ga0207639_101911203 178
728 3300026041 Ga0207639_10344956 Ga0207639_103449562 178
729 3300026067 Ga0207678_10014066 Ga0207678_100140663 178
730 3300026067 Ga0207678_10142149 Ga0207678_101421492 178
731 3300026067 Ga0207678_10558119 Ga0207678_105581192 178
732 3300026075 Ga0207708_10030964 Ga0207708_100309643 178
733 3300026075 Ga0207708_10064806 Ga0207708_100648062 178
734 3300026075 Ga0207708_10515026 Ga0207708_105150262 178
735 3300026078 Ga0207702_10021374 Ga0207702_100213743 178
736 3300026078 Ga0207702_10193215 Ga0207702_101932152 178
737 3300026078 Ga0207702_10621139 Ga0207702_106211392 178
738 3300026078 Ga0207702_10892896 Ga0207702_108928962 178
739 3300026088 Ga0207641_10002951 Ga0207641_100029519 178
740 3300026088 Ga0207641_10020843 Ga0207641_100208434 178
741 3300026088 Ga0207641_10391479 Ga0207641_103914792 178
742 3300026089 Ga0207648_10001142 Ga0207648_1000114224 178
743 3300026089 Ga0207648_10004128 Ga0207648_100041285 178
744 3300026089 Ga0207648_10007320 Ga0207648_100073206 178
745 3300026089 Ga0207648_10063005 Ga0207648_100630052 178
746 3300026089 Ga0207648_10076766 Ga0207648_100767663 178
747 3300026089 Ga0207648_10106098 Ga0207648_101060983 178
748 3300026089 Ga0207648_10180983 Ga0207648_101809833 178
749 3300026089 Ga0207648_10201255 Ga0207648_102012552 178
750 3300026089 Ga0207648_10322856 Ga0207648_103228562 178
751 3300026089 Ga0207648_10616973 Ga0207648_106169732 178
752 3300026095 Ga0207676_10001271 Ga0207676_100012714 178
753 3300026095 Ga0207676_10046806 Ga0207676_100468063 178
754 3300026095 Ga0207676_10047313 Ga0207676_100473133 178
755 3300026095 Ga0207676_10168583 Ga0207676_101685832 178
756 3300026095 Ga0207676_10194569 Ga0207676_101945693 178
757 3300026095 Ga0207676_10266423 Ga0207676_102664232 178
758 3300026116 Ga0207674_10032904 Ga0207674_100329047 178
759 3300026116 Ga0207674_10055624 Ga0207674_100556243 178
760 3300026118 Ga0207675_100022248 Ga0207675_1000222485 178
761 3300026118 Ga0207675_100036654 Ga0207675_1000366544 178
762 3300026118 Ga0207675_100058473 Ga0207675_1000584732 178
763 3300026118 Ga0207675_100235059 Ga0207675_1002350592 178
764 3300026118 Ga0207675_100347515 Ga0207675_1003475152 178
765 3300026118 Ga0207675_100405476 Ga0207675_1004054762 178
766 3300026121 Ga0207683_10017025 Ga0207683_100170255 178
767 3300026121 Ga0207683_10042627 Ga0207683_100426274 178
768 3300026121 Ga0207683_10052282 Ga0207683_100522822 178
769 3300026121 Ga0207683_10053693 Ga0207683_100536933 178
770 3300026121 Ga0207683_10056428 Ga0207683_100564283 178
771 3300026121 Ga0207683_10091182 Ga0207683_100911823 178
772 3300026121 Ga0207683_10177495 Ga0207683_101774953 178
773 3300026121 Ga0207683_10220879 Ga0207683_102208792 178
774 3300026121 Ga0207683_10534447 Ga0207683_105344472 178
775 3300026121 Ga0207683_10666892 Ga0207683_106668922 178
776 3300026142 Ga0207698_10030878 Ga0207698_100308782 178
777 3300026142 Ga0207698_10554737 Ga0207698_105547372 178
778 3300026142 Ga0207698_10741701 Ga0207698_107417012 178
779 3300026142 Ga0207698_11452636 Ga0207698_114526361 178
780 3300027296 Ga0209389_1006568 Ga0209389_10065689 178
781 3300027360 Ga0209969_1010297 Ga0209969_10102972 178
782 3300027526 Ga0209968_1000332 Ga0209968_10003325 178
783 3300027543 Ga0209999_1006616 Ga0209999_10066163 178
784 3300027695 Ga0209966_1000014 Ga0209966_100001443 178
785 3300027866 Ga0209813_10046379 Ga0209813_100463792 178
786 3300027876 Ga0209974_10001693 Ga0209974_100016931 178
787 3300027876 Ga0209974_10011142 Ga0209974_100111422 178
788 3300027876 Ga0209974_10027736 Ga0209974_100277363 178
789 3300027876 Ga0209974_10030489 Ga0209974_100304892 178
790 3300027907 Ga0207428_10095604 Ga0207428_100956041 178
791 3300028379 Ga0268266_10137528 Ga0268266_101375283 178
792 3300028379 Ga0268266_10315015 Ga0268266_103150152 178
793 3300028379 Ga0268266_10352229 Ga0268266_103522292 178
794 3300028379 Ga0268266_10900904 Ga0268266_109009042 178
795 3300028379 Ga0268266_11568120 Ga0268266_115681201 178
796 3300028380 Ga0268265_10019736 Ga0268265_100197365 178
797 3300028381 Ga0268264_10001666 Ga0268264_1000166621 178
798 3300028381 Ga0268264_10005463 Ga0268264_100054632 178
799 3300028381 Ga0268264_10483730 Ga0268264_104837302 178
800 3300028381 Ga0268264_11030019 Ga0268264_110300192 178
801 3300028577 Ga0265318_10122019 Ga0265318_101220192 178
802 3300028786 Ga0307517_10003097 Ga0307517_1000309713 178
803 3300028786 Ga0307517_10172222 Ga0307517_101722222 178
804 3300028786 Ga0307517_10209718 Ga0307517_102097182 178
805 3300028794 Ga0307515_10000006 Ga0307515_1000000639 178
806 3300028794 Ga0307515_10000944 Ga0307515_1000094437 178
807 3300028794 Ga0307515_10001534 Ga0307515_1000153444 178
808 3300028794 Ga0307515_10001963 Ga0307515_1000196318 178
809 3300028794 Ga0307515_10005581 Ga0307515_1000558128 178
810 3300028794 Ga0307515_10016830 Ga0307515_1001683012 178
811 3300028794 Ga0307515_10246527 Ga0307515_102465272 178
812 3300028794 Ga0307515_10418300 Ga0307515_104183002 178
813 3300030745 Ga0316182_1413366 Ga0316182_14133663 178
814 3300031235 Ga0265330_10001548 Ga0265330_100015484 178
815 3300031235 Ga0265330_10097367 Ga0265330_100973672 178
816 3300031238 Ga0265332_10000072 Ga0265332_1000007280 178
817 3300031241 Ga0265325_10002224 Ga0265325_100022249 178
818 3300031242 Ga0265329_10045504 Ga0265329_100455042 178
