F493410
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 760 | 997 | 447 |
Family's Representative Sequence
| Representative Sequence | 3300035089|Ga0373944_0006983|Ga0373944_0006983_62_1615 |
| Length | 517 |
| Sequence | MGLMDRGFDRERIVTPRTRASSTLGAAIEHCAFSGELAHPLQPLPGGGKHGPRTDHKTTDHNQPRMPLLPIERTITSAPGVDPPGFAARRIAADILDGVLRRRRPLDEQFEDRAAHPEFATLPDRDRALVRALVTSALRRLGTLRHLLGRRLARGLPADAPRVEVALLIGAAQILWLEVPDHAAVDLAVRLVQADRRAARYAGLVNAVLRGLARDGAHDLAALDTTALDTPDWLMTRWVANYGAETARAIAVANGHEPALDLTVTSDPEGWASALGGRVLPTGSVRAQVHGPISQLPGYGDGIWWVQDAAAALPAKLLGDVRGLTAADLCAAPGGKTAQLAAGGARVVAVDRSAARLERLRQNLSRLHLSAETVAADVTQWQAGPFDAVLLDAPCSATGTIRRHPDIPWLKHERDIAALAGLQRRLIAQAAELTKPGGVLVYCTCSLEPEEGIEVVRDLLGRNPDLQRQPISAAEVYGHAEWLTPGGDLRTLPCHLPDPDSRMAGLDGFYAARLRRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 14 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 15 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 16 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 17 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 18 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 19 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 20 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 21 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 22 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 23 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 24 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 25 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 26 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 27 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 28 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 29 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 30 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 31 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 32 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 33 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 34 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 35 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 36 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 37 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 38 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 39 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 40 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 41 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 42 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 43 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 44 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 45 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 46 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 47 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 48 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 49 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 50 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 51 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 52 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 53 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 54 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 55 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 56 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 57 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 58 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 59 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 60 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 61 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 62 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 63 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 64 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 65 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 66 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 67 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 68 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 69 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 70 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 71 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 72 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 73 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 74 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 75 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 76 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 77 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 78 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 79 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 80 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 81 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 82 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 83 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 84 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 85 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 86 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 87 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 88 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 89 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 90 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 91 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 92 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 93 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 94 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 95 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 96 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 97 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 98 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 99 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 100 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 101 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 102 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 103 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 104 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 105 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 106 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 107 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 108 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 109 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 110 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 111 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 112 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 113 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 114 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 115 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 116 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 117 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 118 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 119 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 120 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 121 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 122 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 123 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 124 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 125 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 126 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 127 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 128 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 129 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 130 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 131 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 132 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 133 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 134 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 135 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 136 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 137 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 138 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 139 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 140 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 141 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 142 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 143 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 144 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 145 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 146 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 147 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 148 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 149 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 150 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 151 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 152 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 153 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 154 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 155 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 156 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 157 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 158 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 159 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 160 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 161 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 162 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 163 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 164 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 165 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 166 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 167 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 168 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 169 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 170 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 171 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 172 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 173 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 174 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 175 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 176 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 177 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 178 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 179 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 180 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 181 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 182 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 183 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 184 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 185 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 186 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 187 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 188 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 189 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 190 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 191 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 192 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 193 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 194 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 195 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 196 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 197 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 198 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 199 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 200 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 201 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 202 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 203 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 204 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 205 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 206 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 207 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 208 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 209 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 210 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 211 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 212 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 213 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 214 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 215 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 216 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 217 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 218 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 219 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 220 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 221 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 222 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 223 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 224 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 225 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 226 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 227 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 228 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 229 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 230 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 231 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 232 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 233 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 234 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 235 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 236 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 237 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 238 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 239 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 240 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 241 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 242 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 243 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 244 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 245 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 246 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 247 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 248 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 249 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 250 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 251 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 252 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 253 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 254 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 255 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 256 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 257 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 258 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 259 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 260 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 261 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 262 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 263 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 264 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 265 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 266 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 267 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 268 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 269 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 270 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 271 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 272 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 273 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 274 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 275 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 276 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 277 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 278 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 279 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 280 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 281 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 282 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 283 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 284 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 285 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 286 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 287 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 288 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 289 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 290 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 291 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 292 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 293 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 294 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 295 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 296 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 297 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 298 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 299 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 300 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 301 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 302 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 303 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 304 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 305 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 306 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 307 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 308 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 309 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 310 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 311 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 312 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 313 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 314 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 315 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 316 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 317 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 318 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 319 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 320 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 321 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 322 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 323 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 324 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 325 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 326 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 327 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 328 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 329 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 330 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 331 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 332 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 333 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 334 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 335 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 336 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 337 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 338 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 339 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 340 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 341 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 342 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 343 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 344 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 345 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 346 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 347 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 348 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 349 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 350 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 351 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 352 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 353 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 354 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 355 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 356 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 357 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 361 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 362 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 364 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 365 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 367 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 368 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 369 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 370 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 372 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 373 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 374 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 375 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 376 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 380 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 381 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 382 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 383 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 385 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 386 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 387 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 388 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 389 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 390 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 391 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 393 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 394 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 395 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 396 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 397 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 398 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 399 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 400 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 401 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 402 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 403 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 404 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 405 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 406 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 407 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 408 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 409 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 410 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 411 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 412 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 413 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 414 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 415 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 416 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 417 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 418 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 419 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 420 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 421 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 422 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 423 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 424 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 425 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 426 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 427 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 428 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 429 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 430 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 