F493410

General Info

Members Datasets Scaffolds Average Seq Length
1370 760 997 447

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0006983|Ga0373944_0006983_62_1615
Length 517
Sequence MGLMDRGFDRERIVTPRTRASSTLGAAIEHCAFSGELAHPLQPLPGGGKHGPRTDHKTTDHNQPRMPLLPIERTITSAPGVDPPGFAARRIAADILDGVLRRRRPLDEQFEDRAAHPEFATLPDRDRALVRALVTSALRRLGTLRHLLGRRLARGLPADAPRVEVALLIGAAQILWLEVPDHAAVDLAVRLVQADRRAARYAGLVNAVLRGLARDGAHDLAALDTTALDTPDWLMTRWVANYGAETARAIAVANGHEPALDLTVTSDPEGWASALGGRVLPTGSVRAQVHGPISQLPGYGDGIWWVQDAAAALPAKLLGDVRGLTAADLCAAPGGKTAQLAAGGARVVAVDRSAARLERLRQNLSRLHLSAETVAADVTQWQAGPFDAVLLDAPCSATGTIRRHPDIPWLKHERDIAALAGLQRRLIAQAAELTKPGGVLVYCTCSLEPEEGIEVVRDLLGRNPDLQRQPISAAEVYGHAEWLTPGGDLRTLPCHLPDPDSRMAGLDGFYAARLRRN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
14 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
17 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
18 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
19 2534681786 Brucella suis 92/29 Isolate Unclassified
20 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
21 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
22 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
23 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
24 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
25 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
26 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
27 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
28 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
29 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
30 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
31 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
32 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
33 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
34 2643221568 Rhizobium sp. Root564 Isolate Unclassified
35 2643221582 Rhizobium sp. Root651 Isolate Unclassified
36 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
37 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
38 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
39 2643221693 Rhizobium sp. Root491 Isolate Unclassified
40 2643221736 Bosea sp. Root483D1 Isolate Unclassified
41 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
42 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
43 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
44 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
45 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
47 2738543024 Aminobacter sp. AP02 Isolate Unclassified
48 2751185800 Brucella pituitosa AA2 Isolate Unclassified
49 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
50 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
51 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
52 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
53 2773857925 Microvirga vignae BR3299 Isolate Unclassified
54 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
55 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
56 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
57 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
58 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
59 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
60 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
61 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
62 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
63 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
64 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
65 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
66 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
67 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
68 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
69 2841760612 Bosea sp. Tri-49 Isolate Nodule
70 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
71 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
72 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
73 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
74 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
75 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
76 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
77 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
78 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
79 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
80 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
81 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
82 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
83 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
84 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
85 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
86 2844104063 Bosea sp. Tri-39 Isolate Nodule
87 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
88 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
89 2851182111 Bosea sp. Tri-44 Isolate Nodule
90 2851246043 Bosea sp. Tri-54 Isolate Nodule
91 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
92 2854911287 Brucella lupini LUP21 Isolate Unclassified
93 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
94 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
95 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
96 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
97 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
98 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
99 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
100 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
101 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
102 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
103 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
104 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
105 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
106 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
107 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
108 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
109 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
110 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
111 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
112 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
113 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
114 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
115 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
116 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
117 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
118 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
119 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
120 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
121 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
122 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
123 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
124 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
125 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
126 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
127 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
128 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
129 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
130 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
131 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
132 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
133 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
134 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
135 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
136 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
137 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
138 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
139 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
140 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
141 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
142 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
143 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
144 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
145 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
146 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
147 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
148 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
149 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
150 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
151 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
152 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
153 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
154 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
155 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
156 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
157 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
158 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
159 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
160 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
161 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
162 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
163 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
164 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
165 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
166 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
167 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
168 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
169 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
170 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
171 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
172 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
173 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
174 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
175 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
176 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
177 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
178 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
179 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
180 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
181 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
182 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
183 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
184 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
185 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
186 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
187 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
188 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
189 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
190 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
191 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
192 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
193 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
194 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
195 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
196 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
197 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
198 2909042592 Labrys sp. LIt4 Isolate Nodule
199 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
200 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
201 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
202 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
203 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
204 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
205 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
206 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
207 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
208 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
209 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
210 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
211 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
212 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
213 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
214 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
215 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
216 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
217 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
218 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
219 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
220 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
221 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
222 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
223 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
224 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
225 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
226 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
227 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
228 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
229 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
230 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
231 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
232 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
233 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
234 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
235 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
236 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
237 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
238 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
239 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
240 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
241 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
242 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
243 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
244 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
245 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
246 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
247 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
248 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
249 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
250 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
251 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
252 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
253 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
254 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
255 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
256 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
257 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
258 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
259 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
260 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
261 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
262 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
263 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
264 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
265 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
266 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
267 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
268 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
269 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
270 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
271 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
272 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
273 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
274 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
275 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
276 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
277 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
278 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
279 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
280 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
281 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
282 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
283 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
284 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
285 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
286 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
287 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
288 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
289 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
290 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
291 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
292 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
293 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
294 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
295 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
296 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
297 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
298 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
299 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
300 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
301 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
302 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
303 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
304 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
305 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
306 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
307 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
308 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
309 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
310 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
311 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
312 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
313 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
314 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
315 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
316 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
317 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
318 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
319 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
320 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
321 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
322 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
323 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
324 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
325 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
326 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
327 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
328 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
329 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
330 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
331 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
332 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
333 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
334 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
335 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
336 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
337 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
338 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
339 3004167301 Mesorhizobium loti 582 Isolate Unclassified
340 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
341 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
342 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
343 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
344 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
345 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
346 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
347 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
348 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
349 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
350 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
351 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
352 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
353 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
354 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
355 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
356 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
357 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
358 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
359 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
360 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
361 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
362 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
363 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
364 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
365 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
366 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
367 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
368 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
369 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
370 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
371 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
372 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
373 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
374 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
375 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
376 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
377 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
378 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
379 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
380 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
381 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
382 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
383 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
384 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
385 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
386 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
387 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
388 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
389 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
390 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
391 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
392 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
393 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
394 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
395 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
396 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
397 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
398 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
399 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
400 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
401 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
402 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
403 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
404 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
405 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
406 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
407 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
408 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
409 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
410 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
411 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
412 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
413 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
414 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
415 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
416 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
417 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
418 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
419 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
420 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