819 3300031251 Ga0265327_10210350 Ga0265327_102103502 178
820 3300031456 Ga0307513_10000006 Ga0307513_10000006199 178
821 3300031456 Ga0307513_10000094 Ga0307513_1000009466 178
822 3300031456 Ga0307513_10003659 Ga0307513_1000365912 178
823 3300031456 Ga0307513_10015349 Ga0307513_100153495 178
824 3300031456 Ga0307513_10046752 Ga0307513_100467522 178
825 3300031456 Ga0307513_10058530 Ga0307513_100585303 178
826 3300031456 Ga0307513_10152820 Ga0307513_101528203 178
827 3300031507 Ga0307509_10000120 Ga0307509_1000012082 178
828 3300031507 Ga0307509_10015361 Ga0307509_100153613 178
829 3300031507 Ga0307509_10074997 Ga0307509_100749973 178
830 3300031507 Ga0307509_10115949 Ga0307509_101159493 178
831 3300031507 Ga0307509_10149664 Ga0307509_101496642 178
832 3300031548 Ga0307408_100000064 Ga0307408_10000006420 178
833 3300031548 Ga0307408_100198160 Ga0307408_1001981602 178
834 3300031548 Ga0307408_100546902 Ga0307408_1005469022 178
835 3300031548 Ga0307408_100571011 Ga0307408_1005710112 178
836 3300031616 Ga0307508_10000017 Ga0307508_1000001730 178
837 3300031616 Ga0307508_10000163 Ga0307508_1000016323 178
838 3300031616 Ga0307508_10022852 Ga0307508_100228527 178
839 3300031616 Ga0307508_10360829 Ga0307508_103608292 178
840 3300031649 Ga0307514_10000823 Ga0307514_1000082317 178
841 3300031649 Ga0307514_10008501 Ga0307514_100085013 178
842 3300031649 Ga0307514_10009567 Ga0307514_100095675 178
843 3300031649 Ga0307514_10167877 Ga0307514_101678772 178
844 3300031711 Ga0265314_10000516 Ga0265314_1000051615 178
845 3300031711 Ga0265314_10004171 Ga0265314_100041714 178
846 3300031712 Ga0265342_10016086 Ga0265342_100160867 178
847 3300031730 Ga0307516_10002019 Ga0307516_1000201920 178
848 3300031730 Ga0307516_10006850 Ga0307516_1000685014 178
849 3300031730 Ga0307516_10019640 Ga0307516_100196405 178
850 3300031730 Ga0307516_10085135 Ga0307516_100851354 178
851 3300031730 Ga0307516_10093094 Ga0307516_100930943 178
852 3300031731 Ga0307405_10130348 Ga0307405_101303482 178
853 3300031824 Ga0307413_10101510 Ga0307413_101015102 178
854 3300031901 Ga0307406_10000879 Ga0307406_100008795 178
855 3300031901 Ga0307406_10002603 Ga0307406_100026032 178
856 3300031901 Ga0307406_10221578 Ga0307406_102215783 178
857 3300031901 Ga0307406_10482539 Ga0307406_104825391 178
858 3300031903 Ga0307407_10500375 Ga0307407_105003752 178
859 3300031911 Ga0307412_10195468 Ga0307412_101954682 178
860 3300031911 Ga0307412_10358085 Ga0307412_103580852 178
861 3300031911 Ga0307412_10468440 Ga0307412_104684402 178
862 3300031995 Ga0307409_100004624 Ga0307409_1000046246 178
863 3300031995 Ga0307409_100433094 Ga0307409_1004330942 178
864 3300032002 Ga0307416_100022102 Ga0307416_1000221023 178
865 3300032002 Ga0307416_100035014 Ga0307416_1000350142 178
866 3300032002 Ga0307416_100235907 Ga0307416_1002359071 178
867 3300032002 Ga0307416_100795898 Ga0307416_1007958982 178
868 3300032005 Ga0307411_10015641 Ga0307411_100156412 178
869 3300032005 Ga0307411_10217791 Ga0307411_102177911 178
870 3300032005 Ga0307411_10786059 Ga0307411_107860592 178
871 3300032126 Ga0307415_100002068 Ga0307415_1000020685 178
872 3300033179 Ga0307507_10127164 Ga0307507_101271643 178
873 3300033180 Ga0307510_10002394 Ga0307510_1000239415 178
874 3300033180 Ga0307510_10034941 Ga0307510_100349415 178
875 3300033180 Ga0307510_10181925 Ga0307510_101819253 178
876 3300033180 Ga0307510_10188421 Ga0307510_101884212 178
877 3300033180 Ga0307510_10450594 Ga0307510_104505941 178
878 3300034816 Ga0373930_0015531 Ga0373930_0015531_126_692 178
879 3300034820 Ga0373959_0011991 Ga0373959_0011991_387_953 178
880 3300034820 Ga0373959_0032709 Ga0373959_0032709_331_900 178
881 3300035086 Ga0373934_0033147 Ga0373934_0033147_82_648 178
882 3300035111 Ga0373923_0126041 Ga0373923_0126041_428_994 178
883 3300035111 Ga0373923_0261321 Ga0373923_0261321_191_757 178
884 3300035112 Ga0373932_0006153 Ga0373932_0006153_2039_2605 178
885 3300035112 Ga0373932_0047369 Ga0373932_0047369_75_650 178
886 3300035113 Ga0373936_0201448 Ga0373936_0201448_74_640 178
887 3300035114 Ga0373939_0093593 Ga0373939_0093593_346_915 178
888 3300035120 Ga0373957_0179471 Ga0373957_0179471_287_853 178
889 3300035170 Ga0373943_0076009 Ga0373943_0076009_242_808 178
890 3300035172 Ga0373955_0137995 Ga0373955_0137995_451_1017 178
891 3300035410 Ga0373924_0020497 Ga0373924_0020497_778_1344 178
892 3300035691 Ga0373931_0122405 Ga0373931_0122405_373_939 178
893 3300035691 Ga0373931_0476487 Ga0373931_0476487_34_600 178
894 3300035692 Ga0373935_0165026 Ga0373935_0165026_52_618 178
895 3300035695 Ga0373927_0008971 Ga0373927_0008971_3507_4073 178
896 3300035725 Ga0373947_0125985 Ga0373947_0125985_700_1266 178
897 3300036401 Ga0373937_0018511 Ga0373937_0018511_4722_5288 178
898 3300036401 Ga0373937_0027901 Ga0373937_0027901_2214_2780 178
899 3300036401 Ga0373937_0253126 Ga0373937_0253126_125_691 178
900 3300037068 Ga0373925_0102065 Ga0373925_0102065_916_1482 178
901 3300037068 Ga0373925_0168777 Ga0373925_0168777_735_1301 178
902 3300037068 Ga0373925_0360260 Ga0373925_0360260_81_647 178
903 3300037068 Ga0373925_0456791 Ga0373925_0456791_204_770 178
904 3300037312 Ga0395899_0001877 Ga0395899_0001877_14099_14668 178
905 3300037312 Ga0395899_0221413 Ga0395899_0221413_708_1277 178
906 3300037312 Ga0395899_0361911 Ga0395899_0361911_52_630 178
907 3300037418 Ga0395900_0052840 Ga0395900_0052840_1116_1685 178