431 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 433 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 435 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 436 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 437 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 438 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 439 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 440 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 441 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 442 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 443 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 444 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 445 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 446 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 447 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 448 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 449 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 450 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 451 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 452 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 453 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 454 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 455 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 456 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 457 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 459 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 461 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 462 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 466 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 467 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 517 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 518 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 521 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 522 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 523 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 524 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 525 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 526 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 527 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 528 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 529 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 530 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 531 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 532 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 533 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 534 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 535 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 536 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 537 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 538 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 539 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 540 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 541 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 542 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 543 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 544 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 545 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 546 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 547 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 548 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 549 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 550 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 551 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 552 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 553 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 554 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 555 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 556 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 557 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 558 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 559 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 560 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 561 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 562 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 563 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 564 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 565 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 566 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 567 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 568 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 569 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 570 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 571 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 572 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 573 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 574 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 575 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 576 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 577 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 578 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 579 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 580 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 637 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 638 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 639 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 640 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 641 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 642 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 643 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 644 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 645 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 646 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 647 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 648 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 649 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 650 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 651 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 652 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 653 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 654 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 655 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 656 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 657 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 658 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 659 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 660 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 661 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 662 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 663 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 668 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 671 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 672 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 673 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 678 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 679 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 680 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 681 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 682 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 683 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 684 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 688 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 690 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 696 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 697 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 698 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 699 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 700 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 701 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 702 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 703 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 704 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 705 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 706 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 707 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 708 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 709 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 710 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 711 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 717 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 718 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 719 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 720 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 721 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 722 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 723 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 724 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 725 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 726 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 727 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 728 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 729 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 730 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 731 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 732 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 733 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 734 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 735 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 736 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 737 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 738 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 739 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 740 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 741 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 742 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 743 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 744 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 745 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 746 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 747 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 748 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 749 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 750 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 751 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 752 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 753 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 754 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 755 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 756 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 757 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 758 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 759 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 760 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.7 |
| Metatranscriptomes | 0.07 |
| Isolates | 27.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 5.77 |
| Nodule | 20 |
| Rhizoplane | 5.55 |
| Rhizosphere | 60.58 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 7.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001865 | 3300001977 | Bacteria | 3363 |
| 2 | JGI25165J46597_1000026 | 3300003214 | Bacteria | 332550 |
| 3 | JGI25153J46596_10007129 | 3300003215 | Bacteria | 5546 |
| 4 | Ga0006562J51391_1004036 | 3300003578 | Bacteria | 4015 |
| 5 | Ga0055542_1000784 | 3300003762 | Bacteria | 23770 |
| 6 | Ga0055528_1016405 | 3300003790 | Bacteria | 2620 |
| 7 | Ga0058692_1000534 | 3300003856 | Bacteria | 16322 |
| 8 | Ga0058692_1003021 | 3300003856 | Bacteria | 5384 |
| 9 | Ga0065165_1000558 | 3300005262 | Bacteria | 55456 |
| 10 | Ga0070690_100018079 | 3300005330 | Bacteria | 4251 |
| 11 | Ga0070690_100122683 | 3300005330 | Bacteria | 1746 |
| 12 | Ga0070670_100005245 | 3300005331 | Bacteria | 10912 |
| 13 | Ga0070670_100019941 | 3300005331 | Bacteria | 5755 |
| 14 | Ga0070670_100029069 | 3300005331 | Bacteria | 4756 |
| 15 | Ga0070677_10002383 | 3300005333 | Bacteria | 5998 |
| 16 | Ga0070666_10010516 | 3300005335 | Bacteria | 5790 |
| 17 | Ga0070689_100013888 | 3300005340 | Bacteria | 5839 |
| 18 | Ga0070689_100049005 | 3300005340 | Bacteria | 3259 |
| 19 | Ga0070687_100020917 | 3300005343 | Bacteria | 3067 |
| 20 | Ga0070668_100027024 | 3300005347 | Bacteria | 4356 |
| 21 | Ga0070669_100061718 | 3300005353 | Bacteria | 2755 |
| 22 | Ga0070669_100090652 | 3300005353 | Bacteria | 2292 |
| 23 | Ga0070671_100121478 | 3300005355 | Bacteria | 2198 |
| 24 | Ga0070674_100008903 | 3300005356 | Bacteria | 5993 |
| 25 | Ga0070674_100042827 | 3300005356 | Bacteria | 3077 |
| 26 | Ga0070673_100118650 | 3300005364 | Unclassified | 2203 |
| 27 | Ga0070688_100018506 | 3300005365 | Bacteria | 4020 |
| 28 | Ga0070659_100142349 | 3300005366 | Bacteria | 1953 |
| 29 | Ga0070709_10025951 | 3300005434 | Bacteria | 3467 |
| 30 | Ga0070714_100094615 | 3300005435 | Bacteria | 2622 |
| 31 | Ga0070714_100129997 | 3300005435 | Bacteria | 2250 |
| 32 | Ga0070713_100009074 | 3300005436 | Bacteria | 7091 |
| 33 | Ga0070713_100028175 | 3300005436 | Bacteria | 4433 |
| 34 | Ga0070713_100170990 | 3300005436 | Bacteria | 1947 |
| 35 | Ga0070710_10048258 | 3300005437 | Bacteria | 2378 |
| 36 | Ga0070701_10035872 | 3300005438 | Bacteria | 2495 |
| 37 | Ga0070711_100009511 | 3300005439 | Bacteria | 5993 |
| 38 | Ga0070711_100025195 | 3300005439 | Bacteria | 3889 |
| 39 | Ga0070711_100139001 | 3300005439 | Bacteria | 1818 |
| 40 | Ga0070700_100013729 | 3300005441 | Bacteria | 4555 |
| 41 | Ga0070700_100046735 | 3300005441 | Bacteria | 2676 |
| 42 | Ga0070663_100153128 | 3300005455 | Bacteria | 1769 |
| 43 | Ga0070678_100003451 | 3300005456 | Bacteria | 8815 |
| 44 | Ga0070678_100020066 | 3300005456 | Bacteria | 4377 |
| 45 | Ga0070662_100018370 | 3300005457 | Bacteria | 4729 |
| 46 | Ga0068867_100005652 | 3300005459 | Bacteria | 8864 |
| 47 | Ga0068867_100007482 | 3300005459 | Bacteria | 7724 |
| 48 | Ga0070685_10005761 | 3300005466 | Bacteria | 6294 |
| 49 | Ga0070707_100134428 | 3300005468 | Bacteria | 2406 |
| 50 | Ga0070698_100015927 | 3300005471 | Bacteria | 7939 |
| 51 | Ga0070699_100005230 | 3300005518 | Bacteria | 11399 |
| 52 | Ga0070699_100046283 | 3300005518 | Bacteria | 3764 |
| 53 | Ga0070699_100168389 | 3300005518 | Bacteria | 1941 |
| 54 | Ga0070679_100020501 | 3300005530 | Bacteria | 6446 |
| 55 | Ga0070679_100220778 | 3300005530 | Bacteria | 1856 |
| 56 | Ga0070684_100036996 | 3300005535 | Bacteria | 4185 |
| 57 | Ga0070697_100002109 | 3300005536 | Bacteria | 15231 |
| 58 | Ga0068853_100020993 | 3300005539 | Bacteria | 5436 |
| 59 | Ga0070672_100019190 | 3300005543 | Bacteria | 4959 |
| 60 | Ga0070672_100055821 | 3300005543 | Bacteria | 3095 |
| 61 | Ga0070686_100014171 | 3300005544 | Bacteria | 4588 |
| 62 | Ga0070686_100048392 | 3300005544 | Bacteria | 2693 |
| 63 | Ga0070693_100036397 | 3300005547 | Bacteria | 2736 |
| 64 | Ga0070665_100001728 | 3300005548 | Bacteria | 24967 |
| 65 | Ga0070704_100095335 | 3300005549 | Bacteria | 2228 |
| 66 | Ga0068855_100027185 | 3300005563 | Bacteria | 6846 |
| 67 | Ga0070664_100203773 | 3300005564 | Bacteria | 1766 |
| 68 | Ga0068854_100067050 | 3300005578 | Bacteria | 2614 |
| 69 | Ga0068856_100118053 | 3300005614 | Bacteria | 2654 |
| 70 | Ga0068864_100010230 | 3300005618 | Bacteria | 7747 |
| 71 | Ga0068864_100037574 | 3300005618 | Bacteria | 4133 |
| 72 | Ga0068866_10028799 | 3300005718 | Bacteria | 2650 |
| 73 | Ga0068861_100013686 | 3300005719 | Bacteria | 5681 |
| 74 | Ga0068851_10061051 | 3300005834 | Bacteria | 1931 |
| 75 | Ga0068863_100019114 | 3300005841 | Bacteria | 6557 |
| 76 | Ga0068858_100130797 | 3300005842 | Bacteria | 2353 |
| 77 | Ga0068858_100152450 | 3300005842 | Bacteria | 2173 |
| 78 | Ga0068860_100015869 | 3300005843 | Bacteria | 7351 |
| 79 | Ga0068860_100100105 | 3300005843 | Bacteria | 2765 |
| 80 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 81 | Ga0081455_10002140 | 3300005937 | Bacteria | 23551 |
| 82 | Ga0081455_10003800 | 3300005937 | Bacteria | 17227 |
| 83 | Ga0081455_10004068 | 3300005937 | Bacteria | 16566 |
| 84 | Ga0081455_10010247 | 3300005937 | Bacteria | 9531 |
| 85 | Ga0081455_10028423 | 3300005937 | Bacteria | 5109 |
| 86 | Ga0081455_10036290 | 3300005937 | Bacteria | 4391 |
| 87 | Ga0081455_10063296 | 3300005937 | Bacteria | 3104 |
| 88 | Ga0081538_10002581 | 3300005981 | Bacteria | 17571 |
| 89 | Ga0081540_1001091 | 3300005983 | Bacteria | 24073 |
| 90 | Ga0081540_1007590 | 3300005983 | Bacteria | 7706 |
| 91 | Ga0081540_1046654 | 3300005983 | Bacteria | 2185 |
| 92 | Ga0081539_10005263 | 3300005985 | Bacteria | 13347 |
| 93 | Ga0081539_10005675 | 3300005985 | Bacteria | 12525 |
| 94 | Ga0081539_10007857 | 3300005985 | Bacteria | 9523 |
| 95 | Ga0070717_10044234 | 3300006028 | Bacteria | 3636 |
| 96 | Ga0070717_10140379 | 3300006028 | Bacteria | 2083 |
| 97 | Ga0075365_10003320 | 3300006038 | Bacteria | 8264 |
| 98 | Ga0075365_10009306 | 3300006038 | Bacteria | 5637 |
| 99 | Ga0075365_10016899 | 3300006038 | Bacteria | 4452 |
| 100 | Ga0075365_10020120 | 3300006038 | Bacteria | 4132 |
| 101 | Ga0075365_10030319 | 3300006038 | Bacteria | 3463 |
| 102 | Ga0075365_10034079 | 3300006038 | Bacteria | 3286 |
| 103 | Ga0075365_10076154 | 3300006038 | Bacteria | 2265 |
| 104 | Ga0075368_10000331 | 3300006042 | Bacteria | 13823 |
| 105 | Ga0075368_10011055 | 3300006042 | Bacteria | 3278 |
| 106 | Ga0075368_10013733 | 3300006042 | Bacteria | 2978 |
| 107 | Ga0075363_100005619 | 3300006048 | Bacteria | 5603 |
| 108 | Ga0075363_100009168 | 3300006048 | Bacteria | 4646 |
| 109 | Ga0075363_100028583 | 3300006048 | Bacteria | 2870 |
| 110 | Ga0075363_100049136 | 3300006048 | Bacteria | 2245 |
| 111 | Ga0075364_10034422 | 3300006051 | Bacteria | 3268 |
| 112 | Ga0075364_10037772 | 3300006051 | Bacteria | 3129 |
| 113 | Ga0075364_10062135 | 3300006051 | Bacteria | 2451 |
| 114 | Ga0070716_100001502 | 3300006173 | Bacteria | 10422 |
| 115 | Ga0070712_100004185 | 3300006175 | Bacteria | 8876 |
| 116 | Ga0070712_100013202 | 3300006175 | Bacteria | 5272 |
| 117 | Ga0070712_100022302 | 3300006175 | Bacteria | 4170 |
| 118 | Ga0070712_100036607 | 3300006175 | Bacteria | 3341 |
| 119 | Ga0075362_10005316 | 3300006177 | Bacteria | 4703 |
| 120 | Ga0075362_10051880 | 3300006177 | Bacteria | 1837 |
| 121 | Ga0075367_10003717 | 3300006178 | Bacteria | 7337 |
| 122 | Ga0075367_10012255 | 3300006178 | Bacteria | 4564 |
| 123 | Ga0075367_10015700 | 3300006178 | Bacteria | 4121 |
| 124 | Ga0075367_10015858 | 3300006178 | Bacteria | 4105 |
| 125 | Ga0075367_10025996 | 3300006178 | Bacteria | 3315 |
| 126 | Ga0075367_10067363 | 3300006178 | Bacteria | 2146 |
| 127 | Ga0075367_10110267 | 3300006178 | Bacteria | 1688 |
| 128 | Ga0075369_10002069 | 3300006186 | Bacteria | 7079 |
| 129 | Ga0075366_10055200 | 3300006195 | Bacteria | 2360 |
| 130 | Ga0075428_100000426 | 3300006844 | Bacteria | 41901 |
| 131 | Ga0075428_100000797 | 3300006844 | Bacteria | 32864 |
| 132 | Ga0075428_100018779 | 3300006844 | Bacteria | 7644 |
| 133 | Ga0075428_100053742 | 3300006844 | Bacteria | 4414 |
| 134 | Ga0075428_100075255 | 3300006844 | Bacteria | 3687 |
| 135 | Ga0075428_100165218 | 3300006844 | Bacteria | 2401 |
| 136 | Ga0075430_100000045 | 3300006846 | Bacteria | 64983 |
| 137 | Ga0075430_100030098 | 3300006846 | Bacteria | 4610 |
| 138 | Ga0075430_100070582 | 3300006846 | Bacteria | 2930 |
| 139 | Ga0075430_100074556 | 3300006846 | Bacteria | 2845 |
| 140 | Ga0075431_100003583 | 3300006847 | Bacteria | 15048 |
| 141 | Ga0075431_100014785 | 3300006847 | Bacteria | 7901 |
| 142 | Ga0075431_100026280 | 3300006847 | Bacteria | 5972 |
| 143 | Ga0075431_100046633 | 3300006847 | Bacteria | 4469 |
| 144 | Ga0075431_100142836 | 3300006847 | Bacteria | 2467 |
| 145 | Ga0075431_100351834 | 3300006847 | Bacteria | 1481 |
| 146 | Ga0075433_10002970 | 3300006852 | Bacteria | 13023 |
| 147 | Ga0075433_10030537 | 3300006852 | Bacteria | 4599 |
| 148 | Ga0075434_100003473 | 3300006871 | Bacteria | 14090 |
| 149 | Ga0075434_100023729 | 3300006871 | Bacteria | 5983 |
| 150 | Ga0075434_100039472 | 3300006871 | Bacteria | 4678 |
| 151 | Ga0075434_100063077 | 3300006871 | Bacteria | 3689 |
| 152 | Ga0075434_100072570 | 3300006871 | Bacteria | 3434 |
| 153 | Ga0075434_100076053 | 3300006871 | Bacteria | 3352 |
| 154 | Ga0075434_100149251 | 3300006871 | Bacteria | 2358 |
| 155 | Ga0075429_100000214 | 3300006880 | Bacteria | 38983 |
| 156 | Ga0075429_100002102 | 3300006880 | Bacteria | 16623 |
| 157 | Ga0075429_100050551 | 3300006880 | Bacteria | 3616 |
| 158 | Ga0068865_100020355 | 3300006881 | Bacteria | 4302 |
| 159 | Ga0068865_100166423 | 3300006881 | Bacteria | 1686 |
| 160 | Ga0075436_100015129 | 3300006914 | Bacteria | 5288 |
| 161 | Ga0075436_100024156 | 3300006914 | Bacteria | 4178 |
| 162 | Ga0099826_10032477 | 3300006948 | Bacteria | 3762 |
| 163 | Ga0075435_100006471 | 3300007076 | Bacteria | 8284 |
| 164 | Ga0075435_100006663 | 3300007076 | Bacteria | 8187 |
| 165 | Ga0075435_100014741 | 3300007076 | Bacteria | 5857 |
| 166 | Ga0075435_100044338 | 3300007076 | Bacteria | 3562 |
| 167 | Ga0075435_100053355 | 3300007076 | Bacteria | 3260 |
| 168 | Ga0075435_100070735 | 3300007076 | Bacteria | 2848 |
| 169 | Ga0099794_10029142 | 3300007265 | Bacteria | 2571 |
| 170 | Ga0105240_10373984 | 3300009093 | Bacteria | 1610 |
| 171 | Ga0111539_10000554 | 3300009094 | Bacteria | 47836 |
| 172 | Ga0111539_10000693 | 3300009094 | Bacteria | 43665 |
| 173 | Ga0111539_10012226 | 3300009094 | Bacteria | 10767 |
| 174 | Ga0111539_10031180 | 3300009094 | Bacteria | 6479 |
| 175 | Ga0111539_10154888 | 3300009094 | Bacteria | 2682 |
| 176 | Ga0111539_10239265 | 3300009094 | Bacteria | 2113 |
| 177 | Ga0105245_10027605 | 3300009098 | Bacteria | 5001 |
| 178 | Ga0105245_10107215 | 3300009098 | Bacteria | 2593 |
| 179 | Ga0114129_10003055 | 3300009147 | Bacteria | 23465 |
| 180 | Ga0114129_10009653 | 3300009147 | Bacteria | 13772 |
| 181 | Ga0114129_10009862 | 3300009147 | Bacteria | 13618 |
| 182 | Ga0114129_10010881 | 3300009147 | Bacteria | 12959 |
| 183 | Ga0114129_10016101 | 3300009147 | Bacteria | 10636 |
| 184 | Ga0114129_10088526 | 3300009147 | Bacteria | 4292 |
| 185 | Ga0114129_10132552 | 3300009147 | Bacteria | 3421 |
| 186 | Ga0114129_10149759 | 3300009147 | Bacteria | 3194 |
| 187 | Ga0114129_10615199 | 3300009147 | Bacteria | 1406 |
| 188 | Ga0105243_10023475 | 3300009148 | Bacteria | 4697 |
| 189 | Ga0105243_10101266 | 3300009148 | Bacteria | 2392 |
| 190 | Ga0105243_10129958 | 3300009148 | Bacteria | 2135 |
| 191 | Ga0105241_10106515 | 3300009174 | Bacteria | 2238 |
| 192 | Ga0105242_10204839 | 3300009176 | Bacteria | 1754 |
| 193 | Ga0105248_10009517 | 3300009177 | Bacteria | 10695 |
| 194 | Ga0105248_10030987 | 3300009177 | Bacteria | 5976 |
| 195 | Ga0105237_10016432 | 3300009545 | Bacteria | 7689 |
| 196 | Ga0105237_10078198 | 3300009545 | Bacteria | 3298 |
| 197 | Ga0105238_10001556 | 3300009551 | Bacteria | 23011 |
| 198 | Ga0105238_10021249 | 3300009551 | Bacteria | 6614 |
| 199 | Ga0099796_10000604 | 3300010159 | Bacteria | 6221 |
| 200 | Ga0105239_10023787 | 3300010375 | Bacteria | 6746 |
| 201 | Ga0105239_10030728 | 3300010375 | Bacteria | 5908 |
| 202 | Ga0105239_10054348 | 3300010375 | Bacteria | 4393 |
| 203 | Ga0105239_10132102 | 3300010375 | Bacteria | 2778 |
| 204 | Ga0105239_10164534 | 3300010375 | Bacteria | 2480 |
| 205 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 206 | Ga0157371_10089853 | 3300013102 | Bacteria | 2176 |
| 207 | Ga0157370_10000079 | 3300013104 | Bacteria | 107305 |
| 208 | Ga0157370_10151838 | 3300013104 | Bacteria | 2155 |
| 209 | Ga0157374_10117779 | 3300013296 | Bacteria | 2560 |
| 210 | Ga0157378_10127016 | 3300013297 | Bacteria | 2356 |
| 211 | Ga0157372_10010309 | 3300013307 | Bacteria | 9929 |
| 212 | Ga0157375_10028152 | 3300013308 | Bacteria | 5262 |
| 213 | Ga0163163_10072634 | 3300014325 | Bacteria | 3430 |