421 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
422 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
423 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
424 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
425 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
426 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
427 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
428 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
429 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
430 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
431 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
432 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
433 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
434 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
435 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
436 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
437 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
438 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
439 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
440 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
441 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
442 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
443 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
444 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
445 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
446 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
447 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
448 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
449 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
450 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
451 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
452 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
453 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
454 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
455 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
456 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
457 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
459 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
460 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
461 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
462 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
463 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
465 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
467 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
514 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
516 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
517 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
518 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
521 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
522 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
523 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
524 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
525 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
526 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
527 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
528 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
529 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
530 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
531 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
532 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
533 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
534 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
535 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
536 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
537 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
538 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
539 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
540 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
541 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
542 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
543 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
544 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
545 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
546 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
547 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
548 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
549 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
550 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
551 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
552 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
553 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
554 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
555 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
556 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
557 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
558 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
559 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
560 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
561 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
562 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
563 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
564 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
565 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
566 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
567 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
568 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
569 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
570 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
571 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
572 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
573 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
574 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
575 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
576 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
577 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
578 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
579 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
580 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
581 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
582 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
583 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
584 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
585 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
586 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
587 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
588 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
589 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
590 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
591 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
592 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
593 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
594 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
595 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
596 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
597 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
598 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
599 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
600 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
601 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
602 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
603 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
604 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
605 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
606 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
607 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
608 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
609 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
610 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
611 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
612 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
613 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
614 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
615 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
616 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
617 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
618 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
619 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
620 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
621 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
622 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
623 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
624 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
625 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
626 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
627 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
628 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
629 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
630 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
631 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
632 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
633 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
634 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
635 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
636 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
637 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
638 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
639 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
640 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
641 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
642 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
643 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
644 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
645 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
646 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
647 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
648 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
649 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
650 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
651 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
652 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
653 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
654 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
655 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
656 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
657 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
658 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
659 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
660 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
661 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
662 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
663 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
664 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
667 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
671 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
672 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
673 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
675 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
680 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
681 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
682 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
683 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
684 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
685 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
686 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
687 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
688 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
689 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
690 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
691 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
692 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
693 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
694 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
695 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
696 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
697 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
698 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
699 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
700 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
701 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
702 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
703 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
704 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
705 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
706 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
707 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
708 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
709 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
710 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
711 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
712 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
713 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
714 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
715 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
716 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
717 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
718 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
719 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
720 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
721 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
722 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
723 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
724 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
725 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
726 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
727 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
728 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
729 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
730 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
731 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
732 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
733 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
734 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
735 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
736 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
737 641522639 Methylobacterium sp. 4-46 Isolate Nodule
738 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
739 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
740 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
741 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
742 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
743 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
744 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
745 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
746 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
747 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
748 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
749 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
750 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
751 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
752 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
753 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
754 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
755 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
756 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
757 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
758 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
759 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
760 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.7
Metatranscriptomes 0.07
Isolates 27.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 5.77
Nodule 20
Rhizoplane 5.55
Rhizosphere 60.58
Stem 0
Stem Tuber 0.07
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001865 3300001977 Bacteria 3363
2 JGI25165J46597_1000026 3300003214 Bacteria 332550
3 JGI25153J46596_10007129 3300003215 Bacteria 5546
4 Ga0006562J51391_1004036 3300003578 Bacteria 4015
5 Ga0055542_1000784 3300003762 Bacteria 23770
6 Ga0055528_1016405 3300003790 Bacteria 2620
7 Ga0058692_1000534 3300003856 Bacteria 16322
8 Ga0058692_1003021 3300003856 Bacteria 5384
9 Ga0065165_1000558 3300005262 Bacteria 55456
10 Ga0070690_100018079 3300005330 Bacteria 4251
11 Ga0070690_100122683 3300005330 Bacteria 1746
12 Ga0070670_100005245 3300005331 Bacteria 10912
13 Ga0070670_100019941 3300005331 Bacteria 5755
14 Ga0070670_100029069 3300005331 Bacteria 4756
15 Ga0070677_10002383 3300005333 Bacteria 5998
16 Ga0070666_10010516 3300005335 Bacteria 5790
17 Ga0070689_100013888 3300005340 Bacteria 5839
18 Ga0070689_100049005 3300005340 Bacteria 3259
19 Ga0070687_100020917 3300005343 Bacteria 3067
20 Ga0070668_100027024 3300005347 Bacteria 4356
21 Ga0070669_100061718 3300005353 Bacteria 2755
22 Ga0070669_100090652 3300005353 Bacteria 2292
23 Ga0070671_100121478 3300005355 Bacteria 2198
24 Ga0070674_100008903 3300005356 Bacteria 5993
25 Ga0070674_100042827 3300005356 Bacteria 3077
26 Ga0070673_100118650 3300005364 Unclassified 2203
27 Ga0070688_100018506 3300005365 Bacteria 4020
28 Ga0070659_100142349 3300005366 Bacteria 1953
29 Ga0070709_10025951 3300005434 Bacteria 3467
30 Ga0070714_100094615 3300005435 Bacteria 2622
31 Ga0070714_100129997 3300005435 Bacteria 2250
32 Ga0070713_100009074 3300005436 Bacteria 7091
33 Ga0070713_100028175 3300005436 Bacteria 4433
34 Ga0070713_100170990 3300005436 Bacteria 1947
35 Ga0070710_10048258 3300005437 Bacteria 2378
36 Ga0070701_10035872 3300005438 Bacteria 2495
37 Ga0070711_100009511 3300005439 Bacteria 5993
38 Ga0070711_100025195 3300005439 Bacteria 3889
39 Ga0070711_100139001 3300005439 Bacteria 1818
40 Ga0070700_100013729 3300005441 Bacteria 4555
41 Ga0070700_100046735 3300005441 Bacteria 2676
42 Ga0070663_100153128 3300005455 Bacteria 1769
43 Ga0070678_100003451 3300005456 Bacteria 8815
44 Ga0070678_100020066 3300005456 Bacteria 4377
45 Ga0070662_100018370 3300005457 Bacteria 4729
46 Ga0068867_100005652 3300005459 Bacteria 8864
47 Ga0068867_100007482 3300005459 Bacteria 7724
48 Ga0070685_10005761 3300005466 Bacteria 6294
49 Ga0070707_100134428 3300005468 Bacteria 2406
50 Ga0070698_100015927 3300005471 Bacteria 7939
51 Ga0070699_100005230 3300005518 Bacteria 11399
52 Ga0070699_100046283 3300005518 Bacteria 3764
53 Ga0070699_100168389 3300005518 Bacteria 1941
54 Ga0070679_100020501 3300005530 Bacteria 6446
55 Ga0070679_100220778 3300005530 Bacteria 1856
56 Ga0070684_100036996 3300005535 Bacteria 4185
57 Ga0070697_100002109 3300005536 Bacteria 15231
58 Ga0068853_100020993 3300005539 Bacteria 5436
59 Ga0070672_100019190 3300005543 Bacteria 4959
60 Ga0070672_100055821 3300005543 Bacteria 3095
61 Ga0070686_100014171 3300005544 Bacteria 4588
62 Ga0070686_100048392 3300005544 Bacteria 2693
63 Ga0070693_100036397 3300005547 Bacteria 2736
64 Ga0070665_100001728 3300005548 Bacteria 24967
65 Ga0070704_100095335 3300005549 Bacteria 2228
66 Ga0068855_100027185 3300005563 Bacteria 6846
67 Ga0070664_100203773 3300005564 Bacteria 1766
68 Ga0068854_100067050 3300005578 Bacteria 2614
69 Ga0068856_100118053 3300005614 Bacteria 2654
70 Ga0068864_100010230 3300005618 Bacteria 7747
71 Ga0068864_100037574 3300005618 Bacteria 4133
72 Ga0068866_10028799 3300005718 Bacteria 2650
73 Ga0068861_100013686 3300005719 Bacteria 5681
74 Ga0068851_10061051 3300005834 Bacteria 1931
75 Ga0068863_100019114 3300005841 Bacteria 6557
76 Ga0068858_100130797 3300005842 Bacteria 2353
77 Ga0068858_100152450 3300005842 Bacteria 2173
78 Ga0068860_100015869 3300005843 Bacteria 7351
79 Ga0068860_100100105 3300005843 Bacteria 2765
80 Ga0081455_10000002 3300005937 Bacteria 460472
81 Ga0081455_10002140 3300005937 Bacteria 23551
82 Ga0081455_10003800 3300005937 Bacteria 17227
83 Ga0081455_10004068 3300005937 Bacteria 16566
84 Ga0081455_10010247 3300005937 Bacteria 9531
85 Ga0081455_10028423 3300005937 Bacteria 5109
86 Ga0081455_10036290 3300005937 Bacteria 4391
87 Ga0081455_10063296 3300005937 Bacteria 3104
88 Ga0081538_10002581 3300005981 Bacteria 17571
89 Ga0081540_1001091 3300005983 Bacteria 24073
90 Ga0081540_1007590 3300005983 Bacteria 7706
91 Ga0081540_1046654 3300005983 Bacteria 2185
92 Ga0081539_10005263 3300005985 Bacteria 13347
93 Ga0081539_10005675 3300005985 Bacteria 12525
94 Ga0081539_10007857 3300005985 Bacteria 9523
95 Ga0070717_10044234 3300006028 Bacteria 3636
96 Ga0070717_10140379 3300006028 Bacteria 2083
97 Ga0075365_10003320 3300006038 Bacteria 8264
98 Ga0075365_10009306 3300006038 Bacteria 5637
99 Ga0075365_10016899 3300006038 Bacteria 4452
100 Ga0075365_10020120 3300006038 Bacteria 4132
101 Ga0075365_10030319 3300006038 Bacteria 3463
102 Ga0075365_10034079 3300006038 Bacteria 3286
103 Ga0075365_10076154 3300006038 Bacteria 2265
104 Ga0075368_10000331 3300006042 Bacteria 13823
105 Ga0075368_10011055 3300006042 Bacteria 3278
106 Ga0075368_10013733 3300006042 Bacteria 2978
107 Ga0075363_100005619 3300006048 Bacteria 5603
108 Ga0075363_100009168 3300006048 Bacteria 4646
109 Ga0075363_100028583 3300006048 Bacteria 2870
110 Ga0075363_100049136 3300006048 Bacteria 2245
111 Ga0075364_10034422 3300006051 Bacteria 3268
112 Ga0075364_10037772 3300006051 Bacteria 3129
113 Ga0075364_10062135 3300006051 Bacteria 2451
114 Ga0070716_100001502 3300006173 Bacteria 10422
115 Ga0070712_100004185 3300006175 Bacteria 8876
116 Ga0070712_100013202 3300006175 Bacteria 5272
117 Ga0070712_100022302 3300006175 Bacteria 4170
118 Ga0070712_100036607 3300006175 Bacteria 3341
119 Ga0075362_10005316 3300006177 Bacteria 4703
120 Ga0075362_10051880 3300006177 Bacteria 1837
121 Ga0075367_10003717 3300006178 Bacteria 7337
122 Ga0075367_10012255 3300006178 Bacteria 4564
123 Ga0075367_10015700 3300006178 Bacteria 4121
124 Ga0075367_10015858 3300006178 Bacteria 4105
125 Ga0075367_10025996 3300006178 Bacteria 3315
126 Ga0075367_10067363 3300006178 Bacteria 2146
127 Ga0075367_10110267 3300006178 Bacteria 1688
128 Ga0075369_10002069 3300006186 Bacteria 7079
129 Ga0075366_10055200 3300006195 Bacteria 2360
130 Ga0075428_100000426 3300006844 Bacteria 41901
131 Ga0075428_100000797 3300006844 Bacteria 32864
132 Ga0075428_100018779 3300006844 Bacteria 7644
133 Ga0075428_100053742 3300006844 Bacteria 4414
134 Ga0075428_100075255 3300006844 Bacteria 3687
135 Ga0075428_100165218 3300006844 Bacteria 2401
136 Ga0075430_100000045 3300006846 Bacteria 64983
137 Ga0075430_100030098 3300006846 Bacteria 4610
138 Ga0075430_100070582 3300006846 Bacteria 2930
139 Ga0075430_100074556 3300006846 Bacteria 2845
140 Ga0075431_100003583 3300006847 Bacteria 15048
141 Ga0075431_100014785 3300006847 Bacteria 7901
142 Ga0075431_100026280 3300006847 Bacteria 5972
143 Ga0075431_100046633 3300006847 Bacteria 4469
144 Ga0075431_100142836 3300006847 Bacteria 2467
145 Ga0075431_100351834 3300006847 Bacteria 1481
146 Ga0075433_10002970 3300006852 Bacteria 13023
147 Ga0075433_10030537 3300006852 Bacteria 4599
148 Ga0075434_100003473 3300006871 Bacteria 14090
149 Ga0075434_100023729 3300006871 Bacteria 5983
150 Ga0075434_100039472 3300006871 Bacteria 4678
151 Ga0075434_100063077 3300006871 Bacteria 3689
152 Ga0075434_100072570 3300006871 Bacteria 3434
153 Ga0075434_100076053 3300006871 Bacteria 3352
154 Ga0075434_100149251 3300006871 Bacteria 2358
155 Ga0075429_100000214 3300006880 Bacteria 38983
156 Ga0075429_100002102 3300006880 Bacteria 16623
157 Ga0075429_100050551 3300006880 Bacteria 3616
158 Ga0068865_100020355 3300006881 Bacteria 4302
159 Ga0068865_100166423 3300006881 Bacteria 1686
160 Ga0075436_100015129 3300006914 Bacteria 5288
161 Ga0075436_100024156 3300006914 Bacteria 4178
162 Ga0099826_10032477 3300006948 Bacteria 3762
163 Ga0075435_100006471 3300007076 Bacteria 8284
164 Ga0075435_100006663 3300007076 Bacteria 8187
165 Ga0075435_100014741 3300007076 Bacteria 5857
166 Ga0075435_100044338 3300007076 Bacteria 3562
167 Ga0075435_100053355 3300007076 Bacteria 3260
168 Ga0075435_100070735 3300007076 Bacteria 2848
169 Ga0099794_10029142 3300007265 Bacteria 2571
170 Ga0105240_10373984 3300009093 Bacteria 1610
171 Ga0111539_10000554 3300009094 Bacteria 47836
172 Ga0111539_10000693 3300009094 Bacteria 43665
173 Ga0111539_10012226 3300009094 Bacteria 10767
174 Ga0111539_10031180 3300009094 Bacteria 6479
175 Ga0111539_10154888 3300009094 Bacteria 2682
176 Ga0111539_10239265 3300009094 Bacteria 2113
177 Ga0105245_10027605 3300009098 Bacteria 5001
178 Ga0105245_10107215 3300009098 Bacteria 2593
179 Ga0114129_10003055 3300009147 Bacteria 23465
180 Ga0114129_10009653 3300009147 Bacteria 13772
181 Ga0114129_10009862 3300009147 Bacteria 13618
182 Ga0114129_10010881 3300009147 Bacteria 12959
183 Ga0114129_10016101 3300009147 Bacteria 10636
184 Ga0114129_10088526 3300009147 Bacteria 4292
185 Ga0114129_10132552 3300009147 Bacteria 3421
186 Ga0114129_10149759 3300009147 Bacteria 3194
187 Ga0114129_10615199 3300009147 Bacteria 1406
188 Ga0105243_10023475 3300009148 Bacteria 4697
189 Ga0105243_10101266 3300009148 Bacteria 2392
190 Ga0105243_10129958 3300009148 Bacteria 2135
191 Ga0105241_10106515 3300009174 Bacteria 2238
192 Ga0105242_10204839 3300009176 Bacteria 1754
193 Ga0105248_10009517 3300009177 Bacteria 10695
194 Ga0105248_10030987 3300009177 Bacteria 5976
195 Ga0105237_10016432 3300009545 Bacteria 7689
196 Ga0105237_10078198 3300009545 Bacteria 3298
197 Ga0105238_10001556 3300009551 Bacteria 23011
198 Ga0105238_10021249 3300009551 Bacteria 6614
199 Ga0099796_10000604 3300010159 Bacteria 6221
200 Ga0105239_10023787 3300010375 Bacteria 6746
201 Ga0105239_10030728 3300010375 Bacteria 5908
202 Ga0105239_10054348 3300010375 Bacteria 4393
203 Ga0105239_10132102 3300010375 Bacteria 2778
204 Ga0105239_10164534 3300010375 Bacteria 2480
205 Ga0157371_10000071 3300013102 Bacteria 164088
206 Ga0157371_10089853 3300013102 Bacteria 2176
207 Ga0157370_10000079 3300013104 Bacteria 107305
208 Ga0157370_10151838 3300013104 Bacteria 2155
209 Ga0157374_10117779 3300013296 Bacteria 2560
210 Ga0157378_10127016 3300013297 Bacteria 2356
211 Ga0157372_10010309 3300013307 Bacteria 9929
212 Ga0157375_10028152 3300013308 Bacteria 5262
213 Ga0163163_10072634 3300014325 Bacteria 3430
214 Ga0163163_10178779 3300014325 Bacteria 2169
215 Ga0182008_10017764 3300014497 Bacteria 3687
216 Ga0182008_10041680 3300014497 Bacteria 2290
217 Ga0157377_10006953 3300014745 Bacteria 5432
218 Ga0157379_10015858 3300014968 Bacteria 6622
219 Ga0157376_10030826 3300014969 Bacteria 4287
220 Ga0163161_10023758 3300017792 Bacteria 4327
221 Ga0213876_10017764 3300021384 Bacteria 3753
222 Ga0228598_1002344 3300024227 Bacteria 4138
223 Ga0209026_1000032 3300025250 Bacteria 322378
224 Ga0209148_1000094 3300025254 Bacteria 241711
225 Ga0209759_1000654 3300025256 Bacteria 32179
226 Ga0209233_1000030 3300025261 Bacteria 636702
227 Ga0209455_1000113 3300025272 Bacteria 180579
228 Ga0209673_1003238 3300025273 Bacteria 9839
229 Ga0209130_1000100 3300025284 Bacteria 140260
230 Ga0209676_1000093 3300025292 Bacteria 250231
231 Ga0209025_1001149 3300025294 Bacteria 37669
232 Ga0209025_1003984 3300025294 Bacteria 13258
233 Ga0209025_1022887 3300025294 Bacteria 3293
234 Ga0209564_1002513 3300025295 Bacteria 14203
235 Ga0209758_1000351 3300025297 Bacteria 83626
236 Ga0209758_1010083 3300025297 Bacteria 5722
237 Ga0207656_10033112 3300025321 Bacteria 2150
238 Ga0207682_10001074 3300025893 Bacteria 12601
239 Ga0207710_10081153 3300025900 Bacteria 1505
240 Ga0207688_10009739 3300025901 Bacteria 5229
241 Ga0207688_10010651 3300025901 Bacteria 5001
242 Ga0207707_10001567 3300025912 Bacteria 21044
243 Ga0207695_10148807 3300025913 Bacteria 2282
244 Ga0207671_10021515 3300025914 Bacteria 4890
245 Ga0207693_10000434 3300025915 Bacteria 38124
246 Ga0207693_10007408 3300025915 Bacteria 9027
247 Ga0207693_10030439 3300025915 Bacteria 4263
248 Ga0207693_10041887 3300025915 Bacteria 3604
249 Ga0207693_10047451 3300025915 Bacteria 3375
250 Ga0207693_10135186 3300025915 Bacteria 1938
251 Ga0207663_10014716 3300025916 Bacteria 4294
252 Ga0207663_10043013 3300025916 Bacteria 2763
253 Ga0207660_10033189 3300025917 Bacteria 3568
254 Ga0207660_10045233 3300025917 Bacteria 3100
255 Ga0207662_10007603 3300025918 Bacteria 5905
256 Ga0207662_10035651 3300025918 Bacteria 2906
257 Ga0207657_10200094 3300025919 Bacteria 1607
258 Ga0207649_10030181 3300025920 Bacteria 3208
259 Ga0207652_10013529 3300025921 Bacteria 6600
260 Ga0207646_10139417 3300025922 Bacteria 2183
261 Ga0207681_10176282 3300025923 Bacteria 1625
262 Ga0207659_10076418 3300025926 Bacteria 2461
263 Ga0207687_10029140 3300025927 Bacteria 3712
264 Ga0207700_10014082 3300025928 Bacteria 5229
265 Ga0207700_10028695 3300025928 Bacteria 3917
266 Ga0207664_10044050 3300025929 Bacteria 3493
267 Ga0207644_10018432 3300025931 Bacteria 4722
268 Ga0207644_10084012 3300025931 Bacteria 2359
269 Ga0207690_10013558 3300025932 Bacteria 4899
270 Ga0207706_10001103 3300025933 Bacteria 27497
271 Ga0207686_10068064 3300025934 Bacteria 2280
272 Ga0207709_10085631 3300025935 Bacteria 2044
273 Ga0207670_10005481 3300025936 Bacteria 6970
274 Ga0207670_10054563 3300025936 Bacteria 2697
275 Ga0207670_10057512 3300025936 Bacteria 2638
276 Ga0207670_10190376 3300025936 Bacteria 1552
277 Ga0207669_10002350 3300025937 Bacteria 8037
278 Ga0207669_10097204 3300025937 Bacteria 1935
279 Ga0207704_10043837 3300025938 Bacteria 2645
280 Ga0207665_10002324 3300025939 Bacteria 12832
281 Ga0207665_10031554 3300025939 Bacteria 3506
282 Ga0207665_10038536 3300025939 Bacteria 3183
283 Ga0207691_10001292 3300025940 Bacteria 24983
284 Ga0207691_10027729 3300025940 Bacteria 5308
285 Ga0207689_10007363 3300025942 Bacteria 9649
286 Ga0207689_10022368 3300025942 Bacteria 5317
287 Ga0207661_10080240 3300025944 Bacteria 2692
288 Ga0207661_10179545 3300025944 Bacteria 1848
289 Ga0207679_10154186 3300025945 Bacteria 1874
290 Ga0207667_10144988 3300025949 Bacteria 2444
291 Ga0207651_10006399 3300025960 Bacteria 6162
292 Ga0207712_10000880 3300025961 Bacteria 21827
293 Ga0207668_10036309 3300025972 Bacteria 3288
294 Ga0207677_10027198 3300026023 Bacteria 3598
295 Ga0207703_10155739 3300026035 Bacteria 1996
296 Ga0207639_10041136 3300026041 Bacteria 3456
297 Ga0207678_10012203 3300026067 Bacteria 7547
298 Ga0207678_10082887 3300026067 Bacteria 2743
299 Ga0207708_10000620 3300026075 Bacteria 27264
300 Ga0207708_10076958 3300026075 Bacteria 2560
301 Ga0207708_10111538 3300026075 Bacteria 2123
302 Ga0207708_10232340 3300026075 Bacteria 1481
303 Ga0207641_10011851 3300026088 Bacteria 7155
304 Ga0207641_10129032 3300026088 Bacteria 2268
305 Ga0207641_10147468 3300026088 Bacteria 2129
306 Ga0207648_10002122 3300026089 Bacteria 21569
307 Ga0207648_10006883 3300026089 Bacteria 11270
308 Ga0207648_10231485 3300026089 Bacteria 1644
309 Ga0207676_10028462 3300026095 Bacteria 4174
310 Ga0207676_10031531 3300026095 Bacteria 3987
311 Ga0207674_10018581 3300026116 Bacteria 7550
312 Ga0207675_100002342 3300026118 Bacteria 18784
313 Ga0207675_100122629 3300026118 Bacteria 2460
314 Ga0207683_10001466 3300026121 Bacteria 21270
315 Ga0207683_10015346 3300026121 Bacteria 6524
316 Ga0209371_1000037 3300027312 Bacteria 367074
317 Ga0209371_1000911 3300027312 Bacteria 23452
318 Ga0209813_10000656 3300027866 Bacteria 7932
319 Ga0207428_10000180 3300027907 Bacteria 88557
320 Ga0207428_10009912 3300027907 Bacteria 8532
321 Ga0268266_10024962 3300028379 Bacteria 5086
322 Ga0268266_10141623 3300028379 Bacteria 2158
323 Ga0268264_10196813 3300028381 Bacteria 1841
324 Ga0265318_10010410 3300028577 Bacteria 4052
325 Ga0307515_10001049 3300028794 Bacteria 63286
326 Ga0307515_10002808 3300028794 Bacteria 37051
327 Ga0265338_10039087 3300028800 Bacteria 4483
328 Ga0268256_1000039 3300030500 Bacteria 354969
329 Ga0268256_1001490 3300030500 Bacteria 13902
330 Ga0265332_10000743 3300031238 Bacteria 20249
331 Ga0265325_10000011 3300031241 Bacteria 150631
332 Ga0265325_10007899 3300031241 Bacteria 6329
333 Ga0265325_10021294 3300031241 Bacteria 3563
334 Ga0265325_10029443 3300031241 Bacteria 2952
335 Ga0265325_10038529 3300031241 Bacteria 2522
336 Ga0265329_10006949 3300031242 Bacteria 4426
337 Ga0265340_10006011 3300031247 Bacteria 6705
338 Ga0265340_10006392 3300031247 Bacteria 6490
339 Ga0265340_10013593 3300031247 Bacteria 4274
340 Ga0265340_10019396 3300031247 Bacteria 3502
341 Ga0265340_10075488 3300031247 Bacteria 1592
342 Ga0265339_10000033 3300031249 Bacteria 130595
343 Ga0265339_10006458 3300031249 Bacteria 7688
344 Ga0265339_10013851 3300031249 Bacteria 4878
345 Ga0265339_10020920 3300031249 Bacteria 3816
346 Ga0265316_10027808 3300031344 Bacteria 4675
347 Ga0265316_10048132 3300031344 Bacteria 3369
348 Ga0265316_10048681 3300031344 Bacteria 3344
349 Ga0307513_10059089 3300031456 Bacteria 4071
350 Ga0307513_10253465 3300031456 Bacteria 1555
351 Ga0265313_10000049 3300031595 Bacteria 111617
352 Ga0265313_10009973 3300031595 Bacteria 6091
353 Ga0265313_10010693 3300031595 Bacteria 5775
354 Ga0307508_10007178 3300031616 Bacteria 10373
355 Ga0265314_10008661 3300031711 Bacteria 8699
356 Ga0265314_10011925 3300031711 Bacteria 7135
357 Ga0265314_10013823 3300031711 Bacteria 6499
358 Ga0265314_10029460 3300031711 Bacteria 4080
359 Ga0265314_10052401 3300031711 Bacteria 2837
360 Ga0265314_10060562 3300031711 Bacteria 2583
361 Ga0265342_10000034 3300031712 Bacteria 145074
362 Ga0265342_10009968 3300031712 Bacteria 6641
363 Ga0265342_10015647 3300031712 Bacteria 4985
364 Ga0265342_10026071 3300031712 Bacteria 3667
365 Ga0307410_10149936 3300031852 Bacteria 1735
366 Ga0373926_0002534 3300035083 Bacteria 5804
367 Ga0373944_0003584 3300035089 Bacteria 4012
368 Ga0373944_0006983 3300035089 Bacteria 3016
369 Ga0373923_0022562 3300035111 Bacteria 2470
370 Ga0373939_0006504 3300035114 Bacteria 2818
371 Ga0373941_0002007 3300035115 Bacteria 4411
372 Ga0373945_0002010 3300035116 Bacteria 6324
373 Ga0373953_0026835 3300035117 Bacteria 2209
374 Ga0373954_0004165 3300035118 Bacteria 6199
375 Ga0373956_0015614 3300035119 Bacteria 3183
376 Ga0373956_0018976 3300035119 Bacteria 2913
377 Ga0373956_0054032 3300035119 Bacteria 1809
378 Ga0373957_0008948 3300035120 Bacteria 3264
379 Ga0373957_0027438 3300035120 Bacteria 2068
380 Ga0373943_0001179 3300035170 Bacteria 11669
381 Ga0373943_0054528 3300035170 Bacteria 1978
382 Ga0373943_0076961 3300035170 Bacteria 1703
383 Ga0373946_0007928 3300035171 Bacteria 3898
384 Ga0373955_0007731 3300035172 Bacteria 4952
385 Ga0373955_0007784 3300035172 Bacteria 4938
386 Ga0316574_0055723 3300035398 Bacteria 2471
387 Ga0373924_0016492 3300035410 Bacteria 2820
388 Ga0373924_0023436 3300035410 Bacteria 2422
389 Ga0373931_0001020 3300035691 Bacteria 11821
390 Ga0373931_0011815 3300035691 Bacteria 4221
391 Ga0373931_0019764 3300035691 Bacteria 3365
392 Ga0373931_0034626 3300035691 Bacteria 2622
393 Ga0373931_0064720 3300035691 Bacteria 1980
394 Ga0373935_0010340 3300035692 Bacteria 5596
395 Ga0373935_0017541 3300035692 Bacteria 4345
396 Ga0373935_0018168 3300035692 Bacteria 4275
397 Ga0373935_0088165 3300035692 Bacteria 2027
398 Ga0373935_0165584 3300035692 Bacteria 1509
399 Ga0373935_0197549 3300035692 Bacteria 1388
400 Ga0373927_0000863 3300035695 Bacteria 23082
401 Ga0373927_0031034 3300035695 Bacteria 3485
402 Ga0373927_0034462 3300035695 Bacteria 3293
403 Ga0373927_0039932 3300035695 Bacteria 3045
404 Ga0373927_0066257 3300035695 Bacteria 2336
405 Ga0373933_0003790 3300035724 Bacteria 8353
406 Ga0373933_0004956 3300035724 Bacteria 7259
407 Ga0373933_0025115 3300035724 Bacteria 3415
408 Ga0373933_0059390 3300035724 Bacteria 2303
409 Ga0373933_0126992 3300035724 Bacteria 1601
410 Ga0373947_0001832 3300035725 Bacteria 13000
411 Ga0373947_0002147 3300035725 Bacteria 11983
412 Ga0373947_0013464 3300035725 Bacteria 4686
413 Ga0373947_0058003 3300035725 Bacteria 2344
414 Ga0373937_0006754 3300036401 Bacteria 9902
415 Ga0373937_0020608 3300036401 Bacteria 5910
416 Ga0373937_0033961 3300036401 Bacteria 4637
417 Ga0373937_0102431 3300036401 Bacteria 2658
418 Ga0373937_0318840 3300036401 Bacteria 1470
419 Ga0373925_0009283 3300037068 Bacteria 7159
420 Ga0373925_0045409 3300037068 Bacteria 3263
421 Ga0373925_0046170 3300037068 Bacteria 3238
422 Ga0373925_0052748 3300037068 Bacteria 3039
423 Ga0373925_0072113 3300037068 Bacteria 2613
424 Ga0395899_0000058 3300037312 Bacteria 213049
425 Ga0395899_0030218 3300037312 Bacteria 4075
426 Ga0395899_0083518 3300037312 Bacteria 2322
427 Ga0395900_0000056 3300037418 Bacteria 213077
428 Ga0395900_0010116 3300037418 Bacteria 9647
429 Ga0395900_0014386 3300037418 Bacteria 8076
430 Ga0395900_0083436 3300037418 Bacteria 3283
431 Ga0395900_0112730 3300037418 Bacteria 2792
432 Ga0395900_0167688 3300037418 Bacteria 2237
433 Ga0395898_0000114 3300037466 Bacteria 213068
434 Ga0395898_0002569 3300037466 Bacteria 21250
435 Ga0395898_0005741 3300037466 Bacteria 13364
436 Ga0395898_0094620 3300037466 Bacteria 2871
437 Ga0395898_0123107 3300037466 Bacteria 2485
438 Ga0395898_0166056 3300037466 Bacteria 2111
439 Ga0395905_0000053 3300037471 Bacteria 213077
440 Ga0395905_0024499 3300037471 Bacteria 5695
441 Ga0395905_0046908 3300037471 Bacteria 4050
442 Ga0395905_0121097 3300037471 Bacteria 2459
443 Ga0436364_0449051 3300037853 Bacteria 2311
444 Ga0395901_0000037 3300038443 Bacteria 213059
445 Ga0395901_0000475 3300038443 Bacteria 46590
446 Ga0395901_0003628 3300038443 Bacteria 15574
447 Ga0395901_0020312 3300038443 Bacteria 6799
448 Ga0395901_0112892 3300038443 Bacteria 2854
449 Ga0395901_0159547 3300038443 Bacteria 2368
450 Ga0400485_02815 3300038735 Bacteria 1954
451 Ga0400486_11742 3300038742 Bacteria 5223
452 Ga0400486_14182 3300038742 Bacteria 2420
453 Ga0400486_18730 3300038742 Bacteria 2024
454 Ga0436365_0178496 3300039437 Bacteria 3799
455 Ga0436365_0288317 3300039437 Bacteria 2387
456 Ga0436365_1057605 3300039437 Bacteria 25229
457 Ga0436365_1590566 3300039437 Bacteria 4260
458 Ga0436365_1912169 3300039437 Bacteria 3478
459 Ga0436361_0071538 3300039447 Bacteria 3954
460 Ga0436363_0258497 3300039450 Bacteria 2272
461 Ga0436362_0489397 3300039453 Bacteria 4764
462 Ga0439453_0001532 3300041408 Bacteria 2998
463 Ga0451835_0700172 3300041492 Bacteria 1631
464 Ga0451837_1310862 3300041494 Bacteria 1781
465 Ga0451839_0039662 3300041496 Bacteria 1797
466 Ga0451853_2638751 3300041512 Bacteria 2556
467 Ga0451577_0004453 3300042876 Bacteria 14797
468 Ga0451577_0030662 3300042876 Bacteria 4857
469 Ga0451577_0031785 3300042876 Bacteria 4761
470 Ga0451577_0053865 3300042876 Bacteria 3591
471 Ga0453683_0103144 3300044673 Bacteria 1791
472 Ga0466966_0022724 3300044684 Bacteria 4112
473 Ga0453684_0000020 3300044712 Bacteria 879938
474 Ga0453684_0000282 3300044712 Bacteria 219571
475 Ga0453684_0032236 3300044712 Bacteria 7341
476 Ga0453684_0076521 3300044712 Bacteria 4201
477 Ga0451576_0000056 3300045051 Bacteria 303398
478 Ga0451576_0000203 3300045051 Bacteria 149655
479 Ga0451576_0008846 3300045051 Bacteria 11762
480 Ga0451576_0036471 3300045051 Bacteria 5212
481 Ga0495592_0017067 3300046454 Bacteria 5511
482 Ga0495592_0141447 3300046454 Bacteria 1673
483 Ga0495629_0000484 3300046459 Bacteria 33317
484 Ga0495629_0151030 3300046459 Bacteria 1614
485 Ga0495638_0015798 3300046460 Bacteria 5057
486 Ga0495638_0031396 3300046460 Bacteria 3414
487 Ga0495638_0037537 3300046460 Bacteria 3081
488 Ga0495651_0000479 3300046462 Bacteria 30785
489 Ga0495651_0062050 3300046462 Bacteria 2860
490 Ga0495651_0159959 3300046462 Bacteria 1614
491 Ga0495653_0000553 3300046463 Bacteria 28588
492 Ga0495653_0061879 3300046463 Bacteria 2830
493 Ga0495653_0168944 3300046463 Bacteria 1511
494 Ga0495605_0035372 3300046474 Bacteria 2525
495 Ga0495605_0038700 3300046474 Bacteria 2391
496 Ga0495639_0013565 3300046475 Bacteria 3522
497 Ga0495662_0001111 3300046476 Bacteria 13243
498 Ga0495664_0000554 3300046477 Bacteria 18816
499 Ga0495664_0074099 3300046477 Bacteria 2036
500 Ga0495664_0084220 3300046477 Bacteria 1908
501 Ga0495584_0017349 3300046491 Bacteria 3666
502 Ga0495584_0050569 3300046491 Bacteria 2093
503 Ga0495585_0007429 3300046492 Bacteria 6710
504 Ga0495607_0023135 3300046501 Bacteria 3892
505 Ga0495610_0006295 3300046512 Bacteria 8219
506 Ga0495618_0002265 3300046514 Bacteria 12474
507 Ga0495618_0013332 3300046514 Bacteria 5003
508 Ga0495628_0002019 3300046516 Bacteria 18395
509 Ga0495628_0066858 3300046516 Bacteria 2809
510 Ga0495628_0075631 3300046516 Bacteria 2622
511 Ga0495628_0107988 3300046516 Bacteria 2142
512 Ga0495630_0016521 3300046517 Bacteria 5395
513 Ga0495630_0101373 3300046517 Bacteria 2178
514 Ga0495630_0120931 3300046517 Bacteria 1986
515 Ga0495630_0134283 3300046517 Bacteria 1880
516 Ga0495631_0011725 3300046518 Bacteria 4300
517 Ga0495632_0039975 3300046519 Bacteria 2364
518 Ga0495643_0007627 3300046522 Bacteria 6949
519 Ga0495643_0015371 3300046522 Bacteria 4524
520 Ga0495643_0035511 3300046522 Bacteria 2745
521 Ga0495648_0088055 3300046524 Bacteria 1746
522 Ga0495666_0052151 3300046526 Bacteria 1964
523 Ga0495652_0006322 3300046529 Bacteria 11034
524 Ga0495652_0009055 3300046529 Bacteria 9058
525 Ga0495652_0056892 3300046529 Bacteria 3319
526 Ga0495640_0003647 3300046533 Bacteria 12368
527 Ga0495640_0003693 3300046533 Bacteria 12300
528 Ga0495640_0091144 3300046533 Bacteria 2011
529 Ga0495587_0077366 3300046536 Bacteria 1932
530 Ga0495621_0015431 3300046539 Bacteria 2436
531 Ga0495597_0022900 3300046542 Bacteria 2893
532 Ga0495645_0002478 3300046543 Bacteria 12531
533 Ga0495645_0031880 3300046543 Bacteria 3842
534 Ga0495633_0012783 3300046558 Bacteria 4450
535 Ga0495667_0000938 3300046559 Bacteria 18799
536 Ga0495667_0003773 3300046559 Bacteria 10180
537 Ga0495656_0070647 3300046615 Bacteria 1550
538 Ga0495668_0024894 3300046616 Bacteria 3403
539 Ga0495634_0008546 3300046642 Bacteria 7611
540 Ga0495634_0011861 3300046642 Bacteria 6332
541 Ga0495634_0101543 3300046642 Bacteria 1858
542 Ga0495625_0030895 3300046660 Bacteria 3990
543 Ga0495635_0004485 3300046663 Bacteria 9673
544 Ga0495635_0021234 3300046663 Bacteria 4526
545 Ga0495635_0058726 3300046663 Bacteria 2646
546 Ga0495635_0126044 3300046663 Bacteria 1746
547 Ga0495588_0002054 3300046674 Bacteria 8610
548 Ga0495657_0025220 3300046675 Bacteria 4226
549 Ga0495599_0004891 3300046678 Bacteria 7967
550 Ga0495599_0035426 3300046678 Bacteria 3133
551 Ga0495623_0007569 3300046679 Bacteria 7049
552 Ga0495623_0109231 3300046679 Bacteria 1678
553 Ga0495646_0003324 3300046680 Bacteria 9995
554 Ga0495646_0019483 3300046680 Bacteria 4295
555 Ga0495658_0021232 3300046683 Bacteria 3421
556 Ga0495613_0055702 3300046689 Bacteria 2904
557 Ga0495624_0003208 3300046690 Bacteria 12188
558 Ga0495624_0064843 3300046690 Bacteria 2282
559 Ga0495624_0103059 3300046690 Bacteria 1756
560 Ga0495649_0032841 3300046694 Bacteria 2858
561 Ga0495649_0034714 3300046694 Bacteria 2775
562 Ga0495600_0007740 3300046809 Bacteria 6579
563 Ga0495600_0043215 3300046809 Bacteria 2938
564 Ga0495600_0106976 3300046809 Bacteria 1822
565 Ga0495660_0012714 3300046810 Bacteria 4883
566 Ga0495581_0013342 3300047315 Bacteria 4764
567 Ga0495581_0071665 3300047315 Bacteria 2005
568 Ga0495581_0080854 3300047315 Bacteria 1881
569 Ga0495604_0001116 3300047317 Bacteria 22267
570 Ga0495604_0001901 3300047317 Bacteria 16968
571 Ga0495604_0202439 3300047317 Bacteria 1376
572 Ga0495674_0005023 3300047319 Bacteria 12721
573 Ga0495674_0012447 3300047319 Bacteria 8016
574 Ga0495674_0054999 3300047319 Bacteria 3492
575 Ga0495687_012206 3300047443 Bacteria 4558
576 Ga0495675_0011655 3300047444 Bacteria 5520
577 Ga0495675_0020203 3300047444 Bacteria 4234
578 Ga0495685_006328 3300047447 Bacteria 3870
579 Ga0495681_0023489 3300047470 Bacteria 3273
580 Ga0495684_0003655 3300047471 Bacteria 11984
581 Ga0495684_0008513 3300047471 Bacteria 7946
582 Ga0495684_0023761 3300047471 Bacteria 4714
583 Ga0495684_0031461 3300047471 Bacteria 4073
584 Ga0495684_0183854 3300047471 Bacteria 1548
585 Ga0495686_0024414 3300047472 Bacteria 3972
586 Ga0495593_0033876 3300047673 Bacteria 2780
587 Ga0495593_0045049 3300047673 Bacteria 2356
588 Ga0495602_0002877 3300048088 Bacteria 17634
589 Ga0495602_0013293 3300048088 Bacteria 8418
590 Ga0496100_0009675 3300048903 Bacteria 5422
591 Ga0496100_0018641 3300048903 Bacteria 4121
592 Ga0496101_0001461 3300048904 Bacteria 14113
593 Ga0496102_0002294 3300048905 Bacteria 16341
594 Ga0496102_0165686 3300048905 Bacteria 2079
595 Ga0496102_0220397 3300048905 Bacteria 1788
596 Ga0496103_0007191 3300048906 Bacteria 6638
597 Ga0496103_0136186 3300048906 Bacteria 1569
598 Ga0496104_0000067 3300048907 Bacteria 108556
599 Ga0496104_0000275 3300048907 Bacteria 45789
600 Ga0496104_0008263 3300048907 Bacteria 9241
601 Ga0496104_0013356 3300048907 Bacteria 7399
602 Ga0496104_0030510 3300048907 Bacteria 5010
603 Ga0496104_0031348 3300048907 Bacteria 4943
604 Ga0496104_0043107 3300048907 Bacteria 4237
605 Ga0496104_0053180 3300048907 Bacteria 3825
606 Ga0496105_0000973 3300048908 Bacteria 19703
607 Ga0496105_0006553 3300048908 Bacteria 8957
608 Ga0496105_0013665 3300048908 Bacteria 6446
609 Ga0496105_0020573 3300048908 Bacteria 5334
610 Ga0496105_0059858 3300048908 Bacteria 3142
611 Ga0496105_0060449 3300048908 Bacteria 3127
612 Ga0496105_0066956 3300048908 Bacteria 2965
613 Ga0496106_0002640 3300048909 Bacteria 13331
614 Ga0496106_0028442 3300048909 Bacteria 4164
615 Ga0496106_0162532 3300048909 Bacteria 1766
616 Ga0496107_0003942 3300048910 Bacteria 9983
617 Ga0496107_0018342 3300048910 Bacteria 4927
618 Ga0496107_0038551 3300048910 Bacteria 3427
619 Ga0496107_0126425 3300048910 Bacteria 1885
620 Ga0496107_0127156 3300048910 Bacteria 1880
621 Ga0496107_0226034 3300048910 Unclassified 1392
622 Ga0496108_0000347 3300048911 Bacteria 39108
623 Ga0496108_0001531 3300048911 Bacteria 18306
624 Ga0496108_0005206 3300048911 Bacteria 10513
625 Ga0496108_0007453 3300048911 Bacteria 8870
626 Ga0496108_0022438 3300048911 Bacteria 5188
627 Ga0496108_0049056 3300048911 Bacteria 3531
628 Ga0496109_0017109 3300048912 Bacteria 6346
629 Ga0496109_0029291 3300048912 Bacteria 4930
630 Ga0496109_0054274 3300048912 Bacteria 3655
631 Ga0496109_0062750 3300048912 Bacteria 3398
632 Ga0496109_0081778 3300048912 Bacteria 2976
633 Ga0496110_0004026 3300048913 Bacteria 11332
634 Ga0496110_0044371 3300048913 Bacteria 3882
635 Ga0496110_0090852 3300048913 Bacteria 2730
636 Ga0496110_0138776 3300048913 Bacteria 2198
637 Ga0496110_0154168 3300048913 Bacteria 2081
638 Ga0496110_0202430 3300048913 Bacteria 1804
639 Ga0496111_0010222 3300048914 Bacteria 6287
640 Ga0496111_0021085 3300048914 Bacteria 4545
641 Ga0496111_0022726 3300048914 Bacteria 4393
642 Ga0496112_0001330 3300048915 Bacteria 18777
643 Ga0496112_0001338 3300048915 Bacteria 18736
644 Ga0496112_0108662 3300048915 Bacteria 2744
645 Ga0496112_0134418 3300048915 Bacteria 2444
646 Ga0496112_0219250 3300048915 Bacteria 1858
647 Ga0496112_0310449 3300048915 Bacteria 1522
648 Ga0496113_0002538 3300048916 Bacteria 10644
649 Ga0496113_0005068 3300048916 Bacteria 8178
650 Ga0496113_0023272 3300048916 Bacteria 4393
651 Ga0496113_0069310 3300048916 Bacteria 2678
652 Ga0496113_0126718 3300048916 Bacteria 2000
653 Ga0496114_0016997 3300048917 Bacteria 5866
654 Ga0496114_0019417 3300048917 Bacteria 5507
655 Ga0496114_0027325 3300048917 Bacteria 4673
656 Ga0496114_0032419 3300048917 Bacteria 4300
657 Ga0496114_0084827 3300048917 Bacteria 2683
658 Ga0496114_0194888 3300048917 Bacteria 1773
659 Ga0496115_0027048 3300048918 Bacteria 4484
660 Ga0496115_0082075 3300048918 Bacteria 2626
661 Ga0496116_0000057 3300048919 Bacteria 281652
662 Ga0496117_0000031 3300048920 Bacteria 381048
663 Ga0496118_0000208 3300048921 Bacteria 102645
664 Ga0496119_0022482 3300048922 Bacteria 4513
665 Ga0496119_0026171 3300048922 Bacteria 4052
666 Ga0496120_0000387 3300048923 Bacteria 71224
667 Ga0496120_0001163 3300048923 Bacteria 33701
668 Ga0496121_0151061 3300048924 Bacteria 1709
669 Ga0496122_0000023 3300048925 Bacteria 381035
670 Ga0496122_0001941 3300048925 Bacteria 31047
671 Ga0496123_0000027 3300048926 Bacteria 306773
672 Ga0496124_0008477 3300048927 Bacteria 10743
673 Ga0496125_0006385 3300048928 Bacteria 12774
674 Ga0496126_0000115 3300048929 Bacteria 188546
675 Ga0496126_0007940 3300048929 Bacteria 11536
676 Ga0496126_0044907 3300048929 Bacteria 4065
677 Ga0495678_020781 3300049459 Bacteria 2900
678 Ga0501031_0001804 3300049568 Bacteria 13455
679 Ga0501031_0024114 3300049568 Bacteria 3966
680 Ga0501031_0026160 3300049568 Bacteria 3806
681 Ga0501031_0033350 3300049568 Bacteria 3358
682 Ga0501031_0036581 3300049568 Bacteria 3202
683 Ga0501031_0052065 3300049568 Bacteria 2668
684 Ga0501032_0000006 3300049569 Bacteria 261727
685 Ga0501032_0000013 3300049569 Bacteria 185070
686 Ga0501032_0000070 3300049569 Bacteria 86244
687 Ga0501032_0004321 3300049569 Bacteria 10735
688 Ga0501032_0021745 3300049569 Bacteria 4457
689 Ga0501032_0036616 3300049569 Bacteria 3348
690 Ga0501032_0131157 3300049569 Bacteria 1653
691 Ga0501033_0000039 3300049570 Bacteria 142732
692 Ga0501033_0000293 3300049570 Bacteria 48186
693 Ga0501033_0002577 3300049570 Bacteria 15288
694 Ga0501033_0003047 3300049570 Bacteria 13931
695 Ga0501033_0007570 3300049570 Bacteria 8449
696 Ga0501033_0024751 3300049570 Bacteria 4526
697 Ga0501033_0050865 3300049570 Bacteria 3072
698 Ga0501033_0068165 3300049570 Bacteria 2616
699 Ga0501033_0094860 3300049570 Bacteria 2181
700 Ga0501033_0187861 3300049570 Bacteria 1479
701 Ga0501034_0000001 3300049571 Bacteria 2184493
702 Ga0501034_0000023 3300049571 Bacteria 263892
703 Ga0501034_0000030 3300049571 Bacteria 248180
704 Ga0501034_0000374 3300049571 Bacteria 76280
705 Ga0501034_0000702 3300049571 Bacteria 50840
706 Ga0501034_0000959 3300049571 Bacteria 41631
707 Ga0501034_0014630 3300049571 Bacteria 8079
708 Ga0501034_0024527 3300049571 Bacteria 6136
709 Ga0501034_0035055 3300049571 Bacteria 5089
710 Ga0501034_0054458 3300049571 Bacteria 4027
711 Ga0501034_0055429 3300049571 Bacteria 3989
712 Ga0501034_0071493 3300049571 Bacteria 3479
713 Ga0501034_0095010 3300049571 Bacteria 2977
714 Ga0501034_0097002 3300049571 Bacteria 2944
715 Ga0501034_0113819 3300049571 Bacteria 2695
716 Ga0501034_0124406 3300049571 Bacteria 2564
717 Ga0501034_0178863 3300049571 Bacteria 2087
718 Ga0501034_0197398 3300049571 Bacteria 1972
719 Ga0501034_0200342 3300049571 Bacteria 1955
720 Ga0501034_0320365 3300049571 Bacteria 1483
721 Ga0501036_0000003 3300049572 Bacteria 261545
722 Ga0501036_0000412 3300049572 Bacteria 30187
723 Ga0501036_0003886 3300049572 Bacteria 11990
724 Ga0501036_0005528 3300049572 Bacteria 10253
725 Ga0501036_0020737 3300049572 Bacteria 5519
726 Ga0501036_0033174 3300049572 Bacteria 4366
727 Ga0501036_0068022 3300049572 Bacteria 3014
728 Ga0501036_0116328 3300049572 Bacteria 2258
729 Ga0501036_0118539 3300049572 Bacteria 2235
730 Ga0501037_0000003 3300049573 Bacteria 261548
731 Ga0501037_0000007 3300049573 Bacteria 215187
732 Ga0501037_0001208 3300049573 Bacteria 19095
733 Ga0501037_0004329 3300049573 Bacteria 10302
734 Ga0501037_0008498 3300049573 Bacteria 7528
735 Ga0501037_0027893 3300049573 Bacteria 4172
736 Ga0501037_0093133 3300049573 Bacteria 2179
737 Ga0501037_0099748 3300049573 Bacteria 2097
738 Ga0501037_0191839 3300049573 Bacteria 1446
739 Ga0501038_0000004 3300049574 Bacteria 261289
740 Ga0501038_0000040 3300049574 Bacteria 121177
741 Ga0501038_0004971 3300049574 Bacteria 12354
742 Ga0501038_0018824 3300049574 Bacteria 6233
743 Ga0501038_0060712 3300049574 Bacteria 3235
744 Ga0501038_0127911 3300049574 Bacteria 2089
745 Ga0501038_0133905 3300049574 Bacteria 2032
746 Ga0501038_0142068 3300049574 Bacteria 1963
747 Ga0501038_0144129 3300049574 Bacteria 1946
748 Ga0501038_0160557 3300049574 Bacteria 1827
749 Ga0501039_0000001 3300049575 Bacteria 449008
750 Ga0501039_0000008 3300049575 Bacteria 274778
751 Ga0501039_0000188 3300049575 Bacteria 44404
752 Ga0501039_0009966 3300049575 Bacteria 7243
753 Ga0501039_0020438 3300049575 Bacteria 5074
754 Ga0501039_0087954 3300049575 Bacteria 2420
755 Ga0501039_0247819 3300049575 Bacteria 1401
756 Ga0501040_0004945 3300049576 Bacteria 8627
757 Ga0501040_0051346 3300049576 Bacteria 2821
758 Ga0501041_0032662 3300049577 Bacteria 3146
759 Ga0501042_0039402 3300049578 Bacteria 3357
760 Ga0501042_0050716 3300049578 Bacteria 2960
761 Ga0501042_0092954 3300049578 Bacteria 2166
762 Ga0501043_0000019 3300049579 Bacteria 155347
763 Ga0501043_0000034 3300049579 Bacteria 133724
764 Ga0501043_0000177 3300049579 Bacteria 56981
765 Ga0501043_0008300 3300049579 Bacteria 8178
766 Ga0501043_0010760 3300049579 Bacteria 7165
767 Ga0501043_0026048 3300049579 Bacteria 4588
768 Ga0501043_0031291 3300049579 Bacteria 4184
769 Ga0501043_0047470 3300049579 Bacteria 3376
770 Ga0501043_0162417 3300049579 Bacteria 1745
771 Ga0501046_0001179 3300049580 Bacteria 25420
772 Ga0501046_0007256 3300049580 Bacteria 9746
773 Ga0501046_0016030 3300049580 Bacteria 6286
774 Ga0501046_0095970 3300049580 Bacteria 2278
775 Ga0501046_0112901 3300049580 Bacteria 2074
776 Ga0501047_0004025 3300049581 Bacteria 13820
777 Ga0501047_0006184 3300049581 Bacteria 11259
778 Ga0501047_0007110 3300049581 Bacteria 10513
779 Ga0501047_0013347 3300049581 Bacteria 7785
780 Ga0501047_0017714 3300049581 Bacteria 6822
781 Ga0501047_0034936 3300049581 Bacteria 4854
782 Ga0501047_0038409 3300049581 Bacteria 4632
783 Ga0501047_0040143 3300049581 Bacteria 4526
784 Ga0501047_0049215 3300049581 Bacteria 4070
785 Ga0501047_0056861 3300049581 Bacteria 3784
786 Ga0501047_0086988 3300049581 Bacteria 3003
787 Ga0501047_0122721 3300049581 Bacteria 2479
788 Ga0501047_0269354 3300049581 Bacteria 1549
789 Ga0501048_0076927 3300049582 Bacteria 2355
790 Ga0501048_0168825 3300049582 Bacteria 1549
791 Ga0501067_0000044 3300049583 Bacteria 74423
792 Ga0501067_0000085 3300049583 Bacteria 54351
793 Ga0501067_0010712 3300049583 Bacteria 5072
794 Ga0501068_0000862 3300049584 Bacteria 15792
795 Ga0501068_0000900 3300049584 Bacteria 15544
796 Ga0501068_0040570 3300049584 Bacteria 2795
797 Ga0501069_0000017 3300049585 Bacteria 141492
798 Ga0501069_0000504 3300049585 Bacteria 17826
799 Ga0501069_0000608 3300049585 Bacteria 16558
800 Ga0501069_0001495 3300049585 Bacteria 11539
801 Ga0501069_0005634 3300049585 Bacteria 6517
802 Ga0501070_0000223 3300049586 Bacteria 53874
803 Ga0501070_0000275 3300049586 Bacteria 48299
804 Ga0501070_0001269 3300049586 Bacteria 22673
805 Ga0501070_0015276 3300049586 Bacteria 6461
806 Ga0501070_0020182 3300049586 Bacteria 5590
807 Ga0501070_0034753 3300049586 Bacteria 4213
808 Ga0501070_0067697 3300049586 Bacteria 2957
809 Ga0501070_0073821 3300049586 Bacteria 2823
810 Ga0501070_0082668 3300049586 Bacteria 2658
811 Ga0501070_0089715 3300049586 Bacteria 2544
812 Ga0501070_0117981 3300049586 Bacteria 2192
813 Ga0501070_0148553 3300049586 Bacteria 1934
814 Ga0501070_0216934 3300049586 Bacteria 1570
815 Ga0501071_0001509 3300049587 Bacteria 13526
816 Ga0501071_0003548 3300049587 Bacteria 9765
817 Ga0501071_0007369 3300049587 Bacteria 7215
818 Ga0501071_0030303 3300049587 Bacteria 3826
819 Ga0501072_0002643 3300049588 Bacteria 13431
820 Ga0501072_0006941 3300049588 Bacteria 8597
821 Ga0501072_0042017 3300049588 Bacteria 3591
822 Ga0501072_0049383 3300049588 Bacteria 3312
823 Ga0501072_0052678 3300049588 Bacteria 3204
824 Ga0501072_0066784 3300049588 Bacteria 2838
825 Ga0501072_0076632 3300049588 Bacteria 2646
826 Ga0501072_0159536 3300049588 Bacteria 1799
827 Ga0501073_0000007 3300049589 Bacteria 227229
828 Ga0501073_0005889 3300049589 Bacteria 9148
829 Ga0501073_0023267 3300049589 Bacteria 4451
830 Ga0501073_0031716 3300049589 Bacteria 3770
831 Ga0501073_0040293 3300049589 Bacteria 3307
832 Ga0501073_0049159 3300049589 Bacteria 2957
833 Ga0501073_0060156 3300049589 Bacteria 2651
834 Ga0501074_0000060 3300049590 Bacteria 54314
835 Ga0501074_0000664 3300049590 Bacteria 21423
836 Ga0501074_0004007 3300049590 Bacteria 10496
837 Ga0501074_0034900 3300049590 Bacteria 3645
838 Ga0501074_0039974 3300049590 Bacteria 3396
839 Ga0501074_0041493 3300049590 Bacteria 3331
840 Ga0501076_0008099 3300049592 Bacteria 7684
841 Ga0501076_0039233 3300049592 Bacteria 3718
842 Ga0501076_0111806 3300049592 Bacteria 2208
843 Ga0501076_0147593 3300049592 Bacteria 1913
844 Ga0501077_0000003 3300049593 Bacteria 143061
845 Ga0501077_0029923 3300049593 Bacteria 3463
846 Ga0501079_0003533 3300049741 Bacteria 11487
847 Ga0501079_0028248 3300049741 Bacteria 4304
848 Ga0501079_0036203 3300049741 Bacteria 3802
849 Ga0501079_0107780 3300049741 Bacteria 2162
850 Ga0501079_0177508 3300049741 Bacteria 1661
851 Ga0501080_0000988 3300049742 Bacteria 23309
852 Ga0501080_0001013 3300049742 Bacteria 23083
853 Ga0501080_0004825 3300049742 Bacteria 12024
854 Ga0501080_0013088 3300049742 Bacteria 7619
855 Ga0501080_0015899 3300049742 Bacteria 6941
856 Ga0501080_0024335 3300049742 Bacteria 5614
857 Ga0501080_0025960 3300049742 Bacteria 5442
858 Ga0501080_0039526 3300049742 Bacteria 4402
859 Ga0501080_0052234 3300049742 Bacteria 3804
860 Ga0501080_0072218 3300049742 Bacteria 3211
861 Ga0501080_0145684 3300049742 Bacteria 2189
862 Ga0501081_0034304 3300049743 Bacteria 3452
863 Ga0501081_0091307 3300049743 Bacteria 2141
864 Ga0501081_0116363 3300049743 Bacteria 1901
865 Ga0501083_0000511 3300049744 Bacteria 24743
866 Ga0501083_0000560 3300049744 Bacteria 23861
867 Ga0501083_0005924 3300049744 Bacteria 8653
868 Ga0501083_0009206 3300049744 Bacteria 6975
869 Ga0501083_0012418 3300049744 Bacteria 5959
870 Ga0501035_0000112 3300049822 Bacteria 99138
871 Ga0501035_0000159 3300049822 Bacteria 82264
872 Ga0501035_0000488 3300049822 Bacteria 44586
873 Ga0501035_0000772 3300049822 Bacteria 34369
874 Ga0501035_0004717 3300049822 Bacteria 12947
875 Ga0501035_0021721 3300049822 Bacteria 5901
876 Ga0501035_0035083 3300049822 Bacteria 4555
877 Ga0501035_0066823 3300049822 Bacteria 3190
878 Ga0501035_0073609 3300049822 Bacteria 3023
879 Ga0501035_0211521 3300049822 Bacteria 1659
880 Ga0501044_0000008 3300049823 Bacteria 274778
881 Ga0501044_0000010 3300049823 Bacteria 260121
882 Ga0501044_0000411 3300049823 Bacteria 52862
883 Ga0501044_0012445 3300049823 Bacteria 9213
884 Ga0501044_0037724 3300049823 Bacteria 5049
885 Ga0501044_0043987 3300049823 Bacteria 4637
886 Ga0501044_0046666 3300049823 Bacteria 4484
887 Ga0501044_0047924 3300049823 Bacteria 4418
888 Ga0501044_0076966 3300049823 Bacteria 3384
889 Ga0501044_0109952 3300049823 Bacteria 2765
890 Ga0501044_0184955 3300049823 Bacteria 2049
891 Ga0501044_0187854 3300049823 Bacteria 2030
892 Ga0501044_0211777 3300049823 Bacteria 1892
893 Ga0501045_0044118 3300049824 Bacteria 3247
894 Ga0501045_0049040 3300049824 Bacteria 3078
895 nmdc:mga03683_4054_c1 3300050489 Bacteria 4809
896 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
897 nmdc:mga00v17_72749_c1 3300050491 Bacteria 2133
898 nmdc:mga0yw44_1745_c1 3300050492 Bacteria 8845
899 nmdc:mga0yw44_22295_c1 3300050492 Bacteria 3549
900 nmdc:mga0yw44_3742_c1 3300050492 Bacteria 6813
901 nmdc:mga0yw44_8062_c1 3300050492 Bacteria 5226
902 nmdc:mga06z11_2118_c1 3300050494 Bacteria 7526
903 nmdc:mga06z11_32585_c1 3300050494 Bacteria 2543
904 nmdc:mga06z11_59503_c1 3300050494 Bacteria 1986
905 nmdc:mga06z11_7889_c1 3300050494 Bacteria 4408
906 nmdc:mga04h51_44700_c1 3300050495 Bacteria 1462
907 nmdc:mga07m45_92793_c1 3300050496 Bacteria 1730
908 nmdc:mga05p37_137727_c1 3300050507 Bacteria 2992
909 nmdc:mga05p37_151548_c1 3300050507 Bacteria 2835
910 nmdc:mga05p37_183433_c1 3300050507 Bacteria 2545
911 nmdc:mga05p37_305_c1 3300050507 Bacteria 51585
912 nmdc:mga05p37_5814_c1 3300050507 Bacteria 14500
913 nmdc:mga09592_1154_c1 3300050508 Bacteria 21059
914 nmdc:mga0qj67_140025_c1 3300050509 Bacteria 1961
915 nmdc:mga0qj67_24382_c1 3300050509 Bacteria 4662
916 nmdc:mga0qj67_412_c1 3300050509 Bacteria 29289
917 nmdc:mga0qj67_42917_c1 3300050509 Bacteria 3561
918 nmdc:mga0qj67_52286_c1 3300050509 Bacteria 3232
919 nmdc:mga06r32_1000_c1 3300050510 Bacteria 25335
920 nmdc:mga06r32_111318_c1 3300050510 Bacteria 2694
921 nmdc:mga06r32_133220_c1 3300050510 Bacteria 2459
922 nmdc:mga06r32_196912_c1 3300050510 Bacteria 2002
923 nmdc:mga06r32_20818_c1 3300050510 Bacteria 6044
924 nmdc:mga06r32_24274_c1 3300050510 Bacteria 5623
925 nmdc:mga06r32_50797_c1 3300050510 Bacteria 3966
926 nmdc:mga08y16_140156_c1 3300050511 Bacteria 2514
927 nmdc:mga08y16_22596_c1 3300050511 Bacteria 6641
928 nmdc:mga08y16_92508_c1 3300050511 Bacteria 3151
929 nmdc:mga0n895_117665_c1 3300050512 Bacteria 2677
930 nmdc:mga0n895_189257_c1 3300050512 Bacteria 2089
931 nmdc:mga0n895_270806_c1 3300050512 Unclassified 1722
932 nmdc:mga0n895_33055_c1 3300050512 Bacteria 4969
933 nmdc:mga0n895_53506_c1 3300050512 Bacteria 3966
934 nmdc:mga0n895_58688_c1 3300050512 Bacteria 3794
935 nmdc:mga0n895_69536_c1 3300050512 Bacteria 3488
936 nmdc:mga0n895_75677_c1 3300050512 Bacteria 3346
937 nmdc:mga0rr50_30851_c1 3300050513 Bacteria 3800
938 nmdc:mga0rr50_33999_c1 3300050513 Bacteria 3647
939 nmdc:mga0rr50_6667_c1 3300050513 Bacteria 7061
940 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
941 nmdc:mga08x19_43298_c1 3300050514 Bacteria 2872
942 nmdc:mga0sz30_95_c1 3300050516 Bacteria 33938
943 Ga0495601_0000482 3300053077 Bacteria 20947
944 Ga0495601_0004823 3300053077 Bacteria 7820
945 Ga0495601_0022185 3300053077 Bacteria 3896
946 Ga0495601_0037926 3300053077 Bacteria 3012
947 Ga0495601_0058528 3300053077 Bacteria 2442
948 Ga0495601_0088544 3300053077 Bacteria 1990
949 Ga0495612_0000671 3300053078 Bacteria 13820
950 Ga0495612_0004190 3300053078 Bacteria 5978
951 Ga0495655_0000500 3300053083 Bacteria 6520
952 Ga0495595_0002943 3300053084 Bacteria 6720
953 Ga0495595_0004391 3300053084 Bacteria 5674
954 Ga0495595_0009163 3300053084 Bacteria 4089
955 Ga0495595_0028307 3300053084 Bacteria 2503
956 Ga0495619_0000426 3300053085 Bacteria 28605
957 Ga0495619_0006508 3300053085 Bacteria 7391
958 Ga0495619_0007493 3300053085 Bacteria 6912
959 Ga0495619_0015287 3300053085 Bacteria 4854
960 Ga0495619_0054246 3300053085 Bacteria 2652
961 Ga0500643_007497 3300053087 Bacteria 4388
962 Ga0500651_0071553 3300053093 Bacteria 2158
963 Ga0500641_0007870 3300053096 Bacteria 3800
964 Ga0500641_0012417 3300053096 Bacteria 3110
965 Ga0500556_0000054 3300053104 Bacteria 115949
966 Ga0500572_009569 3300053111 Bacteria 2295
967 Ga0500595_005643 3300053119 Bacteria 5438
968 Ga0500658_0000093 3300053134 Bacteria 41128
969 Ga0500559_0002458 3300053136 Bacteria 9585
970 Ga0500561_0000122 3300053137 Bacteria 14939
971 Ga0500568_0000188 3300053139 Bacteria 54105
972 Ga0500568_0008308 3300053139 Bacteria 5016
973 Ga0500616_0017112 3300053153 Bacteria 4117
974 Ga0500620_000445 3300053155 Bacteria 7473
975 Ga0500624_000810 3300053157 Bacteria 7240
976 Ga0500634_0001545 3300053161 Bacteria 9045
977 Ga0500636_0000030 3300053177 Bacteria 77501
978 Ga0500636_0002620 3300053177 Bacteria 9993
979 Ga0500645_001927 3300053730 Bacteria 9861
980 Ga0501084_0013749 3300054114 Bacteria 6698
981 Ga0501084_0026596 3300054114 Bacteria 4829
982 Ga0501084_0034070 3300054114 Bacteria 4258
983 Ga0501084_0045705 3300054114 Bacteria 3666
984 Ga0501084_0053125 3300054114 Bacteria 3389
985 Ga0501084_0202853 3300054114 Bacteria 1673
986 Ga0501084_0245700 3300054114 Bacteria 1511
987 Ga0501084_0264739 3300054114 Bacteria 1451
988 Ga0501082_0011519 3300060353 Bacteria 7612
989 Ga0501082_0025365 3300060353 Bacteria 5108
990 Ga0501082_0035304 3300060353 Bacteria 4309
991 Ga0501082_0053623 3300060353 Bacteria 3475
992 Ga0501082_0081043 3300060353 Bacteria 2801
993 Ga0501082_0085786 3300060353 Bacteria 2715
994 Ga0501082_0215442 3300060353 Bacteria 1671
995 Ga0466962_0057962 3300061719 Bacteria 1849
996 Ga0530510_0014732 3300061734 Bacteria 5521
997 Ga0530510_0104378 3300061734 Bacteria 2074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0126992 Ga0373933_0126992_75_1313 334
2 3300005530 Ga0070679_100220778 Ga0070679_1002207781 353
3 3300025912 Ga0207707_10001567 Ga0207707_100015672 353
4 3300025917 Ga0207660_10033189 Ga0207660_100331895 353
5 3300025921 Ga0207652_10013529 Ga0207652_100135297 353
6 3300049571 Ga0501034_0000959 Ga0501034_0000959_7973_9358 353
7 3300049581 Ga0501047_0056861 Ga0501047_0056861_302_1540 353
8 3300049583 Ga0501067_0000044 Ga0501067_0000044_62282_63667 353
9 3300049584 Ga0501068_0000862 Ga0501068_0000862_4050_5288 353
10 3300049584 Ga0501068_0000900 Ga0501068_0000900_3586_4971 353
11 3300049585 Ga0501069_0000504 Ga0501069_0000504_2110_3495 353
12 3300049585 Ga0501069_0000608 Ga0501069_0000608_3918_5156 353
13 3300049586 Ga0501070_0000223 Ga0501070_0000223_14975_16360 353
14 3300049587 Ga0501071_0001509 Ga0501071_0001509_4554_5939 353
15 3300049587 Ga0501071_0007369 Ga0501071_0007369_4571_5809 353
16 3300049588 Ga0501072_0006941 Ga0501072_0006941_4390_5775 353
17 3300049588 Ga0501072_0052678 Ga0501072_0052678_1426_2664 353
18 3300049590 Ga0501074_0000664 Ga0501074_0000664_2666_4051 353
19 3300049741 Ga0501079_0177508 Ga0501079_0177508_42_1427 353
20 3300049744 Ga0501083_0000560 Ga0501083_0000560_11601_12986 353
21 3300049744 Ga0501083_0012418 Ga0501083_0012418_2319_3557 353
22 3300054114 Ga0501084_0013749 Ga0501084_0013749_4404_5789 353
23 3300060353 Ga0501082_0035304 Ga0501082_0035304_669_1907 353
24 3300060353 Ga0501082_0085786 Ga0501082_0085786_1297_2682 353
25 iso_pu_bacteria 2958144490 2958151835 353
26 3300006844 Ga0075428_100018779 Ga0075428_1000187793 354
27 3300006846 Ga0075430_100074556 Ga0075430_1000745562 354
28 3300050507 nmdc:mga05p37_151548_c1 nmdc:mga05p37_151548_c1_1448_2812 354
29 3300050509 nmdc:mga0qj67_52286_c1 nmdc:mga0qj67_52286_c1_405_1769 354
30 3300050510 nmdc:mga06r32_50797_c1 nmdc:mga06r32_50797_c1_283_1647 354
31 3300037418 Ga0395900_0083436 Ga0395900_0083436_29_1120 357
32 3300005937 Ga0081455_10028423 Ga0081455_100284235 358
33 3300049573 Ga0501037_0093133 Ga0501037_0093133_66_1364 359
34 3300049574 Ga0501038_0133905 Ga0501038_0133905_537_1835 359
35 3300049580 Ga0501046_0007256 Ga0501046_0007256_1626_2924 359
36 3300049586 Ga0501070_0089715 Ga0501070_0089715_1081_2379 359
37 3300049822 Ga0501035_0021721 Ga0501035_0021721_1105_2403 359
38 iso_pu_bacteria 2878788777 2878796054 359
39 3300025292 Ga0209676_1000093 Ga0209676_10000937 361
40 3300046674 Ga0495588_0002054 Ga0495588_0002054_3019_4404 361
41 3300047470 Ga0495681_0023489 Ga0495681_0023489_772_2163 361
42 3300003856 Ga0058692_1003021 Ga0058692_10030213 362
43 3300005983 Ga0081540_1007590 Ga0081540_10075907 362
44 3300027312 Ga0209371_1000911 Ga0209371_10009114 362
45 3300030500 Ga0268256_1001490 Ga0268256_10014902 362
46 3300005364 Ga0070673_100118650 Ga0070673_1001186502 364
47 3300005471 Ga0070698_100015927 Ga0070698_1000159278 364
48 3300005518 Ga0070699_100168389 Ga0070699_1001683892 364
49 3300013296 Ga0157374_10117779 Ga0157374_101177792 364
50 3300014497 Ga0182008_10017764 Ga0182008_100177643 364
51 3300025922 Ga0207646_10139417 Ga0207646_101394172 364
52 3300025923 Ga0207681_10176282 Ga0207681_101762822 364
53 3300042876 Ga0451577_0004453 Ga0451577_0004453_7863_9203 364
54 3300042876 Ga0451577_0031785 Ga0451577_0031785_2499_3842 364
55 3300042876 Ga0451577_0053865 Ga0451577_0053865_1274_2617 364
56 3300044712 Ga0453684_0000282 Ga0453684_0000282_56077_57417 364
57 3300044712 Ga0453684_0032236 Ga0453684_0032236_1372_2715 364
58 3300048915 Ga0496112_0134418 Ga0496112_0134418_1073_2413 364
59 3300049571 Ga0501034_0113819 Ga0501034_0113819_845_2296 364
60 3300049586 Ga0501070_0216934 Ga0501070_0216934_13_1320 364
61 3300049823 Ga0501044_0184955 Ga0501044_0184955_443_1894 364
62 iso_pu_bacteria 2922130491 2922136194 364
63 3300049571 Ga0501034_0320365 Ga0501034_0320365_90_1382 365
64 3300049581 Ga0501047_0269354 Ga0501047_0269354_182_1474 365
65 3300049585 Ga0501069_0005634 Ga0501069_0005634_5035_6429 365
66 3300049590 Ga0501074_0039974 Ga0501074_0039974_43_1437 365
67 3300049742 Ga0501080_0024335 Ga0501080_0024335_427_1821 365
68 3300054114 Ga0501084_0202853 Ga0501084_0202853_134_1528 365
69 3300006048 Ga0075363_100005619 Ga0075363_1000056191 366
70 3300006051 Ga0075364_10037772 Ga0075364_100377721 366
71 3300006178 Ga0075367_10003717 Ga0075367_100037177 366
72 3300006178 Ga0075367_10015700 Ga0075367_100157001 366
73 3300050494 nmdc:mga06z11_32585_c1 nmdc:mga06z11_32585_c1_775_2229 366
74 3300046558 Ga0495633_0012783 Ga0495633_0012783_1979_3364 367
75 3300046679 Ga0495623_0109231 Ga0495623_0109231_11_1114 367
76 3300048905 Ga0496102_0220397 Ga0496102_0220397_103_1377 367
77 3300048907 Ga0496104_0043107 Ga0496104_0043107_2651_4051 367
78 3300048908 Ga0496105_0060449 Ga0496105_0060449_371_1771 367
79 3300048911 Ga0496108_0049056 Ga0496108_0049056_668_2068 367
80 3300048913 Ga0496110_0138776 Ga0496110_0138776_205_1605 367
81 3300048913 Ga0496110_0202430 Ga0496110_0202430_145_1545 367
82 3300048915 Ga0496112_0108662 Ga0496112_0108662_351_1751 367
83 3300049743 Ga0501081_0116363 Ga0501081_0116363_471_1832 367
84 3300053111 Ga0500572_009569 Ga0500572_009569_604_1986 367
85 3300053157 Ga0500624_000810 Ga0500624_000810_2889_4274 367
86 3300053161 Ga0500634_0001545 Ga0500634_0001545_7314_8699 367
87 iso_pu_bacteria 2855020534 2855021215 367
88 3300009094 Ga0111539_10239265 Ga0111539_102392652 368
89 3300048925 Ga0496122_0001941 Ga0496122_0001941_6200_7576 368
90 3300050510 nmdc:mga06r32_111318_c1 nmdc:mga06r32_111318_c1_1312_2631 368
91 3300039453 Ga0436362_0489397 Ga0436362_0489397_1290_2534 369
92 3300046459 Ga0495629_0151030 Ga0495629_0151030_54_1499 370
93 3300050512 nmdc:mga0n895_270806_c1 nmdc:mga0n895_270806_c1_17_1375 370
94 3300031711 Ga0265314_10013823 Ga0265314_100138233 371
95 3300042876 Ga0451577_0030662 Ga0451577_0030662_3681_4796 371
96 3300050512 nmdc:mga0n895_189257_c1 nmdc:mga0n895_189257_c1_898_2013 371
97 3300049571 Ga0501034_0178863 Ga0501034_0178863_668_2020 372
98 3300037312 Ga0395899_0030218 Ga0395899_0030218_630_2069 373
99 3300037418 Ga0395900_0010116 Ga0395900_0010116_267_1706 373
100 3300037466 Ga0395898_0005741 Ga0395898_0005741_7890_9329 373
101 3300038443 Ga0395901_0003628 Ga0395901_0003628_725_2164 373
102 iso_pu_bacteria 2903513507 2903519555 373
103 iso_pu_bacteria 2970532167 2970538988 373
104 3300005262 Ga0065165_1000558 Ga0065165_100055847 374
105 3300005563 Ga0068855_100027185 Ga0068855_1000271854 374
106 3300010375 Ga0105239_10132102 Ga0105239_101321022 374
107 3300025284 Ga0209130_1000100 Ga0209130_100010049 374
108 3300003856 Ga0058692_1000534 Ga0058692_100053412 375
109 3300005937 Ga0081455_10036290 Ga0081455_100362901 375
110 3300009147 Ga0114129_10088526 Ga0114129_100885262 375
111 3300025294 Ga0209025_1001149 Ga0209025_100114928 376
112 3300035083 Ga0373926_0002534 Ga0373926_0002534_3052_4398 376
113 3300035089 Ga0373944_0003584 Ga0373944_0003584_744_2090 376
114 3300035119 Ga0373956_0018976 Ga0373956_0018976_297_1682 376
115 3300035120 Ga0373957_0008948 Ga0373957_0008948_775_2160 376
116 3300035170 Ga0373943_0001179 Ga0373943_0001179_8639_9985 376
117 3300035171 Ga0373946_0007928 Ga0373946_0007928_1751_3097 376
118 3300035410 Ga0373924_0023436 Ga0373924_0023436_102_1487 376
119 3300035692 Ga0373935_0010340 Ga0373935_0010340_211_1557 376
120 3300035695 Ga0373927_0000863 Ga0373927_0000863_13688_15034 376
121 3300035725 Ga0373947_0001832 Ga0373947_0001832_11214_12560 376
122 3300036401 Ga0373937_0006754 Ga0373937_0006754_4443_5828 376
123 3300037068 Ga0373925_0045409 Ga0373925_0045409_1421_2767 376
124 3300044673 Ga0453683_0103144 Ga0453683_0103144_122_1426 376
125 3300045051 Ga0451576_0000203 Ga0451576_0000203_23670_24974 376
126 3300046517 Ga0495630_0120931 Ga0495630_0120931_422_1768 376
127 3300046533 Ga0495640_0091144 Ga0495640_0091144_498_1844 376
128 3300046663 Ga0495635_0126044 Ga0495635_0126044_19_1365 376
129 3300046689 Ga0495613_0055702 Ga0495613_0055702_909_2255 376
130 3300046690 Ga0495624_0003208 Ga0495624_0003208_7700_9046 376
131 3300047315 Ga0495581_0013342 Ga0495581_0013342_2011_3357 376
132 3300047471 Ga0495684_0003655 Ga0495684_0003655_6840_8186 376
133 3300006871 Ga0075434_100039472 Ga0075434_1000394723 377
134 3300007076 Ga0075435_100006471 Ga0075435_1000064715 377
135 3300049588 Ga0501072_0042017 Ga0501072_0042017_1264_2607 377
136 3300049592 Ga0501076_0039233 Ga0501076_0039233_1207_2550 377
137 3300049741 Ga0501079_0028248 Ga0501079_0028248_1024_2367 377
138 3300049743 Ga0501081_0034304 Ga0501081_0034304_1236_2579 377
139 3300050512 nmdc:mga0n895_33055_c1 nmdc:mga0n895_33055_c1_2689_4032 377
140 3300050513 nmdc:mga0rr50_6667_c1 nmdc:mga0rr50_6667_c1_4227_5570 377
141 3300060353 Ga0501082_0081043 Ga0501082_0081043_882_2225 377
142 3300003790 Ga0055528_1016405 Ga0055528_10164052 379
143 3300005340 Ga0070689_100013888 Ga0070689_1000138882 379
144 3300025273 Ga0209673_1003238 Ga0209673_10032384 379
145 3300025297 Ga0209758_1010083 Ga0209758_10100834 379
146 3300025934 Ga0207686_10068064 Ga0207686_100680642 379
147 3300025936 Ga0207670_10005481 Ga0207670_100054812 379
148 3300025960 Ga0207651_10006399 Ga0207651_100063995 379
149 3300028794 Ga0307515_10002808 Ga0307515_100028089 379
150 3300041492 Ga0451835_0700172 Ga0451835_0700172_113_1501 379
151 3300041494 Ga0451837_1310862 Ga0451837_1310862_80_1468 379
152 3300041496 Ga0451839_0039662 Ga0451839_0039662_96_1484 379
153 3300041512 Ga0451853_2638751 Ga0451853_2638751_982_2370 379
154 3300044712 Ga0453684_0000020 Ga0453684_0000020_853427_854704 379
155 3300046460 Ga0495638_0037537 Ga0495638_0037537_1603_2991 379
156 3300046474 Ga0495605_0038700 Ga0495605_0038700_204_1508 379
157 3300046501 Ga0495607_0023135 Ga0495607_0023135_1751_3139 379
158 3300046512 Ga0495610_0006295 Ga0495610_0006295_3883_5271 379
159 3300046518 Ga0495631_0011725 Ga0495631_0011725_2115_3503 379
160 3300046519 Ga0495632_0039975 Ga0495632_0039975_84_1472 379
161 3300046522 Ga0495643_0007627 Ga0495643_0007627_2098_3486 379
162 3300046524 Ga0495648_0088055 Ga0495648_0088055_300_1688 379
163 3300046542 Ga0495597_0022900 Ga0495597_0022900_838_2226 379
164 3300046694 Ga0495649_0034714 Ga0495649_0034714_497_1885 379
165 3300046810 Ga0495660_0012714 Ga0495660_0012714_84_1472 379
166 3300047443 Ga0495687_012206 Ga0495687_012206_1567_2955 379
167 3300047472 Ga0495686_0024414 Ga0495686_0024414_1376_2764 379
168 3300048917 Ga0496114_0194888 Ga0496114_0194888_428_1762 379
169 3300049459 Ga0495678_020781 Ga0495678_020781_40_1428 379
170 3300049575 Ga0501039_0009966 Ga0501039_0009966_880_2208 379
171 3300049575 Ga0501039_0247819 Ga0501039_0247819_10_1251 379
172 3300049576 Ga0501040_0051346 Ga0501040_0051346_86_1414 379
173 3300049578 Ga0501042_0050716 Ga0501042_0050716_978_2306 379
174 3300049580 Ga0501046_0095970 Ga0501046_0095970_718_2079 379
175 3300049582 Ga0501048_0076927 Ga0501048_0076927_338_1666 379
176 3300049586 Ga0501070_0148553 Ga0501070_0148553_15_1376 379
177 3300049587 Ga0501071_0030303 Ga0501071_0030303_1789_3117 379
178 3300049588 Ga0501072_0159536 Ga0501072_0159536_444_1772 379
179 3300049589 Ga0501073_0023267 Ga0501073_0023267_2095_3456 379
180 3300049742 Ga0501080_0004825 Ga0501080_0004825_1658_3019 379
181 3300049824 Ga0501045_0049040 Ga0501045_0049040_729_2057 379
182 3300053119 Ga0500595_005643 Ga0500595_005643_2463_3824 379
183 3300053134 Ga0500658_0000093 Ga0500658_0000093_30340_31728 379
184 3300054114 Ga0501084_0045705 Ga0501084_0045705_619_1947 379
185 3300060353 Ga0501082_0215442 Ga0501082_0215442_83_1411 379
186 3300047673 Ga0495593_0045049 Ga0495593_0045049_720_2054 380
187 3300049569 Ga0501032_0004321 Ga0501032_0004321_8440_9807 380
188 3300049570 Ga0501033_0094860 Ga0501033_0094860_289_1650 380
189 3300049573 Ga0501037_0027893 Ga0501037_0027893_107_1474 380
190 3300049577 Ga0501041_0032662 Ga0501041_0032662_897_2258 380
191 3300049579 Ga0501043_0010760 Ga0501043_0010760_1236_2603 380
192 3300049583 Ga0501067_0000085 Ga0501067_0000085_42827_44194 380
193 3300049588 Ga0501072_0049383 Ga0501072_0049383_489_1841 380
194 3300049589 Ga0501073_0000007 Ga0501073_0000007_57345_58712 380
195 3300049592 Ga0501076_0111806 Ga0501076_0111806_276_1637 380
196 3300049593 Ga0501077_0000003 Ga0501077_0000003_67254_68621 380
197 3300049593 Ga0501077_0029923 Ga0501077_0029923_417_1778 380
198 3300049741 Ga0501079_0107780 Ga0501079_0107780_86_1447 380
199 3300049742 Ga0501080_0000988 Ga0501080_0000988_4140_5507 380
200 3300049743 Ga0501081_0091307 Ga0501081_0091307_263_1624 380
201 3300049823 Ga0501044_0046666 Ga0501044_0046666_2116_3483 380
202 3300053083 Ga0495655_0000500 Ga0495655_0000500_1172_2536 380
203 3300053085 Ga0495619_0054246 Ga0495619_0054246_479_1813 380
204 iso_pu_bacteria 2979793036 2979797775 380
205 3300049574 Ga0501038_0004971 Ga0501038_0004971_9389_10723 381
206 3300049579 Ga0501043_0008300 Ga0501043_0008300_368_1702 381
207 3300049581 Ga0501047_0006184 Ga0501047_0006184_3905_5278 381
208 3300049823 Ga0501044_0076966 Ga0501044_0076966_1053_2498 381
209 3300054114 Ga0501084_0264739 Ga0501084_0264739_39_1400 381
210 3300005466 Ga0070685_10005761 Ga0070685_100057615 382
211 3300006038 Ga0075365_10020120 Ga0075365_100201202 382
212 3300006038 Ga0075365_10076154 Ga0075365_100761542 382
213 3300006844 Ga0075428_100075255 Ga0075428_1000752552 382
214 3300006846 Ga0075430_100070582 Ga0075430_1000705822 382
215 3300006847 Ga0075431_100014785 Ga0075431_1000147852 382
216 3300006847 Ga0075431_100046633 Ga0075431_1000466334 382
217 3300031711 Ga0265314_10060562 Ga0265314_100605622 382
218 3300050492 nmdc:mga0yw44_3742_c1 nmdc:mga0yw44_3742_c1_1847_3295 382
219 3300050510 nmdc:mga06r32_133220_c1 nmdc:mga06r32_133220_c1_299_1747 382
220 3300050510 nmdc:mga06r32_20818_c1 nmdc:mga06r32_20818_c1_2082_3329 382
221 3300006028 Ga0070717_10044234 Ga0070717_100442342 383
222 3300037068 Ga0373925_0046170 Ga0373925_0046170_19_1368 383
223 3300037853 Ga0436364_0449051 Ga0436364_0449051_575_1912 383
224 3300048915 Ga0496112_0310449 Ga0496112_0310449_138_1502 383
225 3300025936 Ga0207670_10054563 Ga0207670_100545632 384
226 3300031852 Ga0307410_10149936 Ga0307410_101499361 384
227 3300037471 Ga0395905_0121097 Ga0395905_0121097_89_1456 384
228 3300049571 Ga0501034_0054458 Ga0501034_0054458_771_2114 384
229 3300049589 Ga0501073_0005889 Ga0501073_0005889_764_2041 384
230 3300053136 Ga0500559_0002458 Ga0500559_0002458_7138_8406 384
231 3300005548 Ga0070665_100001728 Ga0070665_10000172815 385
232 3300005843 Ga0068860_100100105 Ga0068860_1001001052 385
233 3300006042 Ga0075368_10000331 Ga0075368_1000033112 385
234 3300006051 Ga0075364_10034422 Ga0075364_100344222 385
235 3300006178 Ga0075367_10067363 Ga0075367_100673631 385
236 3300006948 Ga0099826_10032477 Ga0099826_100324774 385
237 3300009148 Ga0105243_10023475 Ga0105243_100234752 385
238 3300013102 Ga0157371_10000071 Ga0157371_1000007188 385
239 3300013104 Ga0157370_10000079 Ga0157370_1000007936 385
240 3300025294 Ga0209025_1003984 Ga0209025_10039843 385
241 3300027312 Ga0209371_1000037 Ga0209371_1000037265 385
242 3300027866 Ga0209813_10000656 Ga0209813_100006568 385
243 3300028379 Ga0268266_10024962 Ga0268266_100249626 385
244 3300030500 Ga0268256_1000039 Ga0268256_100003943 385
245 3300037471 Ga0395905_0046908 Ga0395905_0046908_1663_2931 385
246 3300046522 Ga0495643_0035511 Ga0495643_0035511_528_1913 385
247 3300048916 Ga0496113_0126718 Ga0496113_0126718_55_1440 385
248 3300048920 Ga0496117_0000031 Ga0496117_0000031_312459_313844 385
249 3300048921 Ga0496118_0000208 Ga0496118_0000208_56860_58245 385
250 3300048922 Ga0496119_0022482 Ga0496119_0022482_2346_3737 385
251 3300048923 Ga0496120_0000387 Ga0496120_0000387_59990_61375 385
252 3300048925 Ga0496122_0000023 Ga0496122_0000023_312447_313832 385
253 3300048926 Ga0496123_0000027 Ga0496123_0000027_67204_68589 385
254 3300048927 Ga0496124_0008477 Ga0496124_0008477_3139_4524 385
255 3300048928 Ga0496125_0006385 Ga0496125_0006385_5581_6972 385
256 3300048929 Ga0496126_0044907 Ga0496126_0044907_2586_3971 385
257 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_60530_61915 385
258 3300050491 nmdc:mga00v17_72749_c1 nmdc:mga00v17_72749_c1_138_1523 385
259 3300050492 nmdc:mga0yw44_8062_c1 nmdc:mga0yw44_8062_c1_677_2062 385
260 3300050494 nmdc:mga06z11_2118_c1 nmdc:mga06z11_2118_c1_2718_4103 385
261 3300053137 Ga0500561_0000122 Ga0500561_0000122_9801_11186 385
262 3300053177 Ga0500636_0000030 Ga0500636_0000030_8549_9934 385
263 3300053177 Ga0500636_0002620 Ga0500636_0002620_5553_6935 385
264 3300053730 Ga0500645_001927 Ga0500645_001927_8149_9429 385
265 iso_pu_bacteria 2537561587 2537873555 385
266 iso_pu_bacteria 2554235003 2554248986 385
267 iso_pu_bacteria 2558860242 2559296074 385
268 iso_pu_bacteria 2599185210 2599603133 385
269 iso_pu_bacteria 2600255279 2601610962 385
270 iso_pu_bacteria 2600255308 2601747736 385
271 iso_pu_bacteria 2643221582 2643921598 385
272 iso_pu_bacteria 2643221693 2644521652 385
273 iso_pu_bacteria 2808606387 2808988100 385
274 iso_pu_bacteria 2818991439 2819561084 385
275 iso_pu_bacteria 2838675328 2838678545 385
276 iso_pu_bacteria 2838714209 2838718367 385
277 iso_pu_bacteria 2838719591 2838722841 385
278 iso_pu_bacteria 2838724970 2838728433 385
279 iso_pu_bacteria 2841846520 2841850397 385
280 iso_pu_bacteria 2841859092 2841863350 385
281 iso_pu_bacteria 2842124991 2842129093 385
282 iso_pu_bacteria 2842130223 2842133438 385
283 iso_pu_bacteria 2842152218 2842155651 385
284 iso_pu_bacteria 2842170452 2842174391 385
285 iso_pu_bacteria 2842175837 2842179052 385
286 iso_pu_bacteria 2842187318 2842190791 385
287 iso_pu_bacteria 2842211629 2842214885 385
288 iso_pu_bacteria 2842224351 2842227606 385
289 iso_pu_bacteria 2842515876 2842519913 385
290 iso_pu_bacteria 2899792073 2899794822 385
291 iso_pu_bacteria 2899845264 2899849425 385
292 iso_pu_bacteria 2919114240 2919118376 385
293 iso_pu_bacteria 2926754445 2926754905 385
294 iso_pu_bacteria 2926760298 2926762070 385
295 iso_pu_bacteria 2933006813 2933010503 385
296 iso_pu_bacteria 2933011516 2933015825 385
297 iso_pu_bacteria 2933594066 2933597437 385
298 iso_pu_bacteria 2979089926 2979092661 385
299 iso_pu_bacteria 2979095461 2979099948 385
300 iso_pu_bacteria 2979100975 2979104633 385
301 iso_pu_bacteria 2984509177 2984513570 385
302 iso_pu_bacteria 2984518228 2984522850 385
303 iso_pu_bacteria 2984537506 2984542157 385
304 iso_pu_bacteria 2984601300 2984601586 385
305 iso_pu_bacteria 650716007 650741290 385
306 iso_pu_bacteria 8003570095 8003573648 385
307 iso_pu_bacteria 8054460903 8054463882 385
308 3300005331 Ga0070670_100005245 Ga0070670_1000052455 386
309 3300005564 Ga0070664_100203773 Ga0070664_1002037732 386
310 3300006178 Ga0075367_10025996 Ga0075367_100259962 386
311 3300006847 Ga0075431_100026280 Ga0075431_1000262801 386
312 3300006871 Ga0075434_100072570 Ga0075434_1000725702 386
313 3300007076 Ga0075435_100070735 Ga0075435_1000707352 386
314 3300009147 Ga0114129_10016101 Ga0114129_100161012 386
315 3300009147 Ga0114129_10615199 Ga0114129_106151991 386
316 3300013102 Ga0157371_10089853 Ga0157371_100898532 386
317 3300025945 Ga0207679_10154186 Ga0207679_101541861 386
318 3300028794 Ga0307515_10001049 Ga0307515_1000104935 386
319 3300031456 Ga0307513_10059089 Ga0307513_100590892 386
320 3300035691 Ga0373931_0019764 Ga0373931_0019764_1074_2408 386
321 3300046460 Ga0495638_0015798 Ga0495638_0015798_583_1941 386
322 3300046460 Ga0495638_0031396 Ga0495638_0031396_1645_2958 386
323 3300048905 Ga0496102_0165686 Ga0496102_0165686_43_1377 386
324 3300048906 Ga0496103_0136186 Ga0496103_0136186_194_1528 386
325 3300048907 Ga0496104_0000275 Ga0496104_0000275_43209_44504 386
326 3300048907 Ga0496104_0008263 Ga0496104_0008263_1324_2658 386
327 3300048908 Ga0496105_0000973 Ga0496105_0000973_10670_12004 386
328 3300048908 Ga0496105_0020573 Ga0496105_0020573_3642_4937 386
329 3300048909 Ga0496106_0162532 Ga0496106_0162532_201_1535 386
330 3300048910 Ga0496107_0038551 Ga0496107_0038551_1814_3148 386
331 3300048911 Ga0496108_0000347 Ga0496108_0000347_29529_30863 386
332 3300048911 Ga0496108_0007453 Ga0496108_0007453_7229_8524 386
333 3300048912 Ga0496109_0017109 Ga0496109_0017109_3792_5126 386
334 3300048912 Ga0496109_0081778 Ga0496109_0081778_1312_2607 386
335 3300048913 Ga0496110_0004026 Ga0496110_0004026_8792_10087 386
336 3300048913 Ga0496110_0090852 Ga0496110_0090852_1324_2658 386
337 3300048914 Ga0496111_0010222 Ga0496111_0010222_2315_3610 386
338 3300048914 Ga0496111_0021085 Ga0496111_0021085_508_1842 386
339 3300048915 Ga0496112_0001330 Ga0496112_0001330_15530_16825 386
340 3300048915 Ga0496112_0219250 Ga0496112_0219250_201_1535 386
341 3300048916 Ga0496113_0002538 Ga0496113_0002538_5399_6694 386
342 3300048916 Ga0496113_0005068 Ga0496113_0005068_3188_4522 386
343 3300049823 Ga0501044_0187854 Ga0501044_0187854_182_1519 386
344 3300050494 nmdc:mga06z11_7889_c1 nmdc:mga06z11_7889_c1_2487_3851 386
345 3300050507 nmdc:mga05p37_137727_c1 nmdc:mga05p37_137727_c1_1023_2357 386
346 3300050510 nmdc:mga06r32_196912_c1 nmdc:mga06r32_196912_c1_605_1939 386
347 3300050512 nmdc:mga0n895_53506_c1 nmdc:mga0n895_53506_c1_1068_2402 386
348 iso_pu_bacteria 2510461069 2510839177 386
349 iso_pu_bacteria 2818991272 2819244631 386
350 3300005468 Ga0070707_100134428 Ga0070707_1001344282 387
351 3300005518 Ga0070699_100046283 Ga0070699_1000462833 387
352 3300005937 Ga0081455_10002140 Ga0081455_100021404 387
353 3300005985 Ga0081539_10007857 Ga0081539_100078572 387
354 3300006177 Ga0075362_10051880 Ga0075362_100518802 387
355 3300006186 Ga0075369_10002069 Ga0075369_100020692 387
356 3300014325 Ga0163163_10178779 Ga0163163_101787792 387
357 3300026088 Ga0207641_10147468 Ga0207641_101474682 387
358 3300028381 Ga0268264_10196813 Ga0268264_101968132 387
359 3300035691 Ga0373931_0034626 Ga0373931_0034626_592_1881 387
360 3300036401 Ga0373937_0102431 Ga0373937_0102431_1130_2416 387
361 3300037418 Ga0395900_0014386 Ga0395900_0014386_4454_5740 387
362 3300037466 Ga0395898_0002569 Ga0395898_0002569_9048_10334 387
363 3300038443 Ga0395901_0000475 Ga0395901_0000475_21179_22465 387
364 3300038443 Ga0395901_0020312 Ga0395901_0020312_4472_5758 387
365 3300045051 Ga0451576_0000056 Ga0451576_0000056_135337_136626 387
366 3300048910 Ga0496107_0126425 Ga0496107_0126425_687_1850 387
367 3300048919 Ga0496116_0000057 Ga0496116_0000057_68692_69969 387
368 3300048929 Ga0496126_0000115 Ga0496126_0000115_68778_70055 387
369 3300049568 Ga0501031_0036581 Ga0501031_0036581_1063_2445 387
370 3300049569 Ga0501032_0000070 Ga0501032_0000070_81599_82981 387
371 3300049571 Ga0501034_0000001 Ga0501034_0000001_595582_596964 387
372 3300049571 Ga0501034_0000374 Ga0501034_0000374_12045_13358 387
373 3300049571 Ga0501034_0200342 Ga0501034_0200342_388_1677 387
374 3300049572 Ga0501036_0003886 Ga0501036_0003886_5649_7031 387
375 3300049572 Ga0501036_0068022 Ga0501036_0068022_400_1713 387
376 3300049575 Ga0501039_0000001 Ga0501039_0000001_310026_311408 387
377 3300050489 nmdc:mga03683_4054_c1 nmdc:mga03683_4054_c1_2988_4277 387
378 3300050516 nmdc:mga0sz30_95_c1 nmdc:mga0sz30_95_c1_11640_12929 387
379 3300053093 Ga0500651_0071553 Ga0500651_0071553_542_1828 387
380 3300053096 Ga0500641_0007870 Ga0500641_0007870_970_2256 387
381 iso_pu_bacteria 2643221568 2643854826 387
382 iso_pu_bacteria 2837678835 2837681201 387
383 iso_pu_bacteria 2854896431 2854897721 387
384 iso_pu_bacteria 2889790730 2889791560 387
385 iso_pu_bacteria 2889914905 2889917305 387
386 iso_pu_bacteria 2919166419 2919170462 387
387 iso_pu_bacteria 2978969890 2978972742 387
388 iso_pu_bacteria 2984587000 2984590994 387
389 3300005353 Ga0070669_100061718 Ga0070669_1000617182 388
390 3300046463 Ga0495653_0168944 Ga0495653_0168944_297_1463 388
391 3300049823 Ga0501044_0109952 Ga0501044_0109952_1423_2724 388
392 iso_pu_bacteria 2510461076 2510896866 388
393 iso_pu_bacteria 2513237162 2514019577 388
394 iso_pu_bacteria 2738541317 2738947087 388
395 iso_pu_bacteria 2757320392 2757571003 388
396 iso_pu_bacteria 2767802442 2770198420 388
397 iso_pu_bacteria 2840764183 2840766263 388
398 iso_pu_bacteria 2842163707 2842166875 388
399 iso_pu_bacteria 2842871566 2842873867 388
400 iso_pu_bacteria 2894817345 2894821020 388
401 iso_pu_bacteria 2913308742 2913312084 388
402 iso_pu_bacteria 2928521798 2928522888 388
403 iso_pu_bacteria 2954011201 2954013746 388
404 iso_pu_bacteria 8056875544 8056878349 388
405 3300009545 Ga0105237_10078198 Ga0105237_100781982 389
406 3300013104 Ga0157370_10151838 Ga0157370_101518382 389
407 3300026041 Ga0207639_10041136 Ga0207639_100411364 389
408 3300026067 Ga0207678_10082887 Ga0207678_100828872 389
409 3300044712 Ga0453684_0076521 Ga0453684_0076521_86_1402 389
410 3300049568 Ga0501031_0001804 Ga0501031_0001804_4837_6126 389
411 3300049569 Ga0501032_0000013 Ga0501032_0000013_154047_155336 389
412 3300049570 Ga0501033_0002577 Ga0501033_0002577_509_1798 389
413 3300049571 Ga0501034_0000023 Ga0501034_0000023_227314_228603 389
414 3300049571 Ga0501034_0097002 Ga0501034_0097002_589_1974 389
415 3300049571 Ga0501034_0197398 Ga0501034_0197398_524_1927 389
416 3300049572 Ga0501036_0000412 Ga0501036_0000412_13595_14884 389
417 3300049573 Ga0501037_0001208 Ga0501037_0001208_13636_14925 389
418 3300049574 Ga0501038_0000040 Ga0501038_0000040_35290_36579 389
419 3300049575 Ga0501039_0000188 Ga0501039_0000188_13551_14840 389
420 3300049579 Ga0501043_0000019 Ga0501043_0000019_128942_130231 389
421 3300049580 Ga0501046_0112901 Ga0501046_0112901_607_1896 389
422 3300049581 Ga0501047_0086988 Ga0501047_0086988_412_1701 389
423 3300049742 Ga0501080_0072218 Ga0501080_0072218_1035_2420 389
424 3300049822 Ga0501035_0000488 Ga0501035_0000488_13737_15026 389
425 3300061734 Ga0530510_0104378 Ga0530510_0104378_667_1986 389
426 iso_pu_bacteria 2588253730 2588519488 389
427 iso_pu_bacteria 2773857925 2774871828 389
428 iso_pu_bacteria 2882456835 2882459054 389
429 3300003214 JGI25165J46597_1000026 JGI25165J46597_1000026304 390
430 3300003762 Ga0055542_1000784 Ga0055542_10007848 390
431 3300005539 Ga0068853_100020993 Ga0068853_1000209932 390
432 3300005985 Ga0081539_10005263 Ga0081539_100052637 390
433 3300006038 Ga0075365_10016899 Ga0075365_100168992 390
434 3300006038 Ga0075365_10034079 Ga0075365_100340792 390
435 3300006042 Ga0075368_10011055 Ga0075368_100110552 390
436 3300006177 Ga0075362_10005316 Ga0075362_100053162 390
437 3300009093 Ga0105240_10373984 Ga0105240_103739842 390
438 3300009545 Ga0105237_10016432 Ga0105237_100164327 390
439 3300009551 Ga0105238_10001556 Ga0105238_100015562 390
440 3300010375 Ga0105239_10023787 Ga0105239_100237872 390
441 3300010375 Ga0105239_10030728 Ga0105239_100307286 390
442 3300010375 Ga0105239_10164534 Ga0105239_101645342 390
443 3300014497 Ga0182008_10041680 Ga0182008_100416802 390
444 3300025250 Ga0209026_1000032 Ga0209026_1000032217 390
445 3300025254 Ga0209148_1000094 Ga0209148_1000094172 390
446 3300025256 Ga0209759_1000654 Ga0209759_10006545 390
447 3300025261 Ga0209233_1000030 Ga0209233_100003094 390
448 3300025272 Ga0209455_1000113 Ga0209455_1000113112 390
449 3300025913 Ga0207695_10148807 Ga0207695_101488072 390
450 3300025914 Ga0207671_10021515 Ga0207671_100215155 390
451 3300025919 Ga0207657_10200094 Ga0207657_102000941 390
452 3300026089 Ga0207648_10231485 Ga0207648_102314851 390
453 3300035118 Ga0373954_0004165 Ga0373954_0004165_4438_5826 390
454 3300035119 Ga0373956_0054032 Ga0373956_0054032_69_1457 390
455 3300035172 Ga0373955_0007731 Ga0373955_0007731_3201_4589 390
456 3300035410 Ga0373924_0016492 Ga0373924_0016492_253_1641 390
457 3300035695 Ga0373927_0034462 Ga0373927_0034462_148_1536 390
458 3300035724 Ga0373933_0004956 Ga0373933_0004956_4310_5698 390
459 3300036401 Ga0373937_0020608 Ga0373937_0020608_1777_3165 390
460 3300037471 Ga0395905_0024499 Ga0395905_0024499_3610_4992 390
461 3300046459 Ga0495629_0000484 Ga0495629_0000484_29433_30821 390
462 3300046462 Ga0495651_0000479 Ga0495651_0000479_5230_6618 390
463 3300046463 Ga0495653_0000553 Ga0495653_0000553_6156_7544 390
464 3300046477 Ga0495664_0084220 Ga0495664_0084220_107_1495 390
465 3300046514 Ga0495618_0002265 Ga0495618_0002265_1638_3026 390
466 3300046516 Ga0495628_0075631 Ga0495628_0075631_871_2259 390
467 3300046522 Ga0495643_0015371 Ga0495643_0015371_2306_3691 390
468 3300046529 Ga0495652_0006322 Ga0495652_0006322_4741_6129 390
469 3300046533 Ga0495640_0003693 Ga0495640_0003693_2697_4085 390
470 3300046559 Ga0495667_0000938 Ga0495667_0000938_1641_3029 390
471 3300046616 Ga0495668_0024894 Ga0495668_0024894_57_1451 390
472 3300046642 Ga0495634_0011861 Ga0495634_0011861_3045_4433 390
473 3300046660 Ga0495625_0030895 Ga0495625_0030895_253_1638 390
474 3300046663 Ga0495635_0058726 Ga0495635_0058726_850_2238 390
475 3300046678 Ga0495599_0035426 Ga0495599_0035426_797_2185 390
476 3300046680 Ga0495646_0003324 Ga0495646_0003324_344_1732 390
477 3300046809 Ga0495600_0043215 Ga0495600_0043215_1510_2898 390
478 3300047315 Ga0495581_0071665 Ga0495581_0071665_302_1690 390
479 3300047317 Ga0495604_0001116 Ga0495604_0001116_17384_18772 390
480 3300047319 Ga0495674_0012447 Ga0495674_0012447_2032_3420 390
481 3300047444 Ga0495675_0020203 Ga0495675_0020203_25_1413 390
482 3300047471 Ga0495684_0008513 Ga0495684_0008513_6089_7477 390
483 3300047673 Ga0495593_0033876 Ga0495593_0033876_998_2386 390
484 3300048088 Ga0495602_0002877 Ga0495602_0002877_4229_5617 390
485 3300048922 Ga0496119_0026171 Ga0496119_0026171_942_2330 390
486 3300048923 Ga0496120_0001163 Ga0496120_0001163_10428_11804 390
487 3300048924 Ga0496121_0151061 Ga0496121_0151061_161_1651 390
488 3300049569 Ga0501032_0000006 Ga0501032_0000006_186043_187401 390
489 3300049570 Ga0501033_0000039 Ga0501033_0000039_74327_75685 390
490 3300049570 Ga0501033_0000293 Ga0501033_0000293_30069_31454 390
491 3300049570 Ga0501033_0003047 Ga0501033_0003047_3463_4755 390
492 3300049571 Ga0501034_0000030 Ga0501034_0000030_47729_49087 390
493 3300049571 Ga0501034_0000702 Ga0501034_0000702_16165_17490 390
494 3300049571 Ga0501034_0024527 Ga0501034_0024527_4743_6113 390
495 3300049571 Ga0501034_0071493 Ga0501034_0071493_1778_3070 390
496 3300049571 Ga0501034_0124406 Ga0501034_0124406_1125_2483 390
497 3300049572 Ga0501036_0000003 Ga0501036_0000003_74327_75685 390
498 3300049573 Ga0501037_0000003 Ga0501037_0000003_74327_75685 390
499 3300049573 Ga0501037_0000007 Ga0501037_0000007_28596_29981 390
500 3300049574 Ga0501038_0000004 Ga0501038_0000004_74327_75685 390
501 3300049574 Ga0501038_0060712 Ga0501038_0060712_519_1811 390
502 3300049574 Ga0501038_0160557 Ga0501038_0160557_498_1775 390
503 3300049575 Ga0501039_0000008 Ga0501039_0000008_74327_75685 390
504 3300049576 Ga0501040_0004945 Ga0501040_0004945_1450_2808 390
505 3300049578 Ga0501042_0039402 Ga0501042_0039402_755_2113 390
506 3300049578 Ga0501042_0092954 Ga0501042_0092954_159_1481 390
507 3300049579 Ga0501043_0000034 Ga0501043_0000034_60411_61796 390
508 3300049579 Ga0501043_0000177 Ga0501043_0000177_16499_17857 390
509 3300049579 Ga0501043_0031291 Ga0501043_0031291_1884_3176 390
510 3300049581 Ga0501047_0004025 Ga0501047_0004025_916_2208 390
511 3300049581 Ga0501047_0007110 Ga0501047_0007110_4122_5480 390
512 3300049581 Ga0501047_0049215 Ga0501047_0049215_1684_2961 390
513 3300049584 Ga0501068_0040570 Ga0501068_0040570_1190_2548 390
514 3300049585 Ga0501069_0000017 Ga0501069_0000017_116376_117761 390
515 3300049586 Ga0501070_0000275 Ga0501070_0000275_32424_33716 390
516 3300049586 Ga0501070_0001269 Ga0501070_0001269_8161_9546 390
517 3300049586 Ga0501070_0015276 Ga0501070_0015276_193_1551 390
518 3300049587 Ga0501071_0003548 Ga0501071_0003548_4087_5472 390
519 3300049590 Ga0501074_0000060 Ga0501074_0000060_22730_24115 390
520 3300049590 Ga0501074_0034900 Ga0501074_0034900_1394_2686 390
521 3300049742 Ga0501080_0001013 Ga0501080_0001013_19084_20469 390
522 3300049742 Ga0501080_0013088 Ga0501080_0013088_4897_6189 390
523 3300049742 Ga0501080_0145684 Ga0501080_0145684_507_1784 390
524 3300049744 Ga0501083_0000511 Ga0501083_0000511_19934_21319 390
525 3300049822 Ga0501035_0000112 Ga0501035_0000112_23454_24812 390
526 3300049822 Ga0501035_0000159 Ga0501035_0000159_50684_52069 390
527 3300049822 Ga0501035_0000772 Ga0501035_0000772_2966_4243 390
528 3300049822 Ga0501035_0004717 Ga0501035_0004717_881_2266 390
529 3300049822 Ga0501035_0073609 Ga0501035_0073609_471_1805 390
530 3300049823 Ga0501044_0000008 Ga0501044_0000008_74327_75685 390
531 3300049823 Ga0501044_0000010 Ga0501044_0000010_71929_73314 390
532 3300049823 Ga0501044_0012445 Ga0501044_0012445_1360_2652 390
533 3300049823 Ga0501044_0211777 Ga0501044_0211777_143_1528 390
534 3300050492 nmdc:mga0yw44_22295_c1 nmdc:mga0yw44_22295_c1_285_1688 390
535 3300053077 Ga0495601_0004823 Ga0495601_0004823_4676_6064 390
536 3300053078 Ga0495612_0004190 Ga0495612_0004190_2088_3476 390
537 3300053084 Ga0495595_0002943 Ga0495595_0002943_2459_3847 390
538 3300053085 Ga0495619_0000426 Ga0495619_0000426_4230_5618 390
539 3300053087 Ga0500643_007497 Ga0500643_007497_2140_3537 390
540 3300053139 Ga0500568_0000188 Ga0500568_0000188_8118_9452 390
541 3300053155 Ga0500620_000445 Ga0500620_000445_3159_4493 390
542 3300060353 Ga0501082_0053623 Ga0501082_0053623_755_2140 390
543 3300061734 Ga0530510_0014732 Ga0530510_0014732_2803_4125 390
544 iso_pu_bacteria 2503198000 2503199190 390
545 iso_pu_bacteria 2508501050 2508734760 390
546 iso_pu_bacteria 2509276018 2509371691 390
547 iso_pu_bacteria 2509276022 2509394127 390
548 iso_pu_bacteria 2510065059 2510318179 390
549 iso_pu_bacteria 2512875016 2512933416 390
550 iso_pu_bacteria 2512875024 2512961534 390
551 iso_pu_bacteria 2513237090 2513610494 390
552 iso_pu_bacteria 2513237164 2514036819 390
553 iso_pu_bacteria 2513237305 2514423226 390
554 iso_pu_bacteria 2513237351 2514586797 390
555 iso_pu_bacteria 2597489875 2597811757 390
556 iso_pu_bacteria 2643221550 2643771955 390
557 iso_pu_bacteria 2643221551 2643777040 390
558 iso_pu_bacteria 2643221555 2643795488 390
559 iso_pu_bacteria 2643221595 2643988360 390
560 iso_pu_bacteria 2643221623 2644131469 390
561 iso_pu_bacteria 2643221627 2644154723 390
562 iso_pu_bacteria 2671180139 2671693661 390
563 iso_pu_bacteria 2687453392 2688596473 390
564 iso_pu_bacteria 2693429783 2694630077 390
565 iso_pu_bacteria 2693429784 2694635667 390
566 iso_pu_bacteria 2721755686 2723573573 390
567 iso_pu_bacteria 2738543024 2739306150 390
568 iso_pu_bacteria 2756170246 2756673858 390
569 iso_pu_bacteria 2775506901 2776257620 390
570 iso_pu_bacteria 2791355123 2792747730 390
571 iso_pu_bacteria 2829745981 2829750308 390
572 iso_pu_bacteria 2841734538 2841736894 390
573 iso_pu_bacteria 2844002411 2844002963 390
574 iso_pu_bacteria 2844009547 2844011298 390
575 iso_pu_bacteria 2847670302 2847673884 390
576 iso_pu_bacteria 2847686936 2847690370 390
577 iso_pu_bacteria 2856314179 2856320465 390
578 iso_pu_bacteria 2856320880 2856327330 390
579 iso_pu_bacteria 2856328259 2856328382 390
580 iso_pu_bacteria 2856334872 2856337735 390
581 iso_pu_bacteria 2856342000 2856345313 390
582 iso_pu_bacteria 2856349417 2856354248 390
583 iso_pu_bacteria 2856356410 2856362882 390
584 iso_pu_bacteria 2856364286 2856367574 390
585 iso_pu_bacteria 2857349434 2857353395 390
586 iso_pu_bacteria 2857367948 2857368051 390
587 iso_pu_bacteria 2869162929 2869165915 390
588 iso_pu_bacteria 2869169390 2869170392 390
589 iso_pu_bacteria 2869234852 2869235664 390
590 iso_pu_bacteria 2869242130 2869244589 390
591 iso_pu_bacteria 2869249662 2869254045 390
592 iso_pu_bacteria 2869256925 2869257205 390
593 iso_pu_bacteria 2869264136 2869266386 390
594 iso_pu_bacteria 2869271264 2869275866 390
595 iso_pu_bacteria 2869278585 2869280562 390
596 iso_pu_bacteria 2869285874 2869288640 390
597 iso_pu_bacteria 2871429161 2871430130 390
598 iso_pu_bacteria 2871435913 2871438144 390
599 iso_pu_bacteria 2871444079 2871450427 390
600 iso_pu_bacteria 2871451962 2871457264 390
601 iso_pu_bacteria 2871459585 2871464366 390
602 iso_pu_bacteria 2871466892 2871471171 390
603 iso_pu_bacteria 2871474448 2871477110 390
604 iso_pu_bacteria 2871481445 2871483457 390
605 iso_pu_bacteria 2871488783 2871494784 390
606 iso_pu_bacteria 2871495908 2871501087 390
607 iso_pu_bacteria 2874102143 2874102737 390
608 iso_pu_bacteria 2874116593 2874119684 390
609 iso_pu_bacteria 2874123672 2874130210 390
610 iso_pu_bacteria 2874131515 2874133365 390
611 iso_pu_bacteria 2874139085 2874140001 390
612 iso_pu_bacteria 2874146452 2874150768 390
613 iso_pu_bacteria 2874155637 2874158410 390
614 iso_pu_bacteria 2874162495 2874165454 390
615 iso_pu_bacteria 2874168670 2874176688 390
616 iso_pu_bacteria 2876363079 2876364330 390
617 iso_pu_bacteria 2876369609 2876377148 390
618 iso_pu_bacteria 2876377896 2876381367 390
619 iso_pu_bacteria 2876386047 2876390150 390
620 iso_pu_bacteria 2876399893 2876402268 390
621 iso_pu_bacteria 2876406927 2876410173 390
622 iso_pu_bacteria 2876413966 2876416804 390
623 iso_pu_bacteria 2876420981 2876423522 390
624 iso_pu_bacteria 2878035449 2878038880 390
625 iso_pu_bacteria 2878738818 2878741970 390
626 iso_pu_bacteria 2878745973 2878748674 390
627 iso_pu_bacteria 2878753008 2878759918 390
628 iso_pu_bacteria 2878760144 2878765101 390
629 iso_pu_bacteria 2878767105 2878772273 390
630 iso_pu_bacteria 2878774303 2878777732 390
631 iso_pu_bacteria 2878781027 2878786812 390
632 iso_pu_bacteria 2881147464 2881148671 390
633 iso_pu_bacteria 2881155292 2881159752 390
634 iso_pu_bacteria 2881161766 2881165453 390
635 iso_pu_bacteria 2881845957 2881848509 390
636 iso_pu_bacteria 2881853255 2881853540 390
637 iso_pu_bacteria 2881861095 2881861258 390
638 iso_pu_bacteria 2882632389 2882640217 390
639 iso_pu_bacteria 2882912400 2882919193 390
640 iso_pu_bacteria 2885305155 2885307308 390
641 iso_pu_bacteria 2885312484 2885313648 390
642 iso_pu_bacteria 2885318864 2885323177 390
643 iso_pu_bacteria 2885326080 2885327761 390
644 iso_pu_bacteria 2885334103 2885335297 390
645 iso_pu_bacteria 2885342637 2885346091 390
646 iso_pu_bacteria 2885350715 2885352536 390
647 iso_pu_bacteria 2888337043 2888337148 390
648 iso_pu_bacteria 2888343758 2888344862 390
649 iso_pu_bacteria 2888350351 2888353656 390
650 iso_pu_bacteria 2889010040 2889015383 390
651 iso_pu_bacteria 2889016732 2889019547 390
652 iso_pu_bacteria 2894232714 2894234221 390
653 iso_pu_bacteria 2903448605 2903455147 390
654 iso_pu_bacteria 2903492973 2903494142 390
655 iso_pu_bacteria 2903492973 2903504345 390
656 iso_pu_bacteria 2903521522 2903523903 390
657 iso_pu_bacteria 2903528002 2903530402 390
658 iso_pu_bacteria 2903540706 2903545903 390
659 iso_pu_bacteria 2906308376 2906311081 390
660 iso_pu_bacteria 2906321335 2906324856 390
661 iso_pu_bacteria 2906328253 2906333768 390
662 iso_pu_bacteria 2906354277 2906355756 390
663 iso_pu_bacteria 2906363423 2906367554 390
664 iso_pu_bacteria 2906370794 2906377613 390
665 iso_pu_bacteria 2906378014 2906380240 390
666 iso_pu_bacteria 2906386501 2906392189 390
667 iso_pu_bacteria 2906393657 2906399245 390
668 iso_pu_bacteria 2906401398 2906402664 390
669 iso_pu_bacteria 2906408224 2906410118 390
670 iso_pu_bacteria 2906414383 2906421244 390
671 iso_pu_bacteria 2922151315 2922153381 390
672 iso_pu_bacteria 2922158528 2922161154 390
673 iso_pu_bacteria 2922172374 2922173539 390
674 iso_pu_bacteria 2922178524 2922185490 390
675 iso_pu_bacteria 2922185730 2922189345 390
676 iso_pu_bacteria 2924710171 2924717313 390
677 iso_pu_bacteria 2924718760 2924723459 390
678 iso_pu_bacteria 2924726620 2924730470 390
679 iso_pu_bacteria 2924733363 2924734435 390
680 iso_pu_bacteria 2924741084 2924746420 390
681 iso_pu_bacteria 2924748358 2924749288 390
682 iso_pu_bacteria 2924762789 2924765432 390
683 iso_pu_bacteria 2924776078 2924779654 390
684 iso_pu_bacteria 2924784321 2924790721 390
685 iso_pu_bacteria 2937813078 2937816413 390
686 iso_pu_bacteria 2937822353 2937825416 390
687 iso_pu_bacteria 2937836603 2937841256 390
688 iso_pu_bacteria 2937843397 2937848564 390
689 iso_pu_bacteria 2937848649 2937852792 390
690 iso_pu_bacteria 2937861824 2937863995 390
691 iso_pu_bacteria 2937868953 2937874638 390
692 iso_pu_bacteria 2937877337 2937878146 390
693 iso_pu_bacteria 2937972304 2937972946 390
694 iso_pu_bacteria 2937980651 2937987659 390
695 iso_pu_bacteria 2937994558 2937999756 390
696 iso_pu_bacteria 2938014810 2938019750 390
697 iso_pu_bacteria 2958034702 2958036434 390
698 iso_pu_bacteria 2958041894 2958046157 390
699 iso_pu_bacteria 2958071322 2958073170 390
700 iso_pu_bacteria 2958084443 2958085260 390
701 iso_pu_bacteria 2958092219 2958098021 390
702 iso_pu_bacteria 2958100919 2958102770 390
703 iso_pu_bacteria 2958108152 2958112873 390
704 iso_pu_bacteria 2958115193 2958120543 390
705 iso_pu_bacteria 2958122699 2958123038 390
706 iso_pu_bacteria 2958130278 2958133039 390
707 iso_pu_bacteria 2958137437 2958141622 390
708 iso_pu_bacteria 2958158011 2958161867 390
709 iso_pu_bacteria 2958165035 2958170224 390
710 iso_pu_bacteria 2958172287 2958177755 390
711 iso_pu_bacteria 2958179912 2958182743 390
712 iso_pu_bacteria 2961077736 2961080590 390
713 iso_pu_bacteria 2961127735 2961133534 390
714 iso_pu_bacteria 2961136820 2961139740 390
715 iso_pu_bacteria 2961163497 2961168675 390
716 iso_pu_bacteria 2961170736 2961177190 390
717 iso_pu_bacteria 2961183825 2961188021 390
718 iso_pu_bacteria 2963644680 2963645788 390
719 iso_pu_bacteria 2965018300 2965023487 390
720 iso_pu_bacteria 2965025482 2965030916 390
721 iso_pu_bacteria 2965032056 2965037332 390
722 iso_pu_bacteria 2965040258 2965042503 390
723 iso_pu_bacteria 2965047637 2965049578 390
724 iso_pu_bacteria 2965089291 2965093686 390
725 iso_pu_bacteria 2965102966 2965108542 390
726 iso_pu_bacteria 2965110997 2965115051 390
727 iso_pu_bacteria 2965119406 2965124316 390
728 iso_pu_bacteria 2967996073 2968002280 390
729 iso_pu_bacteria 2968003550 2968009514 390
730 iso_pu_bacteria 2968016561 2968023440 390
731 iso_pu_bacteria 2968083720 2968089295 390
732 iso_pu_bacteria 2968091066 2968094286 390
733 iso_pu_bacteria 2968097103 2968100958 390
734 iso_pu_bacteria 2968117919 2968122198 390
735 iso_pu_bacteria 2968128360 2968133229 390
736 iso_pu_bacteria 2968138860 2968143333 390
737 iso_pu_bacteria 2968171901 2968177087 390
738 iso_pu_bacteria 2970469710 2970476022 390
739 iso_pu_bacteria 2970489779 2970493708 390
740 iso_pu_bacteria 2970503327 2970509864 390
741 iso_pu_bacteria 2970510686 2970516240 390
742 iso_pu_bacteria 2970524798 2970526586 390
743 iso_pu_bacteria 2970540015 2970544713 390
744 iso_pu_bacteria 2970547951 2970550224 390
745 iso_pu_bacteria 2970554993 2970559947 390
746 iso_pu_bacteria 2970593180 2970595284 390
747 iso_pu_bacteria 2970619444 2970626507 390
748 iso_pu_bacteria 2970627176 2970628764 390
749 iso_pu_bacteria 2977821940 2977828440 390
750 iso_pu_bacteria 2977828996 2977829960 390
751 iso_pu_bacteria 2977843712 2977846835 390
752 iso_pu_bacteria 2977851361 2977852259 390
753 iso_pu_bacteria 2977858184 2977863112 390
754 iso_pu_bacteria 2977864932 2977869800 390
755 iso_pu_bacteria 2977872689 2977878352 390
756 iso_pu_bacteria 2977898635 2977902265 390
757 iso_pu_bacteria 2977907340 2977913014 390
758 iso_pu_bacteria 2977915119 2977922687 390
759 iso_pu_bacteria 2977922695 2977926345 390
760 iso_pu_bacteria 2977935797 2977941767 390
761 iso_pu_bacteria 2977942078 2977942268 390
762 iso_pu_bacteria 2977950692 2977957310 390
763 iso_pu_bacteria 2977957713 2977962710 390
764 iso_pu_bacteria 2977971508 2977976579 390
765 iso_pu_bacteria 2977986579 2977989713 390
766 iso_pu_bacteria 2979710463 2979714218 390
767 iso_pu_bacteria 2979779861 2979786024 390
768 iso_pu_bacteria 2979808191 2979814740 390
769 iso_pu_bacteria 2987636660 2987641989 390
770 iso_pu_bacteria 2987645492 2987646239 390
771 iso_pu_bacteria 2987652177 2987653397 390
772 iso_pu_bacteria 2987659509 2987664704 390
773 iso_pu_bacteria 2987666974 2987669776 390
774 iso_pu_bacteria 2987673487 2987673835 390
775 iso_pu_bacteria 2996336353 2996339624 390
776 iso_pu_bacteria 2996341866 2996347766 390
777 iso_pu_bacteria 2996348954 2996354604 390
778 iso_pu_bacteria 2996386984 2996387748 390
779 iso_pu_bacteria 3000135777 3000137866 390
780 iso_pu_bacteria 3003665799 3003670225 390
781 iso_pu_bacteria 3004167301 3004173810 390
782 iso_pu_bacteria 3004188549 3004193759 390
783 iso_pu_bacteria 3004203850 3004209200 390
784 iso_pu_bacteria 3004211236 3004218223 390
785 iso_pu_bacteria 3004218560 3004222825 390
786 iso_pu_bacteria 3004232784 3004239301 390
787 iso_pu_bacteria 3004248173 3004251484 390
788 iso_pu_bacteria 3004268573 3004269069 390
789 iso_pu_bacteria 3004275668 3004281252 390
790 iso_pu_bacteria 637000159 637076517 390
791 iso_pu_bacteria 649633066 649871024 390
792 iso_pu_bacteria 8002285264 8002290683 390
793 iso_pu_bacteria 8004300914 8004306696 390
794 iso_pu_bacteria 8004312739 8004320357 390
795 iso_pu_bacteria 8004361976 8004365475 390
796 iso_pu_bacteria 8004374579 8004381416 390
797 iso_pu_bacteria 8004387939 8004390721 390
798 iso_pu_bacteria 8004395343 8004399519 390
799 iso_pu_bacteria 8004445564 8004446889 390
800 iso_pu_bacteria 8004633249 8004639636 390
801 iso_pu_bacteria 8004640170 8004646355 390
802 iso_pu_bacteria 8004695233 8004701085 390
803 iso_pu_bacteria 8004703790 8004706299 390
804 iso_pu_bacteria 8004714634 8004717300 390
805 iso_pu_bacteria 8004727605 8004728129 390
806 iso_pu_bacteria 8055617313 8055618415 390
807 3300003578 Ga0006562J51391_1004036 Ga0006562J51391_10040362 391
808 3300005981 Ga0081538_10002581 Ga0081538_100025814 391
809 3300009148 Ga0105243_10129958 Ga0105243_101299582 391
810 3300028577 Ga0265318_10010410 Ga0265318_100104102 391
811 3300031241 Ga0265325_10007899 Ga0265325_100078992 391
812 3300031241 Ga0265325_10029443 Ga0265325_100294432 391
813 3300031247 Ga0265340_10019396 Ga0265340_100193964 391
814 3300031247 Ga0265340_10075488 Ga0265340_100754881 391
815 3300031344 Ga0265316_10048681 Ga0265316_100486812 391
816 3300031595 Ga0265313_10010693 Ga0265313_100106934 391
817 3300031616 Ga0307508_10007178 Ga0307508_100071783 391
818 3300031711 Ga0265314_10008661 Ga0265314_100086613 391
819 3300031712 Ga0265342_10009968 Ga0265342_100099683 391
820 3300031712 Ga0265342_10015647 Ga0265342_100156474 391
821 3300031712 Ga0265342_10026071 Ga0265342_100260711 391
822 3300049571 Ga0501034_0035055 Ga0501034_0035055_1017_2339 391
823 3300049742 Ga0501080_0052234 Ga0501080_0052234_1241_2563 391
824 3300054114 Ga0501084_0245700 Ga0501084_0245700_162_1433 391
825 iso_pu_bacteria 2508501123 2509117249 391
826 iso_pu_bacteria 2534681786 2535485872 391
827 iso_pu_bacteria 2599185301 2599937104 391
828 iso_pu_bacteria 2751185800 2753360271 391
829 iso_pu_bacteria 2758568016 2758642591 391
830 iso_pu_bacteria 2854911287 2854913079 391
831 iso_pu_bacteria 2884298095 2884298521 391
832 iso_pu_bacteria 2909042592 2909046943 391
833 iso_pu_bacteria 2915650412 2915651869 391
834 iso_pu_bacteria 2958064165 2958068524 391
835 3300006847 Ga0075431_100142836 Ga0075431_1001428361 392
836 3300006852 Ga0075433_10030537 Ga0075433_100305372 392
837 3300006871 Ga0075434_100063077 Ga0075434_1000630774 392
838 3300009094 Ga0111539_10031180 Ga0111539_100311803 392
839 3300009147 Ga0114129_10009862 Ga0114129_100098625 392
840 3300025294 Ga0209025_1022887 Ga0209025_10228872 392
841 3300031711 Ga0265314_10029460 Ga0265314_100294603 392
842 3300035119 Ga0373956_0015614 Ga0373956_0015614_1627_2949 392
843 3300035724 Ga0373933_0059390 Ga0373933_0059390_92_1465 392
844 3300036401 Ga0373937_0318840 Ga0373937_0318840_34_1287 392
845 3300037312 Ga0395899_0000058 Ga0395899_0000058_138312_139604 392
846 3300037418 Ga0395900_0000056 Ga0395900_0000056_138340_139632 392
847 3300037466 Ga0395898_0000114 Ga0395898_0000114_138331_139623 392
848 3300037471 Ga0395905_0000053 Ga0395905_0000053_73446_74738 392
849 3300038443 Ga0395901_0000037 Ga0395901_0000037_138340_139632 392
850 3300049592 Ga0501076_0147593 Ga0501076_0147593_116_1477 392
851 3300050509 nmdc:mga0qj67_140025_c1 nmdc:mga0qj67_140025_c1_415_1728 392
852 3300050510 nmdc:mga06r32_24274_c1 nmdc:mga06r32_24274_c1_3456_4769 392
853 3300050511 nmdc:mga08y16_92508_c1 nmdc:mga08y16_92508_c1_1482_2813 392
854 3300053077 Ga0495601_0037926 Ga0495601_0037926_1234_2607 392
855 3300053104 Ga0500556_0000054 Ga0500556_0000054_108056_109450 392
856 iso_pu_bacteria 2508501114 2509079289 392
857 iso_pu_bacteria 2508501127 2509144269 392
858 iso_pu_bacteria 2643221736 2644743058 392
859 iso_pu_bacteria 2835312727 2835315700 392
860 iso_pu_bacteria 2841760612 2841765135 392
861 iso_pu_bacteria 2844104063 2844106745 392
862 iso_pu_bacteria 2851182111 2851185719 392
863 iso_pu_bacteria 2851246043 2851248785 392
864 iso_pu_bacteria 8057529695 8057532856 392
865 3300005518 Ga0070699_100005230 Ga0070699_10000523011 393
866 3300005937 Ga0081455_10003800 Ga0081455_100038005 393
867 3300005983 Ga0081540_1001091 Ga0081540_100109119 393
868 3300006042 Ga0075368_10013733 Ga0075368_100137332 393
869 3300006048 Ga0075363_100009168 Ga0075363_1000091682 393
870 3300006173 Ga0070716_100001502 Ga0070716_1000015024 393
871 3300006178 Ga0075367_10015858 Ga0075367_100158584 393
872 3300006844 Ga0075428_100053742 Ga0075428_1000537422 393
873 3300006844 Ga0075428_100165218 Ga0075428_1001652182 393
874 3300006847 Ga0075431_100351834 Ga0075431_1003518341 393
875 3300006871 Ga0075434_100149251 Ga0075434_1001492512 393
876 3300007076 Ga0075435_100053355 Ga0075435_1000533552 393
877 3300025928 Ga0207700_10028695 Ga0207700_100286952 393
878 3300025939 Ga0207665_10002324 Ga0207665_100023244 393
879 3300026075 Ga0207708_10111538 Ga0207708_101115381 393
880 3300035398 Ga0316574_0055723 Ga0316574_0055723_31_1395 393
881 3300037466 Ga0395898_0123107 Ga0395898_0123107_487_1824 393
882 3300038443 Ga0395901_0112892 Ga0395901_0112892_954_2345 393
883 3300038735 Ga0400485_02815 Ga0400485_02815_689_1933 393
884 3300039447 Ga0436361_0071538 Ga0436361_0071538_2418_3755 393
885 3300046536 Ga0495587_0077366 Ga0495587_0077366_485_1846 393
886 3300048907 Ga0496104_0013356 Ga0496104_0013356_5223_6563 393
887 3300049588 Ga0501072_0066784 Ga0501072_0066784_1230_2618 393
888 3300049589 Ga0501073_0031716 Ga0501073_0031716_1065_2453 393
889 3300049592 Ga0501076_0008099 Ga0501076_0008099_515_1903 393
890 3300049741 Ga0501079_0003533 Ga0501079_0003533_9568_10956 393
891 3300049742 Ga0501080_0015899 Ga0501080_0015899_1283_2671 393
892 3300050494 nmdc:mga06z11_59503_c1 nmdc:mga06z11_59503_c1_272_1639 393
893 3300050495 nmdc:mga04h51_44700_c1 nmdc:mga04h51_44700_c1_102_1430 393
894 3300050507 nmdc:mga05p37_5814_c1 nmdc:mga05p37_5814_c1_2649_3986 393
895 3300050512 nmdc:mga0n895_58688_c1 nmdc:mga0n895_58688_c1_2073_3410 393
896 3300050512 nmdc:mga0n895_69536_c1 nmdc:mga0n895_69536_c1_163_1500 393
897 3300053077 Ga0495601_0022185 Ga0495601_0022185_2117_3478 393
898 3300053085 Ga0495619_0015287 Ga0495619_0015287_657_2018 393
899 3300054114 Ga0501084_0034070 Ga0501084_0034070_1261_2649 393
900 iso_pu_bacteria 2545555834 2545678490 393
901 iso_pu_bacteria 2643221564 2643838968 393
902 iso_pu_bacteria 2876392853 2876393082 393
903 iso_pu_bacteria 2904659560 2904662398 393
904 iso_pu_bacteria 2961114664 2961116166 393
905 iso_pu_bacteria 2965062239 2965064716 393
906 iso_pu_bacteria 2968110612 2968113463 393
907 iso_pu_bacteria 641522639 641643154 393
908 iso_pu_bacteria 8001845381 8001845908 393
909 3300005330 Ga0070690_100122683 Ga0070690_1001226831 394
910 3300005331 Ga0070670_100029069 Ga0070670_1000290692 394
911 3300005333 Ga0070677_10002383 Ga0070677_100023836 394
912 3300005340 Ga0070689_100049005 Ga0070689_1000490052 394
913 3300005343 Ga0070687_100020917 Ga0070687_1000209172 394
914 3300005353 Ga0070669_100090652 Ga0070669_1000906522 394
915 3300005356 Ga0070674_100008903 Ga0070674_1000089037 394
916 3300005365 Ga0070688_100018506 Ga0070688_1000185062 394
917 3300005436 Ga0070713_100170990 Ga0070713_1001709902 394
918 3300005456 Ga0070678_100003451 Ga0070678_1000034519 394
919 3300005459 Ga0068867_100005652 Ga0068867_1000056528 394
920 3300005543 Ga0070672_100055821 Ga0070672_1000558213 394
921 3300005544 Ga0070686_100048392 Ga0070686_1000483921 394
922 3300005718 Ga0068866_10028799 Ga0068866_100287992 394
923 3300006195 Ga0075366_10055200 Ga0075366_100552002 394
924 3300006881 Ga0068865_100020355 Ga0068865_1000203553 394
925 3300009098 Ga0105245_10107215 Ga0105245_101072152 394
926 3300009177 Ga0105248_10030987 Ga0105248_100309874 394
927 3300013297 Ga0157378_10127016 Ga0157378_101270162 394
928 3300021384 Ga0213876_10017764 Ga0213876_100177642 394
929 3300025893 Ga0207682_10001074 Ga0207682_1000107411 394
930 3300025901 Ga0207688_10009739 Ga0207688_100097393 394
931 3300025918 Ga0207662_10035651 Ga0207662_100356512 394
932 3300025926 Ga0207659_10076418 Ga0207659_100764181 394
933 3300025935 Ga0207709_10085631 Ga0207709_100856311 394
934 3300025936 Ga0207670_10190376 Ga0207670_101903761 394
935 3300025937 Ga0207669_10002350 Ga0207669_100023508 394
936 3300025938 Ga0207704_10043837 Ga0207704_100438371 394
937 3300025940 Ga0207691_10001292 Ga0207691_100012927 394
938 3300025942 Ga0207689_10022368 Ga0207689_100223682 394
939 3300026088 Ga0207641_10129032 Ga0207641_101290322 394
940 3300026089 Ga0207648_10006883 Ga0207648_1000688310 394
941 3300026116 Ga0207674_10018581 Ga0207674_100185817 394
942 3300026121 Ga0207683_10001466 Ga0207683_100014668 394
943 3300035115 Ga0373941_0002007 Ga0373941_0002007_2917_4257 394
944 3300038742 Ga0400486_11742 Ga0400486_11742_3286_4671 394
945 3300038742 Ga0400486_18730 Ga0400486_18730_233_1531 394
946 3300039437 Ga0436365_0178496 Ga0436365_0178496_2228_3586 394
947 3300039437 Ga0436365_1057605 Ga0436365_1057605_5821_7152 394
948 3300039437 Ga0436365_1912169 Ga0436365_1912169_1762_3099 394
949 3300039450 Ga0436363_0258497 Ga0436363_0258497_898_2187 394
950 3300045051 Ga0451576_0008846 Ga0451576_0008846_4428_5888 394
951 3300046539 Ga0495621_0015431 Ga0495621_0015431_96_1406 394
952 3300049568 Ga0501031_0026160 Ga0501031_0026160_15_1322 394
953 3300049568 Ga0501031_0052065 Ga0501031_0052065_82_1422 394
954 3300049569 Ga0501032_0036616 Ga0501032_0036616_311_1633 394
955 3300049569 Ga0501032_0131157 Ga0501032_0131157_210_1532 394
956 3300049570 Ga0501033_0187861 Ga0501033_0187861_12_1334 394
957 3300049571 Ga0501034_0095010 Ga0501034_0095010_1644_2966 394
958 3300049572 Ga0501036_0020737 Ga0501036_0020737_2718_4040 394
959 3300049572 Ga0501036_0116328 Ga0501036_0116328_815_2137 394
960 3300049573 Ga0501037_0008498 Ga0501037_0008498_1209_2531 394
961 3300049573 Ga0501037_0099748 Ga0501037_0099748_12_1334 394
962 3300049574 Ga0501038_0018824 Ga0501038_0018824_3889_5211 394
963 3300049575 Ga0501039_0087954 Ga0501039_0087954_145_1467 394
964 3300049580 Ga0501046_0016030 Ga0501046_0016030_3338_4660 394
965 3300049581 Ga0501047_0017714 Ga0501047_0017714_3539_4861 394
966 3300049582 Ga0501048_0168825 Ga0501048_0168825_183_1538 394
967 3300049586 Ga0501070_0034753 Ga0501070_0034753_2207_3529 394
968 3300049589 Ga0501073_0040293 Ga0501073_0040293_1532_2860 394
969 3300049589 Ga0501073_0060156 Ga0501073_0060156_200_1522 394
970 3300049590 Ga0501074_0041493 Ga0501074_0041493_466_1788 394
971 3300049742 Ga0501080_0025960 Ga0501080_0025960_3018_4340 394
972 3300049822 Ga0501035_0035083 Ga0501035_0035083_763_2085 394
973 3300049823 Ga0501044_0043987 Ga0501044_0043987_1556_2878 394
974 3300060353 Ga0501082_0025365 Ga0501082_0025365_1023_2345 394
975 iso_pu_bacteria 2842698319 2842700853 394
976 iso_pu_bacteria 2919450847 2919452232 394
977 iso_pu_bacteria 643348564 643602851 394
978 3300005331 Ga0070670_100019941 Ga0070670_1000199413 395
979 3300005335 Ga0070666_10010516 Ga0070666_100105162 395
980 3300005347 Ga0070668_100027024 Ga0070668_1000270244 395
981 3300005356 Ga0070674_100042827 Ga0070674_1000428272 395
982 3300005366 Ga0070659_100142349 Ga0070659_1001423492 395
983 3300005435 Ga0070714_100129997 Ga0070714_1001299971 395
984 3300005436 Ga0070713_100028175 Ga0070713_1000281753 395
985 3300005441 Ga0070700_100013729 Ga0070700_1000137292 395
986 3300005455 Ga0070663_100153128 Ga0070663_1001531282 395
987 3300005456 Ga0070678_100020066 Ga0070678_1000200662 395
988 3300005457 Ga0070662_100018370 Ga0070662_1000183702 395
989 3300005459 Ga0068867_100007482 Ga0068867_1000074823 395
990 3300005530 Ga0070679_100020501 Ga0070679_1000205013 395
991 3300005535 Ga0070684_100036996 Ga0070684_1000369962 395
992 3300005536 Ga0070697_100002109 Ga0070697_1000021099 395
993 3300005543 Ga0070672_100019190 Ga0070672_1000191904 395
994 3300005544 Ga0070686_100014171 Ga0070686_1000141712 395
995 3300005547 Ga0070693_100036397 Ga0070693_1000363972 395
996 3300005549 Ga0070704_100095335 Ga0070704_1000953352 395
997 3300005578 Ga0068854_100067050 Ga0068854_1000670502 395
998 3300005614 Ga0068856_100118053 Ga0068856_1001180532 395
999 3300005618 Ga0068864_100010230 Ga0068864_1000102304 395
1000 3300005719 Ga0068861_100013686 Ga0068861_1000136864 395
1001 3300005834 Ga0068851_10061051 Ga0068851_100610512 395
1002 3300005841 Ga0068863_100019114 Ga0068863_1000191143 395
1003 3300005842 Ga0068858_100130797 Ga0068858_1001307972 395
1004 3300005843 Ga0068860_100015869 Ga0068860_1000158694 395
1005 3300005937 Ga0081455_10010247 Ga0081455_100102472 395
1006 3300005985 Ga0081539_10005675 Ga0081539_100056753 395
1007 3300006028 Ga0070717_10140379 Ga0070717_101403792 395
1008 3300006038 Ga0075365_10003320 Ga0075365_100033206 395
1009 3300006038 Ga0075365_10009306 Ga0075365_100093065 395
1010 3300006038 Ga0075365_10030319 Ga0075365_100303194 395
1011 3300006048 Ga0075363_100028583 Ga0075363_1000285831 395
1012 3300006048 Ga0075363_100049136 Ga0075363_1000491362 395
1013 3300006051 Ga0075364_10062135 Ga0075364_100621352 395
1014 3300006175 Ga0070712_100004185 Ga0070712_1000041853 395
1015 3300006175 Ga0070712_100013202 Ga0070712_1000132024 395
1016 3300006175 Ga0070712_100036607 Ga0070712_1000366073 395
1017 3300006178 Ga0075367_10012255 Ga0075367_100122552 395
1018 3300006178 Ga0075367_10110267 Ga0075367_101102671 395
1019 3300006844 Ga0075428_100000426 Ga0075428_1000004262 395
1020 3300006846 Ga0075430_100030098 Ga0075430_1000300983 395
1021 3300006847 Ga0075431_100003583 Ga0075431_10000358315 395
1022 3300006871 Ga0075434_100023729 Ga0075434_1000237295 395
1023 3300006880 Ga0075429_100002102 Ga0075429_1000021028 395
1024 3300006880 Ga0075429_100050551 Ga0075429_1000505512 395
1025 3300006881 Ga0068865_100166423 Ga0068865_1001664232 395
1026 3300006914 Ga0075436_100015129 Ga0075436_1000151293 395
1027 3300006914 Ga0075436_100024156 Ga0075436_1000241564 395
1028 3300007076 Ga0075435_100014741 Ga0075435_1000147415 395
1029 3300007265 Ga0099794_10029142 Ga0099794_100291422 395
1030 3300009094 Ga0111539_10000554 Ga0111539_1000055414 395
1031 3300009094 Ga0111539_10012226 Ga0111539_100122264 395
1032 3300009098 Ga0105245_10027605 Ga0105245_100276052 395
1033 3300009147 Ga0114129_10003055 Ga0114129_1000305514 395
1034 3300009147 Ga0114129_10132552 Ga0114129_101325522 395
1035 3300009147 Ga0114129_10149759 Ga0114129_101497592 395
1036 3300009174 Ga0105241_10106515 Ga0105241_101065153 395
1037 3300009177 Ga0105248_10009517 Ga0105248_100095172 395
1038 3300009551 Ga0105238_10021249 Ga0105238_100212493 395
1039 3300010159 Ga0099796_10000604 Ga0099796_100006044 395
1040 3300010375 Ga0105239_10054348 Ga0105239_100543482 395
1041 3300013307 Ga0157372_10010309 Ga0157372_100103095 395
1042 3300013308 Ga0157375_10028152 Ga0157375_100281523 395
1043 3300014325 Ga0163163_10072634 Ga0163163_100726342 395
1044 3300014745 Ga0157377_10006953 Ga0157377_100069532 395
1045 3300014968 Ga0157379_10015858 Ga0157379_100158582 395
1046 3300014969 Ga0157376_10030826 Ga0157376_100308262 395
1047 3300017792 Ga0163161_10023758 Ga0163161_100237584 395
1048 3300024227 Ga0228598_1002344 Ga0228598_10023441 395
1049 3300025295 Ga0209564_1002513 Ga0209564_10025134 395
1050 3300025321 Ga0207656_10033112 Ga0207656_100331122 395
1051 3300025900 Ga0207710_10081153 Ga0207710_100811531 395
1052 3300025901 Ga0207688_10010651 Ga0207688_100106512 395
1053 3300025915 Ga0207693_10000434 Ga0207693_1000043420 395
1054 3300025915 Ga0207693_10007408 Ga0207693_100074083 395
1055 3300025915 Ga0207693_10030439 Ga0207693_100304393 395
1056 3300025915 Ga0207693_10041887 Ga0207693_100418872 395
1057 3300025915 Ga0207693_10135186 Ga0207693_101351861 395
1058 3300025918 Ga0207662_10007603 Ga0207662_100076035 395
1059 3300025920 Ga0207649_10030181 Ga0207649_100301812 395
1060 3300025927 Ga0207687_10029140 Ga0207687_100291402 395
1061 3300025929 Ga0207664_10044050 Ga0207664_100440504 395
1062 3300025931 Ga0207644_10018432 Ga0207644_100184323 395
1063 3300025932 Ga0207690_10013558 Ga0207690_100135582 395
1064 3300025933 Ga0207706_10001103 Ga0207706_1000110312 395
1065 3300025937 Ga0207669_10097204 Ga0207669_100972042 395
1066 3300025939 Ga0207665_10038536 Ga0207665_100385362 395
1067 3300025940 Ga0207691_10027729 Ga0207691_100277295 395
1068 3300025942 Ga0207689_10007363 Ga0207689_100073635 395
1069 3300025944 Ga0207661_10080240 Ga0207661_100802401 395
1070 3300025944 Ga0207661_10179545 Ga0207661_101795452 395
1071 3300025949 Ga0207667_10144988 Ga0207667_101449882 395
1072 3300025961 Ga0207712_10000880 Ga0207712_100008806 395
1073 3300026023 Ga0207677_10027198 Ga0207677_100271984 395
1074 3300026035 Ga0207703_10155739 Ga0207703_101557392 395
1075 3300026067 Ga0207678_10012203 Ga0207678_100122035 395
1076 3300026075 Ga0207708_10000620 Ga0207708_1000062013 395
1077 3300026075 Ga0207708_10076958 Ga0207708_100769581 395
1078 3300026088 Ga0207641_10011851 Ga0207641_100118515 395
1079 3300026089 Ga0207648_10002122 Ga0207648_1000212211 395
1080 3300026095 Ga0207676_10031531 Ga0207676_100315312 395
1081 3300026118 Ga0207675_100002342 Ga0207675_10000234210 395
1082 3300026121 Ga0207683_10015346 Ga0207683_100153467 395
1083 3300027907 Ga0207428_10009912 Ga0207428_100099123 395
1084 3300028379 Ga0268266_10141623 Ga0268266_101416232 395
1085 3300028800 Ga0265338_10039087 Ga0265338_100390871 395
1086 3300031238 Ga0265332_10000743 Ga0265332_1000074316 395
1087 3300031241 Ga0265325_10021294 Ga0265325_100212942 395
1088 3300031241 Ga0265325_10038529 Ga0265325_100385292 395
1089 3300031242 Ga0265329_10006949 Ga0265329_100069493 395
1090 3300031247 Ga0265340_10006011 Ga0265340_100060115 395
1091 3300031247 Ga0265340_10006392 Ga0265340_100063925 395
1092 3300031247 Ga0265340_10013593 Ga0265340_100135933 395
1093 3300031249 Ga0265339_10000033 Ga0265339_10000033108 395
1094 3300031249 Ga0265339_10006458 Ga0265339_100064584 395
1095 3300031249 Ga0265339_10013851 Ga0265339_100138515 395
1096 3300031344 Ga0265316_10027808 Ga0265316_100278082 395
1097 3300031344 Ga0265316_10048132 Ga0265316_100481322 395
1098 3300031456 Ga0307513_10253465 Ga0307513_102534651 395
1099 3300031595 Ga0265313_10000049 Ga0265313_1000004949 395
1100 3300031595 Ga0265313_10009973 Ga0265313_100099734 395
1101 3300031711 Ga0265314_10011925 Ga0265314_100119253 395
1102 3300031711 Ga0265314_10052401 Ga0265314_100524011 395
1103 3300031712 Ga0265342_10000034 Ga0265342_1000003413 395
1104 3300035089 Ga0373944_0006983 Ga0373944_0006983_62_1615 395
1105 3300035116 Ga0373945_0002010 Ga0373945_0002010_3550_4896 395
1106 3300035170 Ga0373943_0054528 Ga0373943_0054528_221_1582 395
1107 3300035170 Ga0373943_0076961 Ga0373943_0076961_301_1635 395
1108 3300035691 Ga0373931_0001020 Ga0373931_0001020_10059_11381 395
1109 3300035691 Ga0373931_0064720 Ga0373931_0064720_106_1440 395
1110 3300035692 Ga0373935_0017541 Ga0373935_0017541_2949_4307 395
1111 3300035692 Ga0373935_0088165 Ga0373935_0088165_380_1717 395
1112 3300035692 Ga0373935_0165584 Ga0373935_0165584_98_1447 395
1113 3300035692 Ga0373935_0197549 Ga0373935_0197549_26_1285 395
1114 3300035695 Ga0373927_0031034 Ga0373927_0031034_725_2083 395
1115 3300035695 Ga0373927_0066257 Ga0373927_0066257_968_2290 395
1116 3300035724 Ga0373933_0025115 Ga0373933_0025115_1263_2600 395
1117 3300035725 Ga0373947_0002147 Ga0373947_0002147_1433_2782 395
1118 3300035725 Ga0373947_0013464 Ga0373947_0013464_2606_3928 395
1119 3300035725 Ga0373947_0058003 Ga0373947_0058003_365_1723 395
1120 3300037068 Ga0373925_0052748 Ga0373925_0052748_1172_2431 395
1121 3300037068 Ga0373925_0072113 Ga0373925_0072113_500_1882 395
1122 3300038742 Ga0400486_14182 Ga0400486_14182_912_2207 395
1123 3300039437 Ga0436365_0288317 Ga0436365_0288317_937_2241 395
1124 3300039437 Ga0436365_1590566 Ga0436365_1590566_1882_3189 395
1125 3300046454 Ga0495592_0141447 Ga0495592_0141447_25_1332 395
1126 3300046462 Ga0495651_0159959 Ga0495651_0159959_262_1599 395
1127 3300046474 Ga0495605_0035372 Ga0495605_0035372_37_1395 395
1128 3300046475 Ga0495639_0013565 Ga0495639_0013565_1908_3230 395
1129 3300046476 Ga0495662_0001111 Ga0495662_0001111_6993_8342 395
1130 3300046477 Ga0495664_0000554 Ga0495664_0000554_1736_3085 395
1131 3300046491 Ga0495584_0017349 Ga0495584_0017349_720_2072 395
1132 3300046491 Ga0495584_0050569 Ga0495584_0050569_375_1733 395
1133 3300046492 Ga0495585_0007429 Ga0495585_0007429_2699_4057 395
1134 3300046514 Ga0495618_0013332 Ga0495618_0013332_2854_4203 395
1135 3300046516 Ga0495628_0107988 Ga0495628_0107988_677_2038 395
1136 3300046517 Ga0495630_0016521 Ga0495630_0016521_3610_4959 395
1137 3300046517 Ga0495630_0101373 Ga0495630_0101373_661_1920 395
1138 3300046517 Ga0495630_0134283 Ga0495630_0134283_117_1439 395
1139 3300046526 Ga0495666_0052151 Ga0495666_0052151_401_1750 395
1140 3300046529 Ga0495652_0056892 Ga0495652_0056892_1758_3107 395
1141 3300046533 Ga0495640_0003647 Ga0495640_0003647_4515_5864 395
1142 3300046543 Ga0495645_0031880 Ga0495645_0031880_2289_3638 395
1143 3300046615 Ga0495656_0070647 Ga0495656_0070647_164_1486 395
1144 3300046642 Ga0495634_0008546 Ga0495634_0008546_231_1577 395
1145 3300046642 Ga0495634_0101543 Ga0495634_0101543_267_1526 395
1146 3300046663 Ga0495635_0004485 Ga0495635_0004485_2208_3557 395
1147 3300046680 Ga0495646_0019483 Ga0495646_0019483_1366_2703 395
1148 3300046683 Ga0495658_0021232 Ga0495658_0021232_266_1588 395
1149 3300046690 Ga0495624_0064843 Ga0495624_0064843_401_1759 395
1150 3300046690 Ga0495624_0103059 Ga0495624_0103059_333_1682 395
1151 3300046694 Ga0495649_0032841 Ga0495649_0032841_161_1495 395
1152 3300046809 Ga0495600_0106976 Ga0495600_0106976_254_1615 395
1153 3300047315 Ga0495581_0080854 Ga0495581_0080854_396_1718 395
1154 3300047317 Ga0495604_0202439 Ga0495604_0202439_44_1327 395
1155 3300047319 Ga0495674_0005023 Ga0495674_0005023_3551_4900 395
1156 3300047319 Ga0495674_0054999 Ga0495674_0054999_1935_3278 395
1157 3300047447 Ga0495685_006328 Ga0495685_006328_2033_3376 395
1158 3300047471 Ga0495684_0031461 Ga0495684_0031461_1292_2641 395
1159 3300047471 Ga0495684_0183854 Ga0495684_0183854_74_1420 395
1160 3300048903 Ga0496100_0009675 Ga0496100_0009675_1743_3077 395
1161 3300048905 Ga0496102_0002294 Ga0496102_0002294_6183_7463 395
1162 3300048906 Ga0496103_0007191 Ga0496103_0007191_1676_3010 395
1163 3300048907 Ga0496104_0030510 Ga0496104_0030510_475_1755 395
1164 3300048907 Ga0496104_0053180 Ga0496104_0053180_871_2289 395
1165 3300048908 Ga0496105_0013665 Ga0496105_0013665_2821_4101 395
1166 3300048908 Ga0496105_0059858 Ga0496105_0059858_1077_2411 395
1167 3300048909 Ga0496106_0002640 Ga0496106_0002640_7917_9197 395
1168 3300048910 Ga0496107_0003942 Ga0496107_0003942_228_1508 395
1169 3300048910 Ga0496107_0018342 Ga0496107_0018342_1205_2539 395
1170 3300048911 Ga0496108_0001531 Ga0496108_0001531_2447_3775 395
1171 3300048911 Ga0496108_0022438 Ga0496108_0022438_1574_2908 395
1172 3300048912 Ga0496109_0029291 Ga0496109_0029291_3091_4371 395
1173 3300048912 Ga0496109_0062750 Ga0496109_0062750_1205_2539 395
1174 3300048913 Ga0496110_0044371 Ga0496110_0044371_860_2194 395
1175 3300048913 Ga0496110_0154168 Ga0496110_0154168_114_1532 395
1176 3300048914 Ga0496111_0022726 Ga0496111_0022726_3087_4367 395
1177 3300048915 Ga0496112_0001338 Ga0496112_0001338_2197_3525 395
1178 3300048916 Ga0496113_0023272 Ga0496113_0023272_2027_3373 395
1179 3300048917 Ga0496114_0016997 Ga0496114_0016997_3305_4663 395
1180 3300048917 Ga0496114_0027325 Ga0496114_0027325_1765_3099 395
1181 3300048917 Ga0496114_0084827 Ga0496114_0084827_94_1374 395
1182 3300048918 Ga0496115_0027048 Ga0496115_0027048_2638_3984 395
1183 3300048918 Ga0496115_0082075 Ga0496115_0082075_559_1917 395
1184 3300048929 Ga0496126_0007940 Ga0496126_0007940_8456_9805 395
1185 3300049568 Ga0501031_0033350 Ga0501031_0033350_364_1695 395
1186 3300049569 Ga0501032_0021745 Ga0501032_0021745_643_1983 395
1187 3300049570 Ga0501033_0007570 Ga0501033_0007570_2917_4257 395
1188 3300049570 Ga0501033_0050865 Ga0501033_0050865_1007_2347 395
1189 3300049570 Ga0501033_0068165 Ga0501033_0068165_407_1747 395
1190 3300049571 Ga0501034_0055429 Ga0501034_0055429_1536_2876 395
1191 3300049572 Ga0501036_0033174 Ga0501036_0033174_2032_3375 395
1192 3300049572 Ga0501036_0118539 Ga0501036_0118539_381_1721 395
1193 3300049573 Ga0501037_0191839 Ga0501037_0191839_97_1428 395
1194 3300049574 Ga0501038_0142068 Ga0501038_0142068_336_1676 395
1195 3300049579 Ga0501043_0047470 Ga0501043_0047470_103_1443 395
1196 3300049579 Ga0501043_0162417 Ga0501043_0162417_269_1609 395
1197 3300049581 Ga0501047_0013347 Ga0501047_0013347_3931_5271 395
1198 3300049581 Ga0501047_0034936 Ga0501047_0034936_2352_3695 395
1199 3300049581 Ga0501047_0038409 Ga0501047_0038409_1382_2722 395
1200 3300049581 Ga0501047_0122721 Ga0501047_0122721_540_1880 395
1201 3300049586 Ga0501070_0020182 Ga0501070_0020182_2125_3468 395
1202 3300049586 Ga0501070_0073821 Ga0501070_0073821_1026_2366 395
1203 3300049586 Ga0501070_0082668 Ga0501070_0082668_1110_2450 395
1204 3300049586 Ga0501070_0117981 Ga0501070_0117981_463_1788 395
1205 3300049588 Ga0501072_0002643 Ga0501072_0002643_8163_9506 395
1206 3300049744 Ga0501083_0005924 Ga0501083_0005924_1301_2641 395
1207 3300049822 Ga0501035_0066823 Ga0501035_0066823_457_1797 395
1208 3300049822 Ga0501035_0211521 Ga0501035_0211521_68_1408 395
1209 3300049823 Ga0501044_0047924 Ga0501044_0047924_1248_2588 395
1210 3300050492 nmdc:mga0yw44_1745_c1 nmdc:mga0yw44_1745_c1_3609_4943 395
1211 3300050507 nmdc:mga05p37_183433_c1 nmdc:mga05p37_183433_c1_929_2275 395
1212 3300050507 nmdc:mga05p37_305_c1 nmdc:mga05p37_305_c1_31663_33003 395
1213 3300050508 nmdc:mga09592_1154_c1 nmdc:mga09592_1154_c1_16375_17715 395
1214 3300050509 nmdc:mga0qj67_24382_c1 nmdc:mga0qj67_24382_c1_2433_3773 395
1215 3300050509 nmdc:mga0qj67_412_c1 nmdc:mga0qj67_412_c1_24519_25853 395
1216 3300050509 nmdc:mga0qj67_42917_c1 nmdc:mga0qj67_42917_c1_631_1974 395
1217 3300050510 nmdc:mga06r32_1000_c1 nmdc:mga06r32_1000_c1_21352_22692 395
1218 3300050511 nmdc:mga08y16_22596_c1 nmdc:mga08y16_22596_c1_2755_4095 395
1219 3300050512 nmdc:mga0n895_117665_c1 nmdc:mga0n895_117665_c1_248_1588 395
1220 3300050512 nmdc:mga0n895_75677_c1 nmdc:mga0n895_75677_c1_856_2190 395
1221 3300050513 nmdc:mga0rr50_30851_c1 nmdc:mga0rr50_30851_c1_808_2154 395
1222 3300050513 nmdc:mga0rr50_33999_c1 nmdc:mga0rr50_33999_c1_894_2234 395
1223 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_136074_137414 395
1224 3300050514 nmdc:mga08x19_43298_c1 nmdc:mga08x19_43298_c1_681_2030 395
1225 3300053077 Ga0495601_0088544 Ga0495601_0088544_335_1684 395
1226 3300053084 Ga0495595_0009163 Ga0495595_0009163_758_2095 395
1227 3300053085 Ga0495619_0007493 Ga0495619_0007493_690_2039 395
1228 3300053096 Ga0500641_0012417 Ga0500641_0012417_1776_3098 395
1229 3300053139 Ga0500568_0008308 Ga0500568_0008308_1445_2788 395
1230 3300053153 Ga0500616_0017112 Ga0500616_0017112_1494_2813 395
1231 3300054114 Ga0501084_0026596 Ga0501084_0026596_3057_4400 395
1232 iso_pu_bacteria 2513237087 2513593810 395
1233 iso_pu_bacteria 2828305725 2828308748 395
1234 iso_pu_bacteria 2917554339 2917554444 395
1235 3300005937 Ga0081455_10004068 Ga0081455_100040687 396
1236 3300005937 Ga0081455_10063296 Ga0081455_100632962 396
1237 3300006844 Ga0075428_100000797 Ga0075428_10000079711 396
1238 3300006846 Ga0075430_100000045 Ga0075430_10000004539 396
1239 3300006852 Ga0075433_10002970 Ga0075433_100029702 396
1240 3300006871 Ga0075434_100003473 Ga0075434_10000347313 396
1241 3300006871 Ga0075434_100076053 Ga0075434_1000760532 396
1242 3300006880 Ga0075429_100000214 Ga0075429_10000021411 396
1243 3300007076 Ga0075435_100006663 Ga0075435_1000066636 396
1244 3300007076 Ga0075435_100044338 Ga0075435_1000443382 396
1245 3300009094 Ga0111539_10000693 Ga0111539_1000069331 396
1246 3300009147 Ga0114129_10009653 Ga0114129_100096532 396
1247 3300009147 Ga0114129_10010881 Ga0114129_100108812 396
1248 3300027907 Ga0207428_10000180 Ga0207428_1000018012 396
1249 3300045051 Ga0451576_0036471 Ga0451576_0036471_1671_2996 396
1250 3300048910 Ga0496107_0226034 Ga0496107_0226034_148_1341 396
1251 3300003215 JGI25153J46596_10007129 JGI25153J46596_100071293 397
1252 3300005330 Ga0070690_100018079 Ga0070690_1000180793 397
1253 3300005355 Ga0070671_100121478 Ga0070671_1001214783 397
1254 3300005434 Ga0070709_10025951 Ga0070709_100259514 397
1255 3300005436 Ga0070713_100009074 Ga0070713_1000090742 397
1256 3300005437 Ga0070710_10048258 Ga0070710_100482581 397
1257 3300005438 Ga0070701_10035872 Ga0070701_100358722 397
1258 3300005439 Ga0070711_100009511 Ga0070711_1000095113 397
1259 3300005439 Ga0070711_100025195 Ga0070711_1000251951 397
1260 3300005439 Ga0070711_100139001 Ga0070711_1001390012 397
1261 3300005441 Ga0070700_100046735 Ga0070700_1000467353 397
1262 3300005618 Ga0068864_100037574 Ga0068864_1000375743 397
1263 3300005842 Ga0068858_100152450 Ga0068858_1001524501 397
1264 3300005983 Ga0081540_1046654 Ga0081540_10466542 397
1265 3300006175 Ga0070712_100022302 Ga0070712_1000223022 397
1266 3300009094 Ga0111539_10154888 Ga0111539_101548882 397
1267 3300009148 Ga0105243_10101266 Ga0105243_101012661 397
1268 3300009176 Ga0105242_10204839 Ga0105242_102048391 397
1269 3300025297 Ga0209758_1000351 Ga0209758_100035158 397
1270 3300025915 Ga0207693_10047451 Ga0207693_100474512 397
1271 3300025916 Ga0207663_10014716 Ga0207663_100147164 397
1272 3300025916 Ga0207663_10043013 Ga0207663_100430133 397
1273 3300025917 Ga0207660_10045233 Ga0207660_100452332 397
1274 3300025928 Ga0207700_10014082 Ga0207700_100140822 397
1275 3300025931 Ga0207644_10084012 Ga0207644_100840121 397
1276 3300025936 Ga0207670_10057512 Ga0207670_100575123 397
1277 3300025972 Ga0207668_10036309 Ga0207668_100363092 397
1278 3300026075 Ga0207708_10232340 Ga0207708_102323401 397
1279 3300026095 Ga0207676_10028462 Ga0207676_100284621 397
1280 3300026118 Ga0207675_100122629 Ga0207675_1001226292 397
1281 3300031241 Ga0265325_10000011 Ga0265325_1000001136 397
1282 3300031249 Ga0265339_10020920 Ga0265339_100209202 397
1283 3300035111 Ga0373923_0022562 Ga0373923_0022562_403_1758 397
1284 3300035114 Ga0373939_0006504 Ga0373939_0006504_372_1718 397
1285 3300035117 Ga0373953_0026835 Ga0373953_0026835_508_1863 397
1286 3300035120 Ga0373957_0027438 Ga0373957_0027438_219_1574 397
1287 3300035172 Ga0373955_0007784 Ga0373955_0007784_1531_2886 397
1288 3300035691 Ga0373931_0011815 Ga0373931_0011815_1134_2480 397
1289 3300035692 Ga0373935_0018168 Ga0373935_0018168_889_2244 397
1290 3300035695 Ga0373927_0039932 Ga0373927_0039932_289_1644 397
1291 3300035724 Ga0373933_0003790 Ga0373933_0003790_3965_5320 397
1292 3300036401 Ga0373937_0033961 Ga0373937_0033961_186_1541 397
1293 3300037068 Ga0373925_0009283 Ga0373925_0009283_1417_2772 397
1294 3300041408 Ga0439453_0001532 Ga0439453_0001532_493_1836 397
1295 3300044684 Ga0466966_0022724 Ga0466966_0022724_10_1350 397
1296 3300046454 Ga0495592_0017067 Ga0495592_0017067_769_2124 397
1297 3300046462 Ga0495651_0062050 Ga0495651_0062050_39_1394 397
1298 3300046463 Ga0495653_0061879 Ga0495653_0061879_423_1778 397
1299 3300046477 Ga0495664_0074099 Ga0495664_0074099_219_1574 397
1300 3300046516 Ga0495628_0002019 Ga0495628_0002019_4323_5678 397
1301 3300046516 Ga0495628_0066858 Ga0495628_0066858_20_1366 397
1302 3300046529 Ga0495652_0009055 Ga0495652_0009055_460_1815 397
1303 3300046543 Ga0495645_0002478 Ga0495645_0002478_1528_2883 397
1304 3300046559 Ga0495667_0003773 Ga0495667_0003773_3297_4652 397
1305 3300046663 Ga0495635_0021234 Ga0495635_0021234_1165_2520 397
1306 3300046675 Ga0495657_0025220 Ga0495657_0025220_1442_2797 397
1307 3300046678 Ga0495599_0004891 Ga0495599_0004891_2039_3394 397
1308 3300046679 Ga0495623_0007569 Ga0495623_0007569_671_2026 397
1309 3300046809 Ga0495600_0007740 Ga0495600_0007740_4262_5617 397
1310 3300047317 Ga0495604_0001901 Ga0495604_0001901_10701_12056 397
1311 3300047444 Ga0495675_0011655 Ga0495675_0011655_1581_2936 397
1312 3300047471 Ga0495684_0023761 Ga0495684_0023761_519_1874 397
1313 3300048088 Ga0495602_0013293 Ga0495602_0013293_2620_3975 397
1314 3300048903 Ga0496100_0018641 Ga0496100_0018641_2724_4070 397
1315 3300048904 Ga0496101_0001461 Ga0496101_0001461_9276_10622 397
1316 3300048907 Ga0496104_0000067 Ga0496104_0000067_32267_33622 397
1317 3300048907 Ga0496104_0031348 Ga0496104_0031348_106_1452 397
1318 3300048908 Ga0496105_0006553 Ga0496105_0006553_5730_7085 397
1319 3300048908 Ga0496105_0066956 Ga0496105_0066956_1316_2662 397
1320 3300048909 Ga0496106_0028442 Ga0496106_0028442_1877_3223 397
1321 3300048910 Ga0496107_0127156 Ga0496107_0127156_69_1415 397
1322 3300048911 Ga0496108_0005206 Ga0496108_0005206_766_2112 397
1323 3300048912 Ga0496109_0054274 Ga0496109_0054274_1506_2852 397
1324 3300048916 Ga0496113_0069310 Ga0496113_0069310_421_1767 397
1325 3300048917 Ga0496114_0019417 Ga0496114_0019417_3204_4559 397
1326 3300048917 Ga0496114_0032419 Ga0496114_0032419_958_2304 397
1327 3300049568 Ga0501031_0024114 Ga0501031_0024114_401_1744 397
1328 3300049570 Ga0501033_0024751 Ga0501033_0024751_1799_3142 397
1329 3300049571 Ga0501034_0014630 Ga0501034_0014630_3368_4711 397
1330 3300049572 Ga0501036_0005528 Ga0501036_0005528_6081_7424 397
1331 3300049573 Ga0501037_0004329 Ga0501037_0004329_2270_3613 397
1332 3300049574 Ga0501038_0127911 Ga0501038_0127911_106_1458 397
1333 3300049574 Ga0501038_0144129 Ga0501038_0144129_358_1701 397
1334 3300049575 Ga0501039_0020438 Ga0501039_0020438_395_1738 397
1335 3300049579 Ga0501043_0026048 Ga0501043_0026048_2800_4143 397
1336 3300049580 Ga0501046_0001179 Ga0501046_0001179_10400_11743 397
1337 3300049581 Ga0501047_0040143 Ga0501047_0040143_1385_2728 397
1338 3300049583 Ga0501067_0010712 Ga0501067_0010712_1417_2760 397
1339 3300049585 Ga0501069_0001495 Ga0501069_0001495_4622_5965 397
1340 3300049586 Ga0501070_0067697 Ga0501070_0067697_358_1701 397
1341 3300049588 Ga0501072_0076632 Ga0501072_0076632_435_1778 397
1342 3300049589 Ga0501073_0049159 Ga0501073_0049159_1257_2600 397
1343 3300049590 Ga0501074_0004007 Ga0501074_0004007_6884_8227 397
1344 3300049741 Ga0501079_0036203 Ga0501079_0036203_1008_2351 397
1345 3300049742 Ga0501080_0039526 Ga0501080_0039526_1803_3146 397
1346 3300049744 Ga0501083_0009206 Ga0501083_0009206_5190_6533 397
1347 3300049823 Ga0501044_0000411 Ga0501044_0000411_42583_43935 397
1348 3300049823 Ga0501044_0037724 Ga0501044_0037724_1908_3251 397
1349 3300049824 Ga0501045_0044118 Ga0501045_0044118_316_1659 397
1350 3300050496 nmdc:mga07m45_92793_c1 nmdc:mga07m45_92793_c1_221_1567 397
1351 3300050511 nmdc:mga08y16_140156_c1 nmdc:mga08y16_140156_c1_518_1855 397
1352 3300053077 Ga0495601_0000482 Ga0495601_0000482_456_1811 397
1353 3300053077 Ga0495601_0058528 Ga0495601_0058528_92_1432 397
1354 3300053078 Ga0495612_0000671 Ga0495612_0000671_11047_12402 397
1355 3300053084 Ga0495595_0004391 Ga0495595_0004391_1472_2827 397
1356 3300053084 Ga0495595_0028307 Ga0495595_0028307_1003_2343 397
1357 3300053085 Ga0495619_0006508 Ga0495619_0006508_1022_2377 397
1358 3300054114 Ga0501084_0053125 Ga0501084_0053125_441_1784 397
1359 3300060353 Ga0501082_0011519 Ga0501082_0011519_1372_2715 397
1360 3300061719 Ga0466962_0057962 Ga0466962_0057962_10_1350 397
1361 3300001977 JGI24746J21847_1001865 JGI24746J21847_10018653 398
1362 3300005435 Ga0070714_100094615 Ga0070714_1000946152 398
1363 3300005937 Ga0081455_10000002 Ga0081455_10000002327 398
1364 3300025939 Ga0207665_10031554 Ga0207665_100315543 398
1365 3300037312 Ga0395899_0083518 Ga0395899_0083518_293_1636 398
1366 3300037418 Ga0395900_0112730 Ga0395900_0112730_1233_2576 398
1367 3300037418 Ga0395900_0167688 Ga0395900_0167688_638_2056 398
1368 3300037466 Ga0395898_0094620 Ga0395898_0094620_1356_2699 398
1369 3300037466 Ga0395898_0166056 Ga0395898_0166056_236_1579 398
1370 3300038443 Ga0395901_0159547 Ga0395901_0159547_729_2072 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

326

401

0.92

PF01029

NusB

NusB family

87

214

0.91

PF01189

Methyltr_RsmB-F

16S rRNA methyltransferase RsmB/F

316

515

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8796 12 96
2frx-assembly2.cif.gz_B crystal structure of yebu, a m5c rna methyltransferase from e.coli 0.8607 110 398
1sqg-assembly1.cif.gz_A the crystal structure of the e. coli fmu apoenzyme at 1.65 a resolution 0.8476 5 394
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.8401 12 96
3m6w-assembly1.cif.gz_A multi-site-specific 16s rrna methyltransferase rsmf from thermus thermophilus in space group p21212 in complex with s-adenosyl-l-methionine 0.8385 110 398
ID Description Score Start End Superfamily
af_Q2FZ67_236_433_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9252 193 396 3.40.50.150
af_Q651X9_102_252_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9144 6 96 1.10.940.10
1sqgA01 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9134 5 96 1.10.940.10
af_Q8VYC4_72_208_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9096 6 96 1.10.940.10
2yxlA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9075 186 394 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4D7AZ78-F1-model_v4 Methyltransferase domain-containing protein 0.9845 5 395 GO:0001510
GO:0003723
GO:0006355
GO:0008173
AF-A0A1T4T5I6-F1-model_v4 16S rRNA (Cytosine967-C5)-methyltransferase 0.9787 5 397 GO:0001510
GO:0003723
GO:0006355
GO:0008173
AF-A0A0N1L9Y0-F1-model_v4 MFS transporter 0.9781 5 395 GO:0001510
GO:0003723
GO:0006355
GO:0008173
AF-A0A7Y4TC47-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9765 176 397 GO:0001510
GO:0003723
GO:0008173
AF-A0A1H1HPK7-F1-model_v4 16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176) (16S rRNA m5C967 methyltransferase) (rRNA (cytosine-C(5)-)-methyltransferase RsmB) 0.9751 6 396 GO:0003723
GO:0005737
GO:0006355
GO:0008649

Feature Viewer

pLDDT pTM Quality
94.1 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map