908 3300037418 Ga0395900_0097042 Ga0395900_0097042_1079_1648 178
909 3300037418 Ga0395900_0121734 Ga0395900_0121734_135_704 178
910 3300037418 Ga0395900_0405808 Ga0395900_0405808_50_619 178
911 3300037466 Ga0395898_0022468 Ga0395898_0022468_2577_3146 178
912 3300037466 Ga0395898_0023515 Ga0395898_0023515_2219_2797 178
913 3300037466 Ga0395898_0047602 Ga0395898_0047602_1970_2539 178
914 3300037466 Ga0395898_0707332 Ga0395898_0707332_352_921 178
915 3300037471 Ga0395905_0000138 Ga0395905_0000138_90078_90647 178
916 3300037471 Ga0395905_0000837 Ga0395905_0000837_4122_4688 178
917 3300037471 Ga0395905_0013525 Ga0395905_0013525_5375_5944 178
918 3300037471 Ga0395905_0014971 Ga0395905_0014971_743_1309 178
919 3300037471 Ga0395905_0039665 Ga0395905_0039665_1780_2349 178
920 3300037471 Ga0395905_0042156 Ga0395905_0042156_2036_2605 178
921 3300037471 Ga0395905_0059945 Ga0395905_0059945_2037_2606 178
922 3300037471 Ga0395905_0123613 Ga0395905_0123613_1247_1816 178
923 3300037471 Ga0395905_0135924 Ga0395905_0135924_1023_1589 178
924 3300037471 Ga0395905_0150426 Ga0395905_0150426_1342_1911 178
925 3300037471 Ga0395905_0221071 Ga0395905_0221071_262_831 178
926 3300037471 Ga0395905_0252730 Ga0395905_0252730_738_1307 178
927 3300037471 Ga0395905_0538143 Ga0395905_0538143_325_891 178
928 3300038443 Ga0395901_0036782 Ga0395901_0036782_2744_3313 178
929 3300038443 Ga0395901_0069944 Ga0395901_0069944_1870_2448 178
930 3300038443 Ga0395901_0141911 Ga0395901_0141911_275_844 178
931 3300038443 Ga0395901_0175935 Ga0395901_0175935_121_687 178
932 3300038443 Ga0395901_0260777 Ga0395901_0260777_787_1356 178
933 3300038443 Ga0395901_0364843 Ga0395901_0364843_862_1431 178
934 3300039437 Ga0436365_1871400 Ga0436365_1871400_331_897 178
935 3300039447 Ga0436361_0146317 Ga0436361_0146317_40805_41371 178
936 3300039447 Ga0436361_0231085 Ga0436361_0231085_431_997 178
937 3300039447 Ga0436361_0343816 Ga0436361_0343816_19850_20416 178
938 3300039447 Ga0436361_1052556 Ga0436361_1052556_37107_37673 178
939 3300039447 Ga0436361_1132349 Ga0436361_1132349_1174_1740 178
940 3300039450 Ga0436363_0424328 Ga0436363_0424328_168_734 178
941 3300041404 Ga0439436_0019770 Ga0439436_0019770_544_1110 178
942 3300041411 Ga0439466_0013982 Ga0439466_0013982_1619_2185 178
943 3300041443 Ga0451789_0792101 Ga0451789_0792101_279_845 178
944 3300041452 Ga0451793_0084455 Ga0451793_0084455_1619_2185 178
945 3300041453 Ga0451797_0514269 Ga0451797_0514269_1297_1863 178
946 3300041456 Ga0451795_1492822 Ga0451795_1492822_69_635 178
947 3300041458 Ga0451798_0308381 Ga0451798_0308381_431_997 178
948 3300041486 Ga0451807_2595932 Ga0451807_2595932_61_627 178
949 3300041492 Ga0451835_0681653 Ga0451835_0681653_111_677 178
950 3300041496 Ga0451839_0245472 Ga0451839_0245472_100_666 178
951 3300041498 Ga0451841_0499384 Ga0451841_0499384_561_1127 178
952 3300041512 Ga0451853_3545225 Ga0451853_3545225_113_679 178
953 3300041997 Ga0439431_0022002 Ga0439431_0022002_670_1236 178
954 3300042000 Ga0439437_009888 Ga0439437_009888_166_732 178
955 3300042002 Ga0439442_021007 Ga0439442_021007_608_1174 178
956 3300042004 Ga0439445_0016186 Ga0439445_0016186_223_789 178
957 3300042004 Ga0439445_0106099 Ga0439445_0106099_184_753 178
958 3300042007 Ga0439449_0004755 Ga0439449_0004755_1221_1790 178
959 3300042115 Ga0450911_027936 Ga0450911_027936_151_720 178
960 3300042121 Ga0450919_002745 Ga0450919_002745_461_1027 178
961 3300042122 Ga0450920_001884 Ga0450920_001884_2162_2731 178
962 3300042125 Ga0450923_003416 Ga0450923_003416_134_700 178
963 3300042134 Ga0450898_012015 Ga0450898_012015_369_938 178
964 3300042134 Ga0450898_023528 Ga0450898_023528_17_583 178
965 3300042435 Ga0439434_0006244 Ga0439434_0006244_1115_1681 178
966 3300042436 Ga0439435_0063316 Ga0439435_0063316_470_1036 178
967 3300042438 Ga0439459_0016582 Ga0439459_0016582_119_688 178
968 3300042439 Ga0439464_0020171 Ga0439464_0020171_662_1228 178
969 3300042531 Ga0450918_000139 Ga0450918_000139_10171_10740 178
970 3300042531 Ga0450918_000288 Ga0450918_000288_1485_2051 178
971 3300042532 Ga0450893_0001499 Ga0450893_0001499_1362_1928 178
972 3300042876 Ga0451577_0022252 Ga0451577_0022252_2636_3202 178
973 3300042876 Ga0451577_0042165 Ga0451577_0042165_2585_3151 178
974 3300042876 Ga0451577_0293797 Ga0451577_0293797_668_1243 178
975 3300042876 Ga0451577_0540710 Ga0451577_0540710_38_604 178
976 3300044656 Ga0466969_0017037 Ga0466969_0017037_2945_3511 178
977 3300044656 Ga0466969_0033787 Ga0466969_0033787_1232_1801 178
978 3300044673 Ga0453683_0002835 Ga0453683_0002835_1054_1623 178
979 3300044683 Ga0466965_0006955 Ga0466965_0006955_563_1129 178
980 3300044684 Ga0466966_0002595 Ga0466966_0002595_8108_8674 178
981 3300044684 Ga0466966_0013446 Ga0466966_0013446_2374_2943 178
982 3300044684 Ga0466966_0263175 Ga0466966_0263175_307_876 178
983 3300044693 Ga0466961_0002324 Ga0466961_0002324_3389_3955 178
984 3300044693 Ga0466961_0012371 Ga0466961_0012371_4385_4954 178
985 3300044694 Ga0466963_0134608 Ga0466963_0134608_601_1173 178
986 3300044694 Ga0466963_0190015 Ga0466963_0190015_313_879 178
987 3300044694 Ga0466963_0223238 Ga0466963_0223238_682_1248 178
988 3300044706 Ga0466964_0012092 Ga0466964_0012092_1066_1632 178
989 3300044712 Ga0453684_0000121 Ga0453684_0000121_4532_5101 178
990 3300044712 Ga0453684_0011391 Ga0453684_0011391_10325_10891 178