| 214 | Ga0163163_10178779 | 3300014325 | Bacteria | 2169 |
| 215 | Ga0182008_10017764 | 3300014497 | Bacteria | 3687 |
| 216 | Ga0182008_10041680 | 3300014497 | Bacteria | 2290 |
| 217 | Ga0157377_10006953 | 3300014745 | Bacteria | 5432 |
| 218 | Ga0157379_10015858 | 3300014968 | Bacteria | 6622 |
| 219 | Ga0157376_10030826 | 3300014969 | Bacteria | 4287 |
| 220 | Ga0163161_10023758 | 3300017792 | Bacteria | 4327 |
| 221 | Ga0213876_10017764 | 3300021384 | Bacteria | 3753 |
| 222 | Ga0228598_1002344 | 3300024227 | Bacteria | 4138 |
| 223 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 224 | Ga0209148_1000094 | 3300025254 | Bacteria | 241711 |
| 225 | Ga0209759_1000654 | 3300025256 | Bacteria | 32179 |
| 226 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 227 | Ga0209455_1000113 | 3300025272 | Bacteria | 180579 |
| 228 | Ga0209673_1003238 | 3300025273 | Bacteria | 9839 |
| 229 | Ga0209130_1000100 | 3300025284 | Bacteria | 140260 |
| 230 | Ga0209676_1000093 | 3300025292 | Bacteria | 250231 |
| 231 | Ga0209025_1001149 | 3300025294 | Bacteria | 37669 |
| 232 | Ga0209025_1003984 | 3300025294 | Bacteria | 13258 |
| 233 | Ga0209025_1022887 | 3300025294 | Bacteria | 3293 |
| 234 | Ga0209564_1002513 | 3300025295 | Bacteria | 14203 |
| 235 | Ga0209758_1000351 | 3300025297 | Bacteria | 83626 |
| 236 | Ga0209758_1010083 | 3300025297 | Bacteria | 5722 |
| 237 | Ga0207656_10033112 | 3300025321 | Bacteria | 2150 |
| 238 | Ga0207682_10001074 | 3300025893 | Bacteria | 12601 |
| 239 | Ga0207710_10081153 | 3300025900 | Bacteria | 1505 |
| 240 | Ga0207688_10009739 | 3300025901 | Bacteria | 5229 |
| 241 | Ga0207688_10010651 | 3300025901 | Bacteria | 5001 |
| 242 | Ga0207707_10001567 | 3300025912 | Bacteria | 21044 |
| 243 | Ga0207695_10148807 | 3300025913 | Bacteria | 2282 |
| 244 | Ga0207671_10021515 | 3300025914 | Bacteria | 4890 |
| 245 | Ga0207693_10000434 | 3300025915 | Bacteria | 38124 |
| 246 | Ga0207693_10007408 | 3300025915 | Bacteria | 9027 |
| 247 | Ga0207693_10030439 | 3300025915 | Bacteria | 4263 |
| 248 | Ga0207693_10041887 | 3300025915 | Bacteria | 3604 |
| 249 | Ga0207693_10047451 | 3300025915 | Bacteria | 3375 |
| 250 | Ga0207693_10135186 | 3300025915 | Bacteria | 1938 |
| 251 | Ga0207663_10014716 | 3300025916 | Bacteria | 4294 |
| 252 | Ga0207663_10043013 | 3300025916 | Bacteria | 2763 |
| 253 | Ga0207660_10033189 | 3300025917 | Bacteria | 3568 |
| 254 | Ga0207660_10045233 | 3300025917 | Bacteria | 3100 |
| 255 | Ga0207662_10007603 | 3300025918 | Bacteria | 5905 |
| 256 | Ga0207662_10035651 | 3300025918 | Bacteria | 2906 |
| 257 | Ga0207657_10200094 | 3300025919 | Bacteria | 1607 |
| 258 | Ga0207649_10030181 | 3300025920 | Bacteria | 3208 |
| 259 | Ga0207652_10013529 | 3300025921 | Bacteria | 6600 |
| 260 | Ga0207646_10139417 | 3300025922 | Bacteria | 2183 |
| 261 | Ga0207681_10176282 | 3300025923 | Bacteria | 1625 |
| 262 | Ga0207659_10076418 | 3300025926 | Bacteria | 2461 |
| 263 | Ga0207687_10029140 | 3300025927 | Bacteria | 3712 |
| 264 | Ga0207700_10014082 | 3300025928 | Bacteria | 5229 |
| 265 | Ga0207700_10028695 | 3300025928 | Bacteria | 3917 |
| 266 | Ga0207664_10044050 | 3300025929 | Bacteria | 3493 |
| 267 | Ga0207644_10018432 | 3300025931 | Bacteria | 4722 |
| 268 | Ga0207644_10084012 | 3300025931 | Bacteria | 2359 |
| 269 | Ga0207690_10013558 | 3300025932 | Bacteria | 4899 |
| 270 | Ga0207706_10001103 | 3300025933 | Bacteria | 27497 |
| 271 | Ga0207686_10068064 | 3300025934 | Bacteria | 2280 |
| 272 | Ga0207709_10085631 | 3300025935 | Bacteria | 2044 |
| 273 | Ga0207670_10005481 | 3300025936 | Bacteria | 6970 |
| 274 | Ga0207670_10054563 | 3300025936 | Bacteria | 2697 |
| 275 | Ga0207670_10057512 | 3300025936 | Bacteria | 2638 |
| 276 | Ga0207670_10190376 | 3300025936 | Bacteria | 1552 |
| 277 | Ga0207669_10002350 | 3300025937 | Bacteria | 8037 |
| 278 | Ga0207669_10097204 | 3300025937 | Bacteria | 1935 |
| 279 | Ga0207704_10043837 | 3300025938 | Bacteria | 2645 |
| 280 | Ga0207665_10002324 | 3300025939 | Bacteria | 12832 |
| 281 | Ga0207665_10031554 | 3300025939 | Bacteria | 3506 |
| 282 | Ga0207665_10038536 | 3300025939 | Bacteria | 3183 |
| 283 | Ga0207691_10001292 | 3300025940 | Bacteria | 24983 |
| 284 | Ga0207691_10027729 | 3300025940 | Bacteria | 5308 |
| 285 | Ga0207689_10007363 | 3300025942 | Bacteria | 9649 |
| 286 | Ga0207689_10022368 | 3300025942 | Bacteria | 5317 |
| 287 | Ga0207661_10080240 | 3300025944 | Bacteria | 2692 |
| 288 | Ga0207661_10179545 | 3300025944 | Bacteria | 1848 |
| 289 | Ga0207679_10154186 | 3300025945 | Bacteria | 1874 |
| 290 | Ga0207667_10144988 | 3300025949 | Bacteria | 2444 |
| 291 | Ga0207651_10006399 | 3300025960 | Bacteria | 6162 |
| 292 | Ga0207712_10000880 | 3300025961 | Bacteria | 21827 |
| 293 | Ga0207668_10036309 | 3300025972 | Bacteria | 3288 |
| 294 | Ga0207677_10027198 | 3300026023 | Bacteria | 3598 |
| 295 | Ga0207703_10155739 | 3300026035 | Bacteria | 1996 |
| 296 | Ga0207639_10041136 | 3300026041 | Bacteria | 3456 |
| 297 | Ga0207678_10012203 | 3300026067 | Bacteria | 7547 |
| 298 | Ga0207678_10082887 | 3300026067 | Bacteria | 2743 |
| 299 | Ga0207708_10000620 | 3300026075 | Bacteria | 27264 |
| 300 | Ga0207708_10076958 | 3300026075 | Bacteria | 2560 |
| 301 | Ga0207708_10111538 | 3300026075 | Bacteria | 2123 |
| 302 | Ga0207708_10232340 | 3300026075 | Bacteria | 1481 |
| 303 | Ga0207641_10011851 | 3300026088 | Bacteria | 7155 |
| 304 | Ga0207641_10129032 | 3300026088 | Bacteria | 2268 |
| 305 | Ga0207641_10147468 | 3300026088 | Bacteria | 2129 |
| 306 | Ga0207648_10002122 | 3300026089 | Bacteria | 21569 |
| 307 | Ga0207648_10006883 | 3300026089 | Bacteria | 11270 |
| 308 | Ga0207648_10231485 | 3300026089 | Bacteria | 1644 |
| 309 | Ga0207676_10028462 | 3300026095 | Bacteria | 4174 |
| 310 | Ga0207676_10031531 | 3300026095 | Bacteria | 3987 |
| 311 | Ga0207674_10018581 | 3300026116 | Bacteria | 7550 |
| 312 | Ga0207675_100002342 | 3300026118 | Bacteria | 18784 |
| 313 | Ga0207675_100122629 | 3300026118 | Bacteria | 2460 |
| 314 | Ga0207683_10001466 | 3300026121 | Bacteria | 21270 |
| 315 | Ga0207683_10015346 | 3300026121 | Bacteria | 6524 |
| 316 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 317 | Ga0209371_1000911 | 3300027312 | Bacteria | 23452 |
| 318 | Ga0209813_10000656 | 3300027866 | Bacteria | 7932 |
| 319 | Ga0207428_10000180 | 3300027907 | Bacteria | 88557 |
| 320 | Ga0207428_10009912 | 3300027907 | Bacteria | 8532 |
| 321 | Ga0268266_10024962 | 3300028379 | Bacteria | 5086 |
| 322 | Ga0268266_10141623 | 3300028379 | Bacteria | 2158 |
| 323 | Ga0268264_10196813 | 3300028381 | Bacteria | 1841 |
| 324 | Ga0265318_10010410 | 3300028577 | Bacteria | 4052 |
| 325 | Ga0307515_10001049 | 3300028794 | Bacteria | 63286 |
| 326 | Ga0307515_10002808 | 3300028794 | Bacteria | 37051 |
| 327 | Ga0265338_10039087 | 3300028800 | Bacteria | 4483 |
| 328 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 329 | Ga0268256_1001490 | 3300030500 | Bacteria | 13902 |
| 330 | Ga0265332_10000743 | 3300031238 | Bacteria | 20249 |
| 331 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 332 | Ga0265325_10007899 | 3300031241 | Bacteria | 6329 |
| 333 | Ga0265325_10021294 | 3300031241 | Bacteria | 3563 |
| 334 | Ga0265325_10029443 | 3300031241 | Bacteria | 2952 |
| 335 | Ga0265325_10038529 | 3300031241 | Bacteria | 2522 |
| 336 | Ga0265329_10006949 | 3300031242 | Bacteria | 4426 |
| 337 | Ga0265340_10006011 | 3300031247 | Bacteria | 6705 |
| 338 | Ga0265340_10006392 | 3300031247 | Bacteria | 6490 |
| 339 | Ga0265340_10013593 | 3300031247 | Bacteria | 4274 |
| 340 | Ga0265340_10019396 | 3300031247 | Bacteria | 3502 |
| 341 | Ga0265340_10075488 | 3300031247 | Bacteria | 1592 |
| 342 | Ga0265339_10000033 | 3300031249 | Bacteria | 130595 |
| 343 | Ga0265339_10006458 | 3300031249 | Bacteria | 7688 |
| 344 | Ga0265339_10013851 | 3300031249 | Bacteria | 4878 |
| 345 | Ga0265339_10020920 | 3300031249 | Bacteria | 3816 |
| 346 | Ga0265316_10027808 | 3300031344 | Bacteria | 4675 |
| 347 | Ga0265316_10048132 | 3300031344 | Bacteria | 3369 |
| 348 | Ga0265316_10048681 | 3300031344 | Bacteria | 3344 |
| 349 | Ga0307513_10059089 | 3300031456 | Bacteria | 4071 |
| 350 | Ga0307513_10253465 | 3300031456 | Bacteria | 1555 |
| 351 | Ga0265313_10000049 | 3300031595 | Bacteria | 111617 |
| 352 | Ga0265313_10009973 | 3300031595 | Bacteria | 6091 |
| 353 | Ga0265313_10010693 | 3300031595 | Bacteria | 5775 |
| 354 | Ga0307508_10007178 | 3300031616 | Bacteria | 10373 |
| 355 | Ga0265314_10008661 | 3300031711 | Bacteria | 8699 |
| 356 | Ga0265314_10011925 | 3300031711 | Bacteria | 7135 |
| 357 | Ga0265314_10013823 | 3300031711 | Bacteria | 6499 |
| 358 | Ga0265314_10029460 | 3300031711 | Bacteria | 4080 |
| 359 | Ga0265314_10052401 | 3300031711 | Bacteria | 2837 |
| 360 | Ga0265314_10060562 | 3300031711 | Bacteria | 2583 |
| 361 | Ga0265342_10000034 | 3300031712 | Bacteria | 145074 |
| 362 | Ga0265342_10009968 | 3300031712 | Bacteria | 6641 |
| 363 | Ga0265342_10015647 | 3300031712 | Bacteria | 4985 |
| 364 | Ga0265342_10026071 | 3300031712 | Bacteria | 3667 |
| 365 | Ga0307410_10149936 | 3300031852 | Bacteria | 1735 |
| 366 | Ga0373926_0002534 | 3300035083 | Bacteria | 5804 |
| 367 | Ga0373944_0003584 | 3300035089 | Bacteria | 4012 |
| 368 | Ga0373944_0006983 | 3300035089 | Bacteria | 3016 |
| 369 | Ga0373923_0022562 | 3300035111 | Bacteria | 2470 |
| 370 | Ga0373939_0006504 | 3300035114 | Bacteria | 2818 |
| 371 | Ga0373941_0002007 | 3300035115 | Bacteria | 4411 |
| 372 | Ga0373945_0002010 | 3300035116 | Bacteria | 6324 |
| 373 | Ga0373953_0026835 | 3300035117 | Bacteria | 2209 |
| 374 | Ga0373954_0004165 | 3300035118 | Bacteria | 6199 |
| 375 | Ga0373956_0015614 | 3300035119 | Bacteria | 3183 |
| 376 | Ga0373956_0018976 | 3300035119 | Bacteria | 2913 |
| 377 | Ga0373956_0054032 | 3300035119 | Bacteria | 1809 |
| 378 | Ga0373957_0008948 | 3300035120 | Bacteria | 3264 |
| 379 | Ga0373957_0027438 | 3300035120 | Bacteria | 2068 |
| 380 | Ga0373943_0001179 | 3300035170 | Bacteria | 11669 |
| 381 | Ga0373943_0054528 | 3300035170 | Bacteria | 1978 |
| 382 | Ga0373943_0076961 | 3300035170 | Bacteria | 1703 |
| 383 | Ga0373946_0007928 | 3300035171 | Bacteria | 3898 |
| 384 | Ga0373955_0007731 | 3300035172 | Bacteria | 4952 |
| 385 | Ga0373955_0007784 | 3300035172 | Bacteria | 4938 |
| 386 | Ga0316574_0055723 | 3300035398 | Bacteria | 2471 |
| 387 | Ga0373924_0016492 | 3300035410 | Bacteria | 2820 |
| 388 | Ga0373924_0023436 | 3300035410 | Bacteria | 2422 |
| 389 | Ga0373931_0001020 | 3300035691 | Bacteria | 11821 |
| 390 | Ga0373931_0011815 | 3300035691 | Bacteria | 4221 |
| 391 | Ga0373931_0019764 | 3300035691 | Bacteria | 3365 |
| 392 | Ga0373931_0034626 | 3300035691 | Bacteria | 2622 |
| 393 | Ga0373931_0064720 | 3300035691 | Bacteria | 1980 |
| 394 | Ga0373935_0010340 | 3300035692 | Bacteria | 5596 |
| 395 | Ga0373935_0017541 | 3300035692 | Bacteria | 4345 |
| 396 | Ga0373935_0018168 | 3300035692 | Bacteria | 4275 |
| 397 | Ga0373935_0088165 | 3300035692 | Bacteria | 2027 |
| 398 | Ga0373935_0165584 | 3300035692 | Bacteria | 1509 |
| 399 | Ga0373935_0197549 | 3300035692 | Bacteria | 1388 |
| 400 | Ga0373927_0000863 | 3300035695 | Bacteria | 23082 |
| 401 | Ga0373927_0031034 | 3300035695 | Bacteria | 3485 |
| 402 | Ga0373927_0034462 | 3300035695 | Bacteria | 3293 |
| 403 | Ga0373927_0039932 | 3300035695 | Bacteria | 3045 |
| 404 | Ga0373927_0066257 | 3300035695 | Bacteria | 2336 |
| 405 | Ga0373933_0003790 | 3300035724 | Bacteria | 8353 |
| 406 | Ga0373933_0004956 | 3300035724 | Bacteria | 7259 |
| 407 | Ga0373933_0025115 | 3300035724 | Bacteria | 3415 |
| 408 | Ga0373933_0059390 | 3300035724 | Bacteria | 2303 |
| 409 | Ga0373933_0126992 | 3300035724 | Bacteria | 1601 |
| 410 | Ga0373947_0001832 | 3300035725 | Bacteria | 13000 |
| 411 | Ga0373947_0002147 | 3300035725 | Bacteria | 11983 |
| 412 | Ga0373947_0013464 | 3300035725 | Bacteria | 4686 |
| 413 | Ga0373947_0058003 | 3300035725 | Bacteria | 2344 |
| 414 | Ga0373937_0006754 | 3300036401 | Bacteria | 9902 |
| 415 | Ga0373937_0020608 | 3300036401 | Bacteria | 5910 |
| 416 | Ga0373937_0033961 | 3300036401 | Bacteria | 4637 |
| 417 | Ga0373937_0102431 | 3300036401 | Bacteria | 2658 |
| 418 | Ga0373937_0318840 | 3300036401 | Bacteria | 1470 |
| 419 | Ga0373925_0009283 | 3300037068 | Bacteria | 7159 |
| 420 | Ga0373925_0045409 | 3300037068 | Bacteria | 3263 |
| 421 | Ga0373925_0046170 | 3300037068 | Bacteria | 3238 |
| 422 | Ga0373925_0052748 | 3300037068 | Bacteria | 3039 |
| 423 | Ga0373925_0072113 | 3300037068 | Bacteria | 2613 |
| 424 | Ga0395899_0000058 | 3300037312 | Bacteria | 213049 |
| 425 | Ga0395899_0030218 | 3300037312 | Bacteria | 4075 |
| 426 | Ga0395899_0083518 | 3300037312 | Bacteria | 2322 |
| 427 | Ga0395900_0000056 | 3300037418 | Bacteria | 213077 |
| 428 | Ga0395900_0010116 | 3300037418 | Bacteria | 9647 |
| 429 | Ga0395900_0014386 | 3300037418 | Bacteria | 8076 |
| 430 | Ga0395900_0083436 | 3300037418 | Bacteria | 3283 |
| 431 | Ga0395900_0112730 | 3300037418 | Bacteria | 2792 |
| 432 | Ga0395900_0167688 | 3300037418 | Bacteria | 2237 |
| 433 | Ga0395898_0000114 | 3300037466 | Bacteria | 213068 |
| 434 | Ga0395898_0002569 | 3300037466 | Bacteria | 21250 |
| 435 | Ga0395898_0005741 | 3300037466 | Bacteria | 13364 |
| 436 | Ga0395898_0094620 | 3300037466 | Bacteria | 2871 |
| 437 | Ga0395898_0123107 | 3300037466 | Bacteria | 2485 |
| 438 | Ga0395898_0166056 | 3300037466 | Bacteria | 2111 |
| 439 | Ga0395905_0000053 | 3300037471 | Bacteria | 213077 |
| 440 | Ga0395905_0024499 | 3300037471 | Bacteria | 5695 |
| 441 | Ga0395905_0046908 | 3300037471 | Bacteria | 4050 |
| 442 | Ga0395905_0121097 | 3300037471 | Bacteria | 2459 |
| 443 | Ga0436364_0449051 | 3300037853 | Bacteria | 2311 |
| 444 | Ga0395901_0000037 | 3300038443 | Bacteria | 213059 |
| 445 | Ga0395901_0000475 | 3300038443 | Bacteria | 46590 |
| 446 | Ga0395901_0003628 | 3300038443 | Bacteria | 15574 |
| 447 | Ga0395901_0020312 | 3300038443 | Bacteria | 6799 |
| 448 | Ga0395901_0112892 | 3300038443 | Bacteria | 2854 |
| 449 | Ga0395901_0159547 | 3300038443 | Bacteria | 2368 |
| 450 | Ga0400485_02815 | 3300038735 | Bacteria | 1954 |
| 451 | Ga0400486_11742 | 3300038742 | Bacteria | 5223 |
| 452 | Ga0400486_14182 | 3300038742 | Bacteria | 2420 |
| 453 | Ga0400486_18730 | 3300038742 | Bacteria | 2024 |
| 454 | Ga0436365_0178496 | 3300039437 | Bacteria | 3799 |
| 455 | Ga0436365_0288317 | 3300039437 | Bacteria | 2387 |
| 456 | Ga0436365_1057605 | 3300039437 | Bacteria | 25229 |
| 457 | Ga0436365_1590566 | 3300039437 | Bacteria | 4260 |
| 458 | Ga0436365_1912169 | 3300039437 | Bacteria | 3478 |
| 459 | Ga0436361_0071538 | 3300039447 | Bacteria | 3954 |
| 460 | Ga0436363_0258497 | 3300039450 | Bacteria | 2272 |
| 461 | Ga0436362_0489397 | 3300039453 | Bacteria | 4764 |
| 462 | Ga0439453_0001532 | 3300041408 | Bacteria | 2998 |
| 463 | Ga0451835_0700172 | 3300041492 | Bacteria | 1631 |
| 464 | Ga0451837_1310862 | 3300041494 | Bacteria | 1781 |
| 465 | Ga0451839_0039662 | 3300041496 | Bacteria | 1797 |
| 466 | Ga0451853_2638751 | 3300041512 | Bacteria | 2556 |
| 467 | Ga0451577_0004453 | 3300042876 | Bacteria | 14797 |
| 468 | Ga0451577_0030662 | 3300042876 | Bacteria | 4857 |
| 469 | Ga0451577_0031785 | 3300042876 | Bacteria | 4761 |
| 470 | Ga0451577_0053865 | 3300042876 | Bacteria | 3591 |
| 471 | Ga0453683_0103144 | 3300044673 | Bacteria | 1791 |
| 472 | Ga0466966_0022724 | 3300044684 | Bacteria | 4112 |
| 473 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 474 | Ga0453684_0000282 | 3300044712 | Bacteria | 219571 |
| 475 | Ga0453684_0032236 | 3300044712 | Bacteria | 7341 |
| 476 | Ga0453684_0076521 | 3300044712 | Bacteria | 4201 |
| 477 | Ga0451576_0000056 | 3300045051 | Bacteria | 303398 |
| 478 | Ga0451576_0000203 | 3300045051 | Bacteria | 149655 |
| 479 | Ga0451576_0008846 | 3300045051 | Bacteria | 11762 |
| 480 | Ga0451576_0036471 | 3300045051 | Bacteria | 5212 |
| 481 | Ga0495592_0017067 | 3300046454 | Bacteria | 5511 |
| 482 | Ga0495592_0141447 | 3300046454 | Bacteria | 1673 |
| 483 | Ga0495629_0000484 | 3300046459 | Bacteria | 33317 |
| 484 | Ga0495629_0151030 | 3300046459 | Bacteria | 1614 |
| 485 | Ga0495638_0015798 | 3300046460 | Bacteria | 5057 |
| 486 | Ga0495638_0031396 | 3300046460 | Bacteria | 3414 |
| 487 | Ga0495638_0037537 | 3300046460 | Bacteria | 3081 |
| 488 | Ga0495651_0000479 | 3300046462 | Bacteria | 30785 |
| 489 | Ga0495651_0062050 | 3300046462 | Bacteria | 2860 |
| 490 | Ga0495651_0159959 | 3300046462 | Bacteria | 1614 |
| 491 | Ga0495653_0000553 | 3300046463 | Bacteria | 28588 |
| 492 | Ga0495653_0061879 | 3300046463 | Bacteria | 2830 |
| 493 | Ga0495653_0168944 | 3300046463 | Bacteria | 1511 |
| 494 | Ga0495605_0035372 | 3300046474 | Bacteria | 2525 |
| 495 | Ga0495605_0038700 | 3300046474 | Bacteria | 2391 |
| 496 | Ga0495639_0013565 | 3300046475 | Bacteria | 3522 |
| 497 | Ga0495662_0001111 | 3300046476 | Bacteria | 13243 |
| 498 | Ga0495664_0000554 | 3300046477 | Bacteria | 18816 |
| 499 | Ga0495664_0074099 | 3300046477 | Bacteria | 2036 |
| 500 | Ga0495664_0084220 | 3300046477 | Bacteria | 1908 |
| 501 | Ga0495584_0017349 | 3300046491 | Bacteria | 3666 |
| 502 | Ga0495584_0050569 | 3300046491 | Bacteria | 2093 |
| 503 | Ga0495585_0007429 | 3300046492 | Bacteria | 6710 |
| 504 | Ga0495607_0023135 | 3300046501 | Bacteria | 3892 |
| 505 | Ga0495610_0006295 | 3300046512 | Bacteria | 8219 |
| 506 | Ga0495618_0002265 | 3300046514 | Bacteria | 12474 |
| 507 | Ga0495618_0013332 | 3300046514 | Bacteria | 5003 |
| 508 | Ga0495628_0002019 | 3300046516 | Bacteria | 18395 |
| 509 | Ga0495628_0066858 | 3300046516 | Bacteria | 2809 |
| 510 | Ga0495628_0075631 | 3300046516 | Bacteria | 2622 |
| 511 | Ga0495628_0107988 | 3300046516 | Bacteria | 2142 |
| 512 | Ga0495630_0016521 | 3300046517 | Bacteria | 5395 |
| 513 | Ga0495630_0101373 | 3300046517 | Bacteria | 2178 |
| 514 | Ga0495630_0120931 | 3300046517 | Bacteria | 1986 |
| 515 | Ga0495630_0134283 | 3300046517 | Bacteria | 1880 |
| 516 | Ga0495631_0011725 | 3300046518 | Bacteria | 4300 |
| 517 | Ga0495632_0039975 | 3300046519 | Bacteria | 2364 |
| 518 | Ga0495643_0007627 | 3300046522 | Bacteria | 6949 |
| 519 | Ga0495643_0015371 | 3300046522 | Bacteria | 4524 |
| 520 | Ga0495643_0035511 | 3300046522 | Bacteria | 2745 |
| 521 | Ga0495648_0088055 | 3300046524 | Bacteria | 1746 |
| 522 | Ga0495666_0052151 | 3300046526 | Bacteria | 1964 |
| 523 | Ga0495652_0006322 | 3300046529 | Bacteria | 11034 |
| 524 | Ga0495652_0009055 | 3300046529 | Bacteria | 9058 |
| 525 | Ga0495652_0056892 | 3300046529 | Bacteria | 3319 |
| 526 | Ga0495640_0003647 | 3300046533 | Bacteria | 12368 |
| 527 | Ga0495640_0003693 | 3300046533 | Bacteria | 12300 |
| 528 | Ga0495640_0091144 | 3300046533 | Bacteria | 2011 |
| 529 | Ga0495587_0077366 | 3300046536 | Bacteria | 1932 |
| 530 | Ga0495621_0015431 | 3300046539 | Bacteria | 2436 |
| 531 | Ga0495597_0022900 | 3300046542 | Bacteria | 2893 |
| 532 | Ga0495645_0002478 | 3300046543 | Bacteria | 12531 |
| 533 | Ga0495645_0031880 | 3300046543 | Bacteria | 3842 |
| 534 | Ga0495633_0012783 | 3300046558 | Bacteria | 4450 |
| 535 | Ga0495667_0000938 | 3300046559 | Bacteria | 18799 |
| 536 | Ga0495667_0003773 | 3300046559 | Bacteria | 10180 |
| 537 | Ga0495656_0070647 | 3300046615 | Bacteria | 1550 |
| 538 | Ga0495668_0024894 | 3300046616 | Bacteria | 3403 |
| 539 | Ga0495634_0008546 | 3300046642 | Bacteria | 7611 |
| 540 | Ga0495634_0011861 | 3300046642 | Bacteria | 6332 |
| 541 | Ga0495634_0101543 | 3300046642 | Bacteria | 1858 |
| 542 | Ga0495625_0030895 | 3300046660 | Bacteria | 3990 |
| 543 | Ga0495635_0004485 | 3300046663 | Bacteria | 9673 |
| 544 | Ga0495635_0021234 | 3300046663 | Bacteria | 4526 |
| 545 | Ga0495635_0058726 | 3300046663 | Bacteria | 2646 |
| 546 | Ga0495635_0126044 | 3300046663 | Bacteria | 1746 |
| 547 | Ga0495588_0002054 | 3300046674 | Bacteria | 8610 |
| 548 | Ga0495657_0025220 | 3300046675 | Bacteria | 4226 |
| 549 | Ga0495599_0004891 | 3300046678 | Bacteria | 7967 |
| 550 | Ga0495599_0035426 | 3300046678 | Bacteria | 3133 |
| 551 | Ga0495623_0007569 | 3300046679 | Bacteria | 7049 |
| 552 | Ga0495623_0109231 | 3300046679 | Bacteria | 1678 |
| 553 | Ga0495646_0003324 | 3300046680 | Bacteria | 9995 |
| 554 | Ga0495646_0019483 | 3300046680 | Bacteria | 4295 |
| 555 | Ga0495658_0021232 | 3300046683 | Bacteria | 3421 |
| 556 | Ga0495613_0055702 | 3300046689 | Bacteria | 2904 |
| 557 | Ga0495624_0003208 | 3300046690 | Bacteria | 12188 |
| 558 | Ga0495624_0064843 | 3300046690 | Bacteria | 2282 |
| 559 | Ga0495624_0103059 | 3300046690 | Bacteria | 1756 |
| 560 | Ga0495649_0032841 | 3300046694 | Bacteria | 2858 |
| 561 | Ga0495649_0034714 | 3300046694 | Bacteria | 2775 |
| 562 | Ga0495600_0007740 | 3300046809 | Bacteria | 6579 |
| 563 | Ga0495600_0043215 | 3300046809 | Bacteria | 2938 |
| 564 | Ga0495600_0106976 | 3300046809 | Bacteria | 1822 |
| 565 | Ga0495660_0012714 | 3300046810 | Bacteria | 4883 |
| 566 | Ga0495581_0013342 | 3300047315 | Bacteria | 4764 |
| 567 | Ga0495581_0071665 | 3300047315 | Bacteria | 2005 |
| 568 | Ga0495581_0080854 | 3300047315 | Bacteria | 1881 |
| 569 | Ga0495604_0001116 | 3300047317 | Bacteria | 22267 |
| 570 | Ga0495604_0001901 | 3300047317 | Bacteria | 16968 |
| 571 | Ga0495604_0202439 | 3300047317 | Bacteria | 1376 |
| 572 | Ga0495674_0005023 | 3300047319 | Bacteria | 12721 |
| 573 | Ga0495674_0012447 | 3300047319 | Bacteria | 8016 |
| 574 | Ga0495674_0054999 | 3300047319 | Bacteria | 3492 |
| 575 | Ga0495687_012206 | 3300047443 | Bacteria | 4558 |
| 576 | Ga0495675_0011655 | 3300047444 | Bacteria | 5520 |
| 577 | Ga0495675_0020203 | 3300047444 | Bacteria | 4234 |
| 578 | Ga0495685_006328 | 3300047447 | Bacteria | 3870 |
| 579 | Ga0495681_0023489 | 3300047470 | Bacteria | 3273 |
| 580 | Ga0495684_0003655 | 3300047471 | Bacteria | 11984 |
| 581 | Ga0495684_0008513 | 3300047471 | Bacteria | 7946 |
| 582 | Ga0495684_0023761 | 3300047471 | Bacteria | 4714 |
| 583 | Ga0495684_0031461 | 3300047471 | Bacteria | 4073 |
| 584 | Ga0495684_0183854 | 3300047471 | Bacteria | 1548 |
| 585 | Ga0495686_0024414 | 3300047472 | Bacteria | 3972 |
| 586 | Ga0495593_0033876 | 3300047673 | Bacteria | 2780 |
| 587 | Ga0495593_0045049 | 3300047673 | Bacteria | 2356 |
| 588 | Ga0495602_0002877 | 3300048088 | Bacteria | 17634 |
| 589 | Ga0495602_0013293 | 3300048088 | Bacteria | 8418 |
| 590 | Ga0496100_0009675 | 3300048903 | Bacteria | 5422 |
| 591 | Ga0496100_0018641 | 3300048903 | Bacteria | 4121 |
| 592 | Ga0496101_0001461 | 3300048904 | Bacteria | 14113 |
| 593 | Ga0496102_0002294 | 3300048905 | Bacteria | 16341 |
| 594 | Ga0496102_0165686 | 3300048905 | Bacteria | 2079 |
| 595 | Ga0496102_0220397 | 3300048905 | Bacteria | 1788 |
| 596 | Ga0496103_0007191 | 3300048906 | Bacteria | 6638 |
| 597 | Ga0496103_0136186 | 3300048906 | Bacteria | 1569 |
| 598 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 599 | Ga0496104_0000275 | 3300048907 | Bacteria | 45789 |
| 600 | Ga0496104_0008263 | 3300048907 | Bacteria | 9241 |
| 601 | Ga0496104_0013356 | 3300048907 | Bacteria | 7399 |
| 602 | Ga0496104_0030510 | 3300048907 | Bacteria | 5010 |
| 603 | Ga0496104_0031348 | 3300048907 | Bacteria | 4943 |
| 604 | Ga0496104_0043107 | 3300048907 | Bacteria | 4237 |
| 605 | Ga0496104_0053180 | 3300048907 | Bacteria | 3825 |
| 606 | Ga0496105_0000973 | 3300048908 | Bacteria | 19703 |
| 607 | Ga0496105_0006553 | 3300048908 | Bacteria | 8957 |
| 608 | Ga0496105_0013665 | 3300048908 | Bacteria | 6446 |
| 609 | Ga0496105_0020573 | 3300048908 | Bacteria | 5334 |
| 610 | Ga0496105_0059858 | 3300048908 | Bacteria | 3142 |
| 611 | Ga0496105_0060449 | 3300048908 | Bacteria | 3127 |
| 612 | Ga0496105_0066956 | 3300048908 | Bacteria | 2965 |
| 613 | Ga0496106_0002640 | 3300048909 | Bacteria | 13331 |
| 614 | Ga0496106_0028442 | 3300048909 | Bacteria | 4164 |
| 615 | Ga0496106_0162532 | 3300048909 | Bacteria | 1766 |
| 616 | Ga0496107_0003942 | 3300048910 | Bacteria | 9983 |
| 617 | Ga0496107_0018342 | 3300048910 | Bacteria | 4927 |
| 618 | Ga0496107_0038551 | 3300048910 | Bacteria | 3427 |
| 619 | Ga0496107_0126425 | 3300048910 | Bacteria | 1885 |
| 620 | Ga0496107_0127156 | 3300048910 | Bacteria | 1880 |