991 3300044712 Ga0453684_0058580 Ga0453684_0058580_2047_2613 178
992 3300044712 Ga0453684_0067005 Ga0453684_0067005_352_918 178
993 3300044712 Ga0453684_0144168 Ga0453684_0144168_1659_2225 178
994 3300044712 Ga0453684_0363247 Ga0453684_0363247_246_812 178
995 3300044712 Ga0453684_0388449 Ga0453684_0388449_891_1457 178
996 3300044712 Ga0453684_0399728 Ga0453684_0399728_250_825 178
997 3300044712 Ga0453684_0760905 Ga0453684_0760905_150_716 178
998 3300044719 Ga0466971_0014882 Ga0466971_0014882_1760_2326 178
999 3300044735 Ga0466968_0003831 Ga0466968_0003831_5002_5568 178
1000 3300044735 Ga0466968_0013720 Ga0466968_0013720_177_743 178
1001 3300044765 Ga0466970_0007496 Ga0466970_0007496_4476_5042 178
1002 3300044765 Ga0466970_0082348 Ga0466970_0082348_674_1243 178
1003 3300044842 Ga0466957_0002248 Ga0466957_0002248_7357_7923 178
1004 3300044842 Ga0466957_0017319 Ga0466957_0017319_879_1445 178
1005 3300044842 Ga0466957_0602790 Ga0466957_0602790_52_621 178
1006 3300045049 Ga0466959_0006996 Ga0466959_0006996_5340_5909 178
1007 3300045049 Ga0466959_0028726 Ga0466959_0028726_1866_2432 178
1008 3300045051 Ga0451576_0005731 Ga0451576_0005731_4656_5225 178
1009 3300045051 Ga0451576_0007989 Ga0451576_0007989_5458_6024 178
1010 3300045051 Ga0451576_0050947 Ga0451576_0050947_3348_3917 178
1011 3300045051 Ga0451576_0115320 Ga0451576_0115320_972_1538 178
1012 3300045051 Ga0451576_0211312 Ga0451576_0211312_767_1333 178
1013 3300045051 Ga0451576_0236417 Ga0451576_0236417_742_1308 178
1014 3300045051 Ga0451576_0513705 Ga0451576_0513705_263_829 178
1015 3300045051 Ga0451576_1294723 Ga0451576_1294723_31_597 178
1016 3300045836 Ga0466958_0013315 Ga0466958_0013315_435_1001 178
1017 3300045976 Ga0466967_0330751 Ga0466967_0330751_481_1053 178
1018 3300046454 Ga0495592_0001471 Ga0495592_0001471_39_605 178
1019 3300046455 Ga0495603_0252585 Ga0495603_0252585_428_994 178
1020 3300046455 Ga0495603_0318981 Ga0495603_0318981_255_821 178
1021 3300046457 Ga0495590_0001744 Ga0495590_0001744_8494_9060 178
1022 3300046457 Ga0495590_0040706 Ga0495590_0040706_226_792 178
1023 3300046459 Ga0495629_0018252 Ga0495629_0018252_2306_2872 178
1024 3300046459 Ga0495629_0300743 Ga0495629_0300743_260_826 178
1025 3300046459 Ga0495629_0304188 Ga0495629_0304188_205_771 178
1026 3300046475 Ga0495639_0010899 Ga0495639_0010899_3251_3817 178
1027 3300046506 Ga0495583_0000171 Ga0495583_0000171_49037_49603 178
1028 3300046506 Ga0495583_0105022 Ga0495583_0105022_62_628 178
1029 3300046507 Ga0495606_0000868 Ga0495606_0000868_6441_7007 178
1030 3300046507 Ga0495606_0257462 Ga0495606_0257462_10_576 178
1031 3300046512 Ga0495610_0028601 Ga0495610_0028601_1345_1911 178
1032 3300046512 Ga0495610_0194121 Ga0495610_0194121_239_805 178
1033 3300046513 Ga0495616_0003352 Ga0495616_0003352_6606_7172 178
1034 3300046514 Ga0495618_0153996 Ga0495618_0153996_542_1108 178
1035 3300046515 Ga0495620_0052894 Ga0495620_0052894_358_924 178
1036 3300046516 Ga0495628_0286553 Ga0495628_0286553_581_1147 178
1037 3300046517 Ga0495630_0451462 Ga0495630_0451462_303_869 178
1038 3300046519 Ga0495632_0017466 Ga0495632_0017466_1975_2541 178
1039 3300046519 Ga0495632_0021852 Ga0495632_0021852_773_1339 178
1040 3300046522 Ga0495643_0040950 Ga0495643_0040950_131_697 178
1041 3300046524 Ga0495648_0109826 Ga0495648_0109826_136_705 178
1042 3300046524 Ga0495648_0117071 Ga0495648_0117071_799_1365 178
1043 3300046525 Ga0495663_0007358 Ga0495663_0007358_2022_2588 178
1044 3300046525 Ga0495663_0090555 Ga0495663_0090555_26_592 178
1045 3300046526 Ga0495666_0105369 Ga0495666_0105369_306_872 178
1046 3300046526 Ga0495666_0218393 Ga0495666_0218393_158_724 178
1047 3300046528 Ga0495642_0096254 Ga0495642_0096254_102_668 178
1048 3300046529 Ga0495652_0293532 Ga0495652_0293532_515_1081 178
1049 3300046530 Ga0495654_0007324 Ga0495654_0007324_481_1047 178
1050 3300046530 Ga0495654_0020611 Ga0495654_0020611_2225_2791 178
1051 3300046535 Ga0495586_0138276 Ga0495586_0138276_499_1065 178
1052 3300046535 Ga0495586_0222545 Ga0495586_0222545_187_753 178
1053 3300046537 Ga0495598_0024276 Ga0495598_0024276_908_1474 178
1054 3300046537 Ga0495598_0245660 Ga0495598_0245660_23_589 178
1055 3300046539 Ga0495621_0156307 Ga0495621_0156307_320_886 178
1056 3300046542 Ga0495597_0000393 Ga0495597_0000393_10883_11452 178
1057 3300046542 Ga0495597_0060189 Ga0495597_0060189_46_612 178
1058 3300046543 Ga0495645_0119906 Ga0495645_0119906_1066_1632 178
1059 3300046557 Ga0495622_0132809 Ga0495622_0132809_424_990 178
1060 3300046616 Ga0495668_0098130 Ga0495668_0098130_653_1219 178
1061 3300046660 Ga0495625_0000903 Ga0495625_0000903_10355_10921 178
1062 3300046660 Ga0495625_0003716 Ga0495625_0003716_291_857 178
1063 3300046660 Ga0495625_0029597 Ga0495625_0029597_3488_4054 178
1064 3300046660 Ga0495625_0114565 Ga0495625_0114565_985_1551 178
1065 3300046665 Ga0495661_0220853 Ga0495661_0220853_146_712 178
1066 3300046674 Ga0495588_0016294 Ga0495588_0016294_2718_3284 178
1067 3300046678 Ga0495599_0228371 Ga0495599_0228371_472_1038 178
1068 3300046678 Ga0495599_0298484 Ga0495599_0298484_361_927 178
1069 3300046679 Ga0495623_0186156 Ga0495623_0186156_122_688 178
1070 3300046683 Ga0495658_0021538 Ga0495658_0021538_1911_2477 178
1071 3300046683 Ga0495658_0023401 Ga0495658_0023401_1918_2484 178
1072 3300046683 Ga0495658_0108305 Ga0495658_0108305_627_1193 178