| 621 | Ga0496107_0226034 | 3300048910 | Unclassified | 1392 |
| 622 | Ga0496108_0000347 | 3300048911 | Bacteria | 39108 |
| 623 | Ga0496108_0001531 | 3300048911 | Bacteria | 18306 |
| 624 | Ga0496108_0005206 | 3300048911 | Bacteria | 10513 |
| 625 | Ga0496108_0007453 | 3300048911 | Bacteria | 8870 |
| 626 | Ga0496108_0022438 | 3300048911 | Bacteria | 5188 |
| 627 | Ga0496108_0049056 | 3300048911 | Bacteria | 3531 |
| 628 | Ga0496109_0017109 | 3300048912 | Bacteria | 6346 |
| 629 | Ga0496109_0029291 | 3300048912 | Bacteria | 4930 |
| 630 | Ga0496109_0054274 | 3300048912 | Bacteria | 3655 |
| 631 | Ga0496109_0062750 | 3300048912 | Bacteria | 3398 |
| 632 | Ga0496109_0081778 | 3300048912 | Bacteria | 2976 |
| 633 | Ga0496110_0004026 | 3300048913 | Bacteria | 11332 |
| 634 | Ga0496110_0044371 | 3300048913 | Bacteria | 3882 |
| 635 | Ga0496110_0090852 | 3300048913 | Bacteria | 2730 |
| 636 | Ga0496110_0138776 | 3300048913 | Bacteria | 2198 |
| 637 | Ga0496110_0154168 | 3300048913 | Bacteria | 2081 |
| 638 | Ga0496110_0202430 | 3300048913 | Bacteria | 1804 |
| 639 | Ga0496111_0010222 | 3300048914 | Bacteria | 6287 |
| 640 | Ga0496111_0021085 | 3300048914 | Bacteria | 4545 |
| 641 | Ga0496111_0022726 | 3300048914 | Bacteria | 4393 |
| 642 | Ga0496112_0001330 | 3300048915 | Bacteria | 18777 |
| 643 | Ga0496112_0001338 | 3300048915 | Bacteria | 18736 |
| 644 | Ga0496112_0108662 | 3300048915 | Bacteria | 2744 |
| 645 | Ga0496112_0134418 | 3300048915 | Bacteria | 2444 |
| 646 | Ga0496112_0219250 | 3300048915 | Bacteria | 1858 |
| 647 | Ga0496112_0310449 | 3300048915 | Bacteria | 1522 |
| 648 | Ga0496113_0002538 | 3300048916 | Bacteria | 10644 |
| 649 | Ga0496113_0005068 | 3300048916 | Bacteria | 8178 |
| 650 | Ga0496113_0023272 | 3300048916 | Bacteria | 4393 |
| 651 | Ga0496113_0069310 | 3300048916 | Bacteria | 2678 |
| 652 | Ga0496113_0126718 | 3300048916 | Bacteria | 2000 |
| 653 | Ga0496114_0016997 | 3300048917 | Bacteria | 5866 |
| 654 | Ga0496114_0019417 | 3300048917 | Bacteria | 5507 |
| 655 | Ga0496114_0027325 | 3300048917 | Bacteria | 4673 |
| 656 | Ga0496114_0032419 | 3300048917 | Bacteria | 4300 |
| 657 | Ga0496114_0084827 | 3300048917 | Bacteria | 2683 |
| 658 | Ga0496114_0194888 | 3300048917 | Bacteria | 1773 |
| 659 | Ga0496115_0027048 | 3300048918 | Bacteria | 4484 |
| 660 | Ga0496115_0082075 | 3300048918 | Bacteria | 2626 |
| 661 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 662 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 663 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 664 | Ga0496119_0022482 | 3300048922 | Bacteria | 4513 |
| 665 | Ga0496119_0026171 | 3300048922 | Bacteria | 4052 |
| 666 | Ga0496120_0000387 | 3300048923 | Bacteria | 71224 |
| 667 | Ga0496120_0001163 | 3300048923 | Bacteria | 33701 |
| 668 | Ga0496121_0151061 | 3300048924 | Bacteria | 1709 |
| 669 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 670 | Ga0496122_0001941 | 3300048925 | Bacteria | 31047 |
| 671 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 672 | Ga0496124_0008477 | 3300048927 | Bacteria | 10743 |
| 673 | Ga0496125_0006385 | 3300048928 | Bacteria | 12774 |
| 674 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 675 | Ga0496126_0007940 | 3300048929 | Bacteria | 11536 |
| 676 | Ga0496126_0044907 | 3300048929 | Bacteria | 4065 |
| 677 | Ga0495678_020781 | 3300049459 | Bacteria | 2900 |
| 678 | Ga0501031_0001804 | 3300049568 | Bacteria | 13455 |
| 679 | Ga0501031_0024114 | 3300049568 | Bacteria | 3966 |
| 680 | Ga0501031_0026160 | 3300049568 | Bacteria | 3806 |
| 681 | Ga0501031_0033350 | 3300049568 | Bacteria | 3358 |
| 682 | Ga0501031_0036581 | 3300049568 | Bacteria | 3202 |
| 683 | Ga0501031_0052065 | 3300049568 | Bacteria | 2668 |
| 684 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 685 | Ga0501032_0000013 | 3300049569 | Bacteria | 185070 |
| 686 | Ga0501032_0000070 | 3300049569 | Bacteria | 86244 |
| 687 | Ga0501032_0004321 | 3300049569 | Bacteria | 10735 |
| 688 | Ga0501032_0021745 | 3300049569 | Bacteria | 4457 |
| 689 | Ga0501032_0036616 | 3300049569 | Bacteria | 3348 |
| 690 | Ga0501032_0131157 | 3300049569 | Bacteria | 1653 |
| 691 | Ga0501033_0000039 | 3300049570 | Bacteria | 142732 |
| 692 | Ga0501033_0000293 | 3300049570 | Bacteria | 48186 |
| 693 | Ga0501033_0002577 | 3300049570 | Bacteria | 15288 |
| 694 | Ga0501033_0003047 | 3300049570 | Bacteria | 13931 |
| 695 | Ga0501033_0007570 | 3300049570 | Bacteria | 8449 |
| 696 | Ga0501033_0024751 | 3300049570 | Bacteria | 4526 |
| 697 | Ga0501033_0050865 | 3300049570 | Bacteria | 3072 |
| 698 | Ga0501033_0068165 | 3300049570 | Bacteria | 2616 |
| 699 | Ga0501033_0094860 | 3300049570 | Bacteria | 2181 |
| 700 | Ga0501033_0187861 | 3300049570 | Bacteria | 1479 |
| 701 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 702 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 703 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 704 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 705 | Ga0501034_0000702 | 3300049571 | Bacteria | 50840 |
| 706 | Ga0501034_0000959 | 3300049571 | Bacteria | 41631 |
| 707 | Ga0501034_0014630 | 3300049571 | Bacteria | 8079 |
| 708 | Ga0501034_0024527 | 3300049571 | Bacteria | 6136 |
| 709 | Ga0501034_0035055 | 3300049571 | Bacteria | 5089 |
| 710 | Ga0501034_0054458 | 3300049571 | Bacteria | 4027 |
| 711 | Ga0501034_0055429 | 3300049571 | Bacteria | 3989 |
| 712 | Ga0501034_0071493 | 3300049571 | Bacteria | 3479 |
| 713 | Ga0501034_0095010 | 3300049571 | Bacteria | 2977 |
| 714 | Ga0501034_0097002 | 3300049571 | Bacteria | 2944 |
| 715 | Ga0501034_0113819 | 3300049571 | Bacteria | 2695 |
| 716 | Ga0501034_0124406 | 3300049571 | Bacteria | 2564 |
| 717 | Ga0501034_0178863 | 3300049571 | Bacteria | 2087 |
| 718 | Ga0501034_0197398 | 3300049571 | Bacteria | 1972 |
| 719 | Ga0501034_0200342 | 3300049571 | Bacteria | 1955 |
| 720 | Ga0501034_0320365 | 3300049571 | Bacteria | 1483 |
| 721 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 722 | Ga0501036_0000412 | 3300049572 | Bacteria | 30187 |
| 723 | Ga0501036_0003886 | 3300049572 | Bacteria | 11990 |
| 724 | Ga0501036_0005528 | 3300049572 | Bacteria | 10253 |
| 725 | Ga0501036_0020737 | 3300049572 | Bacteria | 5519 |
| 726 | Ga0501036_0033174 | 3300049572 | Bacteria | 4366 |
| 727 | Ga0501036_0068022 | 3300049572 | Bacteria | 3014 |
| 728 | Ga0501036_0116328 | 3300049572 | Bacteria | 2258 |
| 729 | Ga0501036_0118539 | 3300049572 | Bacteria | 2235 |
| 730 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 731 | Ga0501037_0000007 | 3300049573 | Bacteria | 215187 |
| 732 | Ga0501037_0001208 | 3300049573 | Bacteria | 19095 |
| 733 | Ga0501037_0004329 | 3300049573 | Bacteria | 10302 |
| 734 | Ga0501037_0008498 | 3300049573 | Bacteria | 7528 |
| 735 | Ga0501037_0027893 | 3300049573 | Bacteria | 4172 |
| 736 | Ga0501037_0093133 | 3300049573 | Bacteria | 2179 |
| 737 | Ga0501037_0099748 | 3300049573 | Bacteria | 2097 |
| 738 | Ga0501037_0191839 | 3300049573 | Bacteria | 1446 |
| 739 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 740 | Ga0501038_0000040 | 3300049574 | Bacteria | 121177 |
| 741 | Ga0501038_0004971 | 3300049574 | Bacteria | 12354 |
| 742 | Ga0501038_0018824 | 3300049574 | Bacteria | 6233 |
| 743 | Ga0501038_0060712 | 3300049574 | Bacteria | 3235 |
| 744 | Ga0501038_0127911 | 3300049574 | Bacteria | 2089 |
| 745 | Ga0501038_0133905 | 3300049574 | Bacteria | 2032 |
| 746 | Ga0501038_0142068 | 3300049574 | Bacteria | 1963 |
| 747 | Ga0501038_0144129 | 3300049574 | Bacteria | 1946 |
| 748 | Ga0501038_0160557 | 3300049574 | Bacteria | 1827 |
| 749 | Ga0501039_0000001 | 3300049575 | Bacteria | 449008 |
| 750 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 751 | Ga0501039_0000188 | 3300049575 | Bacteria | 44404 |
| 752 | Ga0501039_0009966 | 3300049575 | Bacteria | 7243 |
| 753 | Ga0501039_0020438 | 3300049575 | Bacteria | 5074 |
| 754 | Ga0501039_0087954 | 3300049575 | Bacteria | 2420 |
| 755 | Ga0501039_0247819 | 3300049575 | Bacteria | 1401 |
| 756 | Ga0501040_0004945 | 3300049576 | Bacteria | 8627 |
| 757 | Ga0501040_0051346 | 3300049576 | Bacteria | 2821 |
| 758 | Ga0501041_0032662 | 3300049577 | Bacteria | 3146 |
| 759 | Ga0501042_0039402 | 3300049578 | Bacteria | 3357 |
| 760 | Ga0501042_0050716 | 3300049578 | Bacteria | 2960 |
| 761 | Ga0501042_0092954 | 3300049578 | Bacteria | 2166 |
| 762 | Ga0501043_0000019 | 3300049579 | Bacteria | 155347 |
| 763 | Ga0501043_0000034 | 3300049579 | Bacteria | 133724 |
| 764 | Ga0501043_0000177 | 3300049579 | Bacteria | 56981 |
| 765 | Ga0501043_0008300 | 3300049579 | Bacteria | 8178 |
| 766 | Ga0501043_0010760 | 3300049579 | Bacteria | 7165 |
| 767 | Ga0501043_0026048 | 3300049579 | Bacteria | 4588 |
| 768 | Ga0501043_0031291 | 3300049579 | Bacteria | 4184 |
| 769 | Ga0501043_0047470 | 3300049579 | Bacteria | 3376 |
| 770 | Ga0501043_0162417 | 3300049579 | Bacteria | 1745 |
| 771 | Ga0501046_0001179 | 3300049580 | Bacteria | 25420 |
| 772 | Ga0501046_0007256 | 3300049580 | Bacteria | 9746 |
| 773 | Ga0501046_0016030 | 3300049580 | Bacteria | 6286 |
| 774 | Ga0501046_0095970 | 3300049580 | Bacteria | 2278 |
| 775 | Ga0501046_0112901 | 3300049580 | Bacteria | 2074 |
| 776 | Ga0501047_0004025 | 3300049581 | Bacteria | 13820 |
| 777 | Ga0501047_0006184 | 3300049581 | Bacteria | 11259 |
| 778 | Ga0501047_0007110 | 3300049581 | Bacteria | 10513 |
| 779 | Ga0501047_0013347 | 3300049581 | Bacteria | 7785 |
| 780 | Ga0501047_0017714 | 3300049581 | Bacteria | 6822 |
| 781 | Ga0501047_0034936 | 3300049581 | Bacteria | 4854 |
| 782 | Ga0501047_0038409 | 3300049581 | Bacteria | 4632 |
| 783 | Ga0501047_0040143 | 3300049581 | Bacteria | 4526 |
| 784 | Ga0501047_0049215 | 3300049581 | Bacteria | 4070 |
| 785 | Ga0501047_0056861 | 3300049581 | Bacteria | 3784 |
| 786 | Ga0501047_0086988 | 3300049581 | Bacteria | 3003 |
| 787 | Ga0501047_0122721 | 3300049581 | Bacteria | 2479 |
| 788 | Ga0501047_0269354 | 3300049581 | Bacteria | 1549 |
| 789 | Ga0501048_0076927 | 3300049582 | Bacteria | 2355 |
| 790 | Ga0501048_0168825 | 3300049582 | Bacteria | 1549 |
| 791 | Ga0501067_0000044 | 3300049583 | Bacteria | 74423 |
| 792 | Ga0501067_0000085 | 3300049583 | Bacteria | 54351 |
| 793 | Ga0501067_0010712 | 3300049583 | Bacteria | 5072 |
| 794 | Ga0501068_0000862 | 3300049584 | Bacteria | 15792 |
| 795 | Ga0501068_0000900 | 3300049584 | Bacteria | 15544 |
| 796 | Ga0501068_0040570 | 3300049584 | Bacteria | 2795 |
| 797 | Ga0501069_0000017 | 3300049585 | Bacteria | 141492 |
| 798 | Ga0501069_0000504 | 3300049585 | Bacteria | 17826 |
| 799 | Ga0501069_0000608 | 3300049585 | Bacteria | 16558 |
| 800 | Ga0501069_0001495 | 3300049585 | Bacteria | 11539 |
| 801 | Ga0501069_0005634 | 3300049585 | Bacteria | 6517 |
| 802 | Ga0501070_0000223 | 3300049586 | Bacteria | 53874 |
| 803 | Ga0501070_0000275 | 3300049586 | Bacteria | 48299 |
| 804 | Ga0501070_0001269 | 3300049586 | Bacteria | 22673 |
| 805 | Ga0501070_0015276 | 3300049586 | Bacteria | 6461 |
| 806 | Ga0501070_0020182 | 3300049586 | Bacteria | 5590 |
| 807 | Ga0501070_0034753 | 3300049586 | Bacteria | 4213 |
| 808 | Ga0501070_0067697 | 3300049586 | Bacteria | 2957 |
| 809 | Ga0501070_0073821 | 3300049586 | Bacteria | 2823 |
| 810 | Ga0501070_0082668 | 3300049586 | Bacteria | 2658 |
| 811 | Ga0501070_0089715 | 3300049586 | Bacteria | 2544 |
| 812 | Ga0501070_0117981 | 3300049586 | Bacteria | 2192 |
| 813 | Ga0501070_0148553 | 3300049586 | Bacteria | 1934 |
| 814 | Ga0501070_0216934 | 3300049586 | Bacteria | 1570 |
| 815 | Ga0501071_0001509 | 3300049587 | Bacteria | 13526 |
| 816 | Ga0501071_0003548 | 3300049587 | Bacteria | 9765 |
| 817 | Ga0501071_0007369 | 3300049587 | Bacteria | 7215 |
| 818 | Ga0501071_0030303 | 3300049587 | Bacteria | 3826 |
| 819 | Ga0501072_0002643 | 3300049588 | Bacteria | 13431 |
| 820 | Ga0501072_0006941 | 3300049588 | Bacteria | 8597 |
| 821 | Ga0501072_0042017 | 3300049588 | Bacteria | 3591 |
| 822 | Ga0501072_0049383 | 3300049588 | Bacteria | 3312 |
| 823 | Ga0501072_0052678 | 3300049588 | Bacteria | 3204 |
| 824 | Ga0501072_0066784 | 3300049588 | Bacteria | 2838 |
| 825 | Ga0501072_0076632 | 3300049588 | Bacteria | 2646 |
| 826 | Ga0501072_0159536 | 3300049588 | Bacteria | 1799 |
| 827 | Ga0501073_0000007 | 3300049589 | Bacteria | 227229 |
| 828 | Ga0501073_0005889 | 3300049589 | Bacteria | 9148 |
| 829 | Ga0501073_0023267 | 3300049589 | Bacteria | 4451 |
| 830 | Ga0501073_0031716 | 3300049589 | Bacteria | 3770 |
| 831 | Ga0501073_0040293 | 3300049589 | Bacteria | 3307 |
| 832 | Ga0501073_0049159 | 3300049589 | Bacteria | 2957 |
| 833 | Ga0501073_0060156 | 3300049589 | Bacteria | 2651 |
| 834 | Ga0501074_0000060 | 3300049590 | Bacteria | 54314 |
| 835 | Ga0501074_0000664 | 3300049590 | Bacteria | 21423 |
| 836 | Ga0501074_0004007 | 3300049590 | Bacteria | 10496 |
| 837 | Ga0501074_0034900 | 3300049590 | Bacteria | 3645 |
| 838 | Ga0501074_0039974 | 3300049590 | Bacteria | 3396 |
| 839 | Ga0501074_0041493 | 3300049590 | Bacteria | 3331 |
| 840 | Ga0501076_0008099 | 3300049592 | Bacteria | 7684 |
| 841 | Ga0501076_0039233 | 3300049592 | Bacteria | 3718 |
| 842 | Ga0501076_0111806 | 3300049592 | Bacteria | 2208 |
| 843 | Ga0501076_0147593 | 3300049592 | Bacteria | 1913 |
| 844 | Ga0501077_0000003 | 3300049593 | Bacteria | 143061 |
| 845 | Ga0501077_0029923 | 3300049593 | Bacteria | 3463 |
| 846 | Ga0501079_0003533 | 3300049741 | Bacteria | 11487 |
| 847 | Ga0501079_0028248 | 3300049741 | Bacteria | 4304 |
| 848 | Ga0501079_0036203 | 3300049741 | Bacteria | 3802 |
| 849 | Ga0501079_0107780 | 3300049741 | Bacteria | 2162 |
| 850 | Ga0501079_0177508 | 3300049741 | Bacteria | 1661 |
| 851 | Ga0501080_0000988 | 3300049742 | Bacteria | 23309 |
| 852 | Ga0501080_0001013 | 3300049742 | Bacteria | 23083 |
| 853 | Ga0501080_0004825 | 3300049742 | Bacteria | 12024 |
| 854 | Ga0501080_0013088 | 3300049742 | Bacteria | 7619 |
| 855 | Ga0501080_0015899 | 3300049742 | Bacteria | 6941 |
| 856 | Ga0501080_0024335 | 3300049742 | Bacteria | 5614 |
| 857 | Ga0501080_0025960 | 3300049742 | Bacteria | 5442 |
| 858 | Ga0501080_0039526 | 3300049742 | Bacteria | 4402 |
| 859 | Ga0501080_0052234 | 3300049742 | Bacteria | 3804 |
| 860 | Ga0501080_0072218 | 3300049742 | Bacteria | 3211 |
| 861 | Ga0501080_0145684 | 3300049742 | Bacteria | 2189 |
| 862 | Ga0501081_0034304 | 3300049743 | Bacteria | 3452 |
| 863 | Ga0501081_0091307 | 3300049743 | Bacteria | 2141 |
| 864 | Ga0501081_0116363 | 3300049743 | Bacteria | 1901 |
| 865 | Ga0501083_0000511 | 3300049744 | Bacteria | 24743 |
| 866 | Ga0501083_0000560 | 3300049744 | Bacteria | 23861 |
| 867 | Ga0501083_0005924 | 3300049744 | Bacteria | 8653 |
| 868 | Ga0501083_0009206 | 3300049744 | Bacteria | 6975 |
| 869 | Ga0501083_0012418 | 3300049744 | Bacteria | 5959 |
| 870 | Ga0501035_0000112 | 3300049822 | Bacteria | 99138 |
| 871 | Ga0501035_0000159 | 3300049822 | Bacteria | 82264 |
| 872 | Ga0501035_0000488 | 3300049822 | Bacteria | 44586 |
| 873 | Ga0501035_0000772 | 3300049822 | Bacteria | 34369 |
| 874 | Ga0501035_0004717 | 3300049822 | Bacteria | 12947 |
| 875 | Ga0501035_0021721 | 3300049822 | Bacteria | 5901 |
| 876 | Ga0501035_0035083 | 3300049822 | Bacteria | 4555 |
| 877 | Ga0501035_0066823 | 3300049822 | Bacteria | 3190 |
| 878 | Ga0501035_0073609 | 3300049822 | Bacteria | 3023 |
| 879 | Ga0501035_0211521 | 3300049822 | Bacteria | 1659 |
| 880 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 881 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 882 | Ga0501044_0000411 | 3300049823 | Bacteria | 52862 |
| 883 | Ga0501044_0012445 | 3300049823 | Bacteria | 9213 |
| 884 | Ga0501044_0037724 | 3300049823 | Bacteria | 5049 |
| 885 | Ga0501044_0043987 | 3300049823 | Bacteria | 4637 |
| 886 | Ga0501044_0046666 | 3300049823 | Bacteria | 4484 |
| 887 | Ga0501044_0047924 | 3300049823 | Bacteria | 4418 |
| 888 | Ga0501044_0076966 | 3300049823 | Bacteria | 3384 |
| 889 | Ga0501044_0109952 | 3300049823 | Bacteria | 2765 |
| 890 | Ga0501044_0184955 | 3300049823 | Bacteria | 2049 |
| 891 | Ga0501044_0187854 | 3300049823 | Bacteria | 2030 |
| 892 | Ga0501044_0211777 | 3300049823 | Bacteria | 1892 |
| 893 | Ga0501045_0044118 | 3300049824 | Bacteria | 3247 |
| 894 | Ga0501045_0049040 | 3300049824 | Bacteria | 3078 |
| 895 | nmdc:mga03683_4054_c1 | 3300050489 | Bacteria | 4809 |
| 896 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 897 | nmdc:mga00v17_72749_c1 | 3300050491 | Bacteria | 2133 |
| 898 | nmdc:mga0yw44_1745_c1 | 3300050492 | Bacteria | 8845 |
| 899 | nmdc:mga0yw44_22295_c1 | 3300050492 | Bacteria | 3549 |
| 900 | nmdc:mga0yw44_3742_c1 | 3300050492 | Bacteria | 6813 |
| 901 | nmdc:mga0yw44_8062_c1 | 3300050492 | Bacteria | 5226 |
| 902 | nmdc:mga06z11_2118_c1 | 3300050494 | Bacteria | 7526 |
| 903 | nmdc:mga06z11_32585_c1 | 3300050494 | Bacteria | 2543 |
| 904 | nmdc:mga06z11_59503_c1 | 3300050494 | Bacteria | 1986 |
| 905 | nmdc:mga06z11_7889_c1 | 3300050494 | Bacteria | 4408 |
| 906 | nmdc:mga04h51_44700_c1 | 3300050495 | Bacteria | 1462 |
| 907 | nmdc:mga07m45_92793_c1 | 3300050496 | Bacteria | 1730 |
| 908 | nmdc:mga05p37_137727_c1 | 3300050507 | Bacteria | 2992 |
| 909 | nmdc:mga05p37_151548_c1 | 3300050507 | Bacteria | 2835 |
| 910 | nmdc:mga05p37_183433_c1 | 3300050507 | Bacteria | 2545 |
| 911 | nmdc:mga05p37_305_c1 | 3300050507 | Bacteria | 51585 |
| 912 | nmdc:mga05p37_5814_c1 | 3300050507 | Bacteria | 14500 |
| 913 | nmdc:mga09592_1154_c1 | 3300050508 | Bacteria | 21059 |
| 914 | nmdc:mga0qj67_140025_c1 | 3300050509 | Bacteria | 1961 |
| 915 | nmdc:mga0qj67_24382_c1 | 3300050509 | Bacteria | 4662 |
| 916 | nmdc:mga0qj67_412_c1 | 3300050509 | Bacteria | 29289 |
| 917 | nmdc:mga0qj67_42917_c1 | 3300050509 | Bacteria | 3561 |
| 918 | nmdc:mga0qj67_52286_c1 | 3300050509 | Bacteria | 3232 |
| 919 | nmdc:mga06r32_1000_c1 | 3300050510 | Bacteria | 25335 |
| 920 | nmdc:mga06r32_111318_c1 | 3300050510 | Bacteria | 2694 |
| 921 | nmdc:mga06r32_133220_c1 | 3300050510 | Bacteria | 2459 |
| 922 | nmdc:mga06r32_196912_c1 | 3300050510 | Bacteria | 2002 |
| 923 | nmdc:mga06r32_20818_c1 | 3300050510 | Bacteria | 6044 |
| 924 | nmdc:mga06r32_24274_c1 | 3300050510 | Bacteria | 5623 |
| 925 | nmdc:mga06r32_50797_c1 | 3300050510 | Bacteria | 3966 |
| 926 | nmdc:mga08y16_140156_c1 | 3300050511 | Bacteria | 2514 |
| 927 | nmdc:mga08y16_22596_c1 | 3300050511 | Bacteria | 6641 |
| 928 | nmdc:mga08y16_92508_c1 | 3300050511 | Bacteria | 3151 |
| 929 | nmdc:mga0n895_117665_c1 | 3300050512 | Bacteria | 2677 |
| 930 | nmdc:mga0n895_189257_c1 | 3300050512 | Bacteria | 2089 |
| 931 | nmdc:mga0n895_270806_c1 | 3300050512 | Unclassified | 1722 |
| 932 | nmdc:mga0n895_33055_c1 | 3300050512 | Bacteria | 4969 |
| 933 | nmdc:mga0n895_53506_c1 | 3300050512 | Bacteria | 3966 |
| 934 | nmdc:mga0n895_58688_c1 | 3300050512 | Bacteria | 3794 |
| 935 | nmdc:mga0n895_69536_c1 | 3300050512 | Bacteria | 3488 |
| 936 | nmdc:mga0n895_75677_c1 | 3300050512 | Bacteria | 3346 |
| 937 | nmdc:mga0rr50_30851_c1 | 3300050513 | Bacteria | 3800 |
| 938 | nmdc:mga0rr50_33999_c1 | 3300050513 | Bacteria | 3647 |
| 939 | nmdc:mga0rr50_6667_c1 | 3300050513 | Bacteria | 7061 |
| 940 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 941 | nmdc:mga08x19_43298_c1 | 3300050514 | Bacteria | 2872 |
| 942 | nmdc:mga0sz30_95_c1 | 3300050516 | Bacteria | 33938 |
| 943 | Ga0495601_0000482 | 3300053077 | Bacteria | 20947 |
| 944 | Ga0495601_0004823 | 3300053077 | Bacteria | 7820 |
| 945 | Ga0495601_0022185 | 3300053077 | Bacteria | 3896 |
| 946 | Ga0495601_0037926 | 3300053077 | Bacteria | 3012 |
| 947 | Ga0495601_0058528 | 3300053077 | Bacteria | 2442 |
| 948 | Ga0495601_0088544 | 3300053077 | Bacteria | 1990 |
| 949 | Ga0495612_0000671 | 3300053078 | Bacteria | 13820 |
| 950 | Ga0495612_0004190 | 3300053078 | Bacteria | 5978 |
| 951 | Ga0495655_0000500 | 3300053083 | Bacteria | 6520 |
| 952 | Ga0495595_0002943 | 3300053084 | Bacteria | 6720 |
| 953 | Ga0495595_0004391 | 3300053084 | Bacteria | 5674 |
| 954 | Ga0495595_0009163 | 3300053084 | Bacteria | 4089 |
| 955 | Ga0495595_0028307 | 3300053084 | Bacteria | 2503 |
| 956 | Ga0495619_0000426 | 3300053085 | Bacteria | 28605 |
| 957 | Ga0495619_0006508 | 3300053085 | Bacteria | 7391 |
| 958 | Ga0495619_0007493 | 3300053085 | Bacteria | 6912 |
| 959 | Ga0495619_0015287 | 3300053085 | Bacteria | 4854 |
| 960 | Ga0495619_0054246 | 3300053085 | Bacteria | 2652 |
| 961 | Ga0500643_007497 | 3300053087 | Bacteria | 4388 |
| 962 | Ga0500651_0071553 | 3300053093 | Bacteria | 2158 |
| 963 | Ga0500641_0007870 | 3300053096 | Bacteria | 3800 |
| 964 | Ga0500641_0012417 | 3300053096 | Bacteria | 3110 |
| 965 | Ga0500556_0000054 | 3300053104 | Bacteria | 115949 |
| 966 | Ga0500572_009569 | 3300053111 | Bacteria | 2295 |
| 967 | Ga0500595_005643 | 3300053119 | Bacteria | 5438 |
| 968 | Ga0500658_0000093 | 3300053134 | Bacteria | 41128 |
| 969 | Ga0500559_0002458 | 3300053136 | Bacteria | 9585 |
| 970 | Ga0500561_0000122 | 3300053137 | Bacteria | 14939 |
| 971 | Ga0500568_0000188 | 3300053139 | Bacteria | 54105 |
| 972 | Ga0500568_0008308 | 3300053139 | Bacteria | 5016 |
| 973 | Ga0500616_0017112 | 3300053153 | Bacteria | 4117 |
| 974 | Ga0500620_000445 | 3300053155 | Bacteria | 7473 |
| 975 | Ga0500624_000810 | 3300053157 | Bacteria | 7240 |
| 976 | Ga0500634_0001545 | 3300053161 | Bacteria | 9045 |
| 977 | Ga0500636_0000030 | 3300053177 | Bacteria | 77501 |
| 978 | Ga0500636_0002620 | 3300053177 | Bacteria | 9993 |
| 979 | Ga0500645_001927 | 3300053730 | Bacteria | 9861 |
| 980 | Ga0501084_0013749 | 3300054114 | Bacteria | 6698 |
| 981 | Ga0501084_0026596 | 3300054114 | Bacteria | 4829 |
| 982 | Ga0501084_0034070 | 3300054114 | Bacteria | 4258 |
| 983 | Ga0501084_0045705 | 3300054114 | Bacteria | 3666 |
| 984 | Ga0501084_0053125 | 3300054114 | Bacteria | 3389 |
| 985 | Ga0501084_0202853 | 3300054114 | Bacteria | 1673 |
| 986 | Ga0501084_0245700 | 3300054114 | Bacteria | 1511 |
| 987 | Ga0501084_0264739 | 3300054114 | Bacteria | 1451 |
| 988 | Ga0501082_0011519 | 3300060353 | Bacteria | 7612 |
| 989 | Ga0501082_0025365 | 3300060353 | Bacteria | 5108 |
| 990 | Ga0501082_0035304 | 3300060353 | Bacteria | 4309 |
| 991 | Ga0501082_0053623 | 3300060353 | Bacteria | 3475 |
| 992 | Ga0501082_0081043 | 3300060353 | Bacteria | 2801 |
| 993 | Ga0501082_0085786 | 3300060353 | Bacteria | 2715 |
| 994 | Ga0501082_0215442 | 3300060353 | Bacteria | 1671 |
| 995 | Ga0466962_0057962 | 3300061719 | Bacteria | 1849 |
| 996 | Ga0530510_0014732 | 3300061734 | Bacteria | 5521 |
| 997 | Ga0530510_0104378 | 3300061734 | Bacteria | 2074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0126992 | Ga0373933_0126992_75_1313 | 334 |
| 2 | 3300005530 | Ga0070679_100220778 | Ga0070679_1002207781 | 353 |
| 3 | 3300025912 | Ga0207707_10001567 | Ga0207707_100015672 | 353 |
| 4 | 3300025917 | Ga0207660_10033189 | Ga0207660_100331895 | 353 |
| 5 | 3300025921 | Ga0207652_10013529 | Ga0207652_100135297 | 353 |
| 6 | 3300049571 | Ga0501034_0000959 | Ga0501034_0000959_7973_9358 | 353 |
| 7 | 3300049581 | Ga0501047_0056861 | Ga0501047_0056861_302_1540 | 353 |
| 8 | 3300049583 | Ga0501067_0000044 | Ga0501067_0000044_62282_63667 | 353 |
| 9 | 3300049584 | Ga0501068_0000862 | Ga0501068_0000862_4050_5288 | 353 |
| 10 | 3300049584 | Ga0501068_0000900 | Ga0501068_0000900_3586_4971 | 353 |
| 11 | 3300049585 | Ga0501069_0000504 | Ga0501069_0000504_2110_3495 | 353 |
| 12 | 3300049585 | Ga0501069_0000608 | Ga0501069_0000608_3918_5156 | 353 |
| 13 | 3300049586 | Ga0501070_0000223 | Ga0501070_0000223_14975_16360 | 353 |
| 14 | 3300049587 | Ga0501071_0001509 | Ga0501071_0001509_4554_5939 | 353 |
| 15 | 3300049587 | Ga0501071_0007369 | Ga0501071_0007369_4571_5809 | 353 |
| 16 | 3300049588 | Ga0501072_0006941 | Ga0501072_0006941_4390_5775 | 353 |
| 17 | 3300049588 | Ga0501072_0052678 | Ga0501072_0052678_1426_2664 | 353 |
| 18 | 3300049590 | Ga0501074_0000664 | Ga0501074_0000664_2666_4051 | 353 |
| 19 | 3300049741 | Ga0501079_0177508 | Ga0501079_0177508_42_1427 | 353 |
| 20 | 3300049744 | Ga0501083_0000560 | Ga0501083_0000560_11601_12986 | 353 |
| 21 | 3300049744 | Ga0501083_0012418 | Ga0501083_0012418_2319_3557 | 353 |
| 22 | 3300054114 | Ga0501084_0013749 | Ga0501084_0013749_4404_5789 | 353 |