1073 3300046683 Ga0495658_0205463 Ga0495658_0205463_468_1034 178
1074 3300046683 Ga0495658_0213829 Ga0495658_0213829_55_621 178
1075 3300046684 Ga0495669_0029390 Ga0495669_0029390_464_1030 178
1076 3300046689 Ga0495613_0090441 Ga0495613_0090441_393_959 178
1077 3300046690 Ga0495624_0254131 Ga0495624_0254131_103_669 178
1078 3300046691 Ga0495670_0338216 Ga0495670_0338216_93_659 178
1079 3300046694 Ga0495649_0001001 Ga0495649_0001001_1011_1577 178
1080 3300046794 Ga0495589_0012815 Ga0495589_0012815_3381_3947 178
1081 3300046809 Ga0495600_0048587 Ga0495600_0048587_565_1131 178
1082 3300046810 Ga0495660_0035115 Ga0495660_0035115_28_594 178
1083 3300046810 Ga0495660_0119487 Ga0495660_0119487_731_1297 178
1084 3300047318 Ga0495636_0031425 Ga0495636_0031425_1492_2058 178
1085 3300047321 Ga0495676_0013187 Ga0495676_0013187_3950_4516 178
1086 3300047321 Ga0495676_0093425 Ga0495676_0093425_1206_1772 178
1087 3300047322 Ga0495680_0041698 Ga0495680_0041698_974_1540 178
1088 3300047322 Ga0495680_0299860 Ga0495680_0299860_315_881 178
1089 3300047443 Ga0495687_000138 Ga0495687_000138_60190_60756 178
1090 3300047443 Ga0495687_017456 Ga0495687_017456_2541_3107 178
1091 3300047445 Ga0495677_0174221 Ga0495677_0174221_47_613 178
1092 3300047447 Ga0495685_008881 Ga0495685_008881_620_1186 178
1093 3300047472 Ga0495686_0002281 Ga0495686_0002281_16726_17298 178
1094 3300047472 Ga0495686_0219370 Ga0495686_0219370_120_686 178
1095 3300047673 Ga0495593_0000578 Ga0495593_0000578_19183_19749 178
1096 3300048088 Ga0495602_0452775 Ga0495602_0452775_25_591 178
1097 3300048090 Ga0495615_0082489 Ga0495615_0082489_113_679 178
1098 3300048091 Ga0495626_0024171 Ga0495626_0024171_621_1187 178
1099 3300048903 Ga0496100_0012386 Ga0496100_0012386_1242_1808 178
1100 3300048903 Ga0496100_0201179 Ga0496100_0201179_659_1225 178
1101 3300048904 Ga0496101_0009863 Ga0496101_0009863_3735_4301 178
1102 3300048905 Ga0496102_0009115 Ga0496102_0009115_3013_3579 178
1103 3300048906 Ga0496103_0022029 Ga0496103_0022029_705_1271 178
1104 3300048907 Ga0496104_0018679 Ga0496104_0018679_3072_3638 178
1105 3300048907 Ga0496104_0018814 Ga0496104_0018814_4512_5078 178
1106 3300048907 Ga0496104_0467807 Ga0496104_0467807_564_1136 178
1107 3300048907 Ga0496104_1279501 Ga0496104_1279501_22_588 178
1108 3300048908 Ga0496105_0000491 Ga0496105_0000491_9354_9920 178
1109 3300048908 Ga0496105_0108748 Ga0496105_0108748_737_1303 178
1110 3300048908 Ga0496105_0342113 Ga0496105_0342113_462_1028 178
1111 3300048909 Ga0496106_0030765 Ga0496106_0030765_55_621 178
1112 3300048910 Ga0496107_0025475 Ga0496107_0025475_565_1131 178
1113 3300048911 Ga0496108_0204071 Ga0496108_0204071_660_1226 178
1114 3300048911 Ga0496108_0206051 Ga0496108_0206051_452_1018 178
1115 3300048911 Ga0496108_0453892 Ga0496108_0453892_521_1087 178
1116 3300048912 Ga0496109_0385275 Ga0496109_0385275_437_1003 178
1117 3300048913 Ga0496110_0106051 Ga0496110_0106051_1783_2349 178
1118 3300048914 Ga0496111_0089830 Ga0496111_0089830_173_739 178
1119 3300048914 Ga0496111_0682362 Ga0496111_0682362_63_629 178
1120 3300048916 Ga0496113_0084087 Ga0496113_0084087_1359_1925 178
1121 3300048917 Ga0496114_0043366 Ga0496114_0043366_955_1521 178
1122 3300048917 Ga0496114_0101809 Ga0496114_0101809_490_1056 178
1123 3300048917 Ga0496114_0191340 Ga0496114_0191340_1014_1580 178
1124 3300048919 Ga0496116_0020177 Ga0496116_0020177_2852_3418 178
1125 3300048919 Ga0496116_0054208 Ga0496116_0054208_582_1148 178
1126 3300048920 Ga0496117_0025714 Ga0496117_0025714_594_1160 178
1127 3300048920 Ga0496117_0068573 Ga0496117_0068573_26_592 178
1128 3300048921 Ga0496118_0074272 Ga0496118_0074272_1498_2064 178
1129 3300048921 Ga0496118_0074389 Ga0496118_0074389_87_653 178
1130 3300048924 Ga0496121_0052832 Ga0496121_0052832_673_1239 178
1131 3300048924 Ga0496121_0061500 Ga0496121_0061500_1744_2310 178
1132 3300048924 Ga0496121_0389875 Ga0496121_0389875_193_759 178
1133 3300048925 Ga0496122_0178075 Ga0496122_0178075_691_1257 178
1134 3300048927 Ga0496124_0004176 Ga0496124_0004176_3258_3824 178
1135 3300048927 Ga0496124_0340435 Ga0496124_0340435_242_808 178
1136 3300048928 Ga0496125_0031049 Ga0496125_0031049_1056_1622 178
1137 3300048928 Ga0496125_0035225 Ga0496125_0035225_1110_1676 178
1138 3300048928 Ga0496125_0301771 Ga0496125_0301771_156_722 178
1139 3300049128 Ga0501308_003654 Ga0501308_003654_856_1422 178
1140 3300049515 Ga0501292_000723 Ga0501292_000723_1323_1889 178
1141 3300049516 Ga0501293_010564 Ga0501293_010564_78_644 178
1142 3300049520 Ga0501297_038232 Ga0501297_038232_72_638 178
1143 3300049568 Ga0501031_0404328 Ga0501031_0404328_235_804 178
1144 3300049573 Ga0501037_0106857 Ga0501037_0106857_499_1065 178
1145 3300049574 Ga0501038_0020423 Ga0501038_0020423_3913_4482 178
1146 3300049578 Ga0501042_0704410 Ga0501042_0704410_65_631 178
1147 3300049579 Ga0501043_0001706 Ga0501043_0001706_12155_12721 178
1148 3300049579 Ga0501043_0283736 Ga0501043_0283736_340_909 178
1149 3300049580 Ga0501046_0000132 Ga0501046_0000132_66785_67351 178
1150 3300049580 Ga0501046_0593376 Ga0501046_0593376_44_613 178
1151 3300049581 Ga0501047_0000026 Ga0501047_0000026_12148_12714 178
1152 3300049581 Ga0501047_0032393 Ga0501047_0032393_4194_4763 178
1153 3300049581 Ga0501047_0167836 Ga0501047_0167836_920_1489 178
1154 3300049649 Ga0501198_000021 Ga0501198_000021_49278_49844 178
1155 3300049658 Ga0501211_001974 Ga0501211_001974_246_812 178
1156 3300049662 Ga0501222_000018 Ga0501222_000018_20813_21379 178
1157 3300049669 Ga0501235_018379 Ga0501235_018379_295_861 178
1158 3300049669 Ga0501235_028209 Ga0501235_028209_144_710 178
1159 3300049672 Ga0501239_009032 Ga0501239_009032_349_915 178
1160 3300049683 Ga0501253_006788 Ga0501253_006788_590_1156 178
1161 3300049687 Ga0501258_013651 Ga0501258_013651_235_801 178
1162 3300049705 Ga0501225_0045954 Ga0501225_0045954_525_1091 178
1163 3300049706 Ga0501229_017995 Ga0501229_017995_295_861 178
1164 3300049742 Ga0501080_0133122 Ga0501080_0133122_1593_2162 178
1165 3300049762 Ga0501265_002087 Ga0501265_002087_739_1305 178
1166 3300049763 Ga0501266_000160 Ga0501266_000160_6850_7416 178
1167 3300049777 Ga0501281_02232 Ga0501281_02232_382_948 178
1168 3300049822 Ga0501035_0032810 Ga0501035_0032810_172_741 178
1169 3300049823 Ga0501044_0036845 Ga0501044_0036845_275_844 178
1170 3300049823 Ga0501044_0101166 Ga0501044_0101166_1964_2530 178
1171 3300049824 Ga0501045_0059792 Ga0501045_0059792_2176_2742 178
1172 3300050489 nmdc:mga03683_141194_c1 nmdc:mga03683_141194_c1_60_626 178
1173 3300050489 nmdc:mga03683_19169_c1 nmdc:mga03683_19169_c1_2033_2599 178
1174 3300050489 nmdc:mga03683_49573_c1 nmdc:mga03683_49573_c1_1158_1724 178
1175 3300050489 nmdc:mga03683_5206_c1 nmdc:mga03683_5206_c1_310_876 178
1176 3300050490 nmdc:mga03n38_87079_c1 nmdc:mga03n38_87079_c1_599_1165 178
1177 3300050491 nmdc:mga00v17_296495_c1 nmdc:mga00v17_296495_c1_295_861 178
1178 3300050492 nmdc:mga0yw44_29443_c1 nmdc:mga0yw44_29443_c1_300_866 178
1179 3300050492 nmdc:mga0yw44_93412_c1 nmdc:mga0yw44_93412_c1_46_612 178
1180 3300050493 nmdc:mga0k408_157062_c1 nmdc:mga0k408_157062_c1_405_971 178
1181 3300050493 nmdc:mga0k408_17025_c1 nmdc:mga0k408_17025_c1_1120_1686 178
1182 3300050493 nmdc:mga0k408_17761_c1 nmdc:mga0k408_17761_c1_2121_2687 178
1183 3300050493 nmdc:mga0k408_235462_c1 nmdc:mga0k408_235462_c1_192_761 178
1184 3300050493 nmdc:mga0k408_239917_c1 nmdc:mga0k408_239917_c1_378_944 178
1185 3300050493 nmdc:mga0k408_33886_c1 nmdc:mga0k408_33886_c1_608_1174 178
1186 3300050493 nmdc:mga0k408_36489_c1 nmdc:mga0k408_36489_c1_2016_2582 178
1187 3300050493 nmdc:mga0k408_38309_c1 nmdc:mga0k408_38309_c1_2088_2654 178
1188 3300050493 nmdc:mga0k408_4736_c1 nmdc:mga0k408_4736_c1_2698_3264 178
1189 3300050493 nmdc:mga0k408_58330_c1 nmdc:mga0k408_58330_c1_989_1555 178
1190 3300050493 nmdc:mga0k408_60110_c1 nmdc:mga0k408_60110_c1_976_1542 178
1191 3300050493 nmdc:mga0k408_61535_c1 nmdc:mga0k408_61535_c1_1526_2092 178
1192 3300050493 nmdc:mga0k408_7186_c1 nmdc:mga0k408_7186_c1_4102_4668 178
1193 3300050493 nmdc:mga0k408_7557_c1 nmdc:mga0k408_7557_c1_3963_4529 178
1194 3300050494 nmdc:mga06z11_132048_c1 nmdc:mga06z11_132048_c1_457_1023 178
1195 3300050494 nmdc:mga06z11_149157_c1 nmdc:mga06z11_149157_c1_218_784 178
1196 3300050494 nmdc:mga06z11_257385_c1 nmdc:mga06z11_257385_c1_269_835 178
1197 3300050494 nmdc:mga06z11_523475_c1 nmdc:mga06z11_523475_c1_40_606 178
1198 3300050494 nmdc:mga06z11_6097_c1 nmdc:mga06z11_6097_c1_2178_2744 178
1199 3300050494 nmdc:mga06z11_71471_c1 nmdc:mga06z11_71471_c1_594_1160 178
1200 3300050495 nmdc:mga04h51_53128_c1 nmdc:mga04h51_53128_c1_595_1161 178
1201 3300050496 nmdc:mga07m45_157481_c1 nmdc:mga07m45_157481_c1_733_1299 178
1202 3300050496 nmdc:mga07m45_165333_c1 nmdc:mga07m45_165333_c1_128_694 178
1203 3300050496 nmdc:mga07m45_202_c1 nmdc:mga07m45_202_c1_21823_22389 178
1204 3300050496 nmdc:mga07m45_299_c1 nmdc:mga07m45_299_c1_11202_11768 178
1205 3300050496 nmdc:mga07m45_3013_c2 nmdc:mga07m45_3013_c2_3093_3659 178
1206 3300050496 nmdc:mga07m45_37512_c1 nmdc:mga07m45_37512_c1_1770_2336 178
1207 3300050496 nmdc:mga07m45_451045_c1 nmdc:mga07m45_451045_c1_118_684 178
1208 3300050496 nmdc:mga07m45_5574_c1 nmdc:mga07m45_5574_c1_303_869 178
1209 3300050496 nmdc:mga07m45_7454_c1 nmdc:mga07m45_7454_c1_658_1224 178
1210 3300050496 nmdc:mga07m45_9954_c1 nmdc:mga07m45_9954_c1_2515_3081 178
1211 3300050508 nmdc:mga09592_6905_c1 nmdc:mga09592_6905_c1_2832_3401 178
1212 3300050509 nmdc:mga0qj67_485454_c1 nmdc:mga0qj67_485454_c1_56_622 178
1213 3300053078 Ga0495612_0043903 Ga0495612_0043903_860_1426 178
1214 3300053080 Ga0500635_0000003 Ga0500635_0000003_13094_13660 178
1215 3300053085 Ga0495619_0131144 Ga0495619_0131144_281_847 178
1216 3300053085 Ga0495619_0720940 Ga0495619_0720940_72_638 178
1217 3300053088 Ga0500644_0001962 Ga0500644_0001962_737_1303 178
1218 3300053088 Ga0500644_0012871 Ga0500644_0012871_225_791 178
1219 3300053090 Ga0500646_0020574 Ga0500646_0020574_242_808 178
1220 3300053093 Ga0500651_0000024 Ga0500651_0000024_23457_24023 178
1221 3300053093 Ga0500651_0002535 Ga0500651_0002535_6196_6762 178
1222 3300053093 Ga0500651_0022441 Ga0500651_0022441_2219_2785 178
1223 3300053094 Ga0500566_0022570 Ga0500566_0022570_2206_2772 178
1224 3300053094 Ga0500566_0194079 Ga0500566_0194079_414_980 178
1225 3300053098 Ga0500650_0229769 Ga0500650_0229769_229_795 178
1226 3300053109 Ga0500569_017007 Ga0500569_017007_936_1502 178
1227 3300053110 Ga0500571_000051 Ga0500571_000051_6038_6604 178
1228 3300053118 Ga0500594_0000438 Ga0500594_0000438_7174_7740 178
1229 3300053118 Ga0500594_0023544 Ga0500594_0023544_913_1479 178
1230 3300053120 Ga0500597_045680 Ga0500597_045680_783_1349 178