| 23 | 3300060353 | Ga0501082_0035304 | Ga0501082_0035304_669_1907 | 353 |
| 24 | 3300060353 | Ga0501082_0085786 | Ga0501082_0085786_1297_2682 | 353 |
| 25 | iso_pu_bacteria | 2958144490 | 2958151835 | 353 |
| 26 | 3300006844 | Ga0075428_100018779 | Ga0075428_1000187793 | 354 |
| 27 | 3300006846 | Ga0075430_100074556 | Ga0075430_1000745562 | 354 |
| 28 | 3300050507 | nmdc:mga05p37_151548_c1 | nmdc:mga05p37_151548_c1_1448_2812 | 354 |
| 29 | 3300050509 | nmdc:mga0qj67_52286_c1 | nmdc:mga0qj67_52286_c1_405_1769 | 354 |
| 30 | 3300050510 | nmdc:mga06r32_50797_c1 | nmdc:mga06r32_50797_c1_283_1647 | 354 |
| 31 | 3300037418 | Ga0395900_0083436 | Ga0395900_0083436_29_1120 | 357 |
| 32 | 3300005937 | Ga0081455_10028423 | Ga0081455_100284235 | 358 |
| 33 | 3300049573 | Ga0501037_0093133 | Ga0501037_0093133_66_1364 | 359 |
| 34 | 3300049574 | Ga0501038_0133905 | Ga0501038_0133905_537_1835 | 359 |
| 35 | 3300049580 | Ga0501046_0007256 | Ga0501046_0007256_1626_2924 | 359 |
| 36 | 3300049586 | Ga0501070_0089715 | Ga0501070_0089715_1081_2379 | 359 |
| 37 | 3300049822 | Ga0501035_0021721 | Ga0501035_0021721_1105_2403 | 359 |
| 38 | iso_pu_bacteria | 2878788777 | 2878796054 | 359 |
| 39 | 3300025292 | Ga0209676_1000093 | Ga0209676_10000937 | 361 |
| 40 | 3300046674 | Ga0495588_0002054 | Ga0495588_0002054_3019_4404 | 361 |
| 41 | 3300047470 | Ga0495681_0023489 | Ga0495681_0023489_772_2163 | 361 |
| 42 | 3300003856 | Ga0058692_1003021 | Ga0058692_10030213 | 362 |
| 43 | 3300005983 | Ga0081540_1007590 | Ga0081540_10075907 | 362 |
| 44 | 3300027312 | Ga0209371_1000911 | Ga0209371_10009114 | 362 |
| 45 | 3300030500 | Ga0268256_1001490 | Ga0268256_10014902 | 362 |
| 46 | 3300005364 | Ga0070673_100118650 | Ga0070673_1001186502 | 364 |
| 47 | 3300005471 | Ga0070698_100015927 | Ga0070698_1000159278 | 364 |
| 48 | 3300005518 | Ga0070699_100168389 | Ga0070699_1001683892 | 364 |
| 49 | 3300013296 | Ga0157374_10117779 | Ga0157374_101177792 | 364 |
| 50 | 3300014497 | Ga0182008_10017764 | Ga0182008_100177643 | 364 |
| 51 | 3300025922 | Ga0207646_10139417 | Ga0207646_101394172 | 364 |
| 52 | 3300025923 | Ga0207681_10176282 | Ga0207681_101762822 | 364 |
| 53 | 3300042876 | Ga0451577_0004453 | Ga0451577_0004453_7863_9203 | 364 |
| 54 | 3300042876 | Ga0451577_0031785 | Ga0451577_0031785_2499_3842 | 364 |
| 55 | 3300042876 | Ga0451577_0053865 | Ga0451577_0053865_1274_2617 | 364 |
| 56 | 3300044712 | Ga0453684_0000282 | Ga0453684_0000282_56077_57417 | 364 |
| 57 | 3300044712 | Ga0453684_0032236 | Ga0453684_0032236_1372_2715 | 364 |
| 58 | 3300048915 | Ga0496112_0134418 | Ga0496112_0134418_1073_2413 | 364 |
| 59 | 3300049571 | Ga0501034_0113819 | Ga0501034_0113819_845_2296 | 364 |
| 60 | 3300049586 | Ga0501070_0216934 | Ga0501070_0216934_13_1320 | 364 |
| 61 | 3300049823 | Ga0501044_0184955 | Ga0501044_0184955_443_1894 | 364 |
| 62 | iso_pu_bacteria | 2922130491 | 2922136194 | 364 |
| 63 | 3300049571 | Ga0501034_0320365 | Ga0501034_0320365_90_1382 | 365 |
| 64 | 3300049581 | Ga0501047_0269354 | Ga0501047_0269354_182_1474 | 365 |
| 65 | 3300049585 | Ga0501069_0005634 | Ga0501069_0005634_5035_6429 | 365 |
| 66 | 3300049590 | Ga0501074_0039974 | Ga0501074_0039974_43_1437 | 365 |
| 67 | 3300049742 | Ga0501080_0024335 | Ga0501080_0024335_427_1821 | 365 |
| 68 | 3300054114 | Ga0501084_0202853 | Ga0501084_0202853_134_1528 | 365 |
| 69 | 3300006048 | Ga0075363_100005619 | Ga0075363_1000056191 | 366 |
| 70 | 3300006051 | Ga0075364_10037772 | Ga0075364_100377721 | 366 |
| 71 | 3300006178 | Ga0075367_10003717 | Ga0075367_100037177 | 366 |
| 72 | 3300006178 | Ga0075367_10015700 | Ga0075367_100157001 | 366 |
| 73 | 3300050494 | nmdc:mga06z11_32585_c1 | nmdc:mga06z11_32585_c1_775_2229 | 366 |
| 74 | 3300046558 | Ga0495633_0012783 | Ga0495633_0012783_1979_3364 | 367 |
| 75 | 3300046679 | Ga0495623_0109231 | Ga0495623_0109231_11_1114 | 367 |
| 76 | 3300048905 | Ga0496102_0220397 | Ga0496102_0220397_103_1377 | 367 |
| 77 | 3300048907 | Ga0496104_0043107 | Ga0496104_0043107_2651_4051 | 367 |
| 78 | 3300048908 | Ga0496105_0060449 | Ga0496105_0060449_371_1771 | 367 |
| 79 | 3300048911 | Ga0496108_0049056 | Ga0496108_0049056_668_2068 | 367 |
| 80 | 3300048913 | Ga0496110_0138776 | Ga0496110_0138776_205_1605 | 367 |
| 81 | 3300048913 | Ga0496110_0202430 | Ga0496110_0202430_145_1545 | 367 |
| 82 | 3300048915 | Ga0496112_0108662 | Ga0496112_0108662_351_1751 | 367 |
| 83 | 3300049743 | Ga0501081_0116363 | Ga0501081_0116363_471_1832 | 367 |
| 84 | 3300053111 | Ga0500572_009569 | Ga0500572_009569_604_1986 | 367 |
| 85 | 3300053157 | Ga0500624_000810 | Ga0500624_000810_2889_4274 | 367 |
| 86 | 3300053161 | Ga0500634_0001545 | Ga0500634_0001545_7314_8699 | 367 |
| 87 | iso_pu_bacteria | 2855020534 | 2855021215 | 367 |
| 88 | 3300009094 | Ga0111539_10239265 | Ga0111539_102392652 | 368 |
| 89 | 3300048925 | Ga0496122_0001941 | Ga0496122_0001941_6200_7576 | 368 |
| 90 | 3300050510 | nmdc:mga06r32_111318_c1 | nmdc:mga06r32_111318_c1_1312_2631 | 368 |
| 91 | 3300039453 | Ga0436362_0489397 | Ga0436362_0489397_1290_2534 | 369 |
| 92 | 3300046459 | Ga0495629_0151030 | Ga0495629_0151030_54_1499 | 370 |
| 93 | 3300050512 | nmdc:mga0n895_270806_c1 | nmdc:mga0n895_270806_c1_17_1375 | 370 |
| 94 | 3300031711 | Ga0265314_10013823 | Ga0265314_100138233 | 371 |
| 95 | 3300042876 | Ga0451577_0030662 | Ga0451577_0030662_3681_4796 | 371 |
| 96 | 3300050512 | nmdc:mga0n895_189257_c1 | nmdc:mga0n895_189257_c1_898_2013 | 371 |
| 97 | 3300049571 | Ga0501034_0178863 | Ga0501034_0178863_668_2020 | 372 |
| 98 | 3300037312 | Ga0395899_0030218 | Ga0395899_0030218_630_2069 | 373 |
| 99 | 3300037418 | Ga0395900_0010116 | Ga0395900_0010116_267_1706 | 373 |
| 100 | 3300037466 | Ga0395898_0005741 | Ga0395898_0005741_7890_9329 | 373 |
| 101 | 3300038443 | Ga0395901_0003628 | Ga0395901_0003628_725_2164 | 373 |
| 102 | iso_pu_bacteria | 2903513507 | 2903519555 | 373 |
| 103 | iso_pu_bacteria | 2970532167 | 2970538988 | 373 |
| 104 | 3300005262 | Ga0065165_1000558 | Ga0065165_100055847 | 374 |
| 105 | 3300005563 | Ga0068855_100027185 | Ga0068855_1000271854 | 374 |
| 106 | 3300010375 | Ga0105239_10132102 | Ga0105239_101321022 | 374 |
| 107 | 3300025284 | Ga0209130_1000100 | Ga0209130_100010049 | 374 |
| 108 | 3300003856 | Ga0058692_1000534 | Ga0058692_100053412 | 375 |
| 109 | 3300005937 | Ga0081455_10036290 | Ga0081455_100362901 | 375 |
| 110 | 3300009147 | Ga0114129_10088526 | Ga0114129_100885262 | 375 |
| 111 | 3300025294 | Ga0209025_1001149 | Ga0209025_100114928 | 376 |
| 112 | 3300035083 | Ga0373926_0002534 | Ga0373926_0002534_3052_4398 | 376 |
| 113 | 3300035089 | Ga0373944_0003584 | Ga0373944_0003584_744_2090 | 376 |
| 114 | 3300035119 | Ga0373956_0018976 | Ga0373956_0018976_297_1682 | 376 |
| 115 | 3300035120 | Ga0373957_0008948 | Ga0373957_0008948_775_2160 | 376 |
| 116 | 3300035170 | Ga0373943_0001179 | Ga0373943_0001179_8639_9985 | 376 |
| 117 | 3300035171 | Ga0373946_0007928 | Ga0373946_0007928_1751_3097 | 376 |
| 118 | 3300035410 | Ga0373924_0023436 | Ga0373924_0023436_102_1487 | 376 |
| 119 | 3300035692 | Ga0373935_0010340 | Ga0373935_0010340_211_1557 | 376 |
| 120 | 3300035695 | Ga0373927_0000863 | Ga0373927_0000863_13688_15034 | 376 |
| 121 | 3300035725 | Ga0373947_0001832 | Ga0373947_0001832_11214_12560 | 376 |
| 122 | 3300036401 | Ga0373937_0006754 | Ga0373937_0006754_4443_5828 | 376 |
| 123 | 3300037068 | Ga0373925_0045409 | Ga0373925_0045409_1421_2767 | 376 |
| 124 | 3300044673 | Ga0453683_0103144 | Ga0453683_0103144_122_1426 | 376 |
| 125 | 3300045051 | Ga0451576_0000203 | Ga0451576_0000203_23670_24974 | 376 |
| 126 | 3300046517 | Ga0495630_0120931 | Ga0495630_0120931_422_1768 | 376 |
| 127 | 3300046533 | Ga0495640_0091144 | Ga0495640_0091144_498_1844 | 376 |
| 128 | 3300046663 | Ga0495635_0126044 | Ga0495635_0126044_19_1365 | 376 |
| 129 | 3300046689 | Ga0495613_0055702 | Ga0495613_0055702_909_2255 | 376 |
| 130 | 3300046690 | Ga0495624_0003208 | Ga0495624_0003208_7700_9046 | 376 |
| 131 | 3300047315 | Ga0495581_0013342 | Ga0495581_0013342_2011_3357 | 376 |
| 132 | 3300047471 | Ga0495684_0003655 | Ga0495684_0003655_6840_8186 | 376 |
| 133 | 3300006871 | Ga0075434_100039472 | Ga0075434_1000394723 | 377 |
| 134 | 3300007076 | Ga0075435_100006471 | Ga0075435_1000064715 | 377 |
| 135 | 3300049588 | Ga0501072_0042017 | Ga0501072_0042017_1264_2607 | 377 |
| 136 | 3300049592 | Ga0501076_0039233 | Ga0501076_0039233_1207_2550 | 377 |
| 137 | 3300049741 | Ga0501079_0028248 | Ga0501079_0028248_1024_2367 | 377 |
| 138 | 3300049743 | Ga0501081_0034304 | Ga0501081_0034304_1236_2579 | 377 |
| 139 | 3300050512 | nmdc:mga0n895_33055_c1 | nmdc:mga0n895_33055_c1_2689_4032 | 377 |
| 140 | 3300050513 | nmdc:mga0rr50_6667_c1 | nmdc:mga0rr50_6667_c1_4227_5570 | 377 |
| 141 | 3300060353 | Ga0501082_0081043 | Ga0501082_0081043_882_2225 | 377 |
| 142 | 3300003790 | Ga0055528_1016405 | Ga0055528_10164052 | 379 |
| 143 | 3300005340 | Ga0070689_100013888 | Ga0070689_1000138882 | 379 |
| 144 | 3300025273 | Ga0209673_1003238 | Ga0209673_10032384 | 379 |
| 145 | 3300025297 | Ga0209758_1010083 | Ga0209758_10100834 | 379 |
| 146 | 3300025934 | Ga0207686_10068064 | Ga0207686_100680642 | 379 |
| 147 | 3300025936 | Ga0207670_10005481 | Ga0207670_100054812 | 379 |
| 148 | 3300025960 | Ga0207651_10006399 | Ga0207651_100063995 | 379 |
| 149 | 3300028794 | Ga0307515_10002808 | Ga0307515_100028089 | 379 |
| 150 | 3300041492 | Ga0451835_0700172 | Ga0451835_0700172_113_1501 | 379 |
| 151 | 3300041494 | Ga0451837_1310862 | Ga0451837_1310862_80_1468 | 379 |
| 152 | 3300041496 | Ga0451839_0039662 | Ga0451839_0039662_96_1484 | 379 |
| 153 | 3300041512 | Ga0451853_2638751 | Ga0451853_2638751_982_2370 | 379 |
| 154 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_853427_854704 | 379 |
| 155 | 3300046460 | Ga0495638_0037537 | Ga0495638_0037537_1603_2991 | 379 |
| 156 | 3300046474 | Ga0495605_0038700 | Ga0495605_0038700_204_1508 | 379 |
| 157 | 3300046501 | Ga0495607_0023135 | Ga0495607_0023135_1751_3139 | 379 |
| 158 | 3300046512 | Ga0495610_0006295 | Ga0495610_0006295_3883_5271 | 379 |
| 159 | 3300046518 | Ga0495631_0011725 | Ga0495631_0011725_2115_3503 | 379 |
| 160 | 3300046519 | Ga0495632_0039975 | Ga0495632_0039975_84_1472 | 379 |
| 161 | 3300046522 | Ga0495643_0007627 | Ga0495643_0007627_2098_3486 | 379 |
| 162 | 3300046524 | Ga0495648_0088055 | Ga0495648_0088055_300_1688 | 379 |
| 163 | 3300046542 | Ga0495597_0022900 | Ga0495597_0022900_838_2226 | 379 |
| 164 | 3300046694 | Ga0495649_0034714 | Ga0495649_0034714_497_1885 | 379 |
| 165 | 3300046810 | Ga0495660_0012714 | Ga0495660_0012714_84_1472 | 379 |
| 166 | 3300047443 | Ga0495687_012206 | Ga0495687_012206_1567_2955 | 379 |
| 167 | 3300047472 | Ga0495686_0024414 | Ga0495686_0024414_1376_2764 | 379 |
| 168 | 3300048917 | Ga0496114_0194888 | Ga0496114_0194888_428_1762 | 379 |
| 169 | 3300049459 | Ga0495678_020781 | Ga0495678_020781_40_1428 | 379 |
| 170 | 3300049575 | Ga0501039_0009966 | Ga0501039_0009966_880_2208 | 379 |
| 171 | 3300049575 | Ga0501039_0247819 | Ga0501039_0247819_10_1251 | 379 |
| 172 | 3300049576 | Ga0501040_0051346 | Ga0501040_0051346_86_1414 | 379 |
| 173 | 3300049578 | Ga0501042_0050716 | Ga0501042_0050716_978_2306 | 379 |
| 174 | 3300049580 | Ga0501046_0095970 | Ga0501046_0095970_718_2079 | 379 |
| 175 | 3300049582 | Ga0501048_0076927 | Ga0501048_0076927_338_1666 | 379 |
| 176 | 3300049586 | Ga0501070_0148553 | Ga0501070_0148553_15_1376 | 379 |
| 177 | 3300049587 | Ga0501071_0030303 | Ga0501071_0030303_1789_3117 | 379 |
| 178 | 3300049588 | Ga0501072_0159536 | Ga0501072_0159536_444_1772 | 379 |
| 179 | 3300049589 | Ga0501073_0023267 | Ga0501073_0023267_2095_3456 | 379 |
| 180 | 3300049742 | Ga0501080_0004825 | Ga0501080_0004825_1658_3019 | 379 |
| 181 | 3300049824 | Ga0501045_0049040 | Ga0501045_0049040_729_2057 | 379 |
| 182 | 3300053119 | Ga0500595_005643 | Ga0500595_005643_2463_3824 | 379 |
| 183 | 3300053134 | Ga0500658_0000093 | Ga0500658_0000093_30340_31728 | 379 |
| 184 | 3300054114 | Ga0501084_0045705 | Ga0501084_0045705_619_1947 | 379 |
| 185 | 3300060353 | Ga0501082_0215442 | Ga0501082_0215442_83_1411 | 379 |
| 186 | 3300047673 | Ga0495593_0045049 | Ga0495593_0045049_720_2054 | 380 |
| 187 | 3300049569 | Ga0501032_0004321 | Ga0501032_0004321_8440_9807 | 380 |
| 188 | 3300049570 | Ga0501033_0094860 | Ga0501033_0094860_289_1650 | 380 |
| 189 | 3300049573 | Ga0501037_0027893 | Ga0501037_0027893_107_1474 | 380 |
| 190 | 3300049577 | Ga0501041_0032662 | Ga0501041_0032662_897_2258 | 380 |
| 191 | 3300049579 | Ga0501043_0010760 | Ga0501043_0010760_1236_2603 | 380 |
| 192 | 3300049583 | Ga0501067_0000085 | Ga0501067_0000085_42827_44194 | 380 |
| 193 | 3300049588 | Ga0501072_0049383 | Ga0501072_0049383_489_1841 | 380 |
| 194 | 3300049589 | Ga0501073_0000007 | Ga0501073_0000007_57345_58712 | 380 |
| 195 | 3300049592 | Ga0501076_0111806 | Ga0501076_0111806_276_1637 | 380 |
| 196 | 3300049593 | Ga0501077_0000003 | Ga0501077_0000003_67254_68621 | 380 |
| 197 | 3300049593 | Ga0501077_0029923 | Ga0501077_0029923_417_1778 | 380 |
| 198 | 3300049741 | Ga0501079_0107780 | Ga0501079_0107780_86_1447 | 380 |
| 199 | 3300049742 | Ga0501080_0000988 | Ga0501080_0000988_4140_5507 | 380 |
| 200 | 3300049743 | Ga0501081_0091307 | Ga0501081_0091307_263_1624 | 380 |
| 201 | 3300049823 | Ga0501044_0046666 | Ga0501044_0046666_2116_3483 | 380 |
| 202 | 3300053083 | Ga0495655_0000500 | Ga0495655_0000500_1172_2536 | 380 |
| 203 | 3300053085 | Ga0495619_0054246 | Ga0495619_0054246_479_1813 | 380 |
| 204 | iso_pu_bacteria | 2979793036 | 2979797775 | 380 |
| 205 | 3300049574 | Ga0501038_0004971 | Ga0501038_0004971_9389_10723 | 381 |
| 206 | 3300049579 | Ga0501043_0008300 | Ga0501043_0008300_368_1702 | 381 |
| 207 | 3300049581 | Ga0501047_0006184 | Ga0501047_0006184_3905_5278 | 381 |
| 208 | 3300049823 | Ga0501044_0076966 | Ga0501044_0076966_1053_2498 | 381 |
| 209 | 3300054114 | Ga0501084_0264739 | Ga0501084_0264739_39_1400 | 381 |
| 210 | 3300005466 | Ga0070685_10005761 | Ga0070685_100057615 | 382 |
| 211 | 3300006038 | Ga0075365_10020120 | Ga0075365_100201202 | 382 |
| 212 | 3300006038 | Ga0075365_10076154 | Ga0075365_100761542 | 382 |
| 213 | 3300006844 | Ga0075428_100075255 | Ga0075428_1000752552 | 382 |
| 214 | 3300006846 | Ga0075430_100070582 | Ga0075430_1000705822 | 382 |
| 215 | 3300006847 | Ga0075431_100014785 | Ga0075431_1000147852 | 382 |
| 216 | 3300006847 | Ga0075431_100046633 | Ga0075431_1000466334 | 382 |
| 217 | 3300031711 | Ga0265314_10060562 | Ga0265314_100605622 | 382 |
| 218 | 3300050492 | nmdc:mga0yw44_3742_c1 | nmdc:mga0yw44_3742_c1_1847_3295 | 382 |
| 219 | 3300050510 | nmdc:mga06r32_133220_c1 | nmdc:mga06r32_133220_c1_299_1747 | 382 |
| 220 | 3300050510 | nmdc:mga06r32_20818_c1 | nmdc:mga06r32_20818_c1_2082_3329 | 382 |
| 221 | 3300006028 | Ga0070717_10044234 | Ga0070717_100442342 | 383 |
| 222 | 3300037068 | Ga0373925_0046170 | Ga0373925_0046170_19_1368 | 383 |
| 223 | 3300037853 | Ga0436364_0449051 | Ga0436364_0449051_575_1912 | 383 |
| 224 | 3300048915 | Ga0496112_0310449 | Ga0496112_0310449_138_1502 | 383 |
| 225 | 3300025936 | Ga0207670_10054563 | Ga0207670_100545632 | 384 |
| 226 | 3300031852 | Ga0307410_10149936 | Ga0307410_101499361 | 384 |
| 227 | 3300037471 | Ga0395905_0121097 | Ga0395905_0121097_89_1456 | 384 |
| 228 | 3300049571 | Ga0501034_0054458 | Ga0501034_0054458_771_2114 | 384 |
| 229 | 3300049589 | Ga0501073_0005889 | Ga0501073_0005889_764_2041 | 384 |
| 230 | 3300053136 | Ga0500559_0002458 | Ga0500559_0002458_7138_8406 | 384 |
| 231 | 3300005548 | Ga0070665_100001728 | Ga0070665_10000172815 | 385 |
| 232 | 3300005843 | Ga0068860_100100105 | Ga0068860_1001001052 | 385 |
| 233 | 3300006042 | Ga0075368_10000331 | Ga0075368_1000033112 | 385 |
| 234 | 3300006051 | Ga0075364_10034422 | Ga0075364_100344222 | 385 |
| 235 | 3300006178 | Ga0075367_10067363 | Ga0075367_100673631 | 385 |
| 236 | 3300006948 | Ga0099826_10032477 | Ga0099826_100324774 | 385 |
| 237 | 3300009148 | Ga0105243_10023475 | Ga0105243_100234752 | 385 |
| 238 | 3300013102 | Ga0157371_10000071 | Ga0157371_1000007188 | 385 |
| 239 | 3300013104 | Ga0157370_10000079 | Ga0157370_1000007936 | 385 |
| 240 | 3300025294 | Ga0209025_1003984 | Ga0209025_10039843 | 385 |
| 241 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037265 | 385 |
| 242 | 3300027866 | Ga0209813_10000656 | Ga0209813_100006568 | 385 |
| 243 | 3300028379 | Ga0268266_10024962 | Ga0268266_100249626 | 385 |
| 244 | 3300030500 | Ga0268256_1000039 | Ga0268256_100003943 | 385 |
| 245 | 3300037471 | Ga0395905_0046908 | Ga0395905_0046908_1663_2931 | 385 |
| 246 | 3300046522 | Ga0495643_0035511 | Ga0495643_0035511_528_1913 | 385 |
| 247 | 3300048916 | Ga0496113_0126718 | Ga0496113_0126718_55_1440 | 385 |
| 248 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_312459_313844 | 385 |
| 249 | 3300048921 | Ga0496118_0000208 | Ga0496118_0000208_56860_58245 | 385 |
| 250 | 3300048922 | Ga0496119_0022482 | Ga0496119_0022482_2346_3737 | 385 |
| 251 | 3300048923 | Ga0496120_0000387 | Ga0496120_0000387_59990_61375 | 385 |
| 252 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_312447_313832 | 385 |
| 253 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_67204_68589 | 385 |
| 254 | 3300048927 | Ga0496124_0008477 | Ga0496124_0008477_3139_4524 | 385 |
| 255 | 3300048928 | Ga0496125_0006385 | Ga0496125_0006385_5581_6972 | 385 |
| 256 | 3300048929 | Ga0496126_0044907 | Ga0496126_0044907_2586_3971 | 385 |
| 257 | 3300050491 | nmdc:mga00v17_15_c1 | nmdc:mga00v17_15_c1_60530_61915 | 385 |
| 258 | 3300050491 | nmdc:mga00v17_72749_c1 | nmdc:mga00v17_72749_c1_138_1523 | 385 |
| 259 | 3300050492 | nmdc:mga0yw44_8062_c1 | nmdc:mga0yw44_8062_c1_677_2062 | 385 |
| 260 | 3300050494 | nmdc:mga06z11_2118_c1 | nmdc:mga06z11_2118_c1_2718_4103 | 385 |
| 261 | 3300053137 | Ga0500561_0000122 | Ga0500561_0000122_9801_11186 | 385 |
| 262 | 3300053177 | Ga0500636_0000030 | Ga0500636_0000030_8549_9934 | 385 |
| 263 | 3300053177 | Ga0500636_0002620 | Ga0500636_0002620_5553_6935 | 385 |
| 264 | 3300053730 | Ga0500645_001927 | Ga0500645_001927_8149_9429 | 385 |
| 265 | iso_pu_bacteria | 2537561587 | 2537873555 | 385 |
| 266 | iso_pu_bacteria | 2554235003 | 2554248986 | 385 |
| 267 | iso_pu_bacteria | 2558860242 | 2559296074 | 385 |
| 268 | iso_pu_bacteria | 2599185210 | 2599603133 | 385 |
| 269 | iso_pu_bacteria | 2600255279 | 2601610962 | 385 |
| 270 | iso_pu_bacteria | 2600255308 | 2601747736 | 385 |
| 271 | iso_pu_bacteria | 2643221582 | 2643921598 | 385 |
| 272 | iso_pu_bacteria | 2643221693 | 2644521652 | 385 |
| 273 | iso_pu_bacteria | 2808606387 | 2808988100 | 385 |
| 274 | iso_pu_bacteria | 2818991439 | 2819561084 | 385 |
| 275 | iso_pu_bacteria | 2838675328 | 2838678545 | 385 |
| 276 | iso_pu_bacteria | 2838714209 | 2838718367 | 385 |
| 277 | iso_pu_bacteria | 2838719591 | 2838722841 | 385 |
| 278 | iso_pu_bacteria | 2838724970 | 2838728433 | 385 |
| 279 | iso_pu_bacteria | 2841846520 | 2841850397 | 385 |
| 280 | iso_pu_bacteria | 2841859092 | 2841863350 | 385 |
| 281 | iso_pu_bacteria | 2842124991 | 2842129093 | 385 |
| 282 | iso_pu_bacteria | 2842130223 | 2842133438 | 385 |
| 283 | iso_pu_bacteria | 2842152218 | 2842155651 | 385 |
| 284 | iso_pu_bacteria | 2842170452 | 2842174391 | 385 |
| 285 | iso_pu_bacteria | 2842175837 | 2842179052 | 385 |
| 286 | iso_pu_bacteria | 2842187318 | 2842190791 | 385 |
| 287 | iso_pu_bacteria | 2842211629 | 2842214885 | 385 |
| 288 | iso_pu_bacteria | 2842224351 | 2842227606 | 385 |
| 289 | iso_pu_bacteria | 2842515876 | 2842519913 | 385 |
| 290 | iso_pu_bacteria | 2899792073 | 2899794822 | 385 |
| 291 | iso_pu_bacteria | 2899845264 | 2899849425 | 385 |
| 292 | iso_pu_bacteria | 2919114240 | 2919118376 | 385 |
| 293 | iso_pu_bacteria | 2926754445 | 2926754905 | 385 |
| 294 | iso_pu_bacteria | 2926760298 | 2926762070 | 385 |
| 295 | iso_pu_bacteria | 2933006813 | 2933010503 | 385 |
| 296 | iso_pu_bacteria | 2933011516 | 2933015825 | 385 |
| 297 | iso_pu_bacteria | 2933594066 | 2933597437 | 385 |
| 298 | iso_pu_bacteria | 2979089926 | 2979092661 | 385 |
| 299 | iso_pu_bacteria | 2979095461 | 2979099948 | 385 |
| 300 | iso_pu_bacteria | 2979100975 | 2979104633 | 385 |
| 301 | iso_pu_bacteria | 2984509177 | 2984513570 | 385 |
| 302 | iso_pu_bacteria | 2984518228 | 2984522850 | 385 |
| 303 | iso_pu_bacteria | 2984537506 | 2984542157 | 385 |
| 304 | iso_pu_bacteria | 2984601300 | 2984601586 | 385 |
| 305 | iso_pu_bacteria | 650716007 | 650741290 | 385 |
| 306 | iso_pu_bacteria | 8003570095 | 8003573648 | 385 |
| 307 | iso_pu_bacteria | 8054460903 | 8054463882 | 385 |
| 308 | 3300005331 | Ga0070670_100005245 | Ga0070670_1000052455 | 386 |
| 309 | 3300005564 | Ga0070664_100203773 | Ga0070664_1002037732 | 386 |
| 310 | 3300006178 | Ga0075367_10025996 | Ga0075367_100259962 | 386 |
| 311 | 3300006847 | Ga0075431_100026280 | Ga0075431_1000262801 | 386 |
| 312 | 3300006871 | Ga0075434_100072570 | Ga0075434_1000725702 | 386 |
| 313 | 3300007076 | Ga0075435_100070735 | Ga0075435_1000707352 | 386 |
| 314 | 3300009147 | Ga0114129_10016101 | Ga0114129_100161012 | 386 |
| 315 | 3300009147 | Ga0114129_10615199 | Ga0114129_106151991 | 386 |
| 316 | 3300013102 | Ga0157371_10089853 | Ga0157371_100898532 | 386 |
| 317 | 3300025945 | Ga0207679_10154186 | Ga0207679_101541861 | 386 |
| 318 | 3300028794 | Ga0307515_10001049 | Ga0307515_1000104935 | 386 |
| 319 | 3300031456 | Ga0307513_10059089 | Ga0307513_100590892 | 386 |
| 320 | 3300035691 | Ga0373931_0019764 | Ga0373931_0019764_1074_2408 | 386 |
| 321 | 3300046460 | Ga0495638_0015798 | Ga0495638_0015798_583_1941 | 386 |
| 322 | 3300046460 | Ga0495638_0031396 | Ga0495638_0031396_1645_2958 | 386 |
| 323 | 3300048905 | Ga0496102_0165686 | Ga0496102_0165686_43_1377 | 386 |
| 324 | 3300048906 | Ga0496103_0136186 | Ga0496103_0136186_194_1528 | 386 |
| 325 | 3300048907 | Ga0496104_0000275 | Ga0496104_0000275_43209_44504 | 386 |
| 326 | 3300048907 | Ga0496104_0008263 | Ga0496104_0008263_1324_2658 | 386 |
| 327 | 3300048908 | Ga0496105_0000973 | Ga0496105_0000973_10670_12004 | 386 |
| 328 | 3300048908 | Ga0496105_0020573 | Ga0496105_0020573_3642_4937 | 386 |
| 329 | 3300048909 | Ga0496106_0162532 | Ga0496106_0162532_201_1535 | 386 |
| 330 | 3300048910 | Ga0496107_0038551 | Ga0496107_0038551_1814_3148 | 386 |
| 331 | 3300048911 | Ga0496108_0000347 | Ga0496108_0000347_29529_30863 | 386 |
| 332 | 3300048911 | Ga0496108_0007453 | Ga0496108_0007453_7229_8524 | 386 |
| 333 | 3300048912 | Ga0496109_0017109 | Ga0496109_0017109_3792_5126 | 386 |
| 334 | 3300048912 | Ga0496109_0081778 | Ga0496109_0081778_1312_2607 | 386 |
| 335 | 3300048913 | Ga0496110_0004026 | Ga0496110_0004026_8792_10087 | 386 |
| 336 | 3300048913 | Ga0496110_0090852 | Ga0496110_0090852_1324_2658 | 386 |
| 337 | 3300048914 | Ga0496111_0010222 | Ga0496111_0010222_2315_3610 | 386 |
| 338 | 3300048914 | Ga0496111_0021085 | Ga0496111_0021085_508_1842 | 386 |
| 339 | 3300048915 | Ga0496112_0001330 | Ga0496112_0001330_15530_16825 | 386 |
| 340 | 3300048915 | Ga0496112_0219250 | Ga0496112_0219250_201_1535 | 386 |
| 341 | 3300048916 | Ga0496113_0002538 | Ga0496113_0002538_5399_6694 | 386 |
| 342 | 3300048916 | Ga0496113_0005068 | Ga0496113_0005068_3188_4522 | 386 |
| 343 | 3300049823 | Ga0501044_0187854 | Ga0501044_0187854_182_1519 | 386 |
| 344 | 3300050494 | nmdc:mga06z11_7889_c1 | nmdc:mga06z11_7889_c1_2487_3851 | 386 |
| 345 | 3300050507 | nmdc:mga05p37_137727_c1 | nmdc:mga05p37_137727_c1_1023_2357 | 386 |
| 346 | 3300050510 | nmdc:mga06r32_196912_c1 | nmdc:mga06r32_196912_c1_605_1939 | 386 |
| 347 | 3300050512 | nmdc:mga0n895_53506_c1 | nmdc:mga0n895_53506_c1_1068_2402 | 386 |
| 348 | iso_pu_bacteria | 2510461069 | 2510839177 | 386 |
| 349 | iso_pu_bacteria | 2818991272 | 2819244631 | 386 |
| 350 | 3300005468 | Ga0070707_100134428 | Ga0070707_1001344282 | 387 |
| 351 | 3300005518 | Ga0070699_100046283 | Ga0070699_1000462833 | 387 |
| 352 | 3300005937 | Ga0081455_10002140 | Ga0081455_100021404 | 387 |
| 353 | 3300005985 | Ga0081539_10007857 | Ga0081539_100078572 | 387 |
| 354 | 3300006177 | Ga0075362_10051880 | Ga0075362_100518802 | 387 |
| 355 | 3300006186 | Ga0075369_10002069 | Ga0075369_100020692 | 387 |
| 356 | 3300014325 | Ga0163163_10178779 | Ga0163163_101787792 | 387 |
| 357 | 3300026088 | Ga0207641_10147468 | Ga0207641_101474682 | 387 |