1231 3300053122 Ga0500608_144311 Ga0500608_144311_35_601 178
1232 3300053123 Ga0500614_037736 Ga0500614_037736_410_976 178
1233 3300053127 Ga0500623_131793 Ga0500623_131793_253_819 178
1234 3300053129 Ga0500628_001903 Ga0500628_001903_2201_2767 178
1235 3300053129 Ga0500628_013419 Ga0500628_013419_650_1216 178
1236 3300053130 Ga0500642_0004580 Ga0500642_0004580_2240_2806 178
1237 3300053131 Ga0500652_000824 Ga0500652_000824_3736_4302 178
1238 3300053131 Ga0500652_020607 Ga0500652_020607_1437_2003 178
1239 3300053133 Ga0500655_000309 Ga0500655_000309_3434_4000 178
1240 3300053133 Ga0500655_005756 Ga0500655_005756_328_894 178
1241 3300053134 Ga0500658_0001156 Ga0500658_0001156_4162_4728 178
1242 3300053136 Ga0500559_0000011 Ga0500559_0000011_68747_69313 178
1243 3300053139 Ga0500568_0005643 Ga0500568_0005643_2393_2959 178
1244 3300053139 Ga0500568_0021372 Ga0500568_0021372_1734_2300 178
1245 3300053142 Ga0500577_0037596 Ga0500577_0037596_898_1464 178
1246 3300053143 Ga0500579_129131 Ga0500579_129131_267_833 178
1247 3300053148 Ga0500590_089978 Ga0500590_089978_433_999 178
1248 3300053151 Ga0500604_0114593 Ga0500604_0114593_310_876 178
1249 3300053153 Ga0500616_0121851 Ga0500616_0121851_595_1161 178
1250 3300053154 Ga0500619_000035 Ga0500619_000035_19939_20505 178
1251 3300053156 Ga0500622_0000974 Ga0500622_0000974_6075_6641 178
1252 3300053156 Ga0500622_0001057 Ga0500622_0001057_16579_17145 178
1253 3300053157 Ga0500624_006130 Ga0500624_006130_856_1422 178
1254 3300053161 Ga0500634_0019452 Ga0500634_0019452_2440_3006 178
1255 3300053161 Ga0500634_0043046 Ga0500634_0043046_314_880 178
1256 3300053177 Ga0500636_0016831 Ga0500636_0016831_569_1135 178
1257 3300053177 Ga0500636_0074749 Ga0500636_0074749_291_857 178
1258 3300053730 Ga0500645_000210 Ga0500645_000210_3973_4539 178
1259 3300053730 Ga0500645_000489 Ga0500645_000489_5146_5712 178
1260 3300053730 Ga0500645_000501 Ga0500645_000501_3514_4080 178
1261 3300055283 Ga0500661_001805 Ga0500661_001805_433_999 178
1262 3300055283 Ga0500661_009884 Ga0500661_009884_725_1291 178
1263 3300059421 Ga0590071_000508 Ga0590071_000508_2557_3135 178
1264 3300059424 Ga0590075_046372 Ga0590075_046372_373_939 178
1265 3300059424 Ga0590075_050115 Ga0590075_050115_212_781 178
1266 3300060353 Ga0501082_0902416 Ga0501082_0902416_153_719 178
1267 3300061719 Ga0466962_0010092 Ga0466962_0010092_2552_3118 178
1268 3300061719 Ga0466962_0506199 Ga0466962_0506199_15_584 178
1269 3300005365 Ga0070688_100137864 Ga0070688_1001378641 180
1270 3300006946 Ga0079104_1000004 Ga0079104_100000475 180
1271 3300009148 Ga0105243_10000547 Ga0105243_100005477 180
1272 3300025711 Ga0207696_1010665 Ga0207696_10106654 180
1273 3300025935 Ga0207709_10000019 Ga0207709_10000019187 180
1274 3300027111 Ga0209281_1000005 Ga0209281_1000005276 180
1275 3300031824 Ga0307413_10071919 Ga0307413_100719193 180
1276 3300031911 Ga0307412_10236230 Ga0307412_102362302 180
1277 3300031995 Ga0307409_100487284 Ga0307409_1004872842 180
1278 3300048913 Ga0496110_0353816 Ga0496110_0353816_415_1005 180
1279 3300049823 Ga0501044_0082197 Ga0501044_0082197_576_1166 180
1280 3300003794 Ga0055531_10000051 Ga0055531_1000005114 181
1281 3300003794 Ga0055531_10018358 Ga0055531_100183583 181
1282 3300006195 Ga0075366_10024246 Ga0075366_100242463 181
1283 3300006353 Ga0075370_10001812 Ga0075370_100018129 181
1284 3300014968 Ga0157379_10058113 Ga0157379_100581132 181
1285 3300025298 Ga0209050_1004037 Ga0209050_10040378 181
1286 3300025299 Ga0209256_1007820 Ga0209256_10078205 181
1287 3300025303 Ga0209051_1003378 Ga0209051_10033788 181
1288 3300025303 Ga0209051_1008817 Ga0209051_10088176 181
1289 3300025304 Ga0209257_1000103 Ga0209257_10001033 181
1290 3300025304 Ga0209257_1000450 Ga0209257_1000450104 181
1291 3300026023 Ga0207677_11128300 Ga0207677_111283001 181
1292 3300030500 Ga0268256_1054495 Ga0268256_10544952 181
1293 3300032004 Ga0307414_10033235 Ga0307414_100332353 181
1294 3300032005 Ga0307411_10001625 Ga0307411_100016253 181
1295 3300035091 Ga0373951_0016954 Ga0373951_0016954_648_1223 181
1296 3300035114 Ga0373939_0000308 Ga0373939_0000308_5368_5943 181
1297 3300035121 Ga0373960_0001221 Ga0373960_0001221_2505_3080 181
1298 3300035691 Ga0373931_0001161 Ga0373931_0001161_5211_5786 181
1299 3300042000 Ga0439437_007626 Ga0439437_007626_455_1030 181
1300 3300042115 Ga0450911_001967 Ga0450911_001967_1356_1931 181
1301 3300042118 Ga0450914_001866 Ga0450914_001866_666_1241 181
1302 3300042127 Ga0450890_001708 Ga0450890_001708_915_1490 181
1303 3300042127 Ga0450890_001931 Ga0450890_001931_1214_1789 181
1304 3300042129 Ga0450891_000279 Ga0450891_000279_2359_2934 181
1305 3300042130 Ga0450892_000564 Ga0450892_000564_815_1390 181
1306 3300042144 Ga0450889_000263 Ga0450889_000263_2363_2938 181
1307 3300042438 Ga0439459_0001287 Ga0439459_0001287_1774_2349 181
1308 3300042532 Ga0450893_0001662 Ga0450893_0001662_1043_1618 181
1309 3300048911 Ga0496108_0102989 Ga0496108_0102989_1373_2017 181
1310 3300048912 Ga0496109_1039908 Ga0496109_1039908_32_676 181
1311 3300048924 Ga0496121_0079849 Ga0496121_0079849_1212_1787 181
1312 3300048928 Ga0496125_0014470 Ga0496125_0014470_5866_6441 181
1313 3300048928 Ga0496125_0103076 Ga0496125_0103076_991_1566 181
1314 3300048929 Ga0496126_0285135 Ga0496126_0285135_116_691 181
1315 3300049521 Ga0501298_015327 Ga0501298_015327_382_957 181
1316 3300049650 Ga0501199_012287 Ga0501199_012287_318_893 181
1317 3300049662 Ga0501222_003183 Ga0501222_003183_131_706 181
1318 3300031251 Ga0265327_10000223 Ga0265327_1000022334 182
1319 3300037471 Ga0395905_0026790 Ga0395905_0026790_4072_4650 182
1320 3300048916 Ga0496113_0184162 Ga0496113_0184162_650_1228 182
1321 3300050489 nmdc:mga03683_137854_c1 nmdc:mga03683_137854_c1_319_897 182
1322 3300050496 nmdc:mga07m45_2873_c1 nmdc:mga07m45_2873_c1_2771_3349 182
1323 3300025284 Ga0209130_1055609 Ga0209130_10556091 183
1324 3300025302 Ga0207426_1074086 Ga0207426_10740862 183
1325 3300031911 Ga0307412_10027193 Ga0307412_100271932 183
1326 3300050493 nmdc:mga0k408_155897_c1 nmdc:mga0k408_155897_c1_510_1091 183
1327 3300005455 Ga0070663_100072590 Ga0070663_1000725903 184
1328 3300005457 Ga0070662_100034511 Ga0070662_1000345112 184
1329 3300005459 Ga0068867_100016023 Ga0068867_1000160237 184
1330 3300005577 Ga0068857_100034604 Ga0068857_1000346043 184
1331 3300005840 Ga0068870_10245884 Ga0068870_102458842 184
1332 3300006051 Ga0075364_10044341 Ga0075364_100443413 184
1333 3300006178 Ga0075367_10014712 Ga0075367_100147123 184
1334 3300009093 Ga0105240_10066177 Ga0105240_100661773 184
1335 3300010375 Ga0105239_10027477 Ga0105239_100274777 184
1336 3300021361 Ga0213872_10000535 Ga0213872_1000053516 184
1337 3300025908 Ga0207643_10454759 Ga0207643_104547592 184
1338 3300025913 Ga0207695_10125208 Ga0207695_101252083 184
1339 3300025914 Ga0207671_10230478 Ga0207671_102304782 184
1340 3300025933 Ga0207706_10061572 Ga0207706_100615723 184
1341 3300026089 Ga0207648_10258908 Ga0207648_102589083 184
1342 3300026142 Ga0207698_10173888 Ga0207698_101738882 184
1343 3300031251 Ga0265327_10003808 Ga0265327_100038087 184
1344 3300050493 nmdc:mga0k408_24224_c1 nmdc:mga0k408_24224_c1_1227_1832 184
1345 3300050494 nmdc:mga06z11_154872_c1 nmdc:mga06z11_154872_c1_252_857 184
1346 3300031250 Ga0265331_10008333 Ga0265331_100083336 185
1347 3300031251 Ga0265327_10002338 Ga0265327_100023386 185
1348 3300005334 Ga0068869_100009289 Ga0068869_1000092897 186
1349 3300005354 Ga0070675_100058734 Ga0070675_1000587343 186
1350 3300005355 Ga0070671_100020411 Ga0070671_1000204115 186
1351 3300005456 Ga0070678_100116878 Ga0070678_1001168783 186
1352 3300005467 Ga0070706_100262752 Ga0070706_1002627522 186
1353 3300005577 Ga0068857_100033057 Ga0068857_1000330573 186
1354 3300006195 Ga0075366_10000121 Ga0075366_1000012124 186
1355 3300006195 Ga0075366_10128036 Ga0075366_101280362 186
1356 3300009098 Ga0105245_10126770 Ga0105245_101267703 186
1357 3300025258 Ga0209129_1010003 Ga0209129_10100032 186
1358 3300025294 Ga0209025_1000732 Ga0209025_100073243 186
1359 3300025907 Ga0207645_10017863 Ga0207645_100178633 186
1360 3300025908 Ga0207643_10077754 Ga0207643_100777543 186
1361 3300025925 Ga0207650_10048272 Ga0207650_100482722 186
1362 3300025926 Ga0207659_10045089 Ga0207659_100450893 186
1363 3300025940 Ga0207691_10120713 Ga0207691_101207132 186
1364 3300025942 Ga0207689_10005991 Ga0207689_100059916 186
1365 3300025945 Ga0207679_10074108 Ga0207679_100741084 186
1366 3300025960 Ga0207651_10020668 Ga0207651_100206683 186
1367 3300026116 Ga0207674_10036445 Ga0207674_100364453 186
1368 3300026121 Ga0207683_10173803 Ga0207683_101738033 186
1369 3300041997 Ga0439431_0011003 Ga0439431_0011003_1108_1713 186
1370 3300042128 Ga0450897_011066 Ga0450897_011066_128_742 186
1371 3300042134 Ga0450898_016930 Ga0450898_016930_610_1215 186
1372 3300042156 Ga0439446_0002464 Ga0439446_0002464_1757_2362 186
1373 3300050493 nmdc:mga0k408_215715_c1 nmdc:mga0k408_215715_c1_373_984 186
1374 3300050493 nmdc:mga0k408_278_c1 nmdc:mga0k408_278_c1_14796_15407 186
1375 3300050493 nmdc:mga0k408_353822_c1 nmdc:mga0k408_353822_c1_69_692 186
1376 3300001979 JGI24740J21852_10005871 JGI24740J21852_100058715 187
1377 3300046472 Ga0495580_0018250 Ga0495580_0018250_3744_4442 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

47

214

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7706 13 177
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.693 13 177
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.622 15 174
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.6203 15 174
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.6184 15 174
ID Description Score Start End Superfamily
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8238 13 181 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7957 7 183 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7927 8 182 1.20.120.1760
af_Q2FZ11_2_191_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7912 13 183 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7851 13 181 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7Y5E4Q3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.898 13 183 GO:0008444
GO:0016020
GO:0046474
AF-A0A1S1X4S4-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.8963 12 183 GO:0008444
GO:0016020
GO:0046474
AF-A0A1S3QYL7-F1-model_v4 cardiolipin synthase (CMP-forming) (EC 2.7.8.41) 0.8866 13 166 GO:0008444
GO:0016020
GO:0046474
AF-A0A537BT42-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.8864 13 182 GO:0008444
GO:0016020
GO:0046474
AF-A0A7Z7RHK8-F1-model_v4 deleted 0.8845 12 164

Feature Viewer

pLDDT pTM Quality
76.44 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map