| 358 | 3300028381 | Ga0268264_10196813 | Ga0268264_101968132 | 387 |
| 359 | 3300035691 | Ga0373931_0034626 | Ga0373931_0034626_592_1881 | 387 |
| 360 | 3300036401 | Ga0373937_0102431 | Ga0373937_0102431_1130_2416 | 387 |
| 361 | 3300037418 | Ga0395900_0014386 | Ga0395900_0014386_4454_5740 | 387 |
| 362 | 3300037466 | Ga0395898_0002569 | Ga0395898_0002569_9048_10334 | 387 |
| 363 | 3300038443 | Ga0395901_0000475 | Ga0395901_0000475_21179_22465 | 387 |
| 364 | 3300038443 | Ga0395901_0020312 | Ga0395901_0020312_4472_5758 | 387 |
| 365 | 3300045051 | Ga0451576_0000056 | Ga0451576_0000056_135337_136626 | 387 |
| 366 | 3300048910 | Ga0496107_0126425 | Ga0496107_0126425_687_1850 | 387 |
| 367 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_68692_69969 | 387 |
| 368 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_68778_70055 | 387 |
| 369 | 3300049568 | Ga0501031_0036581 | Ga0501031_0036581_1063_2445 | 387 |
| 370 | 3300049569 | Ga0501032_0000070 | Ga0501032_0000070_81599_82981 | 387 |
| 371 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_595582_596964 | 387 |
| 372 | 3300049571 | Ga0501034_0000374 | Ga0501034_0000374_12045_13358 | 387 |
| 373 | 3300049571 | Ga0501034_0200342 | Ga0501034_0200342_388_1677 | 387 |
| 374 | 3300049572 | Ga0501036_0003886 | Ga0501036_0003886_5649_7031 | 387 |
| 375 | 3300049572 | Ga0501036_0068022 | Ga0501036_0068022_400_1713 | 387 |
| 376 | 3300049575 | Ga0501039_0000001 | Ga0501039_0000001_310026_311408 | 387 |
| 377 | 3300050489 | nmdc:mga03683_4054_c1 | nmdc:mga03683_4054_c1_2988_4277 | 387 |
| 378 | 3300050516 | nmdc:mga0sz30_95_c1 | nmdc:mga0sz30_95_c1_11640_12929 | 387 |
| 379 | 3300053093 | Ga0500651_0071553 | Ga0500651_0071553_542_1828 | 387 |
| 380 | 3300053096 | Ga0500641_0007870 | Ga0500641_0007870_970_2256 | 387 |
| 381 | iso_pu_bacteria | 2643221568 | 2643854826 | 387 |
| 382 | iso_pu_bacteria | 2837678835 | 2837681201 | 387 |
| 383 | iso_pu_bacteria | 2854896431 | 2854897721 | 387 |
| 384 | iso_pu_bacteria | 2889790730 | 2889791560 | 387 |
| 385 | iso_pu_bacteria | 2889914905 | 2889917305 | 387 |
| 386 | iso_pu_bacteria | 2919166419 | 2919170462 | 387 |
| 387 | iso_pu_bacteria | 2978969890 | 2978972742 | 387 |
| 388 | iso_pu_bacteria | 2984587000 | 2984590994 | 387 |
| 389 | 3300005353 | Ga0070669_100061718 | Ga0070669_1000617182 | 388 |
| 390 | 3300046463 | Ga0495653_0168944 | Ga0495653_0168944_297_1463 | 388 |
| 391 | 3300049823 | Ga0501044_0109952 | Ga0501044_0109952_1423_2724 | 388 |
| 392 | iso_pu_bacteria | 2510461076 | 2510896866 | 388 |
| 393 | iso_pu_bacteria | 2513237162 | 2514019577 | 388 |
| 394 | iso_pu_bacteria | 2738541317 | 2738947087 | 388 |
| 395 | iso_pu_bacteria | 2757320392 | 2757571003 | 388 |
| 396 | iso_pu_bacteria | 2767802442 | 2770198420 | 388 |
| 397 | iso_pu_bacteria | 2840764183 | 2840766263 | 388 |
| 398 | iso_pu_bacteria | 2842163707 | 2842166875 | 388 |
| 399 | iso_pu_bacteria | 2842871566 | 2842873867 | 388 |
| 400 | iso_pu_bacteria | 2894817345 | 2894821020 | 388 |
| 401 | iso_pu_bacteria | 2913308742 | 2913312084 | 388 |
| 402 | iso_pu_bacteria | 2928521798 | 2928522888 | 388 |
| 403 | iso_pu_bacteria | 2954011201 | 2954013746 | 388 |
| 404 | iso_pu_bacteria | 8056875544 | 8056878349 | 388 |
| 405 | 3300009545 | Ga0105237_10078198 | Ga0105237_100781982 | 389 |
| 406 | 3300013104 | Ga0157370_10151838 | Ga0157370_101518382 | 389 |
| 407 | 3300026041 | Ga0207639_10041136 | Ga0207639_100411364 | 389 |
| 408 | 3300026067 | Ga0207678_10082887 | Ga0207678_100828872 | 389 |
| 409 | 3300044712 | Ga0453684_0076521 | Ga0453684_0076521_86_1402 | 389 |
| 410 | 3300049568 | Ga0501031_0001804 | Ga0501031_0001804_4837_6126 | 389 |
| 411 | 3300049569 | Ga0501032_0000013 | Ga0501032_0000013_154047_155336 | 389 |
| 412 | 3300049570 | Ga0501033_0002577 | Ga0501033_0002577_509_1798 | 389 |
| 413 | 3300049571 | Ga0501034_0000023 | Ga0501034_0000023_227314_228603 | 389 |
| 414 | 3300049571 | Ga0501034_0097002 | Ga0501034_0097002_589_1974 | 389 |
| 415 | 3300049571 | Ga0501034_0197398 | Ga0501034_0197398_524_1927 | 389 |
| 416 | 3300049572 | Ga0501036_0000412 | Ga0501036_0000412_13595_14884 | 389 |
| 417 | 3300049573 | Ga0501037_0001208 | Ga0501037_0001208_13636_14925 | 389 |
| 418 | 3300049574 | Ga0501038_0000040 | Ga0501038_0000040_35290_36579 | 389 |
| 419 | 3300049575 | Ga0501039_0000188 | Ga0501039_0000188_13551_14840 | 389 |
| 420 | 3300049579 | Ga0501043_0000019 | Ga0501043_0000019_128942_130231 | 389 |
| 421 | 3300049580 | Ga0501046_0112901 | Ga0501046_0112901_607_1896 | 389 |
| 422 | 3300049581 | Ga0501047_0086988 | Ga0501047_0086988_412_1701 | 389 |
| 423 | 3300049742 | Ga0501080_0072218 | Ga0501080_0072218_1035_2420 | 389 |
| 424 | 3300049822 | Ga0501035_0000488 | Ga0501035_0000488_13737_15026 | 389 |
| 425 | 3300061734 | Ga0530510_0104378 | Ga0530510_0104378_667_1986 | 389 |
| 426 | iso_pu_bacteria | 2588253730 | 2588519488 | 389 |
| 427 | iso_pu_bacteria | 2773857925 | 2774871828 | 389 |
| 428 | iso_pu_bacteria | 2882456835 | 2882459054 | 389 |
| 429 | 3300003214 | JGI25165J46597_1000026 | JGI25165J46597_1000026304 | 390 |
| 430 | 3300003762 | Ga0055542_1000784 | Ga0055542_10007848 | 390 |
| 431 | 3300005539 | Ga0068853_100020993 | Ga0068853_1000209932 | 390 |
| 432 | 3300005985 | Ga0081539_10005263 | Ga0081539_100052637 | 390 |
| 433 | 3300006038 | Ga0075365_10016899 | Ga0075365_100168992 | 390 |
| 434 | 3300006038 | Ga0075365_10034079 | Ga0075365_100340792 | 390 |
| 435 | 3300006042 | Ga0075368_10011055 | Ga0075368_100110552 | 390 |
| 436 | 3300006177 | Ga0075362_10005316 | Ga0075362_100053162 | 390 |
| 437 | 3300009093 | Ga0105240_10373984 | Ga0105240_103739842 | 390 |
| 438 | 3300009545 | Ga0105237_10016432 | Ga0105237_100164327 | 390 |
| 439 | 3300009551 | Ga0105238_10001556 | Ga0105238_100015562 | 390 |
| 440 | 3300010375 | Ga0105239_10023787 | Ga0105239_100237872 | 390 |
| 441 | 3300010375 | Ga0105239_10030728 | Ga0105239_100307286 | 390 |
| 442 | 3300010375 | Ga0105239_10164534 | Ga0105239_101645342 | 390 |
| 443 | 3300014497 | Ga0182008_10041680 | Ga0182008_100416802 | 390 |
| 444 | 3300025250 | Ga0209026_1000032 | Ga0209026_1000032217 | 390 |
| 445 | 3300025254 | Ga0209148_1000094 | Ga0209148_1000094172 | 390 |
| 446 | 3300025256 | Ga0209759_1000654 | Ga0209759_10006545 | 390 |
| 447 | 3300025261 | Ga0209233_1000030 | Ga0209233_100003094 | 390 |
| 448 | 3300025272 | Ga0209455_1000113 | Ga0209455_1000113112 | 390 |
| 449 | 3300025913 | Ga0207695_10148807 | Ga0207695_101488072 | 390 |
| 450 | 3300025914 | Ga0207671_10021515 | Ga0207671_100215155 | 390 |
| 451 | 3300025919 | Ga0207657_10200094 | Ga0207657_102000941 | 390 |
| 452 | 3300026089 | Ga0207648_10231485 | Ga0207648_102314851 | 390 |
| 453 | 3300035118 | Ga0373954_0004165 | Ga0373954_0004165_4438_5826 | 390 |
| 454 | 3300035119 | Ga0373956_0054032 | Ga0373956_0054032_69_1457 | 390 |
| 455 | 3300035172 | Ga0373955_0007731 | Ga0373955_0007731_3201_4589 | 390 |
| 456 | 3300035410 | Ga0373924_0016492 | Ga0373924_0016492_253_1641 | 390 |
| 457 | 3300035695 | Ga0373927_0034462 | Ga0373927_0034462_148_1536 | 390 |
| 458 | 3300035724 | Ga0373933_0004956 | Ga0373933_0004956_4310_5698 | 390 |
| 459 | 3300036401 | Ga0373937_0020608 | Ga0373937_0020608_1777_3165 | 390 |
| 460 | 3300037471 | Ga0395905_0024499 | Ga0395905_0024499_3610_4992 | 390 |
| 461 | 3300046459 | Ga0495629_0000484 | Ga0495629_0000484_29433_30821 | 390 |
| 462 | 3300046462 | Ga0495651_0000479 | Ga0495651_0000479_5230_6618 | 390 |
| 463 | 3300046463 | Ga0495653_0000553 | Ga0495653_0000553_6156_7544 | 390 |
| 464 | 3300046477 | Ga0495664_0084220 | Ga0495664_0084220_107_1495 | 390 |
| 465 | 3300046514 | Ga0495618_0002265 | Ga0495618_0002265_1638_3026 | 390 |
| 466 | 3300046516 | Ga0495628_0075631 | Ga0495628_0075631_871_2259 | 390 |
| 467 | 3300046522 | Ga0495643_0015371 | Ga0495643_0015371_2306_3691 | 390 |
| 468 | 3300046529 | Ga0495652_0006322 | Ga0495652_0006322_4741_6129 | 390 |
| 469 | 3300046533 | Ga0495640_0003693 | Ga0495640_0003693_2697_4085 | 390 |
| 470 | 3300046559 | Ga0495667_0000938 | Ga0495667_0000938_1641_3029 | 390 |
| 471 | 3300046616 | Ga0495668_0024894 | Ga0495668_0024894_57_1451 | 390 |
| 472 | 3300046642 | Ga0495634_0011861 | Ga0495634_0011861_3045_4433 | 390 |
| 473 | 3300046660 | Ga0495625_0030895 | Ga0495625_0030895_253_1638 | 390 |
| 474 | 3300046663 | Ga0495635_0058726 | Ga0495635_0058726_850_2238 | 390 |
| 475 | 3300046678 | Ga0495599_0035426 | Ga0495599_0035426_797_2185 | 390 |
| 476 | 3300046680 | Ga0495646_0003324 | Ga0495646_0003324_344_1732 | 390 |
| 477 | 3300046809 | Ga0495600_0043215 | Ga0495600_0043215_1510_2898 | 390 |
| 478 | 3300047315 | Ga0495581_0071665 | Ga0495581_0071665_302_1690 | 390 |
| 479 | 3300047317 | Ga0495604_0001116 | Ga0495604_0001116_17384_18772 | 390 |
| 480 | 3300047319 | Ga0495674_0012447 | Ga0495674_0012447_2032_3420 | 390 |
| 481 | 3300047444 | Ga0495675_0020203 | Ga0495675_0020203_25_1413 | 390 |
| 482 | 3300047471 | Ga0495684_0008513 | Ga0495684_0008513_6089_7477 | 390 |
| 483 | 3300047673 | Ga0495593_0033876 | Ga0495593_0033876_998_2386 | 390 |
| 484 | 3300048088 | Ga0495602_0002877 | Ga0495602_0002877_4229_5617 | 390 |
| 485 | 3300048922 | Ga0496119_0026171 | Ga0496119_0026171_942_2330 | 390 |
| 486 | 3300048923 | Ga0496120_0001163 | Ga0496120_0001163_10428_11804 | 390 |
| 487 | 3300048924 | Ga0496121_0151061 | Ga0496121_0151061_161_1651 | 390 |
| 488 | 3300049569 | Ga0501032_0000006 | Ga0501032_0000006_186043_187401 | 390 |
| 489 | 3300049570 | Ga0501033_0000039 | Ga0501033_0000039_74327_75685 | 390 |
| 490 | 3300049570 | Ga0501033_0000293 | Ga0501033_0000293_30069_31454 | 390 |
| 491 | 3300049570 | Ga0501033_0003047 | Ga0501033_0003047_3463_4755 | 390 |
| 492 | 3300049571 | Ga0501034_0000030 | Ga0501034_0000030_47729_49087 | 390 |
| 493 | 3300049571 | Ga0501034_0000702 | Ga0501034_0000702_16165_17490 | 390 |
| 494 | 3300049571 | Ga0501034_0024527 | Ga0501034_0024527_4743_6113 | 390 |
| 495 | 3300049571 | Ga0501034_0071493 | Ga0501034_0071493_1778_3070 | 390 |
| 496 | 3300049571 | Ga0501034_0124406 | Ga0501034_0124406_1125_2483 | 390 |
| 497 | 3300049572 | Ga0501036_0000003 | Ga0501036_0000003_74327_75685 | 390 |
| 498 | 3300049573 | Ga0501037_0000003 | Ga0501037_0000003_74327_75685 | 390 |
| 499 | 3300049573 | Ga0501037_0000007 | Ga0501037_0000007_28596_29981 | 390 |
| 500 | 3300049574 | Ga0501038_0000004 | Ga0501038_0000004_74327_75685 | 390 |
| 501 | 3300049574 | Ga0501038_0060712 | Ga0501038_0060712_519_1811 | 390 |
| 502 | 3300049574 | Ga0501038_0160557 | Ga0501038_0160557_498_1775 | 390 |
| 503 | 3300049575 | Ga0501039_0000008 | Ga0501039_0000008_74327_75685 | 390 |
| 504 | 3300049576 | Ga0501040_0004945 | Ga0501040_0004945_1450_2808 | 390 |
| 505 | 3300049578 | Ga0501042_0039402 | Ga0501042_0039402_755_2113 | 390 |
| 506 | 3300049578 | Ga0501042_0092954 | Ga0501042_0092954_159_1481 | 390 |
| 507 | 3300049579 | Ga0501043_0000034 | Ga0501043_0000034_60411_61796 | 390 |
| 508 | 3300049579 | Ga0501043_0000177 | Ga0501043_0000177_16499_17857 | 390 |
| 509 | 3300049579 | Ga0501043_0031291 | Ga0501043_0031291_1884_3176 | 390 |
| 510 | 3300049581 | Ga0501047_0004025 | Ga0501047_0004025_916_2208 | 390 |
| 511 | 3300049581 | Ga0501047_0007110 | Ga0501047_0007110_4122_5480 | 390 |
| 512 | 3300049581 | Ga0501047_0049215 | Ga0501047_0049215_1684_2961 | 390 |
| 513 | 3300049584 | Ga0501068_0040570 | Ga0501068_0040570_1190_2548 | 390 |
| 514 | 3300049585 | Ga0501069_0000017 | Ga0501069_0000017_116376_117761 | 390 |
| 515 | 3300049586 | Ga0501070_0000275 | Ga0501070_0000275_32424_33716 | 390 |
| 516 | 3300049586 | Ga0501070_0001269 | Ga0501070_0001269_8161_9546 | 390 |
| 517 | 3300049586 | Ga0501070_0015276 | Ga0501070_0015276_193_1551 | 390 |
| 518 | 3300049587 | Ga0501071_0003548 | Ga0501071_0003548_4087_5472 | 390 |
| 519 | 3300049590 | Ga0501074_0000060 | Ga0501074_0000060_22730_24115 | 390 |
| 520 | 3300049590 | Ga0501074_0034900 | Ga0501074_0034900_1394_2686 | 390 |
| 521 | 3300049742 | Ga0501080_0001013 | Ga0501080_0001013_19084_20469 | 390 |
| 522 | 3300049742 | Ga0501080_0013088 | Ga0501080_0013088_4897_6189 | 390 |
| 523 | 3300049742 | Ga0501080_0145684 | Ga0501080_0145684_507_1784 | 390 |
| 524 | 3300049744 | Ga0501083_0000511 | Ga0501083_0000511_19934_21319 | 390 |
| 525 | 3300049822 | Ga0501035_0000112 | Ga0501035_0000112_23454_24812 | 390 |
| 526 | 3300049822 | Ga0501035_0000159 | Ga0501035_0000159_50684_52069 | 390 |
| 527 | 3300049822 | Ga0501035_0000772 | Ga0501035_0000772_2966_4243 | 390 |
| 528 | 3300049822 | Ga0501035_0004717 | Ga0501035_0004717_881_2266 | 390 |
| 529 | 3300049822 | Ga0501035_0073609 | Ga0501035_0073609_471_1805 | 390 |
| 530 | 3300049823 | Ga0501044_0000008 | Ga0501044_0000008_74327_75685 | 390 |
| 531 | 3300049823 | Ga0501044_0000010 | Ga0501044_0000010_71929_73314 | 390 |
| 532 | 3300049823 | Ga0501044_0012445 | Ga0501044_0012445_1360_2652 | 390 |
| 533 | 3300049823 | Ga0501044_0211777 | Ga0501044_0211777_143_1528 | 390 |
| 534 | 3300050492 | nmdc:mga0yw44_22295_c1 | nmdc:mga0yw44_22295_c1_285_1688 | 390 |
| 535 | 3300053077 | Ga0495601_0004823 | Ga0495601_0004823_4676_6064 | 390 |
| 536 | 3300053078 | Ga0495612_0004190 | Ga0495612_0004190_2088_3476 | 390 |
| 537 | 3300053084 | Ga0495595_0002943 | Ga0495595_0002943_2459_3847 | 390 |
| 538 | 3300053085 | Ga0495619_0000426 | Ga0495619_0000426_4230_5618 | 390 |
| 539 | 3300053087 | Ga0500643_007497 | Ga0500643_007497_2140_3537 | 390 |
| 540 | 3300053139 | Ga0500568_0000188 | Ga0500568_0000188_8118_9452 | 390 |
| 541 | 3300053155 | Ga0500620_000445 | Ga0500620_000445_3159_4493 | 390 |
| 542 | 3300060353 | Ga0501082_0053623 | Ga0501082_0053623_755_2140 | 390 |
| 543 | 3300061734 | Ga0530510_0014732 | Ga0530510_0014732_2803_4125 | 390 |
| 544 | iso_pu_bacteria | 2503198000 | 2503199190 | 390 |
| 545 | iso_pu_bacteria | 2508501050 | 2508734760 | 390 |
| 546 | iso_pu_bacteria | 2509276018 | 2509371691 | 390 |
| 547 | iso_pu_bacteria | 2509276022 | 2509394127 | 390 |
| 548 | iso_pu_bacteria | 2510065059 | 2510318179 | 390 |
| 549 | iso_pu_bacteria | 2512875016 | 2512933416 | 390 |
| 550 | iso_pu_bacteria | 2512875024 | 2512961534 | 390 |
| 551 | iso_pu_bacteria | 2513237090 | 2513610494 | 390 |
| 552 | iso_pu_bacteria | 2513237164 | 2514036819 | 390 |
| 553 | iso_pu_bacteria | 2513237305 | 2514423226 | 390 |
| 554 | iso_pu_bacteria | 2513237351 | 2514586797 | 390 |
| 555 | iso_pu_bacteria | 2597489875 | 2597811757 | 390 |
| 556 | iso_pu_bacteria | 2643221550 | 2643771955 | 390 |
| 557 | iso_pu_bacteria | 2643221551 | 2643777040 | 390 |
| 558 | iso_pu_bacteria | 2643221555 | 2643795488 | 390 |
| 559 | iso_pu_bacteria | 2643221595 | 2643988360 | 390 |
| 560 | iso_pu_bacteria | 2643221623 | 2644131469 | 390 |
| 561 | iso_pu_bacteria | 2643221627 | 2644154723 | 390 |
| 562 | iso_pu_bacteria | 2671180139 | 2671693661 | 390 |
| 563 | iso_pu_bacteria | 2687453392 | 2688596473 | 390 |
| 564 | iso_pu_bacteria | 2693429783 | 2694630077 | 390 |
| 565 | iso_pu_bacteria | 2693429784 | 2694635667 | 390 |
| 566 | iso_pu_bacteria | 2721755686 | 2723573573 | 390 |
| 567 | iso_pu_bacteria | 2738543024 | 2739306150 | 390 |
| 568 | iso_pu_bacteria | 2756170246 | 2756673858 | 390 |
| 569 | iso_pu_bacteria | 2775506901 | 2776257620 | 390 |
| 570 | iso_pu_bacteria | 2791355123 | 2792747730 | 390 |
| 571 | iso_pu_bacteria | 2829745981 | 2829750308 | 390 |
| 572 | iso_pu_bacteria | 2841734538 | 2841736894 | 390 |
| 573 | iso_pu_bacteria | 2844002411 | 2844002963 | 390 |
| 574 | iso_pu_bacteria | 2844009547 | 2844011298 | 390 |
| 575 | iso_pu_bacteria | 2847670302 | 2847673884 | 390 |
| 576 | iso_pu_bacteria | 2847686936 | 2847690370 | 390 |
| 577 | iso_pu_bacteria | 2856314179 | 2856320465 | 390 |
| 578 | iso_pu_bacteria | 2856320880 | 2856327330 | 390 |
| 579 | iso_pu_bacteria | 2856328259 | 2856328382 | 390 |
| 580 | iso_pu_bacteria | 2856334872 | 2856337735 | 390 |
| 581 | iso_pu_bacteria | 2856342000 | 2856345313 | 390 |
| 582 | iso_pu_bacteria | 2856349417 | 2856354248 | 390 |
| 583 | iso_pu_bacteria | 2856356410 | 2856362882 | 390 |
| 584 | iso_pu_bacteria | 2856364286 | 2856367574 | 390 |
| 585 | iso_pu_bacteria | 2857349434 | 2857353395 | 390 |
| 586 | iso_pu_bacteria | 2857367948 | 2857368051 | 390 |
| 587 | iso_pu_bacteria | 2869162929 | 2869165915 | 390 |
| 588 | iso_pu_bacteria | 2869169390 | 2869170392 | 390 |
| 589 | iso_pu_bacteria | 2869234852 | 2869235664 | 390 |
| 590 | iso_pu_bacteria | 2869242130 | 2869244589 | 390 |
| 591 | iso_pu_bacteria | 2869249662 | 2869254045 | 390 |
| 592 | iso_pu_bacteria | 2869256925 | 2869257205 | 390 |
| 593 | iso_pu_bacteria | 2869264136 | 2869266386 | 390 |
| 594 | iso_pu_bacteria | 2869271264 | 2869275866 | 390 |
| 595 | iso_pu_bacteria | 2869278585 | 2869280562 | 390 |
| 596 | iso_pu_bacteria | 2869285874 | 2869288640 | 390 |
| 597 | iso_pu_bacteria | 2871429161 | 2871430130 | 390 |
| 598 | iso_pu_bacteria | 2871435913 | 2871438144 | 390 |
| 599 | iso_pu_bacteria | 2871444079 | 2871450427 | 390 |
| 600 | iso_pu_bacteria | 2871451962 | 2871457264 | 390 |
| 601 | iso_pu_bacteria | 2871459585 | 2871464366 | 390 |
| 602 | iso_pu_bacteria | 2871466892 | 2871471171 | 390 |
| 603 | iso_pu_bacteria | 2871474448 | 2871477110 | 390 |
| 604 | iso_pu_bacteria | 2871481445 | 2871483457 | 390 |
| 605 | iso_pu_bacteria | 2871488783 | 2871494784 | 390 |
| 606 | iso_pu_bacteria | 2871495908 | 2871501087 | 390 |
| 607 | iso_pu_bacteria | 2874102143 | 2874102737 | 390 |
| 608 | iso_pu_bacteria | 2874116593 | 2874119684 | 390 |
| 609 | iso_pu_bacteria | 2874123672 | 2874130210 | 390 |
| 610 | iso_pu_bacteria | 2874131515 | 2874133365 | 390 |
| 611 | iso_pu_bacteria | 2874139085 | 2874140001 | 390 |
| 612 | iso_pu_bacteria | 2874146452 | 2874150768 | 390 |
| 613 | iso_pu_bacteria | 2874155637 | 2874158410 | 390 |
| 614 | iso_pu_bacteria | 2874162495 | 2874165454 | 390 |
| 615 | iso_pu_bacteria | 2874168670 | 2874176688 | 390 |
| 616 | iso_pu_bacteria | 2876363079 | 2876364330 | 390 |
| 617 | iso_pu_bacteria | 2876369609 | 2876377148 | 390 |
| 618 | iso_pu_bacteria | 2876377896 | 2876381367 | 390 |
| 619 | iso_pu_bacteria | 2876386047 | 2876390150 | 390 |
| 620 | iso_pu_bacteria | 2876399893 | 2876402268 | 390 |
| 621 | iso_pu_bacteria | 2876406927 | 2876410173 | 390 |
| 622 | iso_pu_bacteria | 2876413966 | 2876416804 | 390 |
| 623 | iso_pu_bacteria | 2876420981 | 2876423522 | 390 |
| 624 | iso_pu_bacteria | 2878035449 | 2878038880 | 390 |
| 625 | iso_pu_bacteria | 2878738818 | 2878741970 | 390 |
| 626 | iso_pu_bacteria | 2878745973 | 2878748674 | 390 |
| 627 | iso_pu_bacteria | 2878753008 | 2878759918 | 390 |
| 628 | iso_pu_bacteria | 2878760144 | 2878765101 | 390 |
| 629 | iso_pu_bacteria | 2878767105 | 2878772273 | 390 |
| 630 | iso_pu_bacteria | 2878774303 | 2878777732 | 390 |
| 631 | iso_pu_bacteria | 2878781027 | 2878786812 | 390 |
| 632 | iso_pu_bacteria | 2881147464 | 2881148671 | 390 |
| 633 | iso_pu_bacteria | 2881155292 | 2881159752 | 390 |
| 634 | iso_pu_bacteria | 2881161766 | 2881165453 | 390 |
| 635 | iso_pu_bacteria | 2881845957 | 2881848509 | 390 |
| 636 | iso_pu_bacteria | 2881853255 | 2881853540 | 390 |
| 637 | iso_pu_bacteria | 2881861095 | 2881861258 | 390 |
| 638 | iso_pu_bacteria | 2882632389 | 2882640217 | 390 |
| 639 | iso_pu_bacteria | 2882912400 | 2882919193 | 390 |
| 640 | iso_pu_bacteria | 2885305155 | 2885307308 | 390 |
| 641 | iso_pu_bacteria | 2885312484 | 2885313648 | 390 |
| 642 | iso_pu_bacteria | 2885318864 | 2885323177 | 390 |
| 643 | iso_pu_bacteria | 2885326080 | 2885327761 | 390 |
| 644 | iso_pu_bacteria | 2885334103 | 2885335297 | 390 |
| 645 | iso_pu_bacteria | 2885342637 | 2885346091 | 390 |
| 646 | iso_pu_bacteria | 2885350715 | 2885352536 | 390 |
| 647 | iso_pu_bacteria | 2888337043 | 2888337148 | 390 |
| 648 | iso_pu_bacteria | 2888343758 | 2888344862 | 390 |
| 649 | iso_pu_bacteria | 2888350351 | 2888353656 | 390 |
| 650 | iso_pu_bacteria | 2889010040 | 2889015383 | 390 |
| 651 | iso_pu_bacteria | 2889016732 | 2889019547 | 390 |
| 652 | iso_pu_bacteria | 2894232714 | 2894234221 | 390 |
| 653 | iso_pu_bacteria | 2903448605 | 2903455147 | 390 |
| 654 | iso_pu_bacteria | 2903492973 | 2903494142 | 390 |
| 655 | iso_pu_bacteria | 2903492973 | 2903504345 | 390 |
| 656 | iso_pu_bacteria | 2903521522 | 2903523903 | 390 |
| 657 | iso_pu_bacteria | 2903528002 | 2903530402 | 390 |
| 658 | iso_pu_bacteria | 2903540706 | 2903545903 | 390 |
| 659 | iso_pu_bacteria | 2906308376 | 2906311081 | 390 |
| 660 | iso_pu_bacteria | 2906321335 | 2906324856 | 390 |
| 661 | iso_pu_bacteria | 2906328253 | 2906333768 | 390 |
| 662 | iso_pu_bacteria | 2906354277 | 2906355756 | 390 |
| 663 | iso_pu_bacteria | 2906363423 | 2906367554 | 390 |
| 664 | iso_pu_bacteria | 2906370794 | 2906377613 | 390 |
| 665 | iso_pu_bacteria | 2906378014 | 2906380240 | 390 |
| 666 | iso_pu_bacteria | 2906386501 | 2906392189 | 390 |
| 667 | iso_pu_bacteria | 2906393657 | 2906399245 | 390 |
| 668 | iso_pu_bacteria | 2906401398 | 2906402664 | 390 |
| 669 | iso_pu_bacteria | 2906408224 | 2906410118 | 390 |
| 670 | iso_pu_bacteria | 2906414383 | 2906421244 | 390 |
| 671 | iso_pu_bacteria | 2922151315 | 2922153381 | 390 |
| 672 | iso_pu_bacteria | 2922158528 | 2922161154 | 390 |
| 673 | iso_pu_bacteria | 2922172374 | 2922173539 | 390 |
| 674 | iso_pu_bacteria | 2922178524 | 2922185490 | 390 |
| 675 | iso_pu_bacteria | 2922185730 | 2922189345 | 390 |
| 676 | iso_pu_bacteria | 2924710171 | 2924717313 | 390 |
| 677 | iso_pu_bacteria | 2924718760 | 2924723459 | 390 |
| 678 | iso_pu_bacteria | 2924726620 | 2924730470 | 390 |
| 679 | iso_pu_bacteria | 2924733363 | 2924734435 | 390 |
| 680 | iso_pu_bacteria | 2924741084 | 2924746420 | 390 |
| 681 | iso_pu_bacteria | 2924748358 | 2924749288 | 390 |
| 682 | iso_pu_bacteria | 2924762789 | 2924765432 | 390 |
| 683 | iso_pu_bacteria | 2924776078 | 2924779654 | 390 |
| 684 | iso_pu_bacteria | 2924784321 | 2924790721 | 390 |
| 685 | iso_pu_bacteria | 2937813078 | 2937816413 | 390 |
| 686 | iso_pu_bacteria | 2937822353 | 2937825416 | 390 |
| 687 | iso_pu_bacteria | 2937836603 | 2937841256 | 390 |
| 688 | iso_pu_bacteria | 2937843397 | 2937848564 | 390 |
| 689 | iso_pu_bacteria | 2937848649 | 2937852792 | 390 |
| 690 | iso_pu_bacteria | 2937861824 | 2937863995 | 390 |
| 691 | iso_pu_bacteria | 2937868953 | 2937874638 | 390 |
| 692 | iso_pu_bacteria | 2937877337 | 2937878146 | 390 |
| 693 | iso_pu_bacteria | 2937972304 | 2937972946 | 390 |
| 694 | iso_pu_bacteria | 2937980651 | 2937987659 | 390 |
| 695 | iso_pu_bacteria | 2937994558 | 2937999756 | 390 |
| 696 | iso_pu_bacteria | 2938014810 | 2938019750 | 390 |
| 697 | iso_pu_bacteria | 2958034702 | 2958036434 | 390 |
| 698 | iso_pu_bacteria | 2958041894 | 2958046157 | 390 |
| 699 | iso_pu_bacteria | 2958071322 | 2958073170 | 390 |
| 700 | iso_pu_bacteria | 2958084443 | 2958085260 | 390 |
| 701 | iso_pu_bacteria | 2958092219 | 2958098021 | 390 |
| 702 | iso_pu_bacteria | 2958100919 | 2958102770 | 390 |
| 703 | iso_pu_bacteria | 2958108152 | 2958112873 | 390 |
| 704 | iso_pu_bacteria | 2958115193 | 2958120543 | 390 |
| 705 | iso_pu_bacteria | 2958122699 | 2958123038 | 390 |
| 706 | iso_pu_bacteria | 2958130278 | 2958133039 | 390 |
| 707 | iso_pu_bacteria | 2958137437 | 2958141622 | 390 |
| 708 | iso_pu_bacteria | 2958158011 | 2958161867 | 390 |
| 709 | iso_pu_bacteria | 2958165035 | 2958170224 | 390 |
| 710 | iso_pu_bacteria | 2958172287 | 2958177755 | 390 |
| 711 | iso_pu_bacteria | 2958179912 | 2958182743 | 390 |
| 712 | iso_pu_bacteria | 2961077736 | 2961080590 | 390 |
| 713 | iso_pu_bacteria | 2961127735 | 2961133534 | 390 |
| 714 | iso_pu_bacteria | 2961136820 | 2961139740 | 390 |
| 715 | iso_pu_bacteria | 2961163497 | 2961168675 | 390 |
| 716 | iso_pu_bacteria | 2961170736 | 2961177190 | 390 |
| 717 | iso_pu_bacteria | 2961183825 | 2961188021 | 390 |
| 718 | iso_pu_bacteria | 2963644680 | 2963645788 | 390 |
| 719 | iso_pu_bacteria | 2965018300 | 2965023487 | 390 |
| 720 | iso_pu_bacteria | 2965025482 | 2965030916 | 390 |
| 721 | iso_pu_bacteria | 2965032056 | 2965037332 | 390 |
| 722 | iso_pu_bacteria | 2965040258 | 2965042503 | 390 |
| 723 | iso_pu_bacteria | 2965047637 | 2965049578 | 390 |
| 724 | iso_pu_bacteria | 2965089291 | 2965093686 | 390 |
| 725 | iso_pu_bacteria | 2965102966 | 2965108542 | 390 |
| 726 | iso_pu_bacteria | 2965110997 | 2965115051 | 390 |
| 727 | iso_pu_bacteria | 2965119406 | 2965124316 | 390 |
| 728 | iso_pu_bacteria | 2967996073 | 2968002280 | 390 |
| 729 | iso_pu_bacteria | 2968003550 | 2968009514 | 390 |
| 730 | iso_pu_bacteria | 2968016561 | 2968023440 | 390 |
| 731 | iso_pu_bacteria | 2968083720 | 2968089295 | 390 |
| 732 | iso_pu_bacteria | 2968091066 | 2968094286 | 390 |
| 733 | iso_pu_bacteria | 2968097103 | 2968100958 | 390 |
| 734 | iso_pu_bacteria | 2968117919 | 2968122198 | 390 |
| 735 | iso_pu_bacteria | 2968128360 | 2968133229 | 390 |
| 736 | iso_pu_bacteria | 2968138860 | 2968143333 | 390 |
| 737 | iso_pu_bacteria | 2968171901 | 2968177087 | 390 |
| 738 | iso_pu_bacteria | 2970469710 | 2970476022 | 390 |
| 739 | iso_pu_bacteria | 2970489779 | 2970493708 | 390 |
| 740 | iso_pu_bacteria | 2970503327 | 2970509864 | 390 |
| 741 | iso_pu_bacteria | 2970510686 | 2970516240 | 390 |
| 742 | iso_pu_bacteria | 2970524798 | 2970526586 | 390 |
| 743 | iso_pu_bacteria | 2970540015 | 2970544713 | 390 |
| 744 | iso_pu_bacteria | 2970547951 | 2970550224 | 390 |
| 745 | iso_pu_bacteria | 2970554993 | 2970559947 | 390 |
| 746 | iso_pu_bacteria | 2970593180 | 2970595284 | 390 |
| 747 | iso_pu_bacteria | 2970619444 | 2970626507 | 390 |
| 748 | iso_pu_bacteria | 2970627176 | 2970628764 | 390 |
| 749 | iso_pu_bacteria | 2977821940 | 2977828440 | 390 |
| 750 | iso_pu_bacteria | 2977828996 | 2977829960 | 390 |
| 751 | iso_pu_bacteria | 2977843712 | 2977846835 | 390 |
| 752 | iso_pu_bacteria | 2977851361 | 2977852259 | 390 |
| 753 | iso_pu_bacteria | 2977858184 | 2977863112 | 390 |
| 754 | iso_pu_bacteria | 2977864932 | 2977869800 | 390 |
| 755 | iso_pu_bacteria | 2977872689 | 2977878352 | 390 |
| 756 | iso_pu_bacteria | 2977898635 | 2977902265 | 390 |
| 757 | iso_pu_bacteria | 2977907340 | 2977913014 | 390 |
| 758 | iso_pu_bacteria | 2977915119 | 2977922687 | 390 |
| 759 | iso_pu_bacteria | 2977922695 | 2977926345 | 390 |
| 760 | iso_pu_bacteria | 2977935797 | 2977941767 | 390 |
| 761 | iso_pu_bacteria | 2977942078 | 2977942268 | 390 |
| 762 | iso_pu_bacteria | 2977950692 | 2977957310 | 390 |
| 763 | iso_pu_bacteria | 2977957713 | 2977962710 | 390 |
| 764 | iso_pu_bacteria | 2977971508 | 2977976579 | 390 |
| 765 | iso_pu_bacteria | 2977986579 | 2977989713 | 390 |
| 766 | iso_pu_bacteria | 2979710463 | 2979714218 | 390 |
| 767 | iso_pu_bacteria | 2979779861 | 2979786024 | 390 |
| 768 | iso_pu_bacteria | 2979808191 | 2979814740 | 390 |
| 769 | iso_pu_bacteria | 2987636660 | 2987641989 | 390 |
| 770 | iso_pu_bacteria | 2987645492 | 2987646239 | 390 |
| 771 | iso_pu_bacteria | 2987652177 | 2987653397 | 390 |
| 772 | iso_pu_bacteria | 2987659509 | 2987664704 | 390 |
| 773 | iso_pu_bacteria | 2987666974 | 2987669776 | 390 |
| 774 | iso_pu_bacteria | 2987673487 | 2987673835 | 390 |
| 775 | iso_pu_bacteria | 2996336353 | 2996339624 | 390 |
| 776 | iso_pu_bacteria | 2996341866 | 2996347766 | 390 |
| 777 | iso_pu_bacteria | 2996348954 | 2996354604 | 390 |
| 778 | iso_pu_bacteria | 2996386984 | 2996387748 | 390 |
| 779 | iso_pu_bacteria | 3000135777 | 3000137866 | 390 |
| 780 | iso_pu_bacteria | 3003665799 | 3003670225 | 390 |
| 781 | iso_pu_bacteria | 3004167301 | 3004173810 | 390 |
| 782 | iso_pu_bacteria | 3004188549 | 3004193759 | 390 |
| 783 | iso_pu_bacteria | 3004203850 | 3004209200 | 390 |
| 784 | iso_pu_bacteria | 3004211236 | 3004218223 | 390 |
| 785 | iso_pu_bacteria | 3004218560 | 3004222825 | 390 |
| 786 | iso_pu_bacteria | 3004232784 | 3004239301 | 390 |
| 787 | iso_pu_bacteria | 3004248173 | 3004251484 | 390 |
| 788 | iso_pu_bacteria | 3004268573 | 3004269069 | 390 |
| 789 | iso_pu_bacteria | 3004275668 | 3004281252 | 390 |
| 790 | iso_pu_bacteria | 637000159 | 637076517 | 390 |
| 791 | iso_pu_bacteria | 649633066 | 649871024 | 390 |
| 792 | iso_pu_bacteria | 8002285264 | 8002290683 | 390 |
| 793 | iso_pu_bacteria | 8004300914 | 8004306696 | 390 |
| 794 | iso_pu_bacteria | 8004312739 | 8004320357 | 390 |
| 795 | iso_pu_bacteria | 8004361976 | 8004365475 | 390 |
| 796 | iso_pu_bacteria | 8004374579 | 8004381416 | 390 |
| 797 | iso_pu_bacteria | 8004387939 | 8004390721 | 390 |
| 798 | iso_pu_bacteria | 8004395343 | 8004399519 | 390 |
| 799 | iso_pu_bacteria | 8004445564 | 8004446889 | 390 |
| 800 | iso_pu_bacteria | 8004633249 | 8004639636 | 390 |
| 801 | iso_pu_bacteria | 8004640170 | 8004646355 | 390 |
| 802 | iso_pu_bacteria | 8004695233 | 8004701085 | 390 |
| 803 | iso_pu_bacteria | 8004703790 | 8004706299 | 390 |
| 804 | iso_pu_bacteria | 8004714634 | 8004717300 | 390 |
| 805 | iso_pu_bacteria | 8004727605 | 8004728129 | 390 |
| 806 | iso_pu_bacteria | 8055617313 | 8055618415 | 390 |
| 807 | 3300003578 | Ga0006562J51391_1004036 | Ga0006562J51391_10040362 | 391 |
| 808 | 3300005981 | Ga0081538_10002581 | Ga0081538_100025814 | 391 |
| 809 | 3300009148 | Ga0105243_10129958 | Ga0105243_101299582 | 391 |
| 810 | 3300028577 | Ga0265318_10010410 | Ga0265318_100104102 | 391 |
| 811 | 3300031241 | Ga0265325_10007899 | Ga0265325_100078992 | 391 |
| 812 | 3300031241 | Ga0265325_10029443 | Ga0265325_100294432 | 391 |
| 813 | 3300031247 | Ga0265340_10019396 | Ga0265340_100193964 | 391 |
| 814 | 3300031247 | Ga0265340_10075488 | Ga0265340_100754881 | 391 |
| 815 | 3300031344 | Ga0265316_10048681 | Ga0265316_100486812 | 391 |
| 816 | 3300031595 | Ga0265313_10010693 | Ga0265313_100106934 | 391 |
| 817 | 3300031616 | Ga0307508_10007178 | Ga0307508_100071783 | 391 |
| 818 | 3300031711 | Ga0265314_10008661 | Ga0265314_100086613 | 391 |
| 819 | 3300031712 | Ga0265342_10009968 | Ga0265342_100099683 | 391 |
| 820 | 3300031712 | Ga0265342_10015647 | Ga0265342_100156474 | 391 |
| 821 | 3300031712 | Ga0265342_10026071 | Ga0265342_100260711 | 391 |
| 822 | 3300049571 | Ga0501034_0035055 | Ga0501034_0035055_1017_2339 | 391 |
| 823 | 3300049742 | Ga0501080_0052234 | Ga0501080_0052234_1241_2563 | 391 |
| 824 | 3300054114 | Ga0501084_0245700 | Ga0501084_0245700_162_1433 | 391 |
| 825 | iso_pu_bacteria | 2508501123 | 2509117249 | 391 |
| 826 | iso_pu_bacteria | 2534681786 | 2535485872 | 391 |
| 827 | iso_pu_bacteria | 2599185301 | 2599937104 | 391 |
| 828 | iso_pu_bacteria | 2751185800 | 2753360271 | 391 |
| 829 | iso_pu_bacteria | 2758568016 | 2758642591 | 391 |
| 830 | iso_pu_bacteria | 2854911287 | 2854913079 | 391 |
| 831 | iso_pu_bacteria | 2884298095 | 2884298521 | 391 |
| 832 | iso_pu_bacteria | 2909042592 | 2909046943 | 391 |
| 833 | iso_pu_bacteria | 2915650412 | 2915651869 | 391 |
| 834 | iso_pu_bacteria | 2958064165 | 2958068524 | 391 |
| 835 | 3300006847 | Ga0075431_100142836 | Ga0075431_1001428361 | 392 |
| 836 | 3300006852 | Ga0075433_10030537 | Ga0075433_100305372 | 392 |
| 837 | 3300006871 | Ga0075434_100063077 | Ga0075434_1000630774 | 392 |
| 838 | 3300009094 | Ga0111539_10031180 | Ga0111539_100311803 | 392 |
| 839 | 3300009147 | Ga0114129_10009862 | Ga0114129_100098625 | 392 |
| 840 | 3300025294 | Ga0209025_1022887 | Ga0209025_10228872 | 392 |
| 841 | 3300031711 | Ga0265314_10029460 | Ga0265314_100294603 | 392 |
| 842 | 3300035119 | Ga0373956_0015614 | Ga0373956_0015614_1627_2949 | 392 |
| 843 | 3300035724 | Ga0373933_0059390 | Ga0373933_0059390_92_1465 | 392 |
| 844 | 3300036401 | Ga0373937_0318840 | Ga0373937_0318840_34_1287 | 392 |
| 845 | 3300037312 | Ga0395899_0000058 | Ga0395899_0000058_138312_139604 | 392 |
| 846 | 3300037418 | Ga0395900_0000056 | Ga0395900_0000056_138340_139632 | 392 |
| 847 | 3300037466 | Ga0395898_0000114 | Ga0395898_0000114_138331_139623 | 392 |
| 848 | 3300037471 | Ga0395905_0000053 | Ga0395905_0000053_73446_74738 | 392 |
| 849 | 3300038443 | Ga0395901_0000037 | Ga0395901_0000037_138340_139632 | 392 |
| 850 | 3300049592 | Ga0501076_0147593 | Ga0501076_0147593_116_1477 | 392 |
| 851 | 3300050509 | nmdc:mga0qj67_140025_c1 | nmdc:mga0qj67_140025_c1_415_1728 | 392 |
| 852 | 3300050510 | nmdc:mga06r32_24274_c1 | nmdc:mga06r32_24274_c1_3456_4769 | 392 |
| 853 | 3300050511 | nmdc:mga08y16_92508_c1 | nmdc:mga08y16_92508_c1_1482_2813 | 392 |
| 854 | 3300053077 | Ga0495601_0037926 | Ga0495601_0037926_1234_2607 | 392 |
| 855 | 3300053104 | Ga0500556_0000054 | Ga0500556_0000054_108056_109450 | 392 |
| 856 | iso_pu_bacteria | 2508501114 | 2509079289 | 392 |
| 857 | iso_pu_bacteria | 2508501127 | 2509144269 | 392 |
| 858 | iso_pu_bacteria | 2643221736 | 2644743058 | 392 |
| 859 | iso_pu_bacteria | 2835312727 | 2835315700 | 392 |
| 860 | iso_pu_bacteria | 2841760612 | 2841765135 | 392 |
| 861 | iso_pu_bacteria | 2844104063 | 2844106745 | 392 |
| 862 | iso_pu_bacteria | 2851182111 | 2851185719 | 392 |
| 863 | iso_pu_bacteria | 2851246043 | 2851248785 | 392 |
| 864 | iso_pu_bacteria | 8057529695 | 8057532856 | 392 |
| 865 | 3300005518 | Ga0070699_100005230 | Ga0070699_10000523011 | 393 |
| 866 | 3300005937 | Ga0081455_10003800 | Ga0081455_100038005 | 393 |
| 867 | 3300005983 | Ga0081540_1001091 | Ga0081540_100109119 | 393 |
| 868 | 3300006042 | Ga0075368_10013733 | Ga0075368_100137332 | 393 |
| 869 | 3300006048 | Ga0075363_100009168 | Ga0075363_1000091682 | 393 |
| 870 | 3300006173 | Ga0070716_100001502 | Ga0070716_1000015024 | 393 |
| 871 | 3300006178 | Ga0075367_10015858 | Ga0075367_100158584 | 393 |
| 872 | 3300006844 | Ga0075428_100053742 | Ga0075428_1000537422 | 393 |
| 873 | 3300006844 | Ga0075428_100165218 | Ga0075428_1001652182 | 393 |
| 874 | 3300006847 | Ga0075431_100351834 | Ga0075431_1003518341 | 393 |
| 875 | 3300006871 | Ga0075434_100149251 | Ga0075434_1001492512 | 393 |
| 876 | 3300007076 | Ga0075435_100053355 | Ga0075435_1000533552 | 393 |
| 877 | 3300025928 | Ga0207700_10028695 | Ga0207700_100286952 | 393 |
| 878 | 3300025939 | Ga0207665_10002324 | Ga0207665_100023244 | 393 |
| 879 | 3300026075 | Ga0207708_10111538 | Ga0207708_101115381 | 393 |
| 880 | 3300035398 | Ga0316574_0055723 | Ga0316574_0055723_31_1395 | 393 |
| 881 | 3300037466 | Ga0395898_0123107 | Ga0395898_0123107_487_1824 | 393 |
| 882 | 3300038443 | Ga0395901_0112892 | Ga0395901_0112892_954_2345 | 393 |
| 883 | 3300038735 | Ga0400485_02815 | Ga0400485_02815_689_1933 | 393 |
| 884 | 3300039447 | Ga0436361_0071538 | Ga0436361_0071538_2418_3755 | 393 |
| 885 | 3300046536 | Ga0495587_0077366 | Ga0495587_0077366_485_1846 | 393 |
| 886 | 3300048907 | Ga0496104_0013356 | Ga0496104_0013356_5223_6563 | 393 |
| 887 | 3300049588 | Ga0501072_0066784 | Ga0501072_0066784_1230_2618 | 393 |
| 888 | 3300049589 | Ga0501073_0031716 | Ga0501073_0031716_1065_2453 | 393 |
| 889 | 3300049592 | Ga0501076_0008099 | Ga0501076_0008099_515_1903 | 393 |
| 890 | 3300049741 | Ga0501079_0003533 | Ga0501079_0003533_9568_10956 | 393 |
| 891 | 3300049742 | Ga0501080_0015899 | Ga0501080_0015899_1283_2671 | 393 |
| 892 | 3300050494 | nmdc:mga06z11_59503_c1 | nmdc:mga06z11_59503_c1_272_1639 | 393 |
| 893 | 3300050495 | nmdc:mga04h51_44700_c1 | nmdc:mga04h51_44700_c1_102_1430 | 393 |
| 894 | 3300050507 | nmdc:mga05p37_5814_c1 | nmdc:mga05p37_5814_c1_2649_3986 | 393 |
| 895 | 3300050512 | nmdc:mga0n895_58688_c1 | nmdc:mga0n895_58688_c1_2073_3410 | 393 |
| 896 | 3300050512 | nmdc:mga0n895_69536_c1 | nmdc:mga0n895_69536_c1_163_1500 | 393 |
| 897 | 3300053077 | Ga0495601_0022185 | Ga0495601_0022185_2117_3478 | 393 |
| 898 | 3300053085 | Ga0495619_0015287 | Ga0495619_0015287_657_2018 | 393 |
| 899 | 3300054114 | Ga0501084_0034070 | Ga0501084_0034070_1261_2649 | 393 |
| 900 | iso_pu_bacteria | 2545555834 | 2545678490 | 393 |
| 901 | iso_pu_bacteria | 2643221564 | 2643838968 | 393 |
| 902 | iso_pu_bacteria | 2876392853 | 2876393082 | 393 |
| 903 | iso_pu_bacteria | 2904659560 | 2904662398 | 393 |
| 904 | iso_pu_bacteria | 2961114664 | 2961116166 | 393 |
| 905 | iso_pu_bacteria | 2965062239 | 2965064716 | 393 |
| 906 | iso_pu_bacteria | 2968110612 | 2968113463 | 393 |
| 907 | iso_pu_bacteria | 641522639 | 641643154 | 393 |
| 908 | iso_pu_bacteria | 8001845381 | 8001845908 | 393 |
| 909 | 3300005330 | Ga0070690_100122683 | Ga0070690_1001226831 | 394 |
| 910 | 3300005331 | Ga0070670_100029069 | Ga0070670_1000290692 | 394 |
| 911 | 3300005333 | Ga0070677_10002383 | Ga0070677_100023836 | 394 |
| 912 | 3300005340 | Ga0070689_100049005 | Ga0070689_1000490052 | 394 |
| 913 | 3300005343 | Ga0070687_100020917 | Ga0070687_1000209172 | 394 |
| 914 | 3300005353 | Ga0070669_100090652 | Ga0070669_1000906522 | 394 |
| 915 | 3300005356 | Ga0070674_100008903 | Ga0070674_1000089037 | 394 |
| 916 | 3300005365 | Ga0070688_100018506 | Ga0070688_1000185062 | 394 |
| 917 | 3300005436 | Ga0070713_100170990 | Ga0070713_1001709902 | 394 |
| 918 | 3300005456 | Ga0070678_100003451 | Ga0070678_1000034519 | 394 |
| 919 | 3300005459 | Ga0068867_100005652 | Ga0068867_1000056528 | 394 |
| 920 | 3300005543 | Ga0070672_100055821 | Ga0070672_1000558213 | 394 |
| 921 | 3300005544 | Ga0070686_100048392 | Ga0070686_1000483921 | 394 |
| 922 | 3300005718 | Ga0068866_10028799 | Ga0068866_100287992 | 394 |
| 923 | 3300006195 | Ga0075366_10055200 | Ga0075366_100552002 | 394 |
| 924 | 3300006881 | Ga0068865_100020355 | Ga0068865_1000203553 | 394 |
| 925 | 3300009098 | Ga0105245_10107215 | Ga0105245_101072152 | 394 |
| 926 | 3300009177 | Ga0105248_10030987 | Ga0105248_100309874 | 394 |
| 927 | 3300013297 | Ga0157378_10127016 | Ga0157378_101270162 | 394 |
| 928 | 3300021384 | Ga0213876_10017764 | Ga0213876_100177642 | 394 |
| 929 | 3300025893 | Ga0207682_10001074 | Ga0207682_1000107411 | 394 |
| 930 | 3300025901 | Ga0207688_10009739 | Ga0207688_100097393 | 394 |
| 931 | 3300025918 | Ga0207662_10035651 | Ga0207662_100356512 | 394 |
| 932 | 3300025926 | Ga0207659_10076418 | Ga0207659_100764181 | 394 |
| 933 | 3300025935 | Ga0207709_10085631 | Ga0207709_100856311 | 394 |
| 934 | 3300025936 | Ga0207670_10190376 | Ga0207670_101903761 | 394 |
| 935 | 3300025937 | Ga0207669_10002350 | Ga0207669_100023508 | 394 |
| 936 | 3300025938 | Ga0207704_10043837 | Ga0207704_100438371 | 394 |
| 937 | 3300025940 | Ga0207691_10001292 | Ga0207691_100012927 | 394 |
| 938 | 3300025942 | Ga0207689_10022368 | Ga0207689_100223682 | 394 |
| 939 | 3300026088 | Ga0207641_10129032 | Ga0207641_101290322 | 394 |
| 940 | 3300026089 | Ga0207648_10006883 | Ga0207648_1000688310 | 394 |
| 941 | 3300026116 | Ga0207674_10018581 | Ga0207674_100185817 | 394 |
| 942 | 3300026121 | Ga0207683_10001466 | Ga0207683_100014668 | 394 |
| 943 | 3300035115 | Ga0373941_0002007 | Ga0373941_0002007_2917_4257 | 394 |
| 944 | 3300038742 | Ga0400486_11742 | Ga0400486_11742_3286_4671 | 394 |
| 945 | 3300038742 | Ga0400486_18730 | Ga0400486_18730_233_1531 | 394 |
| 946 | 3300039437 | Ga0436365_0178496 | Ga0436365_0178496_2228_3586 | 394 |
| 947 | 3300039437 | Ga0436365_1057605 | Ga0436365_1057605_5821_7152 | 394 |
| 948 | 3300039437 | Ga0436365_1912169 | Ga0436365_1912169_1762_3099 | 394 |
| 949 | 3300039450 | Ga0436363_0258497 | Ga0436363_0258497_898_2187 | 394 |
| 950 | 3300045051 | Ga0451576_0008846 | Ga0451576_0008846_4428_5888 | 394 |
| 951 | 3300046539 | Ga0495621_0015431 | Ga0495621_0015431_96_1406 | 394 |
| 952 | 3300049568 | Ga0501031_0026160 | Ga0501031_0026160_15_1322 | 394 |
| 953 | 3300049568 | Ga0501031_0052065 | Ga0501031_0052065_82_1422 | 394 |
| 954 | 3300049569 | Ga0501032_0036616 | Ga0501032_0036616_311_1633 | 394 |
| 955 | 3300049569 | Ga0501032_0131157 | Ga0501032_0131157_210_1532 | 394 |
| 956 | 3300049570 | Ga0501033_0187861 | Ga0501033_0187861_12_1334 | 394 |
| 957 | 3300049571 | Ga0501034_0095010 | Ga0501034_0095010_1644_2966 | 394 |
| 958 | 3300049572 | Ga0501036_0020737 | Ga0501036_0020737_2718_4040 | 394 |
| 959 | 3300049572 | Ga0501036_0116328 | Ga0501036_0116328_815_2137 | 394 |
| 960 | 3300049573 | Ga0501037_0008498 | Ga0501037_0008498_1209_2531 | 394 |
| 961 | 3300049573 | Ga0501037_0099748 | Ga0501037_0099748_12_1334 | 394 |
| 962 | 3300049574 | Ga0501038_0018824 | Ga0501038_0018824_3889_5211 | 394 |
| 963 | 3300049575 | Ga0501039_0087954 | Ga0501039_0087954_145_1467 | 394 |
| 964 | 3300049580 | Ga0501046_0016030 | Ga0501046_0016030_3338_4660 | 394 |
| 965 | 3300049581 | Ga0501047_0017714 | Ga0501047_0017714_3539_4861 | 394 |
| 966 | 3300049582 | Ga0501048_0168825 | Ga0501048_0168825_183_1538 | 394 |
| 967 | 3300049586 | Ga0501070_0034753 | Ga0501070_0034753_2207_3529 | 394 |
| 968 | 3300049589 | Ga0501073_0040293 | Ga0501073_0040293_1532_2860 | 394 |
| 969 | 3300049589 | Ga0501073_0060156 | Ga0501073_0060156_200_1522 | 394 |
| 970 | 3300049590 | Ga0501074_0041493 | Ga0501074_0041493_466_1788 | 394 |
| 971 | 3300049742 | Ga0501080_0025960 | Ga0501080_0025960_3018_4340 | 394 |
| 972 | 3300049822 | Ga0501035_0035083 | Ga0501035_0035083_763_2085 | 394 |
| 973 | 3300049823 | Ga0501044_0043987 | Ga0501044_0043987_1556_2878 | 394 |
| 974 | 3300060353 | Ga0501082_0025365 | Ga0501082_0025365_1023_2345 | 394 |
| 975 | iso_pu_bacteria | 2842698319 | 2842700853 | 394 |
| 976 | iso_pu_bacteria | 2919450847 | 2919452232 | 394 |
| 977 | iso_pu_bacteria | 643348564 | 643602851 | 394 |
| 978 | 3300005331 | Ga0070670_100019941 | Ga0070670_1000199413 | 395 |
| 979 | 3300005335 | Ga0070666_10010516 | Ga0070666_100105162 | 395 |
| 980 | 3300005347 | Ga0070668_100027024 | Ga0070668_1000270244 | 395 |
| 981 | 3300005356 | Ga0070674_100042827 | Ga0070674_1000428272 | 395 |
| 982 | 3300005366 | Ga0070659_100142349 | Ga0070659_1001423492 | 395 |
| 983 | 3300005435 | Ga0070714_100129997 | Ga0070714_1001299971 | 395 |
| 984 | 3300005436 | Ga0070713_100028175 | Ga0070713_1000281753 | 395 |
| 985 | 3300005441 | Ga0070700_100013729 | Ga0070700_1000137292 | 395 |
| 986 | 3300005455 | Ga0070663_100153128 | Ga0070663_1001531282 | 395 |
| 987 | 3300005456 | Ga0070678_100020066 | Ga0070678_1000200662 | 395 |
| 988 | 3300005457 | Ga0070662_100018370 | Ga0070662_1000183702 | 395 |
| 989 | 3300005459 | Ga0068867_100007482 | Ga0068867_1000074823 | 395 |
| 990 | 3300005530 | Ga0070679_100020501 | Ga0070679_1000205013 | 395 |
| 991 | 3300005535 | Ga0070684_100036996 | Ga0070684_1000369962 | 395 |
| 992 | 3300005536 | Ga0070697_100002109 | Ga0070697_1000021099 | 395 |
| 993 | 3300005543 | Ga0070672_100019190 | Ga0070672_1000191904 | 395 |
| 994 | 3300005544 | Ga0070686_100014171 | Ga0070686_1000141712 | 395 |
| 995 | 3300005547 | Ga0070693_100036397 | Ga0070693_1000363972 | 395 |
| 996 | 3300005549 | Ga0070704_100095335 | Ga0070704_1000953352 | 395 |
| 997 | 3300005578 | Ga0068854_100067050 | Ga0068854_1000670502 | 395 |
| 998 | 3300005614 | Ga0068856_100118053 | Ga0068856_1001180532 | 395 |
| 999 | 3300005618 | Ga0068864_100010230 | Ga0068864_1000102304 | 395 |
| 1000 | 3300005719 | Ga0068861_100013686 | Ga0068861_1000136864 | 395 |
| 1001 | 3300005834 | Ga0068851_10061051 | Ga0068851_100610512 | 395 |
| 1002 | 3300005841 | Ga0068863_100019114 | Ga0068863_1000191143 | 395 |
| 1003 | 3300005842 | Ga0068858_100130797 | Ga0068858_1001307972 | 395 |
| 1004 | 3300005843 | Ga0068860_100015869 | Ga0068860_1000158694 | 395 |
| 1005 | 3300005937 | Ga0081455_10010247 | Ga0081455_100102472 | 395 |
| 1006 | 3300005985 | Ga0081539_10005675 | Ga0081539_100056753 | 395 |
| 1007 | 3300006028 | Ga0070717_10140379 | Ga0070717_101403792 | 395 |
| 1008 | 3300006038 | Ga0075365_10003320 | Ga0075365_100033206 | 395 |
| 1009 | 3300006038 | Ga0075365_10009306 | Ga0075365_100093065 | 395 |
| 1010 | 3300006038 | Ga0075365_10030319 | Ga0075365_100303194 | 395 |
| 1011 | 3300006048 | Ga0075363_100028583 | Ga0075363_1000285831 | 395 |
| 1012 | 3300006048 | Ga0075363_100049136 | Ga0075363_1000491362 | 395 |
| 1013 | 3300006051 | Ga0075364_10062135 | Ga0075364_100621352 | 395 |
| 1014 | 3300006175 | Ga0070712_100004185 | Ga0070712_1000041853 | 395 |
| 1015 | 3300006175 | Ga0070712_100013202 | Ga0070712_1000132024 | 395 |
| 1016 | 3300006175 | Ga0070712_100036607 | Ga0070712_1000366073 | 395 |
| 1017 | 3300006178 | Ga0075367_10012255 | Ga0075367_100122552 | 395 |
| 1018 | 3300006178 | Ga0075367_10110267 | Ga0075367_101102671 | 395 |
| 1019 | 3300006844 | Ga0075428_100000426 | Ga0075428_1000004262 | 395 |
| 1020 | 3300006846 | Ga0075430_100030098 | Ga0075430_1000300983 | 395 |
| 1021 | 3300006847 | Ga0075431_100003583 | Ga0075431_10000358315 | 395 |
| 1022 | 3300006871 | Ga0075434_100023729 | Ga0075434_1000237295 | 395 |
| 1023 | 3300006880 | Ga0075429_100002102 | Ga0075429_1000021028 | 395 |
| 1024 | 3300006880 | Ga0075429_100050551 | Ga0075429_1000505512 | 395 |
| 1025 | 3300006881 | Ga0068865_100166423 | Ga0068865_1001664232 | 395 |
| 1026 | 3300006914 | Ga0075436_100015129 | Ga0075436_1000151293 | 395 |
| 1027 | 3300006914 | Ga0075436_100024156 | Ga0075436_1000241564 | 395 |
| 1028 | 3300007076 | Ga0075435_100014741 | Ga0075435_1000147415 | 395 |
| 1029 | 3300007265 | Ga0099794_10029142 | Ga0099794_100291422 | 395 |
| 1030 | 3300009094 | Ga0111539_10000554 | Ga0111539_1000055414 | 395 |
| 1031 | 3300009094 | Ga0111539_10012226 | Ga0111539_100122264 | 395 |
| 1032 | 3300009098 | Ga0105245_10027605 | Ga0105245_100276052 | 395 |
| 1033 | 3300009147 | Ga0114129_10003055 | Ga0114129_1000305514 | 395 |
| 1034 | 3300009147 | Ga0114129_10132552 | Ga0114129_101325522 | 395 |
| 1035 | 3300009147 | Ga0114129_10149759 | Ga0114129_101497592 | 395 |
| 1036 | 3300009174 | Ga0105241_10106515 | Ga0105241_101065153 | 395 |
| 1037 | 3300009177 | Ga0105248_10009517 | Ga0105248_100095172 | 395 |
| 1038 | 3300009551 | Ga0105238_10021249 | Ga0105238_100212493 | 395 |
| 1039 | 3300010159 | Ga0099796_10000604 | Ga0099796_100006044 | 395 |
| 1040 | 3300010375 | Ga0105239_10054348 | Ga0105239_100543482 | 395 |
| 1041 | 3300013307 | Ga0157372_10010309 | Ga0157372_100103095 | 395 |
| 1042 | 3300013308 | Ga0157375_10028152 | Ga0157375_100281523 | 395 |
| 1043 | 3300014325 | Ga0163163_10072634 | Ga0163163_100726342 | 395 |
| 1044 | 3300014745 | Ga0157377_10006953 | Ga0157377_100069532 | 395 |
| 1045 | 3300014968 | Ga0157379_10015858 | Ga0157379_100158582 | 395 |
| 1046 | 3300014969 | Ga0157376_10030826 | Ga0157376_100308262 | 395 |
| 1047 | 3300017792 | Ga0163161_10023758 | Ga0163161_100237584 | 395 |
| 1048 | 3300024227 | Ga0228598_1002344 | Ga0228598_10023441 | 395 |
| 1049 | 3300025295 | Ga0209564_1002513 | Ga0209564_10025134 | 395 |
| 1050 | 3300025321 | Ga0207656_10033112 | Ga0207656_100331122 | 395 |
| 1051 | 3300025900 | Ga0207710_10081153 | Ga0207710_100811531 | 395 |
| 1052 | 3300025901 | Ga0207688_10010651 | Ga0207688_100106512 | 395 |
| 1053 | 3300025915 | Ga0207693_10000434 | Ga0207693_1000043420 | 395 |
| 1054 | 3300025915 | Ga0207693_10007408 | Ga0207693_100074083 | 395 |
| 1055 | 3300025915 | Ga0207693_10030439 | Ga0207693_100304393 | 395 |
| 1056 | 3300025915 | Ga0207693_10041887 | Ga0207693_100418872 | 395 |
| 1057 | 3300025915 | Ga0207693_10135186 | Ga0207693_101351861 | 395 |
| 1058 | 3300025918 | Ga0207662_10007603 | Ga0207662_100076035 | 395 |
| 1059 | 3300025920 | Ga0207649_10030181 | Ga0207649_100301812 | 395 |
| 1060 | 3300025927 | Ga0207687_10029140 | Ga0207687_100291402 | 395 |
| 1061 | 3300025929 | Ga0207664_10044050 | Ga0207664_100440504 | 395 |
| 1062 | 3300025931 | Ga0207644_10018432 | Ga0207644_100184323 | 395 |
| 1063 | 3300025932 | Ga0207690_10013558 | Ga0207690_100135582 | 395 |
| 1064 | 3300025933 | Ga0207706_10001103 | Ga0207706_1000110312 | 395 |
| 1065 | 3300025937 | Ga0207669_10097204 | Ga0207669_100972042 | 395 |
| 1066 | 3300025939 | Ga0207665_10038536 | Ga0207665_100385362 | 395 |
| 1067 | 3300025940 | Ga0207691_10027729 | Ga0207691_100277295 | 395 |
| 1068 | 3300025942 | Ga0207689_10007363 | Ga0207689_100073635 | 395 |
| 1069 | 3300025944 | Ga0207661_10080240 | Ga0207661_100802401 | 395 |
| 1070 | 3300025944 | Ga0207661_10179545 | Ga0207661_101795452 | 395 |
| 1071 | 3300025949 | Ga0207667_10144988 | Ga0207667_101449882 | 395 |
| 1072 | 3300025961 | Ga0207712_10000880 | Ga0207712_100008806 | 395 |
| 1073 | 3300026023 | Ga0207677_10027198 | Ga0207677_100271984 | 395 |
| 1074 | 3300026035 | Ga0207703_10155739 | Ga0207703_101557392 | 395 |
| 1075 | 3300026067 | Ga0207678_10012203 | Ga0207678_100122035 | 395 |
| 1076 | 3300026075 | Ga0207708_10000620 | Ga0207708_1000062013 | 395 |
| 1077 | 3300026075 | Ga0207708_10076958 | Ga0207708_100769581 | 395 |
| 1078 | 3300026088 | Ga0207641_10011851 | Ga0207641_100118515 | 395 |
| 1079 | 3300026089 | Ga0207648_10002122 | Ga0207648_1000212211 | 395 |
| 1080 | 3300026095 | Ga0207676_10031531 | Ga0207676_100315312 | 395 |
| 1081 | 3300026118 | Ga0207675_100002342 | Ga0207675_10000234210 | 395 |
| 1082 | 3300026121 | Ga0207683_10015346 | Ga0207683_100153467 | 395 |
| 1083 | 3300027907 | Ga0207428_10009912 | Ga0207428_100099123 | 395 |
| 1084 | 3300028379 | Ga0268266_10141623 | Ga0268266_101416232 | 395 |
| 1085 | 3300028800 | Ga0265338_10039087 | Ga0265338_100390871 | 395 |
| 1086 | 3300031238 | Ga0265332_10000743 | Ga0265332_1000074316 | 395 |
| 1087 | 3300031241 | Ga0265325_10021294 | Ga0265325_100212942 | 395 |
| 1088 | 3300031241 | Ga0265325_10038529 | Ga0265325_100385292 | 395 |
| 1089 | 3300031242 | Ga0265329_10006949 | Ga0265329_100069493 | 395 |
| 1090 | 3300031247 | Ga0265340_10006011 | Ga0265340_100060115 | 395 |
| 1091 | 3300031247 | Ga0265340_10006392 | Ga0265340_100063925 | 395 |
| 1092 | 3300031247 | Ga0265340_10013593 | Ga0265340_100135933 | 395 |
| 1093 | 3300031249 | Ga0265339_10000033 | Ga0265339_10000033108 | 395 |
| 1094 | 3300031249 | Ga0265339_10006458 | Ga0265339_100064584 | 395 |
| 1095 | 3300031249 | Ga0265339_10013851 | Ga0265339_100138515 | 395 |
| 1096 | 3300031344 | Ga0265316_10027808 | Ga0265316_100278082 | 395 |
| 1097 | 3300031344 | Ga0265316_10048132 | Ga0265316_100481322 | 395 |
| 1098 | 3300031456 | Ga0307513_10253465 | Ga0307513_102534651 | 395 |
| 1099 | 3300031595 | Ga0265313_10000049 | Ga0265313_1000004949 | 395 |
| 1100 | 3300031595 | Ga0265313_10009973 | Ga0265313_100099734 | 395 |
| 1101 | 3300031711 | Ga0265314_10011925 | Ga0265314_100119253 | 395 |
| 1102 | 3300031711 | Ga0265314_10052401 | Ga0265314_100524011 | 395 |
| 1103 | 3300031712 | Ga0265342_10000034 | Ga0265342_1000003413 | 395 |
| 1104 | 3300035089 | Ga0373944_0006983 | Ga0373944_0006983_62_1615 | 395 |
| 1105 | 3300035116 | Ga0373945_0002010 | Ga0373945_0002010_3550_4896 | 395 |
| 1106 | 3300035170 | Ga0373943_0054528 | Ga0373943_0054528_221_1582 | 395 |
| 1107 | 3300035170 | Ga0373943_0076961 | Ga0373943_0076961_301_1635 | 395 |
| 1108 | 3300035691 | Ga0373931_0001020 | Ga0373931_0001020_10059_11381 | 395 |
| 1109 | 3300035691 | Ga0373931_0064720 | Ga0373931_0064720_106_1440 | 395 |
| 1110 | 3300035692 | Ga0373935_0017541 | Ga0373935_0017541_2949_4307 | 395 |
| 1111 | 3300035692 | Ga0373935_0088165 | Ga0373935_0088165_380_1717 | 395 |
| 1112 | 3300035692 | Ga0373935_0165584 | Ga0373935_0165584_98_1447 | 395 |
| 1113 | 3300035692 | Ga0373935_0197549 | Ga0373935_0197549_26_1285 | 395 |
| 1114 | 3300035695 | Ga0373927_0031034 | Ga0373927_0031034_725_2083 | 395 |
| 1115 | 3300035695 | Ga0373927_0066257 | Ga0373927_0066257_968_2290 | 395 |
| 1116 | 3300035724 | Ga0373933_0025115 | Ga0373933_0025115_1263_2600 | 395 |
| 1117 | 3300035725 | Ga0373947_0002147 | Ga0373947_0002147_1433_2782 | 395 |
| 1118 | 3300035725 | Ga0373947_0013464 | Ga0373947_0013464_2606_3928 | 395 |
| 1119 | 3300035725 | Ga0373947_0058003 | Ga0373947_0058003_365_1723 | 395 |
| 1120 | 3300037068 | Ga0373925_0052748 | Ga0373925_0052748_1172_2431 | 395 |
| 1121 | 3300037068 | Ga0373925_0072113 | Ga0373925_0072113_500_1882 | 395 |
| 1122 | 3300038742 | Ga0400486_14182 | Ga0400486_14182_912_2207 | 395 |
| 1123 | 3300039437 | Ga0436365_0288317 | Ga0436365_0288317_937_2241 | 395 |
| 1124 | 3300039437 | Ga0436365_1590566 | Ga0436365_1590566_1882_3189 | 395 |
| 1125 | 3300046454 | Ga0495592_0141447 | Ga0495592_0141447_25_1332 | 395 |
| 1126 | 3300046462 | Ga0495651_0159959 | Ga0495651_0159959_262_1599 | 395 |
| 1127 | 3300046474 | Ga0495605_0035372 | Ga0495605_0035372_37_1395 | 395 |
| 1128 | 3300046475 | Ga0495639_0013565 | Ga0495639_0013565_1908_3230 | 395 |
| 1129 | 3300046476 | Ga0495662_0001111 | Ga0495662_0001111_6993_8342 | 395 |
| 1130 | 3300046477 | Ga0495664_0000554 | Ga0495664_0000554_1736_3085 | 395 |
| 1131 | 3300046491 | Ga0495584_0017349 | Ga0495584_0017349_720_2072 | 395 |
| 1132 | 3300046491 | Ga0495584_0050569 | Ga0495584_0050569_375_1733 | 395 |
| 1133 | 3300046492 | Ga0495585_0007429 | Ga0495585_0007429_2699_4057 | 395 |
| 1134 | 3300046514 | Ga0495618_0013332 | Ga0495618_0013332_2854_4203 | 395 |
| 1135 | 3300046516 | Ga0495628_0107988 | Ga0495628_0107988_677_2038 | 395 |
| 1136 | 3300046517 | Ga0495630_0016521 | Ga0495630_0016521_3610_4959 | 395 |
| 1137 | 3300046517 | Ga0495630_0101373 | Ga0495630_0101373_661_1920 | 395 |
| 1138 | 3300046517 | Ga0495630_0134283 | Ga0495630_0134283_117_1439 | 395 |
| 1139 | 3300046526 | Ga0495666_0052151 | Ga0495666_0052151_401_1750 | 395 |
| 1140 | 3300046529 | Ga0495652_0056892 | Ga0495652_0056892_1758_3107 | 395 |
| 1141 | 3300046533 | Ga0495640_0003647 | Ga0495640_0003647_4515_5864 | 395 |
| 1142 | 3300046543 | Ga0495645_0031880 | Ga0495645_0031880_2289_3638 | 395 |
| 1143 | 3300046615 | Ga0495656_0070647 | Ga0495656_0070647_164_1486 | 395 |
| 1144 | 3300046642 | Ga0495634_0008546 | Ga0495634_0008546_231_1577 | 395 |
| 1145 | 3300046642 | Ga0495634_0101543 | Ga0495634_0101543_267_1526 | 395 |
| 1146 | 3300046663 | Ga0495635_0004485 | Ga0495635_0004485_2208_3557 | 395 |
| 1147 | 3300046680 | Ga0495646_0019483 | Ga0495646_0019483_1366_2703 | 395 |
| 1148 | 3300046683 | Ga0495658_0021232 | Ga0495658_0021232_266_1588 | 395 |
| 1149 | 3300046690 | Ga0495624_0064843 | Ga0495624_0064843_401_1759 | 395 |
| 1150 | 3300046690 | Ga0495624_0103059 | Ga0495624_0103059_333_1682 | 395 |
| 1151 | 3300046694 | Ga0495649_0032841 | Ga0495649_0032841_161_1495 | 395 |
| 1152 | 3300046809 | Ga0495600_0106976 | Ga0495600_0106976_254_1615 | 395 |
| 1153 | 3300047315 | Ga0495581_0080854 | Ga0495581_0080854_396_1718 | 395 |
| 1154 | 3300047317 | Ga0495604_0202439 | Ga0495604_0202439_44_1327 | 395 |
| 1155 | 3300047319 | Ga0495674_0005023 | Ga0495674_0005023_3551_4900 | 395 |
| 1156 | 3300047319 | Ga0495674_0054999 | Ga0495674_0054999_1935_3278 | 395 |
| 1157 | 3300047447 | Ga0495685_006328 | Ga0495685_006328_2033_3376 | 395 |
| 1158 | 3300047471 | Ga0495684_0031461 | Ga0495684_0031461_1292_2641 | 395 |
| 1159 | 3300047471 | Ga0495684_0183854 | Ga0495684_0183854_74_1420 | 395 |
| 1160 | 3300048903 | Ga0496100_0009675 | Ga0496100_0009675_1743_3077 | 395 |
| 1161 | 3300048905 | Ga0496102_0002294 | Ga0496102_0002294_6183_7463 | 395 |
| 1162 | 3300048906 | Ga0496103_0007191 | Ga0496103_0007191_1676_3010 | 395 |
| 1163 | 3300048907 | Ga0496104_0030510 | Ga0496104_0030510_475_1755 | 395 |
| 1164 | 3300048907 | Ga0496104_0053180 | Ga0496104_0053180_871_2289 | 395 |
| 1165 | 3300048908 | Ga0496105_0013665 | Ga0496105_0013665_2821_4101 | 395 |
| 1166 | 3300048908 | Ga0496105_0059858 | Ga0496105_0059858_1077_2411 | 395 |
| 1167 | 3300048909 | Ga0496106_0002640 | Ga0496106_0002640_7917_9197 | 395 |
| 1168 | 3300048910 | Ga0496107_0003942 | Ga0496107_0003942_228_1508 | 395 |
| 1169 | 3300048910 | Ga0496107_0018342 | Ga0496107_0018342_1205_2539 | 395 |
| 1170 | 3300048911 | Ga0496108_0001531 | Ga0496108_0001531_2447_3775 | 395 |
| 1171 | 3300048911 | Ga0496108_0022438 | Ga0496108_0022438_1574_2908 | 395 |
| 1172 | 3300048912 | Ga0496109_0029291 | Ga0496109_0029291_3091_4371 | 395 |
| 1173 | 3300048912 | Ga0496109_0062750 | Ga0496109_0062750_1205_2539 | 395 |
| 1174 | 3300048913 | Ga0496110_0044371 | Ga0496110_0044371_860_2194 | 395 |
| 1175 | 3300048913 | Ga0496110_0154168 | Ga0496110_0154168_114_1532 | 395 |
| 1176 | 3300048914 | Ga0496111_0022726 | Ga0496111_0022726_3087_4367 | 395 |
| 1177 | 3300048915 | Ga0496112_0001338 | Ga0496112_0001338_2197_3525 | 395 |
| 1178 | 3300048916 | Ga0496113_0023272 | Ga0496113_0023272_2027_3373 | 395 |
| 1179 | 3300048917 | Ga0496114_0016997 | Ga0496114_0016997_3305_4663 | 395 |
| 1180 | 3300048917 | Ga0496114_0027325 | Ga0496114_0027325_1765_3099 | 395 |
| 1181 | 3300048917 | Ga0496114_0084827 | Ga0496114_0084827_94_1374 | 395 |
| 1182 | 3300048918 | Ga0496115_0027048 | Ga0496115_0027048_2638_3984 | 395 |
| 1183 | 3300048918 | Ga0496115_0082075 | Ga0496115_0082075_559_1917 | 395 |
| 1184 | 3300048929 | Ga0496126_0007940 | Ga0496126_0007940_8456_9805 | 395 |
| 1185 | 3300049568 | Ga0501031_0033350 | Ga0501031_0033350_364_1695 | 395 |
| 1186 | 3300049569 | Ga0501032_0021745 | Ga0501032_0021745_643_1983 | 395 |
| 1187 | 3300049570 | Ga0501033_0007570 | Ga0501033_0007570_2917_4257 | 395 |
| 1188 | 3300049570 | Ga0501033_0050865 | Ga0501033_0050865_1007_2347 | 395 |
| 1189 | 3300049570 | Ga0501033_0068165 | Ga0501033_0068165_407_1747 | 395 |
| 1190 | 3300049571 | Ga0501034_0055429 | Ga0501034_0055429_1536_2876 | 395 |
| 1191 | 3300049572 | Ga0501036_0033174 | Ga0501036_0033174_2032_3375 | 395 |
| 1192 | 3300049572 | Ga0501036_0118539 | Ga0501036_0118539_381_1721 | 395 |
| 1193 | 3300049573 | Ga0501037_0191839 | Ga0501037_0191839_97_1428 | 395 |
| 1194 | 3300049574 | Ga0501038_0142068 | Ga0501038_0142068_336_1676 | 395 |
| 1195 | 3300049579 | Ga0501043_0047470 | Ga0501043_0047470_103_1443 | 395 |
| 1196 | 3300049579 | Ga0501043_0162417 | Ga0501043_0162417_269_1609 | 395 |
| 1197 | 3300049581 | Ga0501047_0013347 | Ga0501047_0013347_3931_5271 | 395 |
| 1198 | 3300049581 | Ga0501047_0034936 | Ga0501047_0034936_2352_3695 | 395 |
| 1199 | 3300049581 | Ga0501047_0038409 | Ga0501047_0038409_1382_2722 | 395 |
| 1200 | 3300049581 | Ga0501047_0122721 | Ga0501047_0122721_540_1880 | 395 |
| 1201 | 3300049586 | Ga0501070_0020182 | Ga0501070_0020182_2125_3468 | 395 |
| 1202 | 3300049586 | Ga0501070_0073821 | Ga0501070_0073821_1026_2366 | 395 |
| 1203 | 3300049586 | Ga0501070_0082668 | Ga0501070_0082668_1110_2450 | 395 |
| 1204 | 3300049586 | Ga0501070_0117981 | Ga0501070_0117981_463_1788 | 395 |
| 1205 | 3300049588 | Ga0501072_0002643 | Ga0501072_0002643_8163_9506 | 395 |
| 1206 | 3300049744 | Ga0501083_0005924 | Ga0501083_0005924_1301_2641 | 395 |
| 1207 | 3300049822 | Ga0501035_0066823 | Ga0501035_0066823_457_1797 | 395 |
| 1208 | 3300049822 | Ga0501035_0211521 | Ga0501035_0211521_68_1408 | 395 |
| 1209 | 3300049823 | Ga0501044_0047924 | Ga0501044_0047924_1248_2588 | 395 |
| 1210 | 3300050492 | nmdc:mga0yw44_1745_c1 | nmdc:mga0yw44_1745_c1_3609_4943 | 395 |
| 1211 | 3300050507 | nmdc:mga05p37_183433_c1 | nmdc:mga05p37_183433_c1_929_2275 | 395 |
| 1212 | 3300050507 | nmdc:mga05p37_305_c1 | nmdc:mga05p37_305_c1_31663_33003 | 395 |
| 1213 | 3300050508 | nmdc:mga09592_1154_c1 | nmdc:mga09592_1154_c1_16375_17715 | 395 |
| 1214 | 3300050509 | nmdc:mga0qj67_24382_c1 | nmdc:mga0qj67_24382_c1_2433_3773 | 395 |
| 1215 | 3300050509 | nmdc:mga0qj67_412_c1 | nmdc:mga0qj67_412_c1_24519_25853 | 395 |
| 1216 | 3300050509 | nmdc:mga0qj67_42917_c1 | nmdc:mga0qj67_42917_c1_631_1974 | 395 |
| 1217 | 3300050510 | nmdc:mga06r32_1000_c1 | nmdc:mga06r32_1000_c1_21352_22692 | 395 |
| 1218 | 3300050511 | nmdc:mga08y16_22596_c1 | nmdc:mga08y16_22596_c1_2755_4095 | 395 |
| 1219 | 3300050512 | nmdc:mga0n895_117665_c1 | nmdc:mga0n895_117665_c1_248_1588 | 395 |
| 1220 | 3300050512 | nmdc:mga0n895_75677_c1 | nmdc:mga0n895_75677_c1_856_2190 | 395 |
| 1221 | 3300050513 | nmdc:mga0rr50_30851_c1 | nmdc:mga0rr50_30851_c1_808_2154 | 395 |
| 1222 | 3300050513 | nmdc:mga0rr50_33999_c1 | nmdc:mga0rr50_33999_c1_894_2234 | 395 |
| 1223 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_136074_137414 | 395 |
| 1224 | 3300050514 | nmdc:mga08x19_43298_c1 | nmdc:mga08x19_43298_c1_681_2030 | 395 |
| 1225 | 3300053077 | Ga0495601_0088544 | Ga0495601_0088544_335_1684 | 395 |
| 1226 | 3300053084 | Ga0495595_0009163 | Ga0495595_0009163_758_2095 | 395 |
| 1227 | 3300053085 | Ga0495619_0007493 | Ga0495619_0007493_690_2039 | 395 |
| 1228 | 3300053096 | Ga0500641_0012417 | Ga0500641_0012417_1776_3098 | 395 |
| 1229 | 3300053139 | Ga0500568_0008308 | Ga0500568_0008308_1445_2788 | 395 |
| 1230 | 3300053153 | Ga0500616_0017112 | Ga0500616_0017112_1494_2813 | 395 |
| 1231 | 3300054114 | Ga0501084_0026596 | Ga0501084_0026596_3057_4400 | 395 |
| 1232 | iso_pu_bacteria | 2513237087 | 2513593810 | 395 |
| 1233 | iso_pu_bacteria | 2828305725 | 2828308748 | 395 |
| 1234 | iso_pu_bacteria | 2917554339 | 2917554444 | 395 |
| 1235 | 3300005937 | Ga0081455_10004068 | Ga0081455_100040687 | 396 |
| 1236 | 3300005937 | Ga0081455_10063296 | Ga0081455_100632962 | 396 |
| 1237 | 3300006844 | Ga0075428_100000797 | Ga0075428_10000079711 | 396 |
| 1238 | 3300006846 | Ga0075430_100000045 | Ga0075430_10000004539 | 396 |
| 1239 | 3300006852 | Ga0075433_10002970 | Ga0075433_100029702 | 396 |
| 1240 | 3300006871 | Ga0075434_100003473 | Ga0075434_10000347313 | 396 |
| 1241 | 3300006871 | Ga0075434_100076053 | Ga0075434_1000760532 | 396 |
| 1242 | 3300006880 | Ga0075429_100000214 | Ga0075429_10000021411 | 396 |
| 1243 | 3300007076 | Ga0075435_100006663 | Ga0075435_1000066636 | 396 |
| 1244 | 3300007076 | Ga0075435_100044338 | Ga0075435_1000443382 | 396 |
| 1245 | 3300009094 | Ga0111539_10000693 | Ga0111539_1000069331 | 396 |
| 1246 | 3300009147 | Ga0114129_10009653 | Ga0114129_100096532 | 396 |
| 1247 | 3300009147 | Ga0114129_10010881 | Ga0114129_100108812 | 396 |
| 1248 | 3300027907 | Ga0207428_10000180 | Ga0207428_1000018012 | 396 |
| 1249 | 3300045051 | Ga0451576_0036471 | Ga0451576_0036471_1671_2996 | 396 |
| 1250 | 3300048910 | Ga0496107_0226034 | Ga0496107_0226034_148_1341 | 396 |
| 1251 | 3300003215 | JGI25153J46596_10007129 | JGI25153J46596_100071293 | 397 |
| 1252 | 3300005330 | Ga0070690_100018079 | Ga0070690_1000180793 | 397 |
| 1253 | 3300005355 | Ga0070671_100121478 | Ga0070671_1001214783 | 397 |
| 1254 | 3300005434 | Ga0070709_10025951 | Ga0070709_100259514 | 397 |
| 1255 | 3300005436 | Ga0070713_100009074 | Ga0070713_1000090742 | 397 |
| 1256 | 3300005437 | Ga0070710_10048258 | Ga0070710_100482581 | 397 |
| 1257 | 3300005438 | Ga0070701_10035872 | Ga0070701_100358722 | 397 |
| 1258 | 3300005439 | Ga0070711_100009511 | Ga0070711_1000095113 | 397 |
| 1259 | 3300005439 | Ga0070711_100025195 | Ga0070711_1000251951 | 397 |
| 1260 | 3300005439 | Ga0070711_100139001 | Ga0070711_1001390012 | 397 |
| 1261 | 3300005441 | Ga0070700_100046735 | Ga0070700_1000467353 | 397 |
| 1262 | 3300005618 | Ga0068864_100037574 | Ga0068864_1000375743 | 397 |
| 1263 | 3300005842 | Ga0068858_100152450 | Ga0068858_1001524501 | 397 |
| 1264 | 3300005983 | Ga0081540_1046654 | Ga0081540_10466542 | 397 |
| 1265 | 3300006175 | Ga0070712_100022302 | Ga0070712_1000223022 | 397 |
| 1266 | 3300009094 | Ga0111539_10154888 | Ga0111539_101548882 | 397 |
| 1267 | 3300009148 | Ga0105243_10101266 | Ga0105243_101012661 | 397 |
| 1268 | 3300009176 | Ga0105242_10204839 | Ga0105242_102048391 | 397 |
| 1269 | 3300025297 | Ga0209758_1000351 | Ga0209758_100035158 | 397 |
| 1270 | 3300025915 | Ga0207693_10047451 | Ga0207693_100474512 | 397 |
| 1271 | 3300025916 | Ga0207663_10014716 | Ga0207663_100147164 | 397 |
| 1272 | 3300025916 | Ga0207663_10043013 | Ga0207663_100430133 | 397 |
| 1273 | 3300025917 | Ga0207660_10045233 | Ga0207660_100452332 | 397 |
| 1274 | 3300025928 | Ga0207700_10014082 | Ga0207700_100140822 | 397 |
| 1275 | 3300025931 | Ga0207644_10084012 | Ga0207644_100840121 | 397 |
| 1276 | 3300025936 | Ga0207670_10057512 | Ga0207670_100575123 | 397 |
| 1277 | 3300025972 | Ga0207668_10036309 | Ga0207668_100363092 | 397 |
| 1278 | 3300026075 | Ga0207708_10232340 | Ga0207708_102323401 | 397 |
| 1279 | 3300026095 | Ga0207676_10028462 | Ga0207676_100284621 | 397 |
| 1280 | 3300026118 | Ga0207675_100122629 | Ga0207675_1001226292 | 397 |
| 1281 | 3300031241 | Ga0265325_10000011 | Ga0265325_1000001136 | 397 |
| 1282 | 3300031249 | Ga0265339_10020920 | Ga0265339_100209202 | 397 |
| 1283 | 3300035111 | Ga0373923_0022562 | Ga0373923_0022562_403_1758 | 397 |
| 1284 | 3300035114 | Ga0373939_0006504 | Ga0373939_0006504_372_1718 | 397 |
| 1285 | 3300035117 | Ga0373953_0026835 | Ga0373953_0026835_508_1863 | 397 |
| 1286 | 3300035120 | Ga0373957_0027438 | Ga0373957_0027438_219_1574 | 397 |
| 1287 | 3300035172 | Ga0373955_0007784 | Ga0373955_0007784_1531_2886 | 397 |
| 1288 | 3300035691 | Ga0373931_0011815 | Ga0373931_0011815_1134_2480 | 397 |
| 1289 | 3300035692 | Ga0373935_0018168 | Ga0373935_0018168_889_2244 | 397 |
| 1290 | 3300035695 | Ga0373927_0039932 | Ga0373927_0039932_289_1644 | 397 |
| 1291 | 3300035724 | Ga0373933_0003790 | Ga0373933_0003790_3965_5320 | 397 |
| 1292 | 3300036401 | Ga0373937_0033961 | Ga0373937_0033961_186_1541 | 397 |
| 1293 | 3300037068 | Ga0373925_0009283 | Ga0373925_0009283_1417_2772 | 397 |
| 1294 | 3300041408 | Ga0439453_0001532 | Ga0439453_0001532_493_1836 | 397 |
| 1295 | 3300044684 | Ga0466966_0022724 | Ga0466966_0022724_10_1350 | 397 |
| 1296 | 3300046454 | Ga0495592_0017067 | Ga0495592_0017067_769_2124 | 397 |
| 1297 | 3300046462 | Ga0495651_0062050 | Ga0495651_0062050_39_1394 | 397 |
| 1298 | 3300046463 | Ga0495653_0061879 | Ga0495653_0061879_423_1778 | 397 |
| 1299 | 3300046477 | Ga0495664_0074099 | Ga0495664_0074099_219_1574 | 397 |
| 1300 | 3300046516 | Ga0495628_0002019 | Ga0495628_0002019_4323_5678 | 397 |
| 1301 | 3300046516 | Ga0495628_0066858 | Ga0495628_0066858_20_1366 | 397 |
| 1302 | 3300046529 | Ga0495652_0009055 | Ga0495652_0009055_460_1815 | 397 |
| 1303 | 3300046543 | Ga0495645_0002478 | Ga0495645_0002478_1528_2883 | 397 |
| 1304 | 3300046559 | Ga0495667_0003773 | Ga0495667_0003773_3297_4652 | 397 |
| 1305 | 3300046663 | Ga0495635_0021234 | Ga0495635_0021234_1165_2520 | 397 |
| 1306 | 3300046675 | Ga0495657_0025220 | Ga0495657_0025220_1442_2797 | 397 |
| 1307 | 3300046678 | Ga0495599_0004891 | Ga0495599_0004891_2039_3394 | 397 |
| 1308 | 3300046679 | Ga0495623_0007569 | Ga0495623_0007569_671_2026 | 397 |
| 1309 | 3300046809 | Ga0495600_0007740 | Ga0495600_0007740_4262_5617 | 397 |
| 1310 | 3300047317 | Ga0495604_0001901 | Ga0495604_0001901_10701_12056 | 397 |
| 1311 | 3300047444 | Ga0495675_0011655 | Ga0495675_0011655_1581_2936 | 397 |
| 1312 | 3300047471 | Ga0495684_0023761 | Ga0495684_0023761_519_1874 | 397 |
| 1313 | 3300048088 | Ga0495602_0013293 | Ga0495602_0013293_2620_3975 | 397 |
| 1314 | 3300048903 | Ga0496100_0018641 | Ga0496100_0018641_2724_4070 | 397 |
| 1315 | 3300048904 | Ga0496101_0001461 | Ga0496101_0001461_9276_10622 | 397 |
| 1316 | 3300048907 | Ga0496104_0000067 | Ga0496104_0000067_32267_33622 | 397 |
| 1317 | 3300048907 | Ga0496104_0031348 | Ga0496104_0031348_106_1452 | 397 |
| 1318 | 3300048908 | Ga0496105_0006553 | Ga0496105_0006553_5730_7085 | 397 |
| 1319 | 3300048908 | Ga0496105_0066956 | Ga0496105_0066956_1316_2662 | 397 |
| 1320 | 3300048909 | Ga0496106_0028442 | Ga0496106_0028442_1877_3223 | 397 |
| 1321 | 3300048910 | Ga0496107_0127156 | Ga0496107_0127156_69_1415 | 397 |
| 1322 | 3300048911 | Ga0496108_0005206 | Ga0496108_0005206_766_2112 | 397 |
| 1323 | 3300048912 | Ga0496109_0054274 | Ga0496109_0054274_1506_2852 | 397 |
| 1324 | 3300048916 | Ga0496113_0069310 | Ga0496113_0069310_421_1767 | 397 |
| 1325 | 3300048917 | Ga0496114_0019417 | Ga0496114_0019417_3204_4559 | 397 |
| 1326 | 3300048917 | Ga0496114_0032419 | Ga0496114_0032419_958_2304 | 397 |
| 1327 | 3300049568 | Ga0501031_0024114 | Ga0501031_0024114_401_1744 | 397 |
| 1328 | 3300049570 | Ga0501033_0024751 | Ga0501033_0024751_1799_3142 | 397 |
| 1329 | 3300049571 | Ga0501034_0014630 | Ga0501034_0014630_3368_4711 | 397 |
| 1330 | 3300049572 | Ga0501036_0005528 | Ga0501036_0005528_6081_7424 | 397 |
| 1331 | 3300049573 | Ga0501037_0004329 | Ga0501037_0004329_2270_3613 | 397 |
| 1332 | 3300049574 | Ga0501038_0127911 | Ga0501038_0127911_106_1458 | 397 |
| 1333 | 3300049574 | Ga0501038_0144129 | Ga0501038_0144129_358_1701 | 397 |
| 1334 | 3300049575 | Ga0501039_0020438 | Ga0501039_0020438_395_1738 | 397 |
| 1335 | 3300049579 | Ga0501043_0026048 | Ga0501043_0026048_2800_4143 | 397 |
| 1336 | 3300049580 | Ga0501046_0001179 | Ga0501046_0001179_10400_11743 | 397 |
| 1337 | 3300049581 | Ga0501047_0040143 | Ga0501047_0040143_1385_2728 | 397 |
| 1338 | 3300049583 | Ga0501067_0010712 | Ga0501067_0010712_1417_2760 | 397 |
| 1339 | 3300049585 | Ga0501069_0001495 | Ga0501069_0001495_4622_5965 | 397 |
| 1340 | 3300049586 | Ga0501070_0067697 | Ga0501070_0067697_358_1701 | 397 |
| 1341 | 3300049588 | Ga0501072_0076632 | Ga0501072_0076632_435_1778 | 397 |
| 1342 | 3300049589 | Ga0501073_0049159 | Ga0501073_0049159_1257_2600 | 397 |
| 1343 | 3300049590 | Ga0501074_0004007 | Ga0501074_0004007_6884_8227 | 397 |
| 1344 | 3300049741 | Ga0501079_0036203 | Ga0501079_0036203_1008_2351 | 397 |
| 1345 | 3300049742 | Ga0501080_0039526 | Ga0501080_0039526_1803_3146 | 397 |
| 1346 | 3300049744 | Ga0501083_0009206 | Ga0501083_0009206_5190_6533 | 397 |
| 1347 | 3300049823 | Ga0501044_0000411 | Ga0501044_0000411_42583_43935 | 397 |
| 1348 | 3300049823 | Ga0501044_0037724 | Ga0501044_0037724_1908_3251 | 397 |
| 1349 | 3300049824 | Ga0501045_0044118 | Ga0501045_0044118_316_1659 | 397 |
| 1350 | 3300050496 | nmdc:mga07m45_92793_c1 | nmdc:mga07m45_92793_c1_221_1567 | 397 |
| 1351 | 3300050511 | nmdc:mga08y16_140156_c1 | nmdc:mga08y16_140156_c1_518_1855 | 397 |
| 1352 | 3300053077 | Ga0495601_0000482 | Ga0495601_0000482_456_1811 | 397 |
| 1353 | 3300053077 | Ga0495601_0058528 | Ga0495601_0058528_92_1432 | 397 |
| 1354 | 3300053078 | Ga0495612_0000671 | Ga0495612_0000671_11047_12402 | 397 |
| 1355 | 3300053084 | Ga0495595_0004391 | Ga0495595_0004391_1472_2827 | 397 |
| 1356 | 3300053084 | Ga0495595_0028307 | Ga0495595_0028307_1003_2343 | 397 |
| 1357 | 3300053085 | Ga0495619_0006508 | Ga0495619_0006508_1022_2377 | 397 |
| 1358 | 3300054114 | Ga0501084_0053125 | Ga0501084_0053125_441_1784 | 397 |
| 1359 | 3300060353 | Ga0501082_0011519 | Ga0501082_0011519_1372_2715 | 397 |
| 1360 | 3300061719 | Ga0466962_0057962 | Ga0466962_0057962_10_1350 | 397 |
| 1361 | 3300001977 | JGI24746J21847_1001865 | JGI24746J21847_10018653 | 398 |
| 1362 | 3300005435 | Ga0070714_100094615 | Ga0070714_1000946152 | 398 |
| 1363 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002327 | 398 |
| 1364 | 3300025939 | Ga0207665_10031554 | Ga0207665_100315543 | 398 |
| 1365 | 3300037312 | Ga0395899_0083518 | Ga0395899_0083518_293_1636 | 398 |
| 1366 | 3300037418 | Ga0395900_0112730 | Ga0395900_0112730_1233_2576 | 398 |
| 1367 | 3300037418 | Ga0395900_0167688 | Ga0395900_0167688_638_2056 | 398 |
| 1368 | 3300037466 | Ga0395898_0094620 | Ga0395898_0094620_1356_2699 | 398 |
| 1369 | 3300037466 | Ga0395898_0166056 | Ga0395898_0166056_236_1579 | 398 |
| 1370 | 3300038443 | Ga0395901_0159547 | Ga0395901_0159547_729_2072 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.8796 | 12 | 96 |
| 2frx-assembly2.cif.gz_B | crystal structure of yebu, a m5c rna methyltransferase from e.coli | 0.8607 | 110 | 398 |
| 1sqg-assembly1.cif.gz_A | the crystal structure of the e. coli fmu apoenzyme at 1.65 a resolution | 0.8476 | 5 | 394 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.8401 | 12 | 96 |
| 3m6w-assembly1.cif.gz_A | multi-site-specific 16s rrna methyltransferase rsmf from thermus thermophilus in space group p21212 in complex with s-adenosyl-l-methionine | 0.8385 | 110 | 398 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ67_236_433_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9252 | 193 | 396 | 3.40.50.150 |
| af_Q651X9_102_252_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9144 | 6 | 96 | 1.10.940.10 |
| 1sqgA01 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9134 | 5 | 96 | 1.10.940.10 |
| af_Q8VYC4_72_208_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9096 | 6 | 96 | 1.10.940.10 |
| 2yxlA04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9075 | 186 | 394 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D7AZ78-F1-model_v4 | Methyltransferase domain-containing protein | 0.9845 | 5 | 395 |
GO:0001510
GO:0003723 GO:0006355 GO:0008173 |
| AF-A0A1T4T5I6-F1-model_v4 | 16S rRNA (Cytosine967-C5)-methyltransferase | 0.9787 | 5 | 397 |
GO:0001510
GO:0003723 GO:0006355 GO:0008173 |
| AF-A0A0N1L9Y0-F1-model_v4 | MFS transporter | 0.9781 | 5 | 395 |
GO:0001510
GO:0003723 GO:0006355 GO:0008173 |
| AF-A0A7Y4TC47-F1-model_v4 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | 0.9765 | 176 | 397 |
GO:0001510
GO:0003723 GO:0008173 |
| AF-A0A1H1HPK7-F1-model_v4 | 16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176) (16S rRNA m5C967 methyltransferase) (rRNA (cytosine-C(5)-)-methyltransferase RsmB) | 0.9751 | 6 | 396 |
GO:0003723
GO:0005737 GO:0006355 GO:0008649 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar