F493406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 515 | 2740 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300025315|Ga0207697_10173236|Ga0207697_101732362 |
| Length | 162 |
| Sequence | MFSSRDAFENDFCPVRDELLGEMYRANANGLPLLVESVSSEVRAMLALFCYRRSHLHALAIAIAASCTERELIQLGGRVGSTLYALSREPSARLNAGGNGMWPTPSVRRSAMDQAATTPFCQRTATVKPSCGPSRAVVRMTISPGRSDTTSASLAVAPWLPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 123 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 221 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 246 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 276 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 286 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 287 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 290 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 293 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 430 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 431 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 433 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 434 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 436 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 453 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 455 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 456 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 458 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 459 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 460 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 461 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 462 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 463 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 464 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 466 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 468 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 469 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 470 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 471 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 476 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 481 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 482 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 484 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 485 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 486 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 487 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 490 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 491 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 492 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 493 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 495 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 496 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 499 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 501 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 502 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 504 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 505 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 506 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 507 | 2791355199 | |||
| 508 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 509 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 510 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 511 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 512 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 513 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 514 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 515 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.07 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.4 |
| Nodule | 0.73 |
| Rhizoplane | 6.79 |
| Rhizosphere | 70.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207697_10173236 | 3300025315 | Bacteria | 944 |
| 2 | JGI24740J21852_10002607 | 3300001979 | Bacteria | 8132 |
| 3 | JGI24737J22298_10001898 | 3300001990 | Bacteria | 7467 |
| 4 | JGI25153J46596_10009239 | 3300003215 | Bacteria | 4612 |
| 5 | JGI25153J46596_10049944 | 3300003215 | Bacteria | 1210 |
| 6 | JGI25404J52841_10027072 | 3300003659 | Bacteria | 1234 |
| 7 | Ga0055526_1025121 | 3300003771 | Bacteria | 1921 |
| 8 | Ga0055531_10009160 | 3300003794 | Bacteria | 5102 |
| 9 | JGI25405J52794_10157879 | 3300003911 | Bacteria | 518 |
| 10 | Ga0065707_10558919 | 3300005295 | Bacteria | 716 |
| 11 | Ga0070658_10100992 | 3300005327 | Bacteria | 2385 |
| 12 | Ga0070676_10238053 | 3300005328 | Bacteria | 1209 |
| 13 | Ga0070676_10452910 | 3300005328 | Bacteria | 903 |
| 14 | Ga0070683_100011764 | 3300005329 | Bacteria | 7577 |
| 15 | Ga0070683_100042556 | 3300005329 | Bacteria | 4182 |
| 16 | Ga0070683_100293769 | 3300005329 | Bacteria | 1546 |
| 17 | Ga0070683_100546919 | 3300005329 | Bacteria | 1107 |
| 18 | Ga0070690_100085765 | 3300005330 | Bacteria | 2066 |
| 19 | Ga0070670_100196564 | 3300005331 | Bacteria | 1752 |
| 20 | Ga0068869_100131879 | 3300005334 | Bacteria | 1921 |
| 21 | Ga0070666_10473873 | 3300005335 | Bacteria | 906 |
| 22 | Ga0070666_11236078 | 3300005335 | Bacteria | 557 |
| 23 | Ga0070680_100017794 | 3300005336 | Bacteria | 5606 |
| 24 | Ga0070680_100086383 | 3300005336 | Bacteria | 2593 |
| 25 | Ga0070680_100442713 | 3300005336 | Bacteria | 1109 |
| 26 | Ga0070680_101376302 | 3300005336 | Bacteria | 611 |
| 27 | Ga0070682_100023695 | 3300005337 | Bacteria | 3646 |
| 28 | Ga0070682_100286173 | 3300005337 | Bacteria | 1203 |
| 29 | Ga0070682_100381939 | 3300005337 | Bacteria | 1060 |
| 30 | Ga0070682_100592564 | 3300005337 | Bacteria | 874 |
| 31 | Ga0068868_100095954 | 3300005338 | Bacteria | 2394 |
| 32 | Ga0068868_100213716 | 3300005338 | Bacteria | 1613 |
| 33 | Ga0068868_100786078 | 3300005338 | Bacteria | 858 |
| 34 | Ga0068868_101023399 | 3300005338 | Bacteria | 757 |
| 35 | Ga0070660_100003692 | 3300005339 | Bacteria | 10562 |
| 36 | Ga0070660_100284016 | 3300005339 | Bacteria | 1354 |
| 37 | Ga0070660_100402327 | 3300005339 | Bacteria | 1132 |
| 38 | Ga0070660_100896244 | 3300005339 | Bacteria | 748 |
| 39 | Ga0070660_101032243 | 3300005339 | Bacteria | 695 |
| 40 | Ga0070691_10025378 | 3300005341 | Bacteria | 2759 |
| 41 | Ga0070691_10135098 | 3300005341 | Bacteria | 1253 |
| 42 | Ga0070661_100073128 | 3300005344 | Bacteria | 2524 |
| 43 | Ga0070661_100214975 | 3300005344 | Bacteria | 1473 |
| 44 | Ga0070692_10896759 | 3300005345 | Bacteria | 613 |
| 45 | Ga0070668_100041713 | 3300005347 | Bacteria | 3516 |
| 46 | Ga0070668_100395873 | 3300005347 | Bacteria | 1178 |
| 47 | Ga0070668_100445383 | 3300005347 | Bacteria | 1112 |
| 48 | Ga0070668_100550143 | 3300005347 | Bacteria | 1004 |
| 49 | Ga0070668_100589350 | 3300005347 | Bacteria | 971 |
| 50 | Ga0070668_101053579 | 3300005347 | Bacteria | 732 |
| 51 | Ga0070669_101218043 | 3300005353 | Bacteria | 650 |
| 52 | Ga0070669_101237207 | 3300005353 | Bacteria | 645 |
| 53 | Ga0070669_101569545 | 3300005353 | Bacteria | 573 |
| 54 | Ga0070675_100848577 | 3300005354 | Bacteria | 836 |
| 55 | Ga0070675_100966353 | 3300005354 | Bacteria | 782 |
| 56 | Ga0070671_100140650 | 3300005355 | Bacteria | 2037 |
| 57 | Ga0070671_100335302 | 3300005355 | Bacteria | 1289 |
| 58 | Ga0070671_100544137 | 3300005355 | Bacteria | 1001 |
| 59 | Ga0070674_100309728 | 3300005356 | Bacteria | 1262 |
| 60 | Ga0070674_100831361 | 3300005356 | Bacteria | 800 |
| 61 | Ga0070674_101054772 | 3300005356 | Bacteria | 716 |
| 62 | Ga0070673_100187022 | 3300005364 | Bacteria | 1776 |
| 63 | Ga0070673_100305549 | 3300005364 | Bacteria | 1402 |
| 64 | Ga0070673_100865785 | 3300005364 | Bacteria | 837 |
| 65 | Ga0070673_100886820 | 3300005364 | Bacteria | 827 |
| 66 | Ga0070673_101339807 | 3300005364 | Bacteria | 673 |
| 67 | Ga0070688_101021535 | 3300005365 | Bacteria | 658 |
| 68 | Ga0070659_100114311 | 3300005366 | Bacteria | 2180 |
| 69 | Ga0070659_100408717 | 3300005366 | Bacteria | 1147 |
| 70 | Ga0070659_102109478 | 3300005366 | Bacteria | 507 |
| 71 | Ga0070667_100387923 | 3300005367 | Bacteria | 1270 |
| 72 | Ga0070667_100832480 | 3300005367 | Bacteria | 858 |
| 73 | Ga0070667_101235666 | 3300005367 | Bacteria | 699 |
| 74 | Ga0070667_101456985 | 3300005367 | Bacteria | 643 |
| 75 | Ga0070703_10057966 | 3300005406 | Bacteria | 1259 |
| 76 | Ga0070709_10003406 | 3300005434 | Bacteria | 8539 |
| 77 | Ga0070714_100004471 | 3300005435 | Bacteria | 10536 |
| 78 | Ga0070714_100010483 | 3300005435 | Bacteria | 7324 |
| 79 | Ga0070713_100010463 | 3300005436 | Bacteria | 6700 |
| 80 | Ga0070713_100024195 | 3300005436 | Bacteria | 4727 |
| 81 | Ga0070713_100054553 | 3300005436 | Bacteria | 3316 |
| 82 | Ga0070713_100181775 | 3300005436 | Bacteria | 1890 |
| 83 | Ga0070713_100743935 | 3300005436 | Bacteria | 938 |
| 84 | Ga0070713_101238075 | 3300005436 | Bacteria | 723 |
| 85 | Ga0070710_10370455 | 3300005437 | Bacteria | 953 |
| 86 | Ga0070701_10069119 | 3300005438 | Bacteria | 1883 |
| 87 | Ga0070711_100002277 | 3300005439 | Bacteria | 10885 |
| 88 | Ga0070700_100179938 | 3300005441 | Bacteria | 1471 |
| 89 | Ga0070700_100321171 | 3300005441 | Bacteria | 1137 |
| 90 | Ga0070700_101371046 | 3300005441 | Bacteria | 597 |
| 91 | Ga0070663_100004275 | 3300005455 | Bacteria | 8359 |
| 92 | Ga0070663_100096128 | 3300005455 | Bacteria | 2203 |
| 93 | Ga0070663_100152961 | 3300005455 | Bacteria | 1770 |
| 94 | Ga0070663_100174511 | 3300005455 | Bacteria | 1663 |
| 95 | Ga0070663_100906726 | 3300005455 | Bacteria | 762 |
| 96 | Ga0070678_100018412 | 3300005456 | Bacteria | 4525 |
| 97 | Ga0070678_100051193 | 3300005456 | Bacteria | 2992 |
| 98 | Ga0070678_100069727 | 3300005456 | Bacteria | 2626 |
| 99 | Ga0070678_100147771 | 3300005456 | Bacteria | 1889 |
| 100 | Ga0070662_100103279 | 3300005457 | Bacteria | 2161 |
| 101 | Ga0070662_100348139 | 3300005457 | Bacteria | 1213 |
| 102 | Ga0070662_100634142 | 3300005457 | Bacteria | 901 |
| 103 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 104 | Ga0070681_10007888 | 3300005458 | Bacteria | 10418 |
| 105 | Ga0070681_10049606 | 3300005458 | Bacteria | 4191 |
| 106 | Ga0070681_10087304 | 3300005458 | Bacteria | 3072 |
| 107 | Ga0070681_10224288 | 3300005458 | Bacteria | 1794 |
| 108 | Ga0070681_10641873 | 3300005458 | Bacteria | 976 |
| 109 | Ga0070681_11718644 | 3300005458 | Bacteria | 554 |
| 110 | Ga0068867_100233957 | 3300005459 | Bacteria | 1487 |
| 111 | Ga0068867_100379654 | 3300005459 | Bacteria | 1187 |
| 112 | Ga0068867_100804010 | 3300005459 | Bacteria | 839 |
| 113 | Ga0070706_100281577 | 3300005467 | Bacteria | 1552 |
| 114 | Ga0070706_100891922 | 3300005467 | Bacteria | 822 |
| 115 | Ga0070698_100231594 | 3300005471 | Bacteria | 1780 |
| 116 | Ga0070679_100039460 | 3300005530 | Bacteria | 4692 |
| 117 | Ga0070679_100195311 | 3300005530 | Bacteria | 1991 |
| 118 | Ga0070679_100285758 | 3300005530 | Bacteria | 1601 |
| 119 | Ga0070679_101179880 | 3300005530 | Bacteria | 711 |
| 120 | Ga0070684_100001671 | 3300005535 | Bacteria | 16123 |
| 121 | Ga0070684_100003951 | 3300005535 | Bacteria | 11230 |
| 122 | Ga0070684_101263467 | 3300005535 | Bacteria | 695 |
| 123 | Ga0070697_100040193 | 3300005536 | Bacteria | 3783 |
| 124 | Ga0068853_100009612 | 3300005539 | Bacteria | 7791 |
| 125 | Ga0068853_100025909 | 3300005539 | Bacteria | 4922 |
| 126 | Ga0068853_100124111 | 3300005539 | Bacteria | 2306 |
| 127 | Ga0068853_100139885 | 3300005539 | Bacteria | 2173 |
| 128 | Ga0068853_100440700 | 3300005539 | Bacteria | 1224 |
| 129 | Ga0068853_100523859 | 3300005539 | Bacteria | 1121 |
| 130 | Ga0068853_100688251 | 3300005539 | Bacteria | 975 |
| 131 | Ga0070672_100074181 | 3300005543 | Bacteria | 2713 |
| 132 | Ga0070672_100148648 | 3300005543 | Bacteria | 1937 |
| 133 | Ga0070686_100578983 | 3300005544 | Bacteria | 882 |
| 134 | Ga0070695_101371784 | 3300005545 | Bacteria | 586 |
| 135 | Ga0070696_100794389 | 3300005546 | Bacteria | 778 |
| 136 | Ga0070693_100147363 | 3300005547 | Bacteria | 1487 |
| 137 | Ga0070665_100006775 | 3300005548 | Bacteria | 11646 |
| 138 | Ga0070665_100012547 | 3300005548 | Bacteria | 8534 |
| 139 | Ga0070665_100156769 | 3300005548 | Bacteria | 2278 |
| 140 | Ga0070665_100167886 | 3300005548 | Bacteria | 2196 |
| 141 | Ga0070665_100252716 | 3300005548 | Bacteria | 1763 |
| 142 | Ga0070665_100538598 | 3300005548 | Bacteria | 1179 |
| 143 | Ga0070665_100653078 | 3300005548 | Bacteria | 1065 |
| 144 | Ga0070665_101202722 | 3300005548 | Bacteria | 769 |
| 145 | Ga0070704_100466046 | 3300005549 | Bacteria | 1091 |
| 146 | Ga0070704_101826829 | 3300005549 | Bacteria | 563 |
| 147 | Ga0068855_100027307 | 3300005563 | Bacteria | 6830 |
| 148 | Ga0068855_100067619 | 3300005563 | Bacteria | 4161 |
| 149 | Ga0068855_100076573 | 3300005563 | Bacteria | 3882 |
| 150 | Ga0068855_100090289 | 3300005563 | Bacteria | 3536 |
| 151 | Ga0068855_100177986 | 3300005563 | Bacteria | 2405 |
| 152 | Ga0068855_100186937 | 3300005563 | Bacteria | 2339 |
| 153 | Ga0068855_100212522 | 3300005563 | Bacteria | 2173 |
| 154 | Ga0070664_100049486 | 3300005564 | Bacteria | 3555 |
| 155 | Ga0070664_100159004 | 3300005564 | Bacteria | 1998 |
| 156 | Ga0070664_101585966 | 3300005564 | Bacteria | 620 |
| 157 | Ga0068857_100007471 | 3300005577 | Bacteria | 9410 |
| 158 | Ga0068857_100013087 | 3300005577 | Bacteria | 7230 |
| 159 | Ga0068857_100038262 | 3300005577 | Bacteria | 4248 |
| 160 | Ga0068857_100244908 | 3300005577 | Bacteria | 1642 |
| 161 | Ga0068857_100435988 | 3300005577 | Bacteria | 1223 |
| 162 | Ga0068854_100024624 | 3300005578 | Bacteria | 4124 |
| 163 | Ga0068854_100601709 | 3300005578 | Bacteria | 939 |
| 164 | Ga0068854_100921927 | 3300005578 | Bacteria | 769 |
| 165 | Ga0068856_100566037 | 3300005614 | Bacteria | 1158 |
| 166 | Ga0068856_100913878 | 3300005614 | Bacteria | 896 |
| 167 | Ga0068856_101603708 | 3300005614 | Bacteria | 664 |
| 168 | Ga0068856_101692440 | 3300005614 | Bacteria | 645 |
| 169 | Ga0070702_100056835 | 3300005615 | Bacteria | 2262 |
| 170 | Ga0068852_100023307 | 3300005616 | Bacteria | 4981 |
| 171 | Ga0068852_100067778 | 3300005616 | Bacteria | 3121 |
| 172 | Ga0068852_100088449 | 3300005616 | Bacteria | 2767 |
| 173 | Ga0068852_100294178 | 3300005616 | Bacteria | 1570 |
| 174 | Ga0068852_102375087 | 3300005616 | Bacteria | 551 |
| 175 | Ga0068859_100036471 | 3300005617 | Bacteria | 4936 |
| 176 | Ga0068859_100128727 | 3300005617 | Bacteria | 2602 |
| 177 | Ga0068864_100186634 | 3300005618 | Bacteria | 1898 |
| 178 | Ga0068864_100795912 | 3300005618 | Bacteria | 929 |
| 179 | Ga0068866_10030173 | 3300005718 | Bacteria | 2600 |
| 180 | Ga0068866_10291203 | 3300005718 | Bacteria | 1016 |
| 181 | Ga0068861_100093110 | 3300005719 | Bacteria | 2382 |
| 182 | Ga0068861_100310549 | 3300005719 | Bacteria | 1369 |
| 183 | Ga0068861_100319113 | 3300005719 | Bacteria | 1352 |
| 184 | Ga0068861_101215064 | 3300005719 | Bacteria | 729 |
| 185 | Ga0068851_10009555 | 3300005834 | Bacteria | 4514 |
| 186 | Ga0068851_10477632 | 3300005834 | Bacteria | 745 |
| 187 | Ga0068870_10035691 | 3300005840 | Bacteria | 2553 |
| 188 | Ga0068870_10508534 | 3300005840 | Bacteria | 804 |
| 189 | Ga0068863_101521688 | 3300005841 | Bacteria | 678 |
| 190 | Ga0068863_101770099 | 3300005841 | Bacteria | 628 |
| 191 | Ga0068858_100066851 | 3300005842 | Bacteria | 3329 |
| 192 | Ga0068858_100364369 | 3300005842 | Bacteria | 1385 |
| 193 | Ga0068860_100071594 | 3300005843 | Bacteria | 3294 |
| 194 | Ga0068860_100226177 | 3300005843 | Bacteria | 1817 |
| 195 | Ga0068860_100280008 | 3300005843 | Bacteria | 1629 |
| 196 | Ga0068860_100370438 | 3300005843 | Bacteria | 1412 |
| 197 | Ga0068862_100084042 | 3300005844 | Bacteria | 2765 |
| 198 | Ga0068862_100105209 | 3300005844 | Bacteria | 2473 |
| 199 | Ga0068862_100223020 | 3300005844 | Bacteria | 1707 |
| 200 | Ga0068862_100575299 | 3300005844 | Bacteria | 1078 |
| 201 | Ga0068862_100841792 | 3300005844 | Bacteria | 898 |
| 202 | Ga0068862_101133275 | 3300005844 | Bacteria | 778 |
| 203 | Ga0081455_10005341 | 3300005937 | Bacteria | 14109 |
| 204 | Ga0081455_10006340 | 3300005937 | Bacteria | 12701 |
| 205 | Ga0081455_10059374 | 3300005937 | Bacteria | 3230 |
| 206 | Ga0081538_10048792 | 3300005981 | Bacteria | 2577 |
| 207 | Ga0081540_1012552 | 3300005983 | Bacteria | 5567 |
| 208 | Ga0081540_1028527 | 3300005983 | Bacteria | 3132 |
| 209 | Ga0081540_1040553 | 3300005983 | Bacteria | 2426 |
| 210 | Ga0081539_10002599 | 3300005985 | Bacteria | 24763 |
| 211 | Ga0070717_10001116 | 3300006028 | Bacteria | 18122 |
| 212 | Ga0070717_10112278 | 3300006028 | Bacteria | 2326 |
| 213 | Ga0070717_10234107 | 3300006028 | Bacteria | 1618 |
| 214 | Ga0075365_10005412 | 3300006038 | Bacteria | 6880 |
| 215 | Ga0075365_10007226 | 3300006038 | Bacteria | 6204 |
| 216 | Ga0075365_10010923 | 3300006038 | Bacteria | 5317 |
| 217 | Ga0075365_10053667 | 3300006038 | Bacteria | 2670 |
| 218 | Ga0075365_10104277 | 3300006038 | Bacteria | 1944 |
| 219 | Ga0075365_10217461 | 3300006038 | Bacteria | 1340 |
| 220 | Ga0075368_10024079 | 3300006042 | Bacteria | 2329 |
| 221 | Ga0075368_10050344 | 3300006042 | Bacteria | 1654 |
| 222 | Ga0075363_100053455 | 3300006048 | Bacteria | 2158 |
| 223 | Ga0075363_100095281 | 3300006048 | Bacteria | 1642 |
| 224 | Ga0075363_100214719 | 3300006048 | Bacteria | 1101 |
| 225 | Ga0075364_10056964 | 3300006051 | Bacteria | 2559 |
| 226 | Ga0075364_10103254 | 3300006051 | Bacteria | 1898 |
| 227 | Ga0075364_10209244 | 3300006051 | Bacteria | 1323 |
| 228 | Ga0075364_10714455 | 3300006051 | Bacteria | 684 |
| 229 | Ga0075364_10726323 | 3300006051 | Bacteria | 678 |
| 230 | Ga0075432_10013645 | 3300006058 | Bacteria | 2761 |
| 231 | Ga0070716_100254125 | 3300006173 | Bacteria | 1199 |
| 232 | Ga0070712_100219332 | 3300006175 | Bacteria | 1505 |
| 233 | Ga0070712_101382812 | 3300006175 | Bacteria | 614 |
| 234 | Ga0075362_10015472 | 3300006177 | Bacteria | 3103 |
| 235 | Ga0075362_10065296 | 3300006177 | Bacteria | 1652 |
| 236 | Ga0075362_10291249 | 3300006177 | Bacteria | 809 |
| 237 | Ga0075362_10366428 | 3300006177 | Bacteria | 723 |
| 238 | Ga0075362_10469750 | 3300006177 | Bacteria | 641 |
| 239 | Ga0075367_10039353 | 3300006178 | Bacteria | 2756 |
| 240 | Ga0075367_10089603 | 3300006178 | Bacteria | 1870 |
| 241 | Ga0075367_10120989 | 3300006178 | Bacteria | 1613 |
| 242 | Ga0075367_10135636 | 3300006178 | Bacteria | 1522 |
| 243 | Ga0075367_10144501 | 3300006178 | Bacteria | 1474 |
| 244 | Ga0075367_10316984 | 3300006178 | Bacteria | 982 |
| 245 | Ga0075367_10702205 | 3300006178 | Bacteria | 643 |
| 246 | Ga0075367_10758596 | 3300006178 | Bacteria | 617 |
| 247 | Ga0075369_10009026 | 3300006186 | Bacteria | 3859 |
| 248 | Ga0075369_10020531 | 3300006186 | Bacteria | 2705 |
| 249 | Ga0075369_10038747 | 3300006186 | Bacteria | 2034 |
| 250 | Ga0075369_10228126 | 3300006186 | Bacteria | 863 |
| 251 | Ga0075366_10131148 | 3300006195 | Bacteria | 1513 |
| 252 | Ga0075366_10316323 | 3300006195 | Bacteria | 956 |
| 253 | Ga0075366_10667824 | 3300006195 | Bacteria | 645 |
| 254 | Ga0097621_100061585 | 3300006237 | Bacteria | 3078 |
| 255 | Ga0097621_100384130 | 3300006237 | Bacteria | 1255 |
| 256 | Ga0097621_100508629 | 3300006237 | Bacteria | 1092 |
| 257 | Ga0097621_100912547 | 3300006237 | Bacteria | 819 |
| 258 | Ga0097621_101004074 | 3300006237 | Bacteria | 781 |
| 259 | Ga0075370_10013335 | 3300006353 | Bacteria | 4365 |
| 260 | Ga0075370_10337151 | 3300006353 | Bacteria | 899 |
| 261 | Ga0068871_100553775 | 3300006358 | Bacteria | 1042 |
| 262 | Ga0075428_100226864 | 3300006844 | Bacteria | 2016 |
| 263 | Ga0075434_100009502 | 3300006871 | Bacteria | 9071 |
| 264 | Ga0068865_100126938 | 3300006881 | Bacteria | 1905 |
| 265 | Ga0068865_100156609 | 3300006881 | Bacteria | 1733 |
| 266 | Ga0068865_100177836 | 3300006881 | Bacteria | 1636 |
| 267 | Ga0075436_100568533 | 3300006914 | Bacteria | 833 |
| 268 | Ga0097620_100036468 | 3300006931 | Bacteria | 4936 |
| 269 | Ga0097620_100128729 | 3300006931 | Bacteria | 2602 |
| 270 | Ga0099823_1036587 | 3300006944 | Bacteria | 3760 |
| 271 | Ga0075435_100200434 | 3300007076 | Bacteria | 1691 |
| 272 | Ga0099794_10002476 | 3300007265 | Bacteria | 6813 |
| 273 | Ga0099794_10085426 | 3300007265 | Bacteria | 1561 |
| 274 | Ga0099794_10098702 | 3300007265 | Bacteria | 1456 |
| 275 | Ga0099795_10001129 | 3300007788 | Bacteria | 5569 |
| 276 | Ga0099795_10013742 | 3300007788 | Bacteria | 2493 |
| 277 | Ga0099795_10019144 | 3300007788 | Bacteria | 2210 |
| 278 | Ga0099795_10128202 | 3300007788 | Bacteria | 1021 |
| 279 | Ga0099795_10228721 | 3300007788 | Bacteria | 794 |
| 280 | Ga0105251_10433864 | 3300009011 | Bacteria | 607 |
| 281 | Ga0105250_10026826 | 3300009092 | Bacteria | 2321 |
| 282 | Ga0105240_10001631 | 3300009093 | Bacteria | 38066 |
| 283 | Ga0105240_10002788 | 3300009093 | Bacteria | 27630 |
| 284 | Ga0105240_10008633 | 3300009093 | Bacteria | 14558 |
| 285 | Ga0105240_10019828 | 3300009093 | Bacteria | 8981 |
| 286 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 287 | Ga0105240_10071475 | 3300009093 | Bacteria | 4291 |
| 288 | Ga0105240_10134875 | 3300009093 | Bacteria | 2957 |
| 289 | Ga0105240_10168470 | 3300009093 | Bacteria | 2596 |
| 290 | Ga0105240_10466580 | 3300009093 | Bacteria | 1410 |
| 291 | Ga0105240_11323547 | 3300009093 | Bacteria | 759 |
| 292 | Ga0105240_12010928 | 3300009093 | Bacteria | 600 |
| 293 | Ga0111539_10014399 | 3300009094 | Bacteria | 9872 |
| 294 | Ga0111539_11170263 | 3300009094 | Bacteria | 893 |
| 295 | Ga0105245_10077857 | 3300009098 | Bacteria | 3024 |
| 296 | Ga0105245_10730984 | 3300009098 | Bacteria | 1025 |
| 297 | Ga0105245_12081666 | 3300009098 | Bacteria | 621 |
| 298 | Ga0105247_10126721 | 3300009101 | Bacteria | 1660 |
| 299 | Ga0105247_10129484 | 3300009101 | Bacteria | 1643 |
| 300 | Ga0105247_10358656 | 3300009101 | Bacteria | 1027 |
| 301 | Ga0105247_10574376 | 3300009101 | Bacteria | 832 |
| 302 | Ga0114129_10168882 | 3300009147 | Bacteria | 2984 |
| 303 | Ga0105243_10101927 | 3300009148 | Bacteria | 2384 |
| 304 | Ga0105243_10447974 | 3300009148 | Bacteria | 1210 |
| 305 | Ga0105243_10729377 | 3300009148 | Bacteria | 969 |
| 306 | Ga0105243_10943835 | 3300009148 | Bacteria | 861 |
| 307 | Ga0105241_10016343 | 3300009174 | Bacteria | 5442 |
| 308 | Ga0105241_10496041 | 3300009174 | Bacteria | 1088 |
| 309 | Ga0105241_10865338 | 3300009174 | Bacteria | 837 |
| 310 | Ga0105241_11440924 | 3300009174 | Bacteria | 661 |
| 311 | Ga0105241_12111740 | 3300009174 | Bacteria | 557 |
| 312 | Ga0105242_10181907 | 3300009176 | Bacteria | 1855 |
| 313 | Ga0105242_11039166 | 3300009176 | Bacteria | 829 |
| 314 | Ga0105242_11688964 | 3300009176 | Bacteria | 669 |
| 315 | Ga0105248_10042051 | 3300009177 | Bacteria | 5125 |
| 316 | Ga0105248_10361346 | 3300009177 | Bacteria | 1634 |
| 317 | Ga0105237_10021125 | 3300009545 | Bacteria | 6697 |
| 318 | Ga0105237_10027168 | 3300009545 | Bacteria | 5845 |
| 319 | Ga0105237_10030221 | 3300009545 | Bacteria | 5505 |
| 320 | Ga0105237_10054084 | 3300009545 | Bacteria | 4023 |
| 321 | Ga0105237_10179886 | 3300009545 | Bacteria | 2115 |
| 322 | Ga0105237_10608729 | 3300009545 | Bacteria | 1099 |
| 323 | Ga0105237_10733765 | 3300009545 | Bacteria | 994 |
| 324 | Ga0105237_11433480 | 3300009545 | Bacteria | 697 |
| 325 | Ga0105238_10002394 | 3300009551 | Bacteria | 18807 |
| 326 | Ga0105238_10004666 | 3300009551 | Bacteria | 13561 |
| 327 | Ga0105238_10006268 | 3300009551 | Bacteria | 11820 |
| 328 | Ga0105238_10007999 | 3300009551 | Bacteria | 10578 |
| 329 | Ga0105238_10332213 | 3300009551 | Bacteria | 1507 |
| 330 | Ga0105238_11218272 | 3300009551 | Bacteria | 777 |
| 331 | Ga0105238_11556123 | 3300009551 | Bacteria | 691 |
| 332 | Ga0105249_11475125 | 3300009553 | Bacteria | 752 |
| 333 | Ga0099796_10039140 | 3300010159 | Bacteria | 1594 |
| 334 | Ga0099796_10094634 | 3300010159 | Bacteria | 1115 |
| 335 | Ga0099796_10544448 | 3300010159 | Bacteria | 522 |
| 336 | Ga0105239_10016677 | 3300010375 | Bacteria | 8120 |
| 337 | Ga0105239_10017503 | 3300010375 | Bacteria | 7926 |
| 338 | Ga0105239_10070257 | 3300010375 | Bacteria | 3846 |
| 339 | Ga0105239_10070346 | 3300010375 | Bacteria | 3844 |
| 340 | Ga0105239_10347613 | 3300010375 | Bacteria | 1674 |
| 341 | Ga0105239_10547906 | 3300010375 | Bacteria | 1317 |
| 342 | Ga0105239_10683011 | 3300010375 | Bacteria | 1173 |
| 343 | Ga0105239_11317365 | 3300010375 | Bacteria | 833 |
| 344 | Ga0105239_11510866 | 3300010375 | Bacteria | 776 |
| 345 | Ga0105239_11758788 | 3300010375 | Bacteria | 718 |
| 346 | Ga0105239_11764825 | 3300010375 | Bacteria | 717 |
| 347 | Ga0105239_12878546 | 3300010375 | Bacteria | 561 |
| 348 | Ga0105246_10023159 | 3300011119 | Bacteria | 4016 |
| 349 | Ga0105246_10026492 | 3300011119 | Bacteria | 3789 |
| 350 | Ga0105246_10096483 | 3300011119 | Bacteria | 2143 |
| 351 | Ga0105246_11132365 | 3300011119 | Bacteria | 716 |
| 352 | Ga0157344_1013290 | 3300012476 | Bacteria | 629 |
| 353 | Ga0157318_1014053 | 3300012482 | Bacteria | 639 |
| 354 | Ga0157316_1036984 | 3300012510 | Bacteria | 620 |
| 355 | Ga0157371_10115181 | 3300013102 | Bacteria | 1909 |
| 356 | Ga0157371_10716645 | 3300013102 | Bacteria | 750 |
| 357 | Ga0157371_10830230 | 3300013102 | Bacteria | 698 |
| 358 | Ga0157370_10013445 | 3300013104 | Bacteria | 8431 |
| 359 | Ga0157370_10531279 | 3300013104 | Bacteria | 1079 |
| 360 | Ga0157370_10901388 | 3300013104 | Bacteria | 802 |
| 361 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 362 | Ga0157369_10021614 | 3300013105 | Bacteria | 7195 |
| 363 | Ga0157369_10036307 | 3300013105 | Bacteria | 5400 |
| 364 | Ga0157374_10027912 | 3300013296 | Bacteria | 5095 |
| 365 | Ga0157374_10168655 | 3300013296 | Bacteria | 2135 |
| 366 | Ga0157374_11414775 | 3300013296 | Bacteria | 718 |
| 367 | Ga0157378_10066352 | 3300013297 | Bacteria | 3232 |
| 368 | Ga0157378_10073227 | 3300013297 | Bacteria | 3079 |
| 369 | Ga0157378_10227175 | 3300013297 | Bacteria | 1777 |
| 370 | Ga0157378_10626899 | 3300013297 | Bacteria | 1089 |
| 371 | Ga0157378_11357676 | 3300013297 | Bacteria | 753 |
| 372 | Ga0163162_10015498 | 3300013306 | Bacteria | 7450 |
| 373 | Ga0163162_10057235 | 3300013306 | Bacteria | 3926 |
| 374 | Ga0163162_10192145 | 3300013306 | Bacteria | 2169 |
| 375 | Ga0163162_11394313 | 3300013306 | Bacteria | 797 |
| 376 | Ga0163162_11568492 | 3300013306 | Bacteria | 751 |
| 377 | Ga0157372_10067956 | 3300013307 | Bacteria | 4006 |
| 378 | Ga0157372_10079148 | 3300013307 | Bacteria | 3716 |
| 379 | Ga0157372_10574589 | 3300013307 | Bacteria | 1314 |
| 380 | Ga0157372_10766687 | 3300013307 | Bacteria | 1121 |
| 381 | Ga0157372_12499678 | 3300013307 | Bacteria | 593 |
| 382 | Ga0157375_10044510 | 3300013308 | Bacteria | 4314 |
| 383 | Ga0157375_10293845 | 3300013308 | Bacteria | 1788 |
| 384 | Ga0157375_13078166 | 3300013308 | Bacteria | 556 |
| 385 | Ga0157375_13182192 | 3300013308 | Bacteria | 548 |
| 386 | Ga0163163_10074865 | 3300014325 | Bacteria | 3379 |
| 387 | Ga0163163_10084542 | 3300014325 | Bacteria | 3179 |
| 388 | Ga0163163_10714343 | 3300014325 | Bacteria | 1066 |
| 389 | Ga0163163_13261324 | 3300014325 | Bacteria | 506 |
| 390 | Ga0157380_10223349 | 3300014326 | Bacteria | 1687 |
| 391 | Ga0157380_10612798 | 3300014326 | Bacteria | 1079 |
| 392 | Ga0157380_11580869 | 3300014326 | Bacteria | 711 |
| 393 | Ga0157380_12176979 | 3300014326 | Bacteria | 618 |
| 394 | Ga0157377_10081359 | 3300014745 | Bacteria | 1894 |
| 395 | Ga0157377_10123387 | 3300014745 | Bacteria | 1573 |
| 396 | Ga0157377_10410368 | 3300014745 | Bacteria | 925 |
| 397 | Ga0157379_10033261 | 3300014968 | Bacteria | 4598 |
| 398 | Ga0157379_10112561 | 3300014968 | Bacteria | 2446 |
| 399 | Ga0157379_10159391 | 3300014968 | Bacteria | 2036 |
| 400 | Ga0157379_10170930 | 3300014968 | Bacteria | 1962 |
| 401 | Ga0157379_10262352 | 3300014968 | Bacteria | 1570 |
| 402 | Ga0157379_10565469 | 3300014968 | Bacteria | 1059 |
| 403 | Ga0157379_10840125 | 3300014968 | Bacteria | 868 |
| 404 | Ga0157379_10852726 | 3300014968 | Bacteria | 862 |
| 405 | Ga0157376_10226942 | 3300014969 | Bacteria | 1733 |
| 406 | Ga0157376_10572644 | 3300014969 | Bacteria | 1120 |
| 407 | Ga0157376_10660465 | 3300014969 | Bacteria | 1047 |
| 408 | Ga0163161_10913218 | 3300017792 | Bacteria | 745 |
| 409 | Ga0209564_1003160 | 3300025295 | Bacteria | 11595 |
| 410 | Ga0209564_1006871 | 3300025295 | Bacteria | 6001 |
| 411 | Ga0209564_1017804 | 3300025295 | Bacteria | 2743 |
| 412 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 413 | Ga0209758_1004632 | 3300025297 | Bacteria | 11268 |
| 414 | Ga0209758_1006280 | 3300025297 | Bacteria | 8638 |
| 415 | Ga0209758_1009996 | 3300025297 | Bacteria | 5766 |
| 416 | Ga0209758_1010086 | 3300025297 | Bacteria | 5722 |
| 417 | Ga0209758_1022902 | 3300025297 | Bacteria | 2844 |
| 418 | Ga0209758_1120724 | 3300025297 | Bacteria | 708 |
| 419 | Ga0209256_1002592 | 3300025299 | Bacteria | 14393 |
| 420 | Ga0209256_1068457 | 3300025299 | Bacteria | 805 |
| 421 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 422 | Ga0207426_1016643 | 3300025302 | Bacteria | 2633 |
| 423 | Ga0207426_1108679 | 3300025302 | Bacteria | 703 |
| 424 | Ga0209051_1106550 | 3300025303 | Bacteria | 741 |
| 425 | Ga0209257_1002989 | 3300025304 | Bacteria | 15349 |
| 426 | Ga0209257_1026125 | 3300025304 | Bacteria | 1977 |
| 427 | Ga0207697_10541765 | 3300025315 | Bacteria | 512 |
| 428 | Ga0207656_10041260 | 3300025321 | Bacteria | 1960 |
| 429 | Ga0207656_10320129 | 3300025321 | Bacteria | 770 |
| 430 | Ga0207653_10037971 | 3300025885 | Bacteria | 1572 |
| 431 | Ga0207682_10081724 | 3300025893 | Bacteria | 1386 |
| 432 | Ga0207642_10213379 | 3300025899 | Bacteria | 1074 |
| 433 | Ga0207710_10038269 | 3300025900 | Bacteria | 2121 |
| 434 | Ga0207710_10171436 | 3300025900 | Bacteria | 1061 |
| 435 | Ga0207710_10205014 | 3300025900 | Bacteria | 975 |
| 436 | Ga0207688_10010434 | 3300025901 | Bacteria | 5056 |
| 437 | Ga0207680_10573502 | 3300025903 | Bacteria | 806 |
| 438 | Ga0207680_11055744 | 3300025903 | Bacteria | 581 |
| 439 | Ga0207647_10000121 | 3300025904 | Bacteria | 61311 |
| 440 | Ga0207685_10155918 | 3300025905 | Bacteria | 1038 |
| 441 | Ga0207685_10498364 | 3300025905 | Bacteria | 640 |
| 442 | Ga0207699_10174206 | 3300025906 | Bacteria | 1442 |
| 443 | Ga0207645_10079836 | 3300025907 | Bacteria | 2097 |
| 444 | Ga0207645_10138925 | 3300025907 | Bacteria | 1583 |
| 445 | Ga0207645_10415417 | 3300025907 | Bacteria | 906 |
| 446 | Ga0207643_10044900 | 3300025908 | Bacteria | 2495 |
| 447 | Ga0207643_10720775 | 3300025908 | Bacteria | 645 |
| 448 | Ga0207705_10081118 | 3300025909 | Bacteria | 2364 |
| 449 | Ga0207684_10331385 | 3300025910 | Bacteria | 1311 |
| 450 | Ga0207684_10573677 | 3300025910 | Bacteria | 964 |
| 451 | Ga0207654_10000156 | 3300025911 | Bacteria | 43523 |
| 452 | Ga0207654_10080959 | 3300025911 | Bacteria | 1954 |
| 453 | Ga0207654_10115182 | 3300025911 | Bacteria | 1679 |
| 454 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 455 | Ga0207707_10008151 | 3300025912 | Bacteria | 9091 |
| 456 | Ga0207707_10014431 | 3300025912 | Bacteria | 6882 |
| 457 | Ga0207707_10105877 | 3300025912 | Bacteria | 2458 |
| 458 | Ga0207707_11045354 | 3300025912 | Bacteria | 668 |
| 459 | Ga0207695_10001028 | 3300025913 | Bacteria | 49101 |
| 460 | Ga0207695_10019143 | 3300025913 | Bacteria | 7889 |
| 461 | Ga0207695_10073340 | 3300025913 | Bacteria | 3488 |
| 462 | Ga0207695_10103371 | 3300025913 | Bacteria | 2840 |
| 463 | Ga0207695_10115462 | 3300025913 | Bacteria | 2659 |
| 464 | Ga0207695_10135842 | 3300025913 | Bacteria | 2412 |
| 465 | Ga0207695_10255073 | 3300025913 | Bacteria | 1653 |
| 466 | Ga0207671_10030586 | 3300025914 | Bacteria | 4014 |
| 467 | Ga0207671_10068414 | 3300025914 | Bacteria | 2646 |
| 468 | Ga0207671_10110923 | 3300025914 | Bacteria | 2087 |
| 469 | Ga0207671_10761091 | 3300025914 | Bacteria | 769 |
| 470 | Ga0207671_11351004 | 3300025914 | Bacteria | 554 |
| 471 | Ga0207693_10397185 | 3300025915 | Bacteria | 1078 |
| 472 | Ga0207663_10019239 | 3300025916 | Bacteria | 3842 |
| 473 | Ga0207663_11369437 | 3300025916 | Bacteria | 570 |
| 474 | Ga0207660_10007904 | 3300025917 | Bacteria | 6882 |
| 475 | Ga0207660_10075631 | 3300025917 | Bacteria | 2460 |
| 476 | Ga0207662_10040742 | 3300025918 | Bacteria | 2731 |
| 477 | Ga0207657_10005482 | 3300025919 | Bacteria | 13248 |
| 478 | Ga0207657_10081530 | 3300025919 | Bacteria | 2717 |
| 479 | Ga0207657_10215621 | 3300025919 | Bacteria | 1539 |
| 480 | Ga0207649_10179476 | 3300025920 | Bacteria | 1481 |
| 481 | Ga0207652_10024703 | 3300025921 | Bacteria | 4987 |
| 482 | Ga0207652_10065253 | 3300025921 | Bacteria | 3152 |
| 483 | Ga0207652_10074664 | 3300025921 | Bacteria | 2953 |
| 484 | Ga0207652_10836310 | 3300025921 | Bacteria | 816 |
| 485 | Ga0207681_10806366 | 3300025923 | Bacteria | 784 |
| 486 | Ga0207681_10870153 | 3300025923 | Bacteria | 754 |
| 487 | Ga0207681_11078012 | 3300025923 | Bacteria | 674 |
| 488 | Ga0207694_10000186 | 3300025924 | Bacteria | 63372 |
| 489 | Ga0207694_10027217 | 3300025924 | Bacteria | 4353 |
| 490 | Ga0207694_10029840 | 3300025924 | Bacteria | 4163 |
| 491 | Ga0207694_10127692 | 3300025924 | Bacteria | 2036 |
| 492 | Ga0207694_10158093 | 3300025924 | Bacteria | 1829 |
| 493 | Ga0207694_10212070 | 3300025924 | Bacteria | 1578 |
| 494 | Ga0207650_10392024 | 3300025925 | Bacteria | 1148 |
| 495 | Ga0207650_10748330 | 3300025925 | Bacteria | 827 |
| 496 | Ga0207687_10165880 | 3300025927 | Bacteria | 1699 |
| 497 | Ga0207687_10329460 | 3300025927 | Bacteria | 1238 |
| 498 | Ga0207687_11316005 | 3300025927 | Bacteria | 621 |
| 499 | Ga0207687_11419795 | 3300025927 | Bacteria | 596 |
| 500 | Ga0207700_10024697 | 3300025928 | Bacteria | 4163 |
| 501 | Ga0207700_10034094 | 3300025928 | Bacteria | 3650 |
| 502 | Ga0207700_10415105 | 3300025928 | Bacteria | 1181 |
| 503 | Ga0207664_10016865 | 3300025929 | Bacteria | 5340 |
| 504 | Ga0207664_10065077 | 3300025929 | Bacteria | 2918 |
| 505 | Ga0207644_10473343 | 3300025931 | Bacteria | 1031 |
| 506 | Ga0207690_10186554 | 3300025932 | Bacteria | 1565 |
| 507 | Ga0207690_10424932 | 3300025932 | Bacteria | 1064 |
| 508 | Ga0207690_10986678 | 3300025932 | Bacteria | 700 |
| 509 | Ga0207706_10118230 | 3300025933 | Bacteria | 2331 |
| 510 | Ga0207706_10121877 | 3300025933 | Bacteria | 2293 |
| 511 | Ga0207706_10128089 | 3300025933 | Bacteria | 2232 |
| 512 | Ga0207706_10379788 | 3300025933 | Bacteria | 1226 |
| 513 | Ga0207686_10363744 | 3300025934 | Bacteria | 1093 |
| 514 | Ga0207709_10010853 | 3300025935 | Bacteria | 5018 |
| 515 | Ga0207709_10555064 | 3300025935 | Bacteria | 904 |
| 516 | Ga0207709_10598354 | 3300025935 | Bacteria | 873 |
| 517 | Ga0207709_10724192 | 3300025935 | Bacteria | 798 |
| 518 | Ga0207670_10273332 | 3300025936 | Bacteria | 1314 |
| 519 | Ga0207669_10130937 | 3300025937 | Bacteria | 1723 |
| 520 | Ga0207669_10862701 | 3300025937 | Bacteria | 754 |
| 521 | Ga0207669_11597502 | 3300025937 | Bacteria | 557 |
| 522 | Ga0207704_10145727 | 3300025938 | Bacteria | 1663 |
| 523 | Ga0207704_10405640 | 3300025938 | Bacteria | 1077 |
| 524 | Ga0207704_11088168 | 3300025938 | Bacteria | 679 |
| 525 | Ga0207704_11185159 | 3300025938 | Bacteria | 651 |
| 526 | Ga0207691_10062150 | 3300025940 | Bacteria | 3390 |
| 527 | Ga0207691_10173916 | 3300025940 | Bacteria | 1884 |
| 528 | Ga0207691_10518455 | 3300025940 | Bacteria | 1012 |
| 529 | Ga0207711_10030129 | 3300025941 | Bacteria | 4577 |
| 530 | Ga0207711_10257545 | 3300025941 | Bacteria | 1603 |
| 531 | Ga0207711_10261215 | 3300025941 | Bacteria | 1592 |
| 532 | Ga0207689_10107240 | 3300025942 | Bacteria | 2296 |
| 533 | Ga0207689_10381278 | 3300025942 | Bacteria | 1174 |
| 534 | Ga0207689_10659464 | 3300025942 | Bacteria | 882 |
| 535 | Ga0207689_10778994 | 3300025942 | Bacteria | 807 |
| 536 | Ga0207689_11215612 | 3300025942 | Bacteria | 634 |
| 537 | Ga0207661_10009377 | 3300025944 | Bacteria | 7018 |
| 538 | Ga0207661_10028137 | 3300025944 | Bacteria | 4301 |
| 539 | Ga0207661_10295156 | 3300025944 | Bacteria | 1452 |
| 540 | Ga0207661_10395929 | 3300025944 | Bacteria | 1252 |
| 541 | Ga0207679_10606129 | 3300025945 | Bacteria | 987 |
| 542 | Ga0207679_11191872 | 3300025945 | Bacteria | 699 |
| 543 | Ga0207667_10020014 | 3300025949 | Bacteria | 7455 |
| 544 | Ga0207667_10020505 | 3300025949 | Bacteria | 7348 |
| 545 | Ga0207667_10023400 | 3300025949 | Bacteria | 6803 |
| 546 | Ga0207667_10025056 | 3300025949 | Bacteria | 6539 |
| 547 | Ga0207667_10057622 | 3300025949 | Bacteria | 4077 |
| 548 | Ga0207667_10998509 | 3300025949 | Bacteria | 824 |
| 549 | Ga0207651_10358880 | 3300025960 | Bacteria | 1229 |
| 550 | Ga0207651_11448683 | 3300025960 | Bacteria | 618 |
| 551 | Ga0207712_10470997 | 3300025961 | Bacteria | 1069 |
| 552 | Ga0207712_10704372 | 3300025961 | Bacteria | 882 |
| 553 | Ga0207668_10163868 | 3300025972 | Bacteria | 1735 |
| 554 | Ga0207668_10389326 | 3300025972 | Bacteria | 1175 |
| 555 | Ga0207668_10783421 | 3300025972 | Bacteria | 843 |
| 556 | Ga0207640_10301766 | 3300025981 | Bacteria | 1267 |
| 557 | Ga0207640_10540751 | 3300025981 | Bacteria | 977 |
| 558 | Ga0207658_10650420 | 3300025986 | Bacteria | 950 |
| 559 | Ga0207658_10900729 | 3300025986 | Bacteria | 805 |
| 560 | Ga0207658_11045407 | 3300025986 | Bacteria | 745 |
| 561 | Ga0207677_10275907 | 3300026023 | Bacteria | 1378 |
| 562 | Ga0207677_10440319 | 3300026023 | Bacteria | 1114 |
| 563 | Ga0207677_10494314 | 3300026023 | Bacteria | 1056 |
| 564 | Ga0207703_10121025 | 3300026035 | Bacteria | 2247 |
| 565 | Ga0207703_10205049 | 3300026035 | Bacteria | 1754 |
| 566 | Ga0207703_10387995 | 3300026035 | Bacteria | 1293 |
| 567 | Ga0207703_10758340 | 3300026035 | Bacteria | 925 |
| 568 | Ga0207703_11040507 | 3300026035 | Bacteria | 786 |
| 569 | Ga0207639_10015471 | 3300026041 | Bacteria | 5384 |
| 570 | Ga0207639_10043716 | 3300026041 | Bacteria | 3365 |
| 571 | Ga0207639_10066380 | 3300026041 | Bacteria | 2804 |
| 572 | Ga0207639_10077369 | 3300026041 | Bacteria | 2623 |
| 573 | Ga0207639_10098345 | 3300026041 | Bacteria | 2358 |
| 574 | Ga0207639_10279479 | 3300026041 | Bacteria | 1468 |
| 575 | Ga0207639_10491193 | 3300026041 | Bacteria | 1120 |
| 576 | Ga0207678_10007639 | 3300026067 | Bacteria | 9552 |
| 577 | Ga0207678_10025016 | 3300026067 | Bacteria | 5213 |
| 578 | Ga0207678_10055862 | 3300026067 | Bacteria | 3400 |
| 579 | Ga0207678_10087755 | 3300026067 | Bacteria | 2658 |
| 580 | Ga0207678_10236829 | 3300026067 | Bacteria | 1563 |
| 581 | Ga0207678_10828132 | 3300026067 | Bacteria | 817 |
| 582 | Ga0207678_11099351 | 3300026067 | Bacteria | 704 |
| 583 | Ga0207678_11103988 | 3300026067 | Bacteria | 702 |
| 584 | Ga0207708_10306848 | 3300026075 | Bacteria | 1292 |
| 585 | Ga0207708_10307142 | 3300026075 | Bacteria | 1291 |
| 586 | Ga0207702_10000064 | 3300026078 | Bacteria | 120869 |
| 587 | Ga0207702_10039481 | 3300026078 | Bacteria | 3955 |
| 588 | Ga0207702_10528544 | 3300026078 | Bacteria | 1152 |
| 589 | Ga0207702_10853984 | 3300026078 | Bacteria | 901 |
| 590 | Ga0207702_11159115 | 3300026078 | Bacteria | 767 |
| 591 | Ga0207702_11382797 | 3300026078 | Bacteria | 698 |
| 592 | Ga0207641_11171949 | 3300026088 | Bacteria | 768 |
| 593 | Ga0207648_10220133 | 3300026089 | Bacteria | 1687 |
| 594 | Ga0207648_10305019 | 3300026089 | Bacteria | 1429 |
| 595 | Ga0207676_10032201 | 3300026095 | Bacteria | 3949 |
| 596 | Ga0207674_10000946 | 3300026116 | Bacteria | 37958 |
| 597 | Ga0207674_10001023 | 3300026116 | Bacteria | 36523 |
| 598 | Ga0207674_10018135 | 3300026116 | Bacteria | 7658 |
| 599 | Ga0207674_10242682 | 3300026116 | Bacteria | 1749 |
| 600 | Ga0207674_10361018 | 3300026116 | Bacteria | 1404 |
| 601 | Ga0207674_10389418 | 3300026116 | Bacteria | 1347 |
| 602 | Ga0207674_11407648 | 3300026116 | Bacteria | 667 |
| 603 | Ga0207675_100022393 | 3300026118 | Bacteria | 5885 |
| 604 | Ga0207675_100148351 | 3300026118 | Bacteria | 2231 |
| 605 | Ga0207675_100335926 | 3300026118 | Bacteria | 1478 |
| 606 | Ga0207675_100370820 | 3300026118 | Bacteria | 1406 |
| 607 | Ga0207675_100549391 | 3300026118 | Bacteria | 1154 |
| 608 | Ga0207675_100560234 | 3300026118 | Bacteria | 1143 |
| 609 | Ga0207683_10007406 | 3300026121 | Bacteria | 9411 |
| 610 | Ga0207683_10011518 | 3300026121 | Bacteria | 7550 |
| 611 | Ga0207683_10051080 | 3300026121 | Bacteria | 3622 |
| 612 | Ga0207683_10146225 | 3300026121 | Bacteria | 2131 |
| 613 | Ga0207683_10192417 | 3300026121 | Bacteria | 1852 |
| 614 | Ga0207683_10541005 | 3300026121 | Bacteria | 1077 |
| 615 | Ga0207683_10674818 | 3300026121 | Bacteria | 958 |
| 616 | Ga0207698_10012190 | 3300026142 | Bacteria | 5613 |
| 617 | Ga0207698_10033871 | 3300026142 | Bacteria | 3716 |
| 618 | Ga0207698_10058830 | 3300026142 | Bacteria | 2981 |
| 619 | Ga0207698_10063110 | 3300026142 | Bacteria | 2897 |
| 620 | Ga0207698_10871055 | 3300026142 | Bacteria | 907 |
| 621 | Ga0207698_11677531 | 3300026142 | Bacteria | 651 |
| 622 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 623 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 624 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 625 | Ga0209179_1049452 | 3300027512 | Bacteria | 899 |
| 626 | Ga0209588_1044647 | 3300027671 | Bacteria | 1433 |
| 627 | Ga0209813_10049621 | 3300027866 | Bacteria | 1307 |
| 628 | Ga0209813_10151785 | 3300027866 | Bacteria | 830 |
| 629 | Ga0207428_10037444 | 3300027907 | Bacteria | 3946 |
| 630 | Ga0207428_10921502 | 3300027907 | Bacteria | 617 |
| 631 | Ga0268266_10003191 | 3300028379 | Bacteria | 16594 |
| 632 | Ga0268266_10015771 | 3300028379 | Bacteria | 6469 |
| 633 | Ga0268266_10041730 | 3300028379 | Bacteria | 3916 |
| 634 | Ga0268266_10092497 | 3300028379 | Bacteria | 2653 |
| 635 | Ga0268266_10123778 | 3300028379 | Bacteria | 2304 |
| 636 | Ga0268266_10370392 | 3300028379 | Bacteria | 1349 |
| 637 | Ga0268266_11128779 | 3300028379 | Bacteria | 758 |
| 638 | Ga0268265_10067630 | 3300028380 | Bacteria | 2766 |
| 639 | Ga0268265_10187365 | 3300028380 | Bacteria | 1783 |
| 640 | Ga0268265_10941183 | 3300028380 | Bacteria | 850 |
| 641 | Ga0268265_11170689 | 3300028380 | Bacteria | 765 |
| 642 | Ga0268264_10050385 | 3300028381 | Bacteria | 3467 |
| 643 | Ga0268264_10373920 | 3300028381 | Bacteria | 1363 |
| 644 | Ga0268264_10669848 | 3300028381 | Bacteria | 1028 |
| 645 | Ga0307517_10000476 | 3300028786 | Bacteria | 68696 |
| 646 | Ga0307517_10266205 | 3300028786 | Bacteria | 990 |
| 647 | Ga0307517_10442286 | 3300028786 | Bacteria | 676 |
| 648 | Ga0307515_10183742 | 3300028794 | Bacteria | 2029 |
| 649 | Ga0307515_10228322 | 3300028794 | Bacteria | 1661 |
| 650 | Ga0307515_10362971 | 3300028794 | Bacteria | 1088 |
| 651 | Ga0265338_10754481 | 3300028800 | Bacteria | 669 |
| 652 | Ga0307512_10425969 | 3300030522 | Bacteria | 546 |
| 653 | Ga0265762_1099244 | 3300030760 | Bacteria | 644 |
| 654 | Ga0265330_10010731 | 3300031235 | Bacteria | 4310 |
| 655 | Ga0265330_10021675 | 3300031235 | Bacteria | 2929 |
| 656 | Ga0265330_10030642 | 3300031235 | Bacteria | 2414 |
| 657 | Ga0265328_10106210 | 3300031239 | Bacteria | 1042 |
| 658 | Ga0265328_10211959 | 3300031239 | Bacteria | 737 |
| 659 | Ga0265328_10298473 | 3300031239 | Bacteria | 622 |
| 660 | Ga0265325_10024575 | 3300031241 | Bacteria | 3277 |
| 661 | Ga0265340_10016299 | 3300031247 | Bacteria | 3849 |
| 662 | Ga0265340_10120117 | 3300031247 | Bacteria | 1210 |
| 663 | Ga0265340_10234888 | 3300031247 | Bacteria | 819 |
| 664 | Ga0265339_10132922 | 3300031249 | Bacteria | 1271 |
| 665 | Ga0265339_10323372 | 3300031249 | Bacteria | 731 |
| 666 | Ga0265331_10129396 | 3300031250 | Bacteria | 1152 |
| 667 | Ga0265316_10045394 | 3300031344 | Bacteria | 3489 |
| 668 | Ga0265316_10411955 | 3300031344 | Bacteria | 972 |
| 669 | Ga0307513_10182196 | 3300031456 | Bacteria | 1962 |
| 670 | Ga0307513_10196500 | 3300031456 | Bacteria | 1863 |
| 671 | Ga0307513_10519532 | 3300031456 | Bacteria | 906 |
| 672 | Ga0307509_10359830 | 3300031507 | Bacteria | 1175 |
| 673 | Ga0307509_10440274 | 3300031507 | Bacteria | 999 |
| 674 | Ga0307408_100686835 | 3300031548 | Bacteria | 919 |
| 675 | Ga0307408_100808437 | 3300031548 | Bacteria | 851 |
| 676 | Ga0307508_10062120 | 3300031616 | Bacteria | 3298 |
| 677 | Ga0307508_10121402 | 3300031616 | Bacteria | 2216 |
| 678 | Ga0307508_10151308 | 3300031616 | Bacteria | 1925 |
| 679 | Ga0265314_10054500 | 3300031711 | Bacteria | 2768 |
| 680 | Ga0265342_10202160 | 3300031712 | Bacteria | 1079 |
| 681 | Ga0265342_10259627 | 3300031712 | Bacteria | 925 |
| 682 | Ga0307516_10032872 | 3300031730 | Bacteria | 5224 |
| 683 | Ga0307516_10110382 | 3300031730 | Bacteria | 2554 |
| 684 | Ga0307516_10417850 | 3300031730 | Bacteria | 999 |
| 685 | Ga0307516_11022517 | 3300031730 | Bacteria | 500 |
| 686 | Ga0307405_10353501 | 3300031731 | Bacteria | 1134 |
| 687 | Ga0307405_10582605 | 3300031731 | Bacteria | 910 |
| 688 | Ga0307405_11335153 | 3300031731 | Bacteria | 625 |
| 689 | Ga0307413_10016476 | 3300031824 | Bacteria | 3819 |
| 690 | Ga0307406_10094965 | 3300031901 | Bacteria | 2017 |
| 691 | Ga0307406_10436721 | 3300031901 | Bacteria | 1047 |
| 692 | Ga0307406_10791064 | 3300031901 | Bacteria | 800 |
| 693 | Ga0307412_10167113 | 3300031911 | Bacteria | 1641 |
| 694 | Ga0307412_10727941 | 3300031911 | Bacteria | 854 |
| 695 | Ga0307412_11424133 | 3300031911 | Bacteria | 628 |
| 696 | Ga0307409_100294876 | 3300031995 | Bacteria | 1505 |
| 697 | Ga0307409_100961845 | 3300031995 | Bacteria | 870 |
| 698 | Ga0307416_100143847 | 3300032002 | Bacteria | 2173 |
| 699 | Ga0307416_102451615 | 3300032002 | Bacteria | 621 |
| 700 | Ga0307416_103787280 | 3300032002 | Bacteria | 506 |
| 701 | Ga0307414_12165731 | 3300032004 | Bacteria | 519 |
| 702 | Ga0307411_10929053 | 3300032005 | Bacteria | 775 |
| 703 | Ga0307411_11230677 | 3300032005 | Bacteria | 680 |
| 704 | Ga0307411_11357309 | 3300032005 | Bacteria | 649 |
| 705 | Ga0307411_11450151 | 3300032005 | Bacteria | 629 |
| 706 | Ga0307415_100049710 | 3300032126 | Bacteria | 2837 |
| 707 | Ga0307415_100267581 | 3300032126 | Bacteria | 1398 |
| 708 | Ga0307415_101115163 | 3300032126 | Bacteria | 739 |
| 709 | Ga0307510_10015750 | 3300033180 | Bacteria | 8940 |
| 710 | Ga0307510_10123576 | 3300033180 | Bacteria | 2284 |
| 711 | Ga0373959_0085786 | 3300034820 | Bacteria | 731 |
| 712 | Ga0373928_0239134 | 3300035084 | Bacteria | 537 |
| 713 | Ga0373929_0161657 | 3300035085 | Bacteria | 607 |
| 714 | Ga0373923_0024804 | 3300035111 | Bacteria | 2370 |
| 715 | Ga0373936_0014097 | 3300035113 | Bacteria | 3054 |
| 716 | Ga0373936_0308333 | 3300035113 | Bacteria | 715 |
| 717 | Ga0373953_0413420 | 3300035117 | Bacteria | 594 |
| 718 | Ga0373954_0162963 | 3300035118 | Bacteria | 1091 |
| 719 | Ga0373956_0155943 | 3300035119 | Bacteria | 1075 |
| 720 | Ga0373960_0140404 | 3300035121 | Bacteria | 818 |
| 721 | Ga0373943_0644322 | 3300035170 | Bacteria | 626 |
| 722 | Ga0373946_0011656 | 3300035171 | Bacteria | 3286 |
| 723 | Ga0373955_0069830 | 3300035172 | Bacteria | 1961 |
| 724 | Ga0373955_0979538 | 3300035172 | Bacteria | 521 |
| 725 | Ga0373961_0159112 | 3300035241 | Bacteria | 774 |
| 726 | Ga0373931_0188163 | 3300035691 | Bacteria | 1227 |
| 727 | Ga0373931_0420866 | 3300035691 | Bacteria | 849 |
| 728 | Ga0373935_0001812 | 3300035692 | Bacteria | 11998 |
| 729 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 730 | Ga0373927_0091424 | 3300035695 | Bacteria | 1976 |
| 731 | Ga0373927_0146354 | 3300035695 | Bacteria | 1547 |
| 732 | Ga0373933_0000108 | 3300035724 | Bacteria | 53024 |
| 733 | Ga0373933_0639436 | 3300035724 | Bacteria | 699 |
| 734 | Ga0373947_0003829 | 3300035725 | Bacteria | 8862 |
| 735 | Ga0373947_0680834 | 3300035725 | Bacteria | 701 |
| 736 | Ga0373937_0089555 | 3300036401 | Bacteria | 2849 |
| 737 | Ga0373937_0883068 | 3300036401 | Bacteria | 843 |
| 738 | Ga0373937_1096704 | 3300036401 | Bacteria | 745 |
| 739 | Ga0373925_0008084 | 3300037068 | Bacteria | 7662 |
| 740 | Ga0373925_0151201 | 3300037068 | Bacteria | 1823 |
| 741 | Ga0373925_0519741 | 3300037068 | Bacteria | 978 |
| 742 | Ga0395899_0351295 | 3300037312 | Bacteria | 986 |
| 743 | Ga0395900_0010102 | 3300037418 | Bacteria | 9655 |
| 744 | Ga0395898_0036867 | 3300037466 | Bacteria | 4853 |
| 745 | Ga0395898_0166395 | 3300037466 | Bacteria | 2109 |
| 746 | Ga0395898_0767607 | 3300037466 | Bacteria | 905 |
| 747 | Ga0395905_0062121 | 3300037471 | Bacteria | 3494 |
| 748 | Ga0395905_0514328 | 3300037471 | Bacteria | 1098 |
| 749 | Ga0395905_0584010 | 3300037471 | Bacteria | 1019 |
| 750 | Ga0436364_1091707 | 3300037853 | Bacteria | 1462 |
| 751 | Ga0436364_1175882 | 3300037853 | Bacteria | 2048 |
| 752 | Ga0395901_0141469 | 3300038443 | Bacteria | 2529 |
| 753 | Ga0436365_0263128 | 3300039437 | Bacteria | 2284 |
| 754 | Ga0436365_0503144 | 3300039437 | Bacteria | 3811 |
| 755 | Ga0436365_0661367 | 3300039437 | Bacteria | 677 |
| 756 | Ga0436365_1219104 | 3300039437 | Bacteria | 1360 |
| 757 | Ga0436365_1404308 | 3300039437 | Bacteria | 819 |
| 758 | Ga0436361_1064220 | 3300039447 | Bacteria | 750 |
| 759 | Ga0436363_0386314 | 3300039450 | Bacteria | 720 |
| 760 | Ga0439465_0012701 | 3300041413 | Bacteria | 2634 |
| 761 | Ga0439465_0040339 | 3300041413 | Bacteria | 1509 |
| 762 | Ga0451787_365869 | 3300041441 | Bacteria | 807 |
| 763 | Ga0451789_0396661 | 3300041443 | Bacteria | 1434 |
| 764 | Ga0451791_0032085 | 3300041451 | Bacteria | 509 |
| 765 | Ga0451791_0876452 | 3300041451 | Bacteria | 606 |
| 766 | Ga0451791_1651265 | 3300041451 | Bacteria | 811 |
| 767 | Ga0451793_0433591 | 3300041452 | Bacteria | 569 |
| 768 | Ga0451795_0426728 | 3300041456 | Bacteria | 677 |
| 769 | Ga0451798_0375827 | 3300041458 | Bacteria | 694 |
| 770 | Ga0451800_0008514 | 3300041459 | Bacteria | 532 |
| 771 | Ga0451800_0883643 | 3300041459 | Bacteria | 1209 |
| 772 | Ga0451802_0590931 | 3300041460 | Bacteria | 690 |
| 773 | Ga0451807_0508539 | 3300041486 | Bacteria | 1492 |
| 774 | Ga0451833_0686837 | 3300041491 | Bacteria | 679 |
| 775 | Ga0451837_0379450 | 3300041494 | Bacteria | 682 |
| 776 | Ga0451839_1532871 | 3300041496 | Bacteria | 671 |
| 777 | Ga0451841_0698586 | 3300041498 | Bacteria | 738 |
| 778 | Ga0451845_0402220 | 3300041501 | Bacteria | 1159 |
| 779 | Ga0451843_0508687 | 3300041509 | Bacteria | 782 |
| 780 | Ga0451843_1443504 | 3300041509 | Bacteria | 621 |
| 781 | Ga0439432_206656 | 3300042006 | Bacteria | 568 |
| 782 | Ga0439463_120326 | 3300042016 | Bacteria | 679 |
| 783 | Ga0466969_0057080 | 3300044656 | Bacteria | 1904 |
| 784 | Ga0466966_0001463 | 3300044684 | Bacteria | 15199 |
| 785 | Ga0466961_0000601 | 3300044693 | Bacteria | 22652 |
| 786 | Ga0466963_0098934 | 3300044694 | Bacteria | 1994 |
| 787 | Ga0466963_0376908 | 3300044694 | Bacteria | 1000 |
| 788 | Ga0466963_0523746 | 3300044694 | Bacteria | 837 |
| 789 | Ga0466971_0023831 | 3300044719 | Bacteria | 2728 |
| 790 | Ga0466968_0156452 | 3300044735 | Bacteria | 1050 |
| 791 | Ga0466970_0121464 | 3300044765 | Bacteria | 1431 |
| 792 | Ga0466959_0020323 | 3300045049 | Bacteria | 4891 |
| 793 | Ga0466959_0122799 | 3300045049 | Bacteria | 1844 |
| 794 | Ga0466958_0068149 | 3300045836 | Bacteria | 2175 |
| 795 | Ga0466967_0118926 | 3300045976 | Bacteria | 2438 |
| 796 | Ga0466967_1835599 | 3300045976 | Bacteria | 603 |
| 797 | Ga0466967_2346469 | 3300045976 | Bacteria | 529 |
| 798 | Ga0495617_085265 | 3300046452 | Bacteria | 1033 |
| 799 | Ga0495617_096767 | 3300046452 | Bacteria | 961 |
| 800 | Ga0495617_102924 | 3300046452 | Bacteria | 927 |
| 801 | Ga0495592_0042253 | 3300046454 | Bacteria | 3414 |
| 802 | Ga0495592_0099161 | 3300046454 | Bacteria | 2078 |
| 803 | Ga0495603_0000029 | 3300046455 | Bacteria | 60872 |
| 804 | Ga0495603_0004729 | 3300046455 | Bacteria | 8133 |
| 805 | Ga0495603_0014019 | 3300046455 | Bacteria | 4847 |
| 806 | Ga0495603_0226579 | 3300046455 | Bacteria | 1078 |
| 807 | Ga0495603_0380401 | 3300046455 | Bacteria | 809 |
| 808 | Ga0495590_0079468 | 3300046457 | Bacteria | 1155 |
| 809 | Ga0495590_0171735 | 3300046457 | Bacteria | 790 |
| 810 | Ga0495590_0336208 | 3300046457 | Bacteria | 572 |
| 811 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 812 | Ga0495629_0103196 | 3300046459 | Bacteria | 1989 |
| 813 | Ga0495638_0039729 | 3300046460 | Bacteria | 2985 |
| 814 | Ga0495638_0304432 | 3300046460 | Bacteria | 857 |
| 815 | Ga0495641_0004254 | 3300046461 | Bacteria | 10233 |
| 816 | Ga0495651_0018866 | 3300046462 | Bacteria | 5343 |
| 817 | Ga0495651_0561326 | 3300046462 | Bacteria | 724 |
| 818 | Ga0495653_0053410 | 3300046463 | Bacteria | 3092 |
| 819 | Ga0495653_0261307 | 3300046463 | Bacteria | 1144 |
| 820 | Ga0495650_0150432 | 3300046471 | Bacteria | 836 |
| 821 | Ga0495580_0000321 | 3300046472 | Bacteria | 39093 |
| 822 | Ga0495580_0143203 | 3300046472 | Bacteria | 1657 |
| 823 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 824 | Ga0495582_0047239 | 3300046473 | Bacteria | 2371 |
| 825 | Ga0495582_0175141 | 3300046473 | Bacteria | 1222 |
| 826 | Ga0495582_0752118 | 3300046473 | Bacteria | 564 |
| 827 | Ga0495605_0077229 | 3300046474 | Bacteria | 1562 |
| 828 | Ga0495605_0121756 | 3300046474 | Bacteria | 1182 |
| 829 | Ga0495605_0305044 | 3300046474 | Bacteria | 673 |
| 830 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 831 | Ga0495639_0026865 | 3300046475 | Bacteria | 2546 |
| 832 | Ga0495639_0077820 | 3300046475 | Bacteria | 1540 |
| 833 | Ga0495662_0000068 | 3300046476 | Bacteria | 36559 |
| 834 | Ga0495664_0002214 | 3300046477 | Bacteria | 10401 |
| 835 | Ga0495664_0007034 | 3300046477 | Bacteria | 6232 |
| 836 | Ga0495664_0088422 | 3300046477 | Bacteria | 1862 |
| 837 | Ga0495664_0439276 | 3300046477 | Bacteria | 782 |
| 838 | Ga0495584_0087591 | 3300046491 | Bacteria | 1569 |
| 839 | Ga0495584_0088953 | 3300046491 | Bacteria | 1557 |
| 840 | Ga0495584_0105262 | 3300046491 | Bacteria | 1426 |
| 841 | Ga0495584_0268437 | 3300046491 | Bacteria | 867 |
| 842 | Ga0495585_0032631 | 3300046492 | Bacteria | 2949 |
| 843 | Ga0495585_0302416 | 3300046492 | Bacteria | 786 |
| 844 | Ga0495585_0368772 | 3300046492 | Bacteria | 695 |
| 845 | Ga0495585_0479109 | 3300046492 | Bacteria | 593 |
| 846 | Ga0495594_0000170 | 3300046499 | Bacteria | 31295 |
| 847 | Ga0495594_0044046 | 3300046499 | Bacteria | 2447 |
| 848 | Ga0495594_0101779 | 3300046499 | Bacteria | 1616 |
| 849 | Ga0495596_0022507 | 3300046500 | Bacteria | 2565 |
| 850 | Ga0495596_0081177 | 3300046500 | Bacteria | 1259 |
| 851 | Ga0495596_0156540 | 3300046500 | Bacteria | 885 |
| 852 | Ga0495607_0077506 | 3300046501 | Bacteria | 1836 |
| 853 | Ga0495607_0190722 | 3300046501 | Bacteria | 1021 |
| 854 | Ga0495607_0444124 | 3300046501 | Bacteria | 583 |
| 855 | Ga0495583_0076812 | 3300046506 | Bacteria | 1458 |
| 856 | Ga0495583_0078672 | 3300046506 | Bacteria | 1436 |
| 857 | Ga0495583_0294955 | 3300046506 | Bacteria | 645 |
| 858 | Ga0495583_0323665 | 3300046506 | Bacteria | 610 |
| 859 | Ga0495606_0167138 | 3300046507 | Bacteria | 1279 |
| 860 | Ga0495606_0291845 | 3300046507 | Bacteria | 887 |
| 861 | Ga0495608_0009012 | 3300046511 | Bacteria | 6978 |
| 862 | Ga0495610_0041986 | 3300046512 | Bacteria | 2291 |
| 863 | Ga0495616_0016693 | 3300046513 | Bacteria | 4057 |
| 864 | Ga0495616_0059685 | 3300046513 | Bacteria | 1875 |
| 865 | Ga0495616_0202204 | 3300046513 | Bacteria | 873 |
| 866 | Ga0495618_0074655 | 3300046514 | Bacteria | 2159 |
| 867 | Ga0495628_0014226 | 3300046516 | Bacteria | 6678 |
| 868 | Ga0495628_0110070 | 3300046516 | Bacteria | 2119 |
| 869 | Ga0495628_0592241 | 3300046516 | Bacteria | 793 |
| 870 | Ga0495628_0896722 | 3300046516 | Bacteria | 615 |
| 871 | Ga0495630_0018888 | 3300046517 | Bacteria | 5067 |
| 872 | Ga0495630_0121912 | 3300046517 | Bacteria | 1978 |
| 873 | Ga0495631_0037304 | 3300046518 | Bacteria | 2166 |
| 874 | Ga0495631_0084995 | 3300046518 | Bacteria | 1363 |
| 875 | Ga0495631_0129524 | 3300046518 | Bacteria | 1084 |
| 876 | Ga0495631_0482174 | 3300046518 | Bacteria | 528 |
| 877 | Ga0495632_0100744 | 3300046519 | Bacteria | 1362 |
| 878 | Ga0495632_0101919 | 3300046519 | Bacteria | 1352 |
| 879 | Ga0495632_0121414 | 3300046519 | Bacteria | 1221 |
| 880 | Ga0495632_0220394 | 3300046519 | Bacteria | 858 |
| 881 | Ga0495632_0223282 | 3300046519 | Bacteria | 851 |
| 882 | Ga0495637_0087746 | 3300046520 | Bacteria | 1231 |
| 883 | Ga0495643_0028111 | 3300046522 | Bacteria | 3156 |
| 884 | Ga0495644_0014483 | 3300046523 | Bacteria | 3021 |
| 885 | Ga0495644_0038719 | 3300046523 | Bacteria | 1798 |
| 886 | Ga0495644_0130675 | 3300046523 | Bacteria | 957 |
| 887 | Ga0495644_0205417 | 3300046523 | Bacteria | 760 |
| 888 | Ga0495644_0207300 | 3300046523 | Bacteria | 756 |
| 889 | Ga0495644_0357583 | 3300046523 | Bacteria | 575 |
| 890 | Ga0495648_0002829 | 3300046524 | Bacteria | 15615 |
| 891 | Ga0495648_0053168 | 3300046524 | Bacteria | 2455 |
| 892 | Ga0495648_0162762 | 3300046524 | Bacteria | 1152 |
| 893 | Ga0495648_0203480 | 3300046524 | Bacteria | 989 |
| 894 | Ga0495663_0044876 | 3300046525 | Bacteria | 1354 |
| 895 | Ga0495663_0047293 | 3300046525 | Bacteria | 1324 |
| 896 | Ga0495663_0282599 | 3300046525 | Bacteria | 595 |
| 897 | Ga0495663_0340047 | 3300046525 | Bacteria | 545 |
| 898 | Ga0495666_0003580 | 3300046526 | Bacteria | 7855 |
| 899 | Ga0495666_0197727 | 3300046526 | Bacteria | 925 |
| 900 | Ga0495666_0201346 | 3300046526 | Bacteria | 915 |
| 901 | Ga0495652_0005882 | 3300046529 | Bacteria | 11474 |
| 902 | Ga0495652_0026908 | 3300046529 | Bacteria | 5073 |
| 903 | Ga0495652_0075663 | 3300046529 | Bacteria | 2795 |
| 904 | Ga0495652_0633398 | 3300046529 | Bacteria | 726 |
| 905 | Ga0495654_0012651 | 3300046530 | Bacteria | 4529 |
| 906 | Ga0495665_0000158 | 3300046531 | Bacteria | 33789 |
| 907 | Ga0495665_0261792 | 3300046531 | Bacteria | 889 |
| 908 | Ga0495640_0015043 | 3300046533 | Bacteria | 5830 |
| 909 | Ga0495640_0050077 | 3300046533 | Bacteria | 2879 |
| 910 | Ga0495587_0008157 | 3300046536 | Bacteria | 6752 |
| 911 | Ga0495587_0501719 | 3300046536 | Bacteria | 671 |
| 912 | Ga0495598_0009804 | 3300046537 | Bacteria | 2276 |
| 913 | Ga0495598_0271994 | 3300046537 | Bacteria | 633 |
| 914 | Ga0495598_0429742 | 3300046537 | Bacteria | 520 |
| 915 | Ga0495609_0092162 | 3300046538 | Bacteria | 1318 |
| 916 | Ga0495609_0189116 | 3300046538 | Bacteria | 864 |
| 917 | Ga0495609_0267383 | 3300046538 | Bacteria | 701 |
| 918 | Ga0495621_0066195 | 3300046539 | Bacteria | 1321 |
| 919 | Ga0495621_0096300 | 3300046539 | Bacteria | 1121 |
| 920 | Ga0495621_0179078 | 3300046539 | Bacteria | 845 |
| 921 | Ga0495597_0061578 | 3300046542 | Bacteria | 1634 |
| 922 | Ga0495597_0216030 | 3300046542 | Bacteria | 763 |
| 923 | Ga0495645_0069536 | 3300046543 | Bacteria | 2542 |
| 924 | Ga0495622_0020064 | 3300046557 | Bacteria | 3112 |
| 925 | Ga0495622_0025852 | 3300046557 | Bacteria | 2743 |
| 926 | Ga0495622_0050649 | 3300046557 | Bacteria | 1926 |
| 927 | Ga0495633_0042911 | 3300046558 | Bacteria | 2146 |
| 928 | Ga0495633_0074140 | 3300046558 | Bacteria | 1586 |
| 929 | Ga0495633_0185950 | 3300046558 | Bacteria | 956 |
| 930 | Ga0495667_0003075 | 3300046559 | Bacteria | 11195 |
| 931 | Ga0495667_0152817 | 3300046559 | Bacteria | 1486 |
| 932 | Ga0495656_0023160 | 3300046615 | Bacteria | 2441 |
| 933 | Ga0495656_0064017 | 3300046615 | Bacteria | 1613 |
| 934 | Ga0495656_0182476 | 3300046615 | Bacteria | 1032 |
| 935 | Ga0495656_0394344 | 3300046615 | Bacteria | 723 |
| 936 | Ga0495668_0071825 | 3300046616 | Bacteria | 1902 |
| 937 | Ga0495668_0178765 | 3300046616 | Bacteria | 1162 |
| 938 | Ga0495668_0253358 | 3300046616 | Bacteria | 963 |
| 939 | Ga0495668_0296394 | 3300046616 | Bacteria | 886 |
| 940 | Ga0495634_0000354 | 3300046642 | Bacteria | 44714 |
| 941 | Ga0495634_0080981 | 3300046642 | Bacteria | 2124 |
| 942 | Ga0495611_0083924 | 3300046648 | Bacteria | 1468 |
| 943 | Ga0495611_0287871 | 3300046648 | Bacteria | 758 |
| 944 | Ga0495611_0370073 | 3300046648 | Bacteria | 657 |
| 945 | Ga0495611_0436429 | 3300046648 | Bacteria | 597 |
| 946 | Ga0495625_0028158 | 3300046660 | Bacteria | 4217 |
| 947 | Ga0495625_0283130 | 3300046660 | Bacteria | 1066 |
| 948 | Ga0495625_0667081 | 3300046660 | Bacteria | 617 |
| 949 | Ga0495635_0000179 | 3300046663 | Bacteria | 40014 |
| 950 | Ga0495635_0018638 | 3300046663 | Bacteria | 4842 |
| 951 | Ga0495635_0628540 | 3300046663 | Bacteria | 700 |
| 952 | Ga0495659_0010833 | 3300046664 | Bacteria | 2935 |
| 953 | Ga0495659_0050594 | 3300046664 | Bacteria | 1511 |
| 954 | Ga0495661_0012280 | 3300046665 | Bacteria | 5785 |
| 955 | Ga0495661_0414396 | 3300046665 | Bacteria | 653 |
| 956 | Ga0495661_0432746 | 3300046665 | Bacteria | 635 |
| 957 | Ga0495588_0001137 | 3300046674 | Bacteria | 11460 |
| 958 | Ga0495588_0007919 | 3300046674 | Bacteria | 4856 |
| 959 | Ga0495588_0226428 | 3300046674 | Bacteria | 987 |
| 960 | Ga0495588_0475777 | 3300046674 | Bacteria | 655 |
| 961 | Ga0495657_0005133 | 3300046675 | Bacteria | 10381 |
| 962 | Ga0495657_0114242 | 3300046675 | Bacteria | 1707 |
| 963 | Ga0495657_0493092 | 3300046675 | Bacteria | 715 |
| 964 | Ga0495599_0491312 | 3300046678 | Bacteria | 723 |
| 965 | Ga0495623_0010483 | 3300046679 | Bacteria | 5998 |
| 966 | Ga0495623_0104152 | 3300046679 | Bacteria | 1726 |
| 967 | Ga0495646_0003762 | 3300046680 | Bacteria | 9487 |
| 968 | Ga0495646_0012426 | 3300046680 | Bacteria | 5414 |
| 969 | Ga0495647_0000068 | 3300046681 | Bacteria | 25521 |
| 970 | Ga0495647_0016668 | 3300046681 | Bacteria | 2590 |
| 971 | Ga0495658_0000428 | 3300046683 | Bacteria | 23516 |
| 972 | Ga0495658_0820438 | 3300046683 | Bacteria | 595 |
| 973 | Ga0495669_0031545 | 3300046684 | Bacteria | 2327 |
| 974 | Ga0495669_0069036 | 3300046684 | Bacteria | 1608 |
| 975 | Ga0495669_0164215 | 3300046684 | Bacteria | 1055 |
| 976 | Ga0495669_0203999 | 3300046684 | Bacteria | 945 |
| 977 | Ga0495669_0319307 | 3300046684 | Bacteria | 749 |
| 978 | Ga0495613_0081938 | 3300046689 | Bacteria | 2344 |
| 979 | Ga0495613_0085821 | 3300046689 | Bacteria | 2283 |
| 980 | Ga0495624_0010213 | 3300046690 | Bacteria | 6471 |
| 981 | Ga0495624_0212538 | 3300046690 | Bacteria | 1173 |
| 982 | Ga0495670_0012601 | 3300046691 | Bacteria | 4158 |
| 983 | Ga0495670_0013643 | 3300046691 | Bacteria | 3995 |
| 984 | Ga0495670_0118671 | 3300046691 | Bacteria | 1373 |
| 985 | Ga0495670_0448278 | 3300046691 | Bacteria | 699 |
| 986 | Ga0495670_0483425 | 3300046691 | Bacteria | 672 |
| 987 | Ga0495671_0016996 | 3300046692 | Bacteria | 3875 |
| 988 | Ga0495671_0081145 | 3300046692 | Bacteria | 1589 |
| 989 | Ga0495671_0225249 | 3300046692 | Bacteria | 907 |
| 990 | Ga0495649_0219568 | 3300046694 | Bacteria | 983 |
| 991 | Ga0495589_0034599 | 3300046794 | Bacteria | 2535 |
| 992 | Ga0495589_0099590 | 3300046794 | Bacteria | 1407 |
| 993 | Ga0495589_0124773 | 3300046794 | Bacteria | 1238 |
| 994 | Ga0495600_0006367 | 3300046809 | Bacteria | 7183 |
| 995 | Ga0495600_0196740 | 3300046809 | Bacteria | 1295 |
| 996 | Ga0495600_0224586 | 3300046809 | Bacteria | 1201 |
| 997 | Ga0495600_0593136 | 3300046809 | Bacteria | 674 |
| 998 | Ga0495660_0228689 | 3300046810 | Bacteria | 873 |
| 999 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 1000 | Ga0495581_0069806 | 3300047315 | Bacteria | 2032 |
| 1001 | Ga0495581_0070868 | 3300047315 | Bacteria | 2017 |
| 1002 | Ga0495581_0089589 | 3300047315 | Bacteria | 1784 |
| 1003 | Ga0495604_0000678 | 3300047317 | Bacteria | 28877 |
| 1004 | Ga0495604_0105632 | 3300047317 | Bacteria | 2061 |
| 1005 | Ga0495604_0268544 | 3300047317 | Bacteria | 1157 |
| 1006 | Ga0495604_0776898 | 3300047317 | Bacteria | 604 |
| 1007 | Ga0495636_0017078 | 3300047318 | Bacteria | 2904 |
| 1008 | Ga0495636_0026314 | 3300047318 | Bacteria | 2366 |
| 1009 | Ga0495636_0047744 | 3300047318 | Bacteria | 1788 |
| 1010 | Ga0495674_0000415 | 3300047319 | Bacteria | 38235 |
| 1011 | Ga0495674_0224876 | 3300047319 | Bacteria | 1550 |
| 1012 | Ga0495674_1123313 | 3300047319 | Bacteria | 597 |
| 1013 | Ga0495672_0034348 | 3300047320 | Bacteria | 3134 |
| 1014 | Ga0495672_0117952 | 3300047320 | Bacteria | 1415 |
| 1015 | Ga0495672_0211851 | 3300047320 | Bacteria | 962 |
| 1016 | Ga0495676_0005774 | 3300047321 | Bacteria | 11351 |
| 1017 | Ga0495676_0060457 | 3300047321 | Bacteria | 2969 |
| 1018 | Ga0495680_0001164 | 3300047322 | Bacteria | 28965 |
| 1019 | Ga0495683_0137317 | 3300047323 | Bacteria | 1148 |
| 1020 | Ga0495683_0166240 | 3300047323 | Bacteria | 1017 |
| 1021 | Ga0495683_0166478 | 3300047323 | Bacteria | 1016 |
| 1022 | Ga0495675_0004534 | 3300047444 | Bacteria | 8423 |
| 1023 | Ga0495677_0017888 | 3300047445 | Bacteria | 2569 |
| 1024 | Ga0495677_0158040 | 3300047445 | Bacteria | 874 |
| 1025 | Ga0495677_0257091 | 3300047445 | Bacteria | 683 |
| 1026 | Ga0495677_0438709 | 3300047445 | Bacteria | 517 |
| 1027 | Ga0495679_160938 | 3300047446 | Bacteria | 600 |
| 1028 | Ga0495685_036930 | 3300047447 | Bacteria | 1677 |
| 1029 | Ga0495673_0006914 | 3300047469 | Bacteria | 6607 |
| 1030 | Ga0495673_0066465 | 3300047469 | Bacteria | 1529 |
| 1031 | Ga0495673_0184675 | 3300047469 | Bacteria | 788 |
| 1032 | Ga0495673_0231489 | 3300047469 | Bacteria | 680 |
| 1033 | Ga0495673_0275076 | 3300047469 | Bacteria | 609 |
| 1034 | Ga0495673_0308127 | 3300047469 | Bacteria | 566 |
| 1035 | Ga0495681_0055455 | 3300047470 | Bacteria | 1848 |
| 1036 | Ga0495681_0200822 | 3300047470 | Bacteria | 809 |
| 1037 | Ga0495681_0360372 | 3300047470 | Bacteria | 551 |
| 1038 | Ga0495684_0043390 | 3300047471 | Bacteria | 3443 |
| 1039 | Ga0495684_0263849 | 3300047471 | Bacteria | 1248 |
| 1040 | Ga0495686_0013762 | 3300047472 | Bacteria | 5605 |
| 1041 | Ga0495686_0078436 | 3300047472 | Bacteria | 2021 |
| 1042 | Ga0495686_0242890 | 3300047472 | Bacteria | 1015 |
| 1043 | Ga0495686_0316354 | 3300047472 | Bacteria | 857 |
| 1044 | Ga0495686_0396861 | 3300047472 | Bacteria | 741 |
| 1045 | Ga0495686_0504141 | 3300047472 | Bacteria | 637 |
| 1046 | Ga0495686_0516035 | 3300047472 | Bacteria | 628 |
| 1047 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 1048 | Ga0495593_0213287 | 3300047673 | Bacteria | 969 |
| 1049 | Ga0495593_0226993 | 3300047673 | Bacteria | 937 |
| 1050 | Ga0495593_0629572 | 3300047673 | Bacteria | 538 |
| 1051 | Ga0495602_0007817 | 3300048088 | Bacteria | 11179 |
| 1052 | Ga0495602_0305780 | 3300048088 | Bacteria | 1162 |
| 1053 | Ga0495602_1174300 | 3300048088 | Bacteria | 501 |
| 1054 | Ga0495614_0012824 | 3300048089 | Bacteria | 3678 |
| 1055 | Ga0495615_0078522 | 3300048090 | Bacteria | 901 |
| 1056 | Ga0495615_0256624 | 3300048090 | Bacteria | 555 |
| 1057 | Ga0495626_0108189 | 3300048091 | Bacteria | 1206 |
| 1058 | Ga0496100_0008266 | 3300048903 | Bacteria | 5798 |
| 1059 | Ga0496100_0011406 | 3300048903 | Bacteria | 5059 |
| 1060 | Ga0496100_0307974 | 3300048903 | Bacteria | 1187 |
| 1061 | Ga0496100_0432918 | 3300048903 | Bacteria | 1006 |
| 1062 | Ga0496100_1533122 | 3300048903 | Bacteria | 526 |
| 1063 | Ga0496101_0058043 | 3300048904 | Bacteria | 2801 |
| 1064 | Ga0496101_0060305 | 3300048904 | Bacteria | 2752 |
| 1065 | Ga0496101_0201442 | 3300048904 | Bacteria | 1539 |
| 1066 | Ga0496101_0368079 | 3300048904 | Bacteria | 1130 |
| 1067 | Ga0496101_0618585 | 3300048904 | Bacteria | 856 |
| 1068 | Ga0496101_0811034 | 3300048904 | Bacteria | 738 |
| 1069 | Ga0496102_0010634 | 3300048905 | Bacteria | 7927 |
| 1070 | Ga0496102_0214683 | 3300048905 | Bacteria | 1813 |
| 1071 | Ga0496102_0243148 | 3300048905 | Bacteria | 1697 |
| 1072 | Ga0496102_0259254 | 3300048905 | Bacteria | 1639 |
| 1073 | Ga0496102_1022682 | 3300048905 | Bacteria | 747 |
| 1074 | Ga0496102_1959057 | 3300048905 | Bacteria | 502 |
| 1075 | Ga0496103_0276532 | 3300048906 | Bacteria | 1080 |
| 1076 | Ga0496103_0301911 | 3300048906 | Bacteria | 1030 |
| 1077 | Ga0496103_0338283 | 3300048906 | Bacteria | 968 |
| 1078 | Ga0496103_0404656 | 3300048906 | Bacteria | 877 |
| 1079 | Ga0496103_0661048 | 3300048906 | Bacteria | 663 |
| 1080 | Ga0496104_0018816 | 3300048907 | Bacteria | 6309 |
| 1081 | Ga0496104_0033807 | 3300048907 | Bacteria | 4765 |
| 1082 | Ga0496104_0188870 | 3300048907 | Bacteria | 1971 |
| 1083 | Ga0496104_0958240 | 3300048907 | Bacteria | 760 |
| 1084 | Ga0496105_0181358 | 3300048908 | Bacteria | 1724 |
| 1085 | Ga0496105_0307805 | 3300048908 | Bacteria | 1272 |
| 1086 | Ga0496105_0599646 | 3300048908 | Bacteria | 855 |
| 1087 | Ga0496105_0637564 | 3300048908 | Bacteria | 823 |
| 1088 | Ga0496105_0999045 | 3300048908 | Bacteria | 626 |
| 1089 | Ga0496106_0003717 | 3300048909 | Bacteria | 11385 |
| 1090 | Ga0496106_0013044 | 3300048909 | Bacteria | 6132 |
| 1091 | Ga0496106_0101798 | 3300048909 | Bacteria | 2228 |
| 1092 | Ga0496106_0286486 | 3300048909 | Bacteria | 1320 |
| 1093 | Ga0496106_0389258 | 3300048909 | Bacteria | 1120 |
| 1094 | Ga0496107_0009967 | 3300048910 | Bacteria | 6593 |
| 1095 | Ga0496107_0010093 | 3300048910 | Bacteria | 6550 |
| 1096 | Ga0496107_0131585 | 3300048910 | Bacteria | 1847 |
| 1097 | Ga0496107_0296591 | 3300048910 | Bacteria | 1203 |
| 1098 | Ga0496107_0406720 | 3300048910 | Bacteria | 1012 |
| 1099 | Ga0496107_1313151 | 3300048910 | Bacteria | 517 |
| 1100 | Ga0496108_0007465 | 3300048911 | Bacteria | 8863 |
| 1101 | Ga0496108_0122614 | 3300048911 | Bacteria | 2230 |
| 1102 | Ga0496108_0208670 | 3300048911 | Bacteria | 1695 |
| 1103 | Ga0496108_0306232 | 3300048911 | Bacteria | 1384 |
| 1104 | Ga0496108_0700872 | 3300048911 | Bacteria | 878 |
| 1105 | Ga0496108_1307959 | 3300048911 | Bacteria | 609 |
| 1106 | Ga0496109_0000609 | 3300048912 | Bacteria | 29900 |
| 1107 | Ga0496109_0150173 | 3300048912 | Bacteria | 2181 |
| 1108 | Ga0496109_0600938 | 3300048912 | Bacteria | 1036 |
| 1109 | Ga0496110_0008924 | 3300048913 | Bacteria | 8082 |
| 1110 | Ga0496110_0041617 | 3300048913 | Bacteria | 4010 |
| 1111 | Ga0496110_0113009 | 3300048913 | Bacteria | 2442 |
| 1112 | Ga0496110_0150169 | 3300048913 | Bacteria | 2109 |
| 1113 | Ga0496110_0455806 | 3300048913 | Bacteria | 1165 |
| 1114 | Ga0496110_0524587 | 3300048913 | Bacteria | 1077 |
| 1115 | Ga0496111_0041340 | 3300048914 | Bacteria | 3308 |
| 1116 | Ga0496111_0098512 | 3300048914 | Bacteria | 2147 |
| 1117 | Ga0496111_0377147 | 3300048914 | Bacteria | 1049 |
| 1118 | Ga0496111_0502582 | 3300048914 | Bacteria | 892 |
| 1119 | Ga0496112_0002437 | 3300048915 | Bacteria | 14996 |
| 1120 | Ga0496112_0143201 | 3300048915 | Bacteria | 2359 |
| 1121 | Ga0496112_0319757 | 3300048915 | Bacteria | 1496 |
| 1122 | Ga0496112_0584269 | 3300048915 | Bacteria | 1049 |
| 1123 | Ga0496112_0585128 | 3300048915 | Bacteria | 1049 |
| 1124 | Ga0496113_0023429 | 3300048916 | Bacteria | 4377 |
| 1125 | Ga0496113_0914721 | 3300048916 | Bacteria | 693 |
| 1126 | Ga0496114_0117270 | 3300048917 | Bacteria | 2287 |
| 1127 | Ga0496114_0178181 | 3300048917 | Bacteria | 1855 |
| 1128 | Ga0496114_0409840 | 3300048917 | Bacteria | 1200 |
| 1129 | Ga0496114_0604832 | 3300048917 | Bacteria | 967 |
| 1130 | Ga0496114_0764487 | 3300048917 | Bacteria | 844 |
| 1131 | Ga0496114_0921501 | 3300048917 | Bacteria | 755 |
| 1132 | Ga0496115_0017598 | 3300048918 | Bacteria | 5469 |
| 1133 | Ga0496115_0020165 | 3300048918 | Bacteria | 5139 |
| 1134 | Ga0496115_0025658 | 3300048918 | Bacteria | 4591 |
| 1135 | Ga0496115_0119489 | 3300048918 | Bacteria | 2168 |
| 1136 | Ga0496115_0170297 | 3300048918 | Bacteria | 1801 |
| 1137 | Ga0496115_0723448 | 3300048918 | Bacteria | 781 |
| 1138 | Ga0496115_1279621 | 3300048918 | Bacteria | 547 |
| 1139 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 1140 | Ga0496116_0047134 | 3300048919 | Bacteria | 2903 |
| 1141 | Ga0496117_0034522 | 3300048920 | Bacteria | 3809 |
| 1142 | Ga0496117_0137648 | 3300048920 | Bacteria | 1468 |
| 1143 | Ga0496117_0173672 | 3300048920 | Bacteria | 1248 |
| 1144 | Ga0496118_0019475 | 3300048921 | Bacteria | 6064 |
| 1145 | Ga0496118_0039154 | 3300048921 | Bacteria | 3787 |
| 1146 | Ga0496118_0271839 | 3300048921 | Bacteria | 949 |
| 1147 | Ga0496118_0304640 | 3300048921 | Bacteria | 873 |
| 1148 | Ga0496118_0329083 | 3300048921 | Bacteria | 825 |
| 1149 | Ga0496118_0527570 | 3300048921 | Bacteria | 581 |
| 1150 | Ga0496119_0024118 | 3300048922 | Bacteria | 4289 |
| 1151 | Ga0496119_0137067 | 3300048922 | Bacteria | 1326 |
| 1152 | Ga0496119_0191145 | 3300048922 | Bacteria | 1066 |
| 1153 | Ga0496119_0337684 | 3300048922 | Bacteria | 733 |
| 1154 | Ga0496119_0550366 | 3300048922 | Bacteria | 531 |
| 1155 | Ga0496120_0136221 | 3300048923 | Bacteria | 1251 |
| 1156 | Ga0496121_0002689 | 3300048924 | Bacteria | 26584 |
| 1157 | Ga0496121_0011130 | 3300048924 | Bacteria | 10036 |
| 1158 | Ga0496121_0027684 | 3300048924 | Bacteria | 5298 |
| 1159 | Ga0496121_0097490 | 3300048924 | Bacteria | 2278 |
| 1160 | Ga0496121_0248032 | 3300048924 | Bacteria | 1236 |
| 1161 | Ga0496121_0253675 | 3300048924 | Bacteria | 1218 |
| 1162 | Ga0496121_0257737 | 3300048924 | Bacteria | 1206 |
| 1163 | Ga0496121_0317418 | 3300048924 | Bacteria | 1050 |
| 1164 | Ga0496121_0355480 | 3300048924 | Bacteria | 974 |
| 1165 | Ga0496121_0529001 | 3300048924 | Bacteria | 742 |
| 1166 | Ga0496122_0024545 | 3300048925 | Bacteria | 5272 |
| 1167 | Ga0496122_0238997 | 3300048925 | Bacteria | 1026 |
| 1168 | Ga0496123_0065829 | 3300048926 | Bacteria | 2299 |
| 1169 | Ga0496124_0067565 | 3300048927 | Bacteria | 2974 |
| 1170 | Ga0496124_0348594 | 3300048927 | Bacteria | 1048 |
| 1171 | Ga0496125_0001441 | 3300048928 | Bacteria | 34581 |
| 1172 | Ga0496125_0001512 | 3300048928 | Bacteria | 33307 |
| 1173 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 1174 | Ga0496125_0056184 | 3300048928 | Bacteria | 3199 |
| 1175 | Ga0496125_0231720 | 3300048928 | Bacteria | 1180 |
| 1176 | Ga0496125_0332777 | 3300048928 | Bacteria | 915 |
| 1177 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 1178 | Ga0496126_0022661 | 3300048929 | Bacteria | 6104 |
| 1179 | Ga0496126_0033555 | 3300048929 | Bacteria | 4827 |
| 1180 | Ga0496126_0038950 | 3300048929 | Bacteria | 4417 |
| 1181 | Ga0496126_0104438 | 3300048929 | Bacteria | 2475 |
| 1182 | Ga0496126_0130051 | 3300048929 | Bacteria | 2176 |
| 1183 | Ga0496126_0301495 | 3300048929 | Bacteria | 1322 |
| 1184 | Ga0496126_0861504 | 3300048929 | Bacteria | 690 |
| 1185 | Ga0495682_0038299 | 3300049460 | Bacteria | 1762 |
| 1186 | Ga0495682_0045592 | 3300049460 | Bacteria | 1601 |
| 1187 | Ga0495682_0075744 | 3300049460 | Bacteria | 1210 |
| 1188 | Ga0501067_0013941 | 3300049583 | Bacteria | 4452 |
| 1189 | Ga0501071_0969290 | 3300049587 | Bacteria | 657 |
| 1190 | Ga0501075_0732020 | 3300049591 | Bacteria | 753 |
| 1191 | nmdc:mga03683_109449_c1 | 3300050489 | Bacteria | 1220 |
| 1192 | nmdc:mga03683_243412_c1 | 3300050489 | Bacteria | 834 |
| 1193 | nmdc:mga03683_24826_c1 | 3300050489 | Bacteria | 2348 |
| 1194 | nmdc:mga03683_284465_c1 | 3300050489 | Bacteria | 773 |
| 1195 | nmdc:mga03683_565971_c1 | 3300050489 | Bacteria | 554 |
| 1196 | nmdc:mga03683_647769_c1 | 3300050489 | Bacteria | 520 |
| 1197 | nmdc:mga03683_99813_c1 | 3300050489 | Bacteria | 1275 |
| 1198 | nmdc:mga03n38_39464_c1 | 3300050490 | Bacteria | 2048 |
| 1199 | nmdc:mga03n38_579434_c1 | 3300050490 | Bacteria | 637 |
| 1200 | nmdc:mga03n38_585439_c1 | 3300050490 | Bacteria | 634 |
| 1201 | nmdc:mga03n38_867908_c1 | 3300050490 | Bacteria | 529 |
| 1202 | nmdc:mga00v17_22955_c1 | 3300050491 | Bacteria | 3606 |
| 1203 | nmdc:mga00v17_28827_c1 | 3300050491 | Bacteria | 3254 |
| 1204 | nmdc:mga00v17_738101_c1 | 3300050491 | Bacteria | 630 |
| 1205 | nmdc:mga0yw44_153761_c1 | 3300050492 | Bacteria | 1502 |
| 1206 | nmdc:mga0yw44_206802_c1 | 3300050492 | Bacteria | 1298 |
| 1207 | nmdc:mga0yw44_434883_c1 | 3300050492 | Bacteria | 520 |
| 1208 | nmdc:mga0yw44_53733_c1 | 3300050492 | Bacteria | 2447 |
| 1209 | nmdc:mga0yw44_63216_c1 | 3300050492 | Bacteria | 2276 |
| 1210 | nmdc:mga0yw44_66164_c1 | 3300050492 | Bacteria | 2230 |
| 1211 | nmdc:mga0yw44_7729_c1 | 3300050492 | Bacteria | 5309 |
| 1212 | nmdc:mga0k408_21232_c2 | 3300050493 | Bacteria | 1620 |
| 1213 | nmdc:mga0k408_280282_c1 | 3300050493 | Bacteria | 995 |
| 1214 | nmdc:mga0k408_47855_c1 | 3300050493 | Bacteria | 2472 |
| 1215 | nmdc:mga0k408_940307_c1 | 3300050493 | Bacteria | 501 |
| 1216 | nmdc:mga06z11_190076_c1 | 3300050494 | Bacteria | 1188 |
| 1217 | nmdc:mga06z11_248921_c1 | 3300050494 | Bacteria | 1046 |
| 1218 | nmdc:mga06z11_627_c1 | 3300050494 | Bacteria | 12858 |
| 1219 | nmdc:mga06z11_666253_c1 | 3300050494 | Bacteria | 634 |
| 1220 | nmdc:mga04h51_17084_c1 | 3300050495 | Bacteria | 2116 |
| 1221 | nmdc:mga04h51_176428_c1 | 3300050495 | Bacteria | 830 |
| 1222 | nmdc:mga04h51_51394_c1 | 3300050495 | Bacteria | 1385 |
| 1223 | nmdc:mga07m45_2231_c1 | 3300050496 | Bacteria | 9053 |
| 1224 | nmdc:mga07m45_244503_c1 | 3300050496 | Bacteria | 1044 |
| 1225 | nmdc:mga05p37_90704_c1 | 3300050507 | Bacteria | 3766 |
| 1226 | nmdc:mga0qj67_974176_c1 | 3300050509 | Bacteria | 666 |
| 1227 | nmdc:mga08y16_105097_c1 | 3300050511 | Bacteria | 2940 |
| 1228 | nmdc:mga08y16_399061_c1 | 3300050511 | Bacteria | 1408 |
| 1229 | nmdc:mga0n895_5885_c1 | 3300050512 | Bacteria | 10304 |
| 1230 | nmdc:mga0rr50_187200_c1 | 3300050513 | Bacteria | 1695 |
| 1231 | nmdc:mga0rr50_893185_c1 | 3300050513 | Bacteria | 758 |
| 1232 | nmdc:mga08x19_769318_c1 | 3300050514 | Unclassified | 684 |
| 1233 | nmdc:mga0sz30_170911_c1 | 3300050516 | Bacteria | 964 |
| 1234 | nmdc:mga0sz30_227467_c1 | 3300050516 | Bacteria | 830 |
| 1235 | nmdc:mga0sz30_26226_c1 | 3300050516 | Bacteria | 2388 |
| 1236 | nmdc:mga0sz30_46987_c1 | 3300050516 | Bacteria | 1824 |
| 1237 | Ga0495601_0169578 | 3300053077 | Bacteria | 1427 |
| 1238 | Ga0495601_0175010 | 3300053077 | Bacteria | 1403 |
| 1239 | Ga0495601_0334365 | 3300053077 | Bacteria | 986 |
| 1240 | Ga0495601_0826512 | 3300053077 | Bacteria | 587 |
| 1241 | Ga0500610_0088878 | 3300053079 | Bacteria | 1606 |
| 1242 | Ga0500610_0451002 | 3300053079 | Bacteria | 504 |
| 1243 | Ga0495655_0093586 | 3300053083 | Bacteria | 879 |
| 1244 | Ga0495655_0130451 | 3300053083 | Bacteria | 774 |
| 1245 | Ga0495595_0037722 | 3300053084 | Bacteria | 2199 |
| 1246 | Ga0495595_0038930 | 3300053084 | Bacteria | 2168 |
| 1247 | Ga0495595_0729867 | 3300053084 | Bacteria | 508 |
| 1248 | Ga0495619_0024156 | 3300053085 | Bacteria | 3898 |
| 1249 | Ga0495619_0174194 | 3300053085 | Bacteria | 1488 |
| 1250 | Ga0500578_0076702 | 3300053086 | Bacteria | 2128 |
| 1251 | Ga0500578_0443889 | 3300053086 | Bacteria | 740 |
| 1252 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 1253 | Ga0500643_154038 | 3300053087 | Bacteria | 617 |
| 1254 | Ga0500644_0004674 | 3300053088 | Bacteria | 3435 |
| 1255 | Ga0500646_0022886 | 3300053090 | Bacteria | 1673 |
| 1256 | Ga0500646_0215919 | 3300053090 | Bacteria | 663 |
| 1257 | Ga0500647_0248655 | 3300053091 | Bacteria | 783 |
| 1258 | Ga0500583_0010766 | 3300053092 | Bacteria | 3412 |
| 1259 | Ga0500583_0060762 | 3300053092 | Bacteria | 1783 |
| 1260 | Ga0500651_0002004 | 3300053093 | Bacteria | 10570 |
| 1261 | Ga0500651_0015050 | 3300053093 | Bacteria | 4743 |
| 1262 | Ga0500651_0070845 | 3300053093 | Bacteria | 2170 |
| 1263 | Ga0500651_0202834 | 3300053093 | Bacteria | 1170 |
| 1264 | Ga0500651_0501790 | 3300053093 | Bacteria | 669 |
| 1265 | Ga0500566_0002605 | 3300053094 | Bacteria | 10733 |
| 1266 | Ga0500566_0006460 | 3300053094 | Bacteria | 6955 |
| 1267 | Ga0500566_0061049 | 3300053094 | Bacteria | 2134 |
| 1268 | Ga0500566_0365180 | 3300053094 | Bacteria | 657 |
| 1269 | Ga0500566_0380453 | 3300053094 | Bacteria | 638 |
| 1270 | Ga0500641_0008827 | 3300053096 | Bacteria | 3608 |
| 1271 | Ga0500641_0155793 | 3300053096 | Bacteria | 985 |
| 1272 | Ga0500641_0325848 | 3300053096 | Bacteria | 624 |
| 1273 | Ga0500641_0328934 | 3300053096 | Bacteria | 620 |
| 1274 | Ga0500648_152082 | 3300053097 | Bacteria | 1229 |
| 1275 | Ga0500554_061582 | 3300053102 | Bacteria | 1205 |
| 1276 | Ga0500555_144278 | 3300053103 | Bacteria | 585 |
| 1277 | Ga0500557_000088 | 3300053105 | Bacteria | 31829 |
| 1278 | Ga0500562_020061 | 3300053108 | Bacteria | 1734 |
| 1279 | Ga0500569_002366 | 3300053109 | Bacteria | 3699 |
| 1280 | Ga0500569_085580 | 3300053109 | Bacteria | 1014 |
| 1281 | Ga0500571_314731 | 3300053110 | Bacteria | 513 |
| 1282 | Ga0500582_036894 | 3300053114 | Bacteria | 1536 |
| 1283 | Ga0500592_001298 | 3300053116 | Bacteria | 4052 |
| 1284 | Ga0500593_230583 | 3300053117 | Bacteria | 643 |
| 1285 | Ga0500594_0002506 | 3300053118 | Bacteria | 3995 |
| 1286 | Ga0500594_0012929 | 3300053118 | Bacteria | 1976 |
| 1287 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 1288 | Ga0500595_000497 | 3300053119 | Bacteria | 23997 |
| 1289 | Ga0500595_002282 | 3300053119 | Bacteria | 9644 |
| 1290 | Ga0500595_004153 | 3300053119 | Bacteria | 6566 |
| 1291 | Ga0500595_013163 | 3300053119 | Bacteria | 3173 |
| 1292 | Ga0500595_020920 | 3300053119 | Bacteria | 2344 |
| 1293 | Ga0500597_191896 | 3300053120 | Bacteria | 862 |
| 1294 | Ga0500597_293894 | 3300053120 | Bacteria | 651 |
| 1295 | Ga0500607_019806 | 3300053121 | Bacteria | 3804 |
| 1296 | Ga0500607_066218 | 3300053121 | Bacteria | 1875 |
| 1297 | Ga0500608_334710 | 3300053122 | Bacteria | 544 |
| 1298 | Ga0500618_006607 | 3300053125 | Bacteria | 3387 |
| 1299 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 1300 | Ga0500642_0000143 | 3300053130 | Bacteria | 31709 |
| 1301 | Ga0500642_0001744 | 3300053130 | Bacteria | 6273 |
| 1302 | Ga0500642_0347039 | 3300053130 | Bacteria | 659 |
| 1303 | Ga0500652_003561 | 3300053131 | Bacteria | 4724 |
| 1304 | Ga0500655_029403 | 3300053133 | Bacteria | 1054 |
| 1305 | Ga0500658_0031805 | 3300053134 | Bacteria | 2066 |
| 1306 | Ga0500658_0169324 | 3300053134 | Bacteria | 991 |
| 1307 | Ga0500559_0001714 | 3300053136 | Bacteria | 12043 |
| 1308 | Ga0500559_0005658 | 3300053136 | Bacteria | 5719 |
| 1309 | Ga0500564_121438 | 3300053138 | Bacteria | 1137 |
| 1310 | Ga0500564_330418 | 3300053138 | Bacteria | 574 |
| 1311 | Ga0500568_0010874 | 3300053139 | Bacteria | 4244 |
| 1312 | Ga0500568_0070271 | 3300053139 | Bacteria | 1341 |
| 1313 | Ga0500568_0285877 | 3300053139 | Bacteria | 599 |
| 1314 | Ga0500573_0561340 | 3300053140 | Bacteria | 503 |
| 1315 | Ga0500577_0000798 | 3300053142 | Bacteria | 8118 |
| 1316 | Ga0500577_0245612 | 3300053142 | Bacteria | 777 |
| 1317 | Ga0500579_276854 | 3300053143 | Bacteria | 517 |
| 1318 | Ga0500586_000330 | 3300053145 | Bacteria | 9419 |
| 1319 | Ga0500588_0174675 | 3300053146 | Bacteria | 787 |
| 1320 | Ga0500589_042224 | 3300053147 | Bacteria | 2126 |
| 1321 | Ga0500589_099011 | 3300053147 | Bacteria | 1269 |
| 1322 | Ga0500590_080953 | 3300053148 | Bacteria | 1595 |
| 1323 | Ga0500590_162550 | 3300053148 | Bacteria | 992 |
| 1324 | Ga0500603_009249 | 3300053150 | Bacteria | 2201 |
| 1325 | Ga0500604_0101708 | 3300053151 | Bacteria | 948 |
| 1326 | Ga0500604_0115254 | 3300053151 | Bacteria | 895 |
| 1327 | Ga0500604_0197041 | 3300053151 | Bacteria | 692 |
| 1328 | Ga0500619_006592 | 3300053154 | Bacteria | 2685 |
| 1329 | Ga0500619_307813 | 3300053154 | Bacteria | 510 |
| 1330 | Ga0500620_262817 | 3300053155 | Bacteria | 571 |
| 1331 | Ga0500622_0083261 | 3300053156 | Bacteria | 1598 |
| 1332 | Ga0500627_0030354 | 3300053158 | Bacteria | 2262 |
| 1333 | Ga0500627_0034673 | 3300053158 | Bacteria | 2141 |
| 1334 | Ga0500627_0043782 | 3300053158 | Bacteria | 1931 |
| 1335 | Ga0500633_0036925 | 3300053160 | Bacteria | 1618 |
| 1336 | Ga0500634_0128681 | 3300053161 | Bacteria | 1219 |
| 1337 | Ga0500634_0204866 | 3300053161 | Bacteria | 862 |
| 1338 | Ga0500634_0348609 | 3300053161 | Bacteria | 566 |
| 1339 | Ga0500638_016198 | 3300053162 | Bacteria | 3434 |
| 1340 | Ga0500638_041168 | 3300053162 | Bacteria | 2244 |
| 1341 | Ga0500638_127956 | 3300053162 | Bacteria | 1155 |
| 1342 | Ga0500638_200225 | 3300053162 | Bacteria | 845 |
| 1343 | Ga0500636_0000148 | 3300053177 | Bacteria | 36338 |
| 1344 | Ga0500636_0015308 | 3300053177 | Bacteria | 4519 |
| 1345 | Ga0500636_0044508 | 3300053177 | Bacteria | 2618 |
| 1346 | Ga0500636_0053183 | 3300053177 | Bacteria | 2377 |
| 1347 | Ga0500636_0227488 | 3300053177 | Bacteria | 967 |
| 1348 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1349 | Ga0500649_164480 | 3300053722 | Bacteria | 775 |
| 1350 | Ga0500611_212108 | 3300053727 | Bacteria | 551 |
| 1351 | Ga0500625_025808 | 3300053729 | Bacteria | 2781 |
| 1352 | Ga0500645_006475 | 3300053730 | Bacteria | 4171 |
| 1353 | Ga0500645_020541 | 3300053730 | Bacteria | 2047 |
| 1354 | Ga0500645_039938 | 3300053730 | Bacteria | 1389 |
| 1355 | Ga0500645_089926 | 3300053730 | Bacteria | 871 |
| 1356 | Ga0500656_005792 | 3300053732 | Bacteria | 1233 |
| 1357 | Ga0500661_001013 | 3300055283 | Bacteria | 5278 |
| 1358 | Ga0500661_007645 | 3300055283 | Bacteria | 1995 |
| 1359 | Ga0466962_0032344 | 3300061719 | Bacteria | 2504 |
| 1360 | Ga0466962_0445135 | 3300061719 | Bacteria | 652 |
| 1361 | 2723842243 | 2721755755 | Bacteria | 8322773 |
| 1362 | 2793077986 | |||
| 1363 | 2874610167 | 2874604998 | Bacteria | 7834745 |
| 1364 | 2876815724 | 2876808645 | Bacteria | 8824342 |
| 1365 | 2879117043 | 2879110137 | Bacteria | 8907982 |
| 1366 | 2922366757 | 2922361189 | Bacteria | 7436256 |
| 1367 | 2922389340 | 2922386360 | Bacteria | 7017218 |
| 1368 | 8006927334 | 8006926726 | Bacteria | 6749210 |
| 1369 | 8006966355 | 8006964411 | Bacteria | 8966052 |
| 1370 | 8006993181 | 8006984368 | Bacteria | 9651211 |
| 1371 | Ga0207697_10173236 | |||
| 1372 | JGI24740J21852_10002607 | |||
| 1373 | JGI24737J22298_10001898 | |||
| 1374 | JGI25153J46596_10009239 | |||
| 1375 | JGI25153J46596_10049944 | |||
| 1376 | JGI25404J52841_10027072 | |||
| 1377 | Ga0055526_1025121 | |||
| 1378 | Ga0055531_10009160 | |||
| 1379 | JGI25405J52794_10157879 | |||
| 1380 | Ga0065707_10558919 | |||
| 1381 | Ga0070658_10100992 | |||
| 1382 | Ga0070676_10238053 | |||
| 1383 | Ga0070676_10452910 | |||
| 1384 | Ga0070683_100011764 | |||
| 1385 | Ga0070683_100042556 | |||
| 1386 | Ga0070683_100293769 | |||
| 1387 | Ga0070683_100546919 | |||
| 1388 | Ga0070690_100085765 | |||
| 1389 | Ga0070670_100196564 | |||
| 1390 | Ga0068869_100131879 | |||
| 1391 | Ga0070666_10473873 | |||
| 1392 | Ga0070666_11236078 | |||
| 1393 | Ga0070680_100017794 | |||
| 1394 | Ga0070680_100086383 | |||
| 1395 | Ga0070680_100442713 | |||
| 1396 | Ga0070680_101376302 | |||
| 1397 | Ga0070682_100023695 | |||
| 1398 | Ga0070682_100286173 | |||
| 1399 | Ga0070682_100381939 | |||
| 1400 | Ga0070682_100592564 | |||
| 1401 | Ga0068868_100095954 | |||
| 1402 | Ga0068868_100213716 | |||
| 1403 | Ga0068868_100786078 | |||
| 1404 | Ga0068868_101023399 | |||
| 1405 | Ga0070660_100003692 | |||
| 1406 | Ga0070660_100284016 | |||
| 1407 | Ga0070660_100402327 | |||
| 1408 | Ga0070660_100896244 | |||
| 1409 | Ga0070660_101032243 | |||
| 1410 | Ga0070691_10025378 | |||
| 1411 | Ga0070691_10135098 | |||
| 1412 | Ga0070661_100073128 | |||
| 1413 | Ga0070661_100214975 | |||
| 1414 | Ga0070692_10896759 | |||
| 1415 | Ga0070668_100041713 | |||
| 1416 | Ga0070668_100395873 | |||
| 1417 | Ga0070668_100445383 | |||
| 1418 | Ga0070668_100550143 | |||
| 1419 | Ga0070668_100589350 | |||
| 1420 | Ga0070668_101053579 | |||
| 1421 | Ga0070669_101218043 | |||
| 1422 | Ga0070669_101237207 | |||
| 1423 | Ga0070669_101569545 | |||
| 1424 | Ga0070675_100848577 | |||
| 1425 | Ga0070675_100966353 | |||
| 1426 | Ga0070671_100140650 | |||
| 1427 | Ga0070671_100335302 | |||
| 1428 | Ga0070671_100544137 | |||
| 1429 | Ga0070674_100309728 | |||
| 1430 | Ga0070674_100831361 | |||
| 1431 | Ga0070674_101054772 | |||
| 1432 | Ga0070673_100187022 | |||
| 1433 | Ga0070673_100305549 | |||
| 1434 | Ga0070673_100865785 | |||
| 1435 | Ga0070673_100886820 | |||
| 1436 | Ga0070673_101339807 | |||
| 1437 | Ga0070688_101021535 | |||
| 1438 | Ga0070659_100114311 | |||
| 1439 | Ga0070659_100408717 | |||
| 1440 | Ga0070659_102109478 | |||
| 1441 | Ga0070667_100387923 | |||
| 1442 | Ga0070667_100832480 | |||
| 1443 | Ga0070667_101235666 | |||
| 1444 | Ga0070667_101456985 | |||
| 1445 | Ga0070703_10057966 | |||
| 1446 | Ga0070709_10003406 | |||
| 1447 | Ga0070714_100004471 | |||
| 1448 | Ga0070714_100010483 | |||
| 1449 | Ga0070713_100010463 | |||
| 1450 | Ga0070713_100024195 | |||
| 1451 | Ga0070713_100054553 | |||
| 1452 | Ga0070713_100181775 | |||
| 1453 | Ga0070713_100743935 | |||
| 1454 | Ga0070713_101238075 | |||
| 1455 | Ga0070710_10370455 | |||
| 1456 | Ga0070701_10069119 | |||
| 1457 | Ga0070711_100002277 | |||
| 1458 | Ga0070700_100179938 | |||
| 1459 | Ga0070700_100321171 | |||
| 1460 | Ga0070700_101371046 | |||
| 1461 | Ga0070663_100004275 | |||
| 1462 | Ga0070663_100096128 | |||
| 1463 | Ga0070663_100152961 | |||
| 1464 | Ga0070663_100174511 | |||
| 1465 | Ga0070663_100906726 | |||
| 1466 | Ga0070678_100018412 | |||
| 1467 | Ga0070678_100051193 | |||
| 1468 | Ga0070678_100069727 | |||
| 1469 | Ga0070678_100147771 | |||
| 1470 | Ga0070662_100103279 | |||
| 1471 | Ga0070662_100348139 | |||
| 1472 | Ga0070662_100634142 | |||
| 1473 | Ga0070681_10006411 | |||
| 1474 | Ga0070681_10007888 | |||
| 1475 | Ga0070681_10049606 | |||
| 1476 | Ga0070681_10087304 | |||
| 1477 | Ga0070681_10224288 | |||
| 1478 | Ga0070681_10641873 | |||
| 1479 | Ga0070681_11718644 | |||
| 1480 | Ga0068867_100233957 | |||
| 1481 | Ga0068867_100379654 | |||
| 1482 | Ga0068867_100804010 | |||
| 1483 | Ga0070706_100281577 | |||
| 1484 | Ga0070706_100891922 | |||
| 1485 | Ga0070698_100231594 | |||
| 1486 | Ga0070679_100039460 | |||
| 1487 | Ga0070679_100195311 | |||
| 1488 | Ga0070679_100285758 | |||
| 1489 | Ga0070679_101179880 | |||
| 1490 | Ga0070684_100001671 | |||
| 1491 | Ga0070684_100003951 | |||
| 1492 | Ga0070684_101263467 | |||
| 1493 | Ga0070697_100040193 | |||
| 1494 | Ga0068853_100009612 | |||
| 1495 | Ga0068853_100025909 | |||
| 1496 | Ga0068853_100124111 | |||
| 1497 | Ga0068853_100139885 | |||
| 1498 | Ga0068853_100440700 | |||
| 1499 | Ga0068853_100523859 | |||
| 1500 | Ga0068853_100688251 | |||
| 1501 | Ga0070672_100074181 | |||
| 1502 | Ga0070672_100148648 | |||
| 1503 | Ga0070686_100578983 | |||
| 1504 | Ga0070695_101371784 | |||
| 1505 | Ga0070696_100794389 | |||
| 1506 | Ga0070693_100147363 | |||
| 1507 | Ga0070665_100006775 | |||
| 1508 | Ga0070665_100012547 | |||
| 1509 | Ga0070665_100156769 | |||
| 1510 | Ga0070665_100167886 | |||
| 1511 | Ga0070665_100252716 | |||
| 1512 | Ga0070665_100538598 | |||
| 1513 | Ga0070665_100653078 | |||
| 1514 | Ga0070665_101202722 | |||
| 1515 | Ga0070704_100466046 | |||
| 1516 | Ga0070704_101826829 | |||
| 1517 | Ga0068855_100027307 | |||
| 1518 | Ga0068855_100067619 | |||
| 1519 | Ga0068855_100076573 | |||
| 1520 | Ga0068855_100090289 | |||
| 1521 | Ga0068855_100177986 | |||
| 1522 | Ga0068855_100186937 | |||
| 1523 | Ga0068855_100212522 | |||
| 1524 | Ga0070664_100049486 | |||
| 1525 | Ga0070664_100159004 | |||
| 1526 | Ga0070664_101585966 | |||
| 1527 | Ga0068857_100007471 | |||
| 1528 | Ga0068857_100013087 | |||
| 1529 | Ga0068857_100038262 | |||
| 1530 | Ga0068857_100244908 | |||
| 1531 | Ga0068857_100435988 | |||
| 1532 | Ga0068854_100024624 | |||
| 1533 | Ga0068854_100601709 | |||
| 1534 | Ga0068854_100921927 | |||
| 1535 | Ga0068856_100566037 | |||
| 1536 | Ga0068856_100913878 | |||
| 1537 | Ga0068856_101603708 | |||
| 1538 | Ga0068856_101692440 | |||
| 1539 | Ga0070702_100056835 | |||
| 1540 | Ga0068852_100023307 | |||
| 1541 | Ga0068852_100067778 | |||
| 1542 | Ga0068852_100088449 | |||
| 1543 | Ga0068852_100294178 | |||
| 1544 | Ga0068852_102375087 | |||
| 1545 | Ga0068859_100036471 | |||
| 1546 | Ga0068859_100128727 | |||
| 1547 | Ga0068864_100186634 | |||
| 1548 | Ga0068864_100795912 | |||
| 1549 | Ga0068866_10030173 | |||
| 1550 | Ga0068866_10291203 | |||
| 1551 | Ga0068861_100093110 | |||
| 1552 | Ga0068861_100310549 | |||
| 1553 | Ga0068861_100319113 | |||
| 1554 | Ga0068861_101215064 | |||
| 1555 | Ga0068851_10009555 | |||
| 1556 | Ga0068851_10477632 | |||
| 1557 | Ga0068870_10035691 | |||
| 1558 | Ga0068870_10508534 | |||
| 1559 | Ga0068863_101521688 | |||
| 1560 | Ga0068863_101770099 | |||
| 1561 | Ga0068858_100066851 | |||
| 1562 | Ga0068858_100364369 | |||
| 1563 | Ga0068860_100071594 | |||
| 1564 | Ga0068860_100226177 | |||
| 1565 | Ga0068860_100280008 | |||
| 1566 | Ga0068860_100370438 | |||
| 1567 | Ga0068862_100084042 | |||
| 1568 | Ga0068862_100105209 | |||
| 1569 | Ga0068862_100223020 | |||
| 1570 | Ga0068862_100575299 | |||
| 1571 | Ga0068862_100841792 | |||
| 1572 | Ga0068862_101133275 | |||
| 1573 | Ga0081455_10005341 | |||
| 1574 | Ga0081455_10006340 | |||
| 1575 | Ga0081455_10059374 | |||
| 1576 | Ga0081538_10048792 | |||
| 1577 | Ga0081540_1012552 | |||
| 1578 | Ga0081540_1028527 | |||
| 1579 | Ga0081540_1040553 | |||
| 1580 | Ga0081539_10002599 | |||
| 1581 | Ga0070717_10001116 | |||
| 1582 | Ga0070717_10112278 | |||
| 1583 | Ga0070717_10234107 | |||
| 1584 | Ga0075365_10005412 | |||
| 1585 | Ga0075365_10007226 | |||
| 1586 | Ga0075365_10010923 | |||
| 1587 | Ga0075365_10053667 | |||
| 1588 | Ga0075365_10104277 | |||
| 1589 | Ga0075365_10217461 | |||
| 1590 | Ga0075368_10024079 | |||
| 1591 | Ga0075368_10050344 | |||
| 1592 | Ga0075363_100053455 | |||
| 1593 | Ga0075363_100095281 | |||
| 1594 | Ga0075363_100214719 | |||
| 1595 | Ga0075364_10056964 | |||
| 1596 | Ga0075364_10103254 | |||
| 1597 | Ga0075364_10209244 | |||
| 1598 | Ga0075364_10714455 | |||
| 1599 | Ga0075364_10726323 | |||
| 1600 | Ga0075432_10013645 | |||
| 1601 | Ga0070716_100254125 | |||
| 1602 | Ga0070712_100219332 | |||
| 1603 | Ga0070712_101382812 | |||
| 1604 | Ga0075362_10015472 | |||
| 1605 | Ga0075362_10065296 | |||
| 1606 | Ga0075362_10291249 | |||
| 1607 | Ga0075362_10366428 | |||
| 1608 | Ga0075362_10469750 | |||
| 1609 | Ga0075367_10039353 | |||
| 1610 | Ga0075367_10089603 | |||
| 1611 | Ga0075367_10120989 | |||
| 1612 | Ga0075367_10135636 | |||
| 1613 | Ga0075367_10144501 | |||
| 1614 | Ga0075367_10316984 | |||
| 1615 | Ga0075367_10702205 | |||
| 1616 | Ga0075367_10758596 | |||
| 1617 | Ga0075369_10009026 | |||
| 1618 | Ga0075369_10020531 | |||
| 1619 | Ga0075369_10038747 | |||
| 1620 | Ga0075369_10228126 | |||
| 1621 | Ga0075366_10131148 | |||
| 1622 | Ga0075366_10316323 | |||
| 1623 | Ga0075366_10667824 | |||
| 1624 | Ga0097621_100061585 | |||
| 1625 | Ga0097621_100384130 | |||
| 1626 | Ga0097621_100508629 | |||
| 1627 | Ga0097621_100912547 | |||
| 1628 | Ga0097621_101004074 | |||
| 1629 | Ga0075370_10013335 | |||
| 1630 | Ga0075370_10337151 | |||
| 1631 | Ga0068871_100553775 | |||
| 1632 | Ga0075428_100226864 | |||
| 1633 | Ga0075434_100009502 | |||
| 1634 | Ga0068865_100126938 | |||
| 1635 | Ga0068865_100156609 | |||
| 1636 | Ga0068865_100177836 | |||
| 1637 | Ga0075436_100568533 | |||
| 1638 | Ga0097620_100036468 | |||
| 1639 | Ga0097620_100128729 | |||
| 1640 | Ga0099823_1036587 | |||
| 1641 | Ga0075435_100200434 | |||
| 1642 | Ga0099794_10002476 | |||
| 1643 | Ga0099794_10085426 | |||
| 1644 | Ga0099794_10098702 | |||
| 1645 | Ga0099795_10001129 | |||
| 1646 | Ga0099795_10013742 | |||
| 1647 | Ga0099795_10019144 | |||
| 1648 | Ga0099795_10128202 | |||
| 1649 | Ga0099795_10228721 | |||
| 1650 | Ga0105251_10433864 | |||
| 1651 | Ga0105250_10026826 | |||
| 1652 | Ga0105240_10001631 | |||
| 1653 | Ga0105240_10002788 | |||
| 1654 | Ga0105240_10008633 | |||
| 1655 | Ga0105240_10019828 | |||
| 1656 | Ga0105240_10033307 | |||
| 1657 | Ga0105240_10071475 | |||
| 1658 | Ga0105240_10134875 | |||
| 1659 | Ga0105240_10168470 | |||
| 1660 | Ga0105240_10466580 | |||
| 1661 | Ga0105240_11323547 | |||
| 1662 | Ga0105240_12010928 | |||
| 1663 | Ga0111539_10014399 | |||
| 1664 | Ga0111539_11170263 | |||
| 1665 | Ga0105245_10077857 | |||
| 1666 | Ga0105245_10730984 | |||
| 1667 | Ga0105245_12081666 | |||
| 1668 | Ga0105247_10126721 | |||
| 1669 | Ga0105247_10129484 | |||
| 1670 | Ga0105247_10358656 | |||
| 1671 | Ga0105247_10574376 | |||
| 1672 | Ga0114129_10168882 | |||
| 1673 | Ga0105243_10101927 | |||
| 1674 | Ga0105243_10447974 | |||
| 1675 | Ga0105243_10729377 | |||
| 1676 | Ga0105243_10943835 | |||
| 1677 | Ga0105241_10016343 | |||
| 1678 | Ga0105241_10496041 | |||
| 1679 | Ga0105241_10865338 | |||
| 1680 | Ga0105241_11440924 | |||
| 1681 | Ga0105241_12111740 | |||
| 1682 | Ga0105242_10181907 | |||
| 1683 | Ga0105242_11039166 | |||
| 1684 | Ga0105242_11688964 | |||
| 1685 | Ga0105248_10042051 | |||
| 1686 | Ga0105248_10361346 | |||
| 1687 | Ga0105237_10021125 | |||
| 1688 | Ga0105237_10027168 | |||
| 1689 | Ga0105237_10030221 | |||
| 1690 | Ga0105237_10054084 | |||
| 1691 | Ga0105237_10179886 | |||
| 1692 | Ga0105237_10608729 | |||
| 1693 | Ga0105237_10733765 | |||
| 1694 | Ga0105237_11433480 | |||
| 1695 | Ga0105238_10002394 | |||
| 1696 | Ga0105238_10004666 | |||
| 1697 | Ga0105238_10006268 | |||
| 1698 | Ga0105238_10007999 | |||
| 1699 | Ga0105238_10332213 | |||
| 1700 | Ga0105238_11218272 | |||
| 1701 | Ga0105238_11556123 | |||
| 1702 | Ga0105249_11475125 | |||
| 1703 | Ga0099796_10039140 | |||
| 1704 | Ga0099796_10094634 | |||
| 1705 | Ga0099796_10544448 | |||
| 1706 | Ga0105239_10016677 | |||
| 1707 | Ga0105239_10017503 | |||
| 1708 | Ga0105239_10070257 | |||
| 1709 | Ga0105239_10070346 | |||
| 1710 | Ga0105239_10347613 | |||
| 1711 | Ga0105239_10547906 | |||
| 1712 | Ga0105239_10683011 | |||
| 1713 | Ga0105239_11317365 | |||
| 1714 | Ga0105239_11510866 | |||
| 1715 | Ga0105239_11758788 | |||
| 1716 | Ga0105239_11764825 | |||
| 1717 | Ga0105239_12878546 | |||
| 1718 | Ga0105246_10023159 | |||
| 1719 | Ga0105246_10026492 | |||
| 1720 | Ga0105246_10096483 | |||
| 1721 | Ga0105246_11132365 | |||
| 1722 | Ga0157344_1013290 | |||
| 1723 | Ga0157318_1014053 | |||
| 1724 | Ga0157316_1036984 | |||
| 1725 | Ga0157371_10115181 | |||
| 1726 | Ga0157371_10716645 | |||
| 1727 | Ga0157371_10830230 | |||
| 1728 | Ga0157370_10013445 | |||
| 1729 | Ga0157370_10531279 | |||
| 1730 | Ga0157370_10901388 | |||
| 1731 | Ga0157369_10018692 | |||
| 1732 | Ga0157369_10021614 | |||
| 1733 | Ga0157369_10036307 | |||
| 1734 | Ga0157374_10027912 | |||
| 1735 | Ga0157374_10168655 | |||
| 1736 | Ga0157374_11414775 | |||
| 1737 | Ga0157378_10066352 | |||
| 1738 | Ga0157378_10073227 | |||
| 1739 | Ga0157378_10227175 | |||
| 1740 | Ga0157378_10626899 | |||
| 1741 | Ga0157378_11357676 | |||
| 1742 | Ga0163162_10015498 | |||
| 1743 | Ga0163162_10057235 | |||
| 1744 | Ga0163162_10192145 | |||
| 1745 | Ga0163162_11394313 | |||
| 1746 | Ga0163162_11568492 | |||
| 1747 | Ga0157372_10067956 | |||
| 1748 | Ga0157372_10079148 | |||
| 1749 | Ga0157372_10574589 | |||
| 1750 | Ga0157372_10766687 | |||
| 1751 | Ga0157372_12499678 | |||
| 1752 | Ga0157375_10044510 | |||
| 1753 | Ga0157375_10293845 | |||
| 1754 | Ga0157375_13078166 | |||
| 1755 | Ga0157375_13182192 | |||
| 1756 | Ga0163163_10074865 | |||
| 1757 | Ga0163163_10084542 | |||
| 1758 | Ga0163163_10714343 | |||
| 1759 | Ga0163163_13261324 | |||
| 1760 | Ga0157380_10223349 | |||
| 1761 | Ga0157380_10612798 | |||
| 1762 | Ga0157380_11580869 | |||
| 1763 | Ga0157380_12176979 | |||
| 1764 | Ga0157377_10081359 | |||
| 1765 | Ga0157377_10123387 | |||
| 1766 | Ga0157377_10410368 | |||
| 1767 | Ga0157379_10033261 | |||
| 1768 | Ga0157379_10112561 | |||
| 1769 | Ga0157379_10159391 | |||
| 1770 | Ga0157379_10170930 | |||
| 1771 | Ga0157379_10262352 | |||
| 1772 | Ga0157379_10565469 | |||
| 1773 | Ga0157379_10840125 | |||
| 1774 | Ga0157379_10852726 | |||
| 1775 | Ga0157376_10226942 | |||
| 1776 | Ga0157376_10572644 | |||
| 1777 | Ga0157376_10660465 | |||
| 1778 | Ga0163161_10913218 | |||
| 1779 | Ga0209564_1003160 | |||
| 1780 | Ga0209564_1006871 | |||
| 1781 | Ga0209564_1017804 | |||
| 1782 | Ga0209758_1000015 | |||
| 1783 | Ga0209758_1004632 | |||
| 1784 | Ga0209758_1006280 | |||
| 1785 | Ga0209758_1009996 | |||
| 1786 | Ga0209758_1010086 | |||
| 1787 | Ga0209758_1022902 | |||
| 1788 | Ga0209758_1120724 | |||
| 1789 | Ga0209256_1002592 | |||
| 1790 | Ga0209256_1068457 | |||
| 1791 | Ga0207426_1000217 | |||
| 1792 | Ga0207426_1016643 | |||
| 1793 | Ga0207426_1108679 | |||
| 1794 | Ga0209051_1106550 | |||
| 1795 | Ga0209257_1002989 | |||
| 1796 | Ga0209257_1026125 | |||
| 1797 | Ga0207697_10541765 | |||
| 1798 | Ga0207656_10041260 | |||
| 1799 | Ga0207656_10320129 | |||
| 1800 | Ga0207653_10037971 | |||
| 1801 | Ga0207682_10081724 | |||
| 1802 | Ga0207642_10213379 | |||
| 1803 | Ga0207710_10038269 | |||
| 1804 | Ga0207710_10171436 | |||
| 1805 | Ga0207710_10205014 | |||
| 1806 | Ga0207688_10010434 | |||
| 1807 | Ga0207680_10573502 | |||
| 1808 | Ga0207680_11055744 | |||
| 1809 | Ga0207647_10000121 | |||
| 1810 | Ga0207685_10155918 | |||
| 1811 | Ga0207685_10498364 | |||
| 1812 | Ga0207699_10174206 | |||
| 1813 | Ga0207645_10079836 | |||
| 1814 | Ga0207645_10138925 | |||
| 1815 | Ga0207645_10415417 | |||
| 1816 | Ga0207643_10044900 | |||
| 1817 | Ga0207643_10720775 | |||
| 1818 | Ga0207705_10081118 | |||
| 1819 | Ga0207684_10331385 | |||
| 1820 | Ga0207684_10573677 | |||
| 1821 | Ga0207654_10000156 | |||
| 1822 | Ga0207654_10080959 | |||
| 1823 | Ga0207654_10115182 | |||
| 1824 | Ga0207707_10000143 | |||
| 1825 | Ga0207707_10008151 | |||
| 1826 | Ga0207707_10014431 | |||
| 1827 | Ga0207707_10105877 | |||
| 1828 | Ga0207707_11045354 | |||
| 1829 | Ga0207695_10001028 | |||
| 1830 | Ga0207695_10019143 | |||
| 1831 | Ga0207695_10073340 | |||
| 1832 | Ga0207695_10103371 | |||
| 1833 | Ga0207695_10115462 | |||
| 1834 | Ga0207695_10135842 | |||
| 1835 | Ga0207695_10255073 | |||
| 1836 | Ga0207671_10030586 | |||
| 1837 | Ga0207671_10068414 | |||
| 1838 | Ga0207671_10110923 | |||
| 1839 | Ga0207671_10761091 | |||
| 1840 | Ga0207671_11351004 | |||
| 1841 | Ga0207693_10397185 | |||
| 1842 | Ga0207663_10019239 | |||
| 1843 | Ga0207663_11369437 | |||
| 1844 | Ga0207660_10007904 | |||
| 1845 | Ga0207660_10075631 | |||
| 1846 | Ga0207662_10040742 | |||
| 1847 | Ga0207657_10005482 | |||
| 1848 | Ga0207657_10081530 | |||
| 1849 | Ga0207657_10215621 | |||
| 1850 | Ga0207649_10179476 | |||
| 1851 | Ga0207652_10024703 | |||
| 1852 | Ga0207652_10065253 | |||
| 1853 | Ga0207652_10074664 | |||
| 1854 | Ga0207652_10836310 | |||
| 1855 | Ga0207681_10806366 | |||
| 1856 | Ga0207681_10870153 | |||
| 1857 | Ga0207681_11078012 | |||
| 1858 | Ga0207694_10000186 | |||
| 1859 | Ga0207694_10027217 | |||
| 1860 | Ga0207694_10029840 | |||
| 1861 | Ga0207694_10127692 | |||
| 1862 | Ga0207694_10158093 | |||
| 1863 | Ga0207694_10212070 | |||
| 1864 | Ga0207650_10392024 | |||
| 1865 | Ga0207650_10748330 | |||
| 1866 | Ga0207687_10165880 | |||
| 1867 | Ga0207687_10329460 | |||
| 1868 | Ga0207687_11316005 | |||
| 1869 | Ga0207687_11419795 | |||
| 1870 | Ga0207700_10024697 | |||
| 1871 | Ga0207700_10034094 | |||
| 1872 | Ga0207700_10415105 | |||
| 1873 | Ga0207664_10016865 | |||
| 1874 | Ga0207664_10065077 | |||
| 1875 | Ga0207644_10473343 | |||
| 1876 | Ga0207690_10186554 | |||
| 1877 | Ga0207690_10424932 | |||
| 1878 | Ga0207690_10986678 | |||
| 1879 | Ga0207706_10118230 | |||
| 1880 | Ga0207706_10121877 | |||
| 1881 | Ga0207706_10128089 | |||
| 1882 | Ga0207706_10379788 | |||
| 1883 | Ga0207686_10363744 | |||
| 1884 | Ga0207709_10010853 | |||
| 1885 | Ga0207709_10555064 | |||
| 1886 | Ga0207709_10598354 | |||
| 1887 | Ga0207709_10724192 | |||
| 1888 | Ga0207670_10273332 | |||
| 1889 | Ga0207669_10130937 | |||
| 1890 | Ga0207669_10862701 | |||
| 1891 | Ga0207669_11597502 | |||
| 1892 | Ga0207704_10145727 | |||
| 1893 | Ga0207704_10405640 | |||
| 1894 | Ga0207704_11088168 | |||
| 1895 | Ga0207704_11185159 | |||
| 1896 | Ga0207691_10062150 | |||
| 1897 | Ga0207691_10173916 | |||
| 1898 | Ga0207691_10518455 | |||
| 1899 | Ga0207711_10030129 | |||
| 1900 | Ga0207711_10257545 | |||
| 1901 | Ga0207711_10261215 | |||
| 1902 | Ga0207689_10107240 | |||
| 1903 | Ga0207689_10381278 | |||
| 1904 | Ga0207689_10659464 | |||
| 1905 | Ga0207689_10778994 | |||
| 1906 | Ga0207689_11215612 | |||
| 1907 | Ga0207661_10009377 | |||
| 1908 | Ga0207661_10028137 | |||
| 1909 | Ga0207661_10295156 | |||
| 1910 | Ga0207661_10395929 | |||
| 1911 | Ga0207679_10606129 | |||
| 1912 | Ga0207679_11191872 | |||
| 1913 | Ga0207667_10020014 | |||
| 1914 | Ga0207667_10020505 | |||
| 1915 | Ga0207667_10023400 | |||
| 1916 | Ga0207667_10025056 | |||
| 1917 | Ga0207667_10057622 | |||
| 1918 | Ga0207667_10998509 | |||
| 1919 | Ga0207651_10358880 | |||
| 1920 | Ga0207651_11448683 | |||
| 1921 | Ga0207712_10470997 | |||
| 1922 | Ga0207712_10704372 | |||
| 1923 | Ga0207668_10163868 | |||
| 1924 | Ga0207668_10389326 | |||
| 1925 | Ga0207668_10783421 | |||
| 1926 | Ga0207640_10301766 | |||
| 1927 | Ga0207640_10540751 | |||
| 1928 | Ga0207658_10650420 | |||
| 1929 | Ga0207658_10900729 | |||
| 1930 | Ga0207658_11045407 | |||
| 1931 | Ga0207677_10275907 | |||
| 1932 | Ga0207677_10440319 | |||
| 1933 | Ga0207677_10494314 | |||
| 1934 | Ga0207703_10121025 | |||
| 1935 | Ga0207703_10205049 | |||
| 1936 | Ga0207703_10387995 | |||
| 1937 | Ga0207703_10758340 | |||
| 1938 | Ga0207703_11040507 | |||
| 1939 | Ga0207639_10015471 | |||
| 1940 | Ga0207639_10043716 | |||
| 1941 | Ga0207639_10066380 | |||
| 1942 | Ga0207639_10077369 | |||
| 1943 | Ga0207639_10098345 | |||
| 1944 | Ga0207639_10279479 | |||
| 1945 | Ga0207639_10491193 | |||
| 1946 | Ga0207678_10007639 | |||
| 1947 | Ga0207678_10025016 | |||
| 1948 | Ga0207678_10055862 | |||
| 1949 | Ga0207678_10087755 | |||
| 1950 | Ga0207678_10236829 | |||
| 1951 | Ga0207678_10828132 | |||
| 1952 | Ga0207678_11099351 | |||
| 1953 | Ga0207678_11103988 | |||
| 1954 | Ga0207708_10306848 | |||
| 1955 | Ga0207708_10307142 | |||
| 1956 | Ga0207702_10000064 | |||
| 1957 | Ga0207702_10039481 | |||
| 1958 | Ga0207702_10528544 | |||
| 1959 | Ga0207702_10853984 | |||
| 1960 | Ga0207702_11159115 | |||
| 1961 | Ga0207702_11382797 | |||
| 1962 | Ga0207641_11171949 | |||
| 1963 | Ga0207648_10220133 | |||
| 1964 | Ga0207648_10305019 | |||
| 1965 | Ga0207676_10032201 | |||
| 1966 | Ga0207674_10000946 | |||
| 1967 | Ga0207674_10001023 | |||
| 1968 | Ga0207674_10018135 | |||
| 1969 | Ga0207674_10242682 | |||
| 1970 | Ga0207674_10361018 | |||
| 1971 | Ga0207674_10389418 | |||
| 1972 | Ga0207674_11407648 | |||
| 1973 | Ga0207675_100022393 | |||
| 1974 | Ga0207675_100148351 | |||
| 1975 | Ga0207675_100335926 | |||
| 1976 | Ga0207675_100370820 | |||
| 1977 | Ga0207675_100549391 | |||
| 1978 | Ga0207675_100560234 | |||
| 1979 | Ga0207683_10007406 | |||
| 1980 | Ga0207683_10011518 | |||
| 1981 | Ga0207683_10051080 | |||
| 1982 | Ga0207683_10146225 | |||
| 1983 | Ga0207683_10192417 | |||
| 1984 | Ga0207683_10541005 | |||
| 1985 | Ga0207683_10674818 | |||
| 1986 | Ga0207698_10012190 | |||
| 1987 | Ga0207698_10033871 | |||
| 1988 | Ga0207698_10058830 | |||
| 1989 | Ga0207698_10063110 | |||
| 1990 | Ga0207698_10871055 | |||
| 1991 | Ga0207698_11677531 | |||
| 1992 | Ga0209389_1000012 | |||
| 1993 | Ga0209489_100019 | |||
| 1994 | Ga0209700_100018 | |||
| 1995 | Ga0209179_1049452 | |||
| 1996 | Ga0209588_1044647 | |||
| 1997 | Ga0209813_10049621 | |||
| 1998 | Ga0209813_10151785 | |||
| 1999 | Ga0207428_10037444 | |||
| 2000 | Ga0207428_10921502 | |||
| 2001 | Ga0268266_10003191 | |||
| 2002 | Ga0268266_10015771 | |||
| 2003 | Ga0268266_10041730 | |||
| 2004 | Ga0268266_10092497 | |||
| 2005 | Ga0268266_10123778 | |||
| 2006 | Ga0268266_10370392 | |||
| 2007 | Ga0268266_11128779 | |||
| 2008 | Ga0268265_10067630 | |||
| 2009 | Ga0268265_10187365 | |||
| 2010 | Ga0268265_10941183 | |||
| 2011 | Ga0268265_11170689 | |||
| 2012 | Ga0268264_10050385 | |||
| 2013 | Ga0268264_10373920 | |||
| 2014 | Ga0268264_10669848 | |||
| 2015 | Ga0307517_10000476 | |||
| 2016 | Ga0307517_10266205 | |||
| 2017 | Ga0307517_10442286 | |||
| 2018 | Ga0307515_10183742 | |||
| 2019 | Ga0307515_10228322 | |||
| 2020 | Ga0307515_10362971 | |||
| 2021 | Ga0265338_10754481 | |||
| 2022 | Ga0307512_10425969 | |||
| 2023 | Ga0265762_1099244 | |||
| 2024 | Ga0265330_10010731 | |||
| 2025 | Ga0265330_10021675 | |||
| 2026 | Ga0265330_10030642 | |||
| 2027 | Ga0265328_10106210 | |||
| 2028 | Ga0265328_10211959 | |||
| 2029 | Ga0265328_10298473 | |||
| 2030 | Ga0265325_10024575 | |||
| 2031 | Ga0265340_10016299 | |||
| 2032 | Ga0265340_10120117 | |||
| 2033 | Ga0265340_10234888 | |||
| 2034 | Ga0265339_10132922 | |||
| 2035 | Ga0265339_10323372 | |||
| 2036 | Ga0265331_10129396 | |||
| 2037 | Ga0265316_10045394 | |||
| 2038 | Ga0265316_10411955 | |||
| 2039 | Ga0307513_10182196 | |||
| 2040 | Ga0307513_10196500 | |||
| 2041 | Ga0307513_10519532 | |||
| 2042 | Ga0307509_10359830 | |||
| 2043 | Ga0307509_10440274 | |||
| 2044 | Ga0307408_100686835 | |||
| 2045 | Ga0307408_100808437 | |||
| 2046 | Ga0307508_10062120 | |||
| 2047 | Ga0307508_10121402 | |||
| 2048 | Ga0307508_10151308 | |||
| 2049 | Ga0265314_10054500 | |||
| 2050 | Ga0265342_10202160 | |||
| 2051 | Ga0265342_10259627 | |||
| 2052 | Ga0307516_10032872 | |||
| 2053 | Ga0307516_10110382 | |||
| 2054 | Ga0307516_10417850 | |||
| 2055 | Ga0307516_11022517 | |||
| 2056 | Ga0307405_10353501 | |||
| 2057 | Ga0307405_10582605 | |||
| 2058 | Ga0307405_11335153 | |||
| 2059 | Ga0307413_10016476 | |||
| 2060 | Ga0307406_10094965 | |||
| 2061 | Ga0307406_10436721 | |||
| 2062 | Ga0307406_10791064 | |||
| 2063 | Ga0307412_10167113 | |||
| 2064 | Ga0307412_10727941 | |||
| 2065 | Ga0307412_11424133 | |||
| 2066 | Ga0307409_100294876 | |||
| 2067 | Ga0307409_100961845 | |||
| 2068 | Ga0307416_100143847 | |||
| 2069 | Ga0307416_102451615 | |||
| 2070 | Ga0307416_103787280 | |||
| 2071 | Ga0307414_12165731 | |||
| 2072 | Ga0307411_10929053 | |||
| 2073 | Ga0307411_11230677 | |||
| 2074 | Ga0307411_11357309 | |||
| 2075 | Ga0307411_11450151 | |||
| 2076 | Ga0307415_100049710 | |||
| 2077 | Ga0307415_100267581 | |||
| 2078 | Ga0307415_101115163 | |||
| 2079 | Ga0307510_10015750 | |||
| 2080 | Ga0307510_10123576 | |||
| 2081 | Ga0373959_0085786 | |||
| 2082 | Ga0373928_0239134 | |||
| 2083 | Ga0373929_0161657 | |||
| 2084 | Ga0373923_0024804 | |||
| 2085 | Ga0373936_0014097 | |||
| 2086 | Ga0373936_0308333 | |||
| 2087 | Ga0373953_0413420 | |||
| 2088 | Ga0373954_0162963 | |||
| 2089 | Ga0373956_0155943 | |||
| 2090 | Ga0373960_0140404 | |||
| 2091 | Ga0373943_0644322 | |||
| 2092 | Ga0373946_0011656 | |||
| 2093 | Ga0373955_0069830 | |||
| 2094 | Ga0373955_0979538 | |||
| 2095 | Ga0373961_0159112 | |||
| 2096 | Ga0373931_0188163 | |||
| 2097 | Ga0373931_0420866 | |||
| 2098 | Ga0373935_0001812 | |||
| 2099 | Ga0373927_0000137 | |||
| 2100 | Ga0373927_0091424 | |||
| 2101 | Ga0373927_0146354 | |||
| 2102 | Ga0373933_0000108 | |||
| 2103 | Ga0373933_0639436 | |||
| 2104 | Ga0373947_0003829 | |||
| 2105 | Ga0373947_0680834 | |||
| 2106 | Ga0373937_0089555 | |||
| 2107 | Ga0373937_0883068 | |||
| 2108 | Ga0373937_1096704 | |||
| 2109 | Ga0373925_0008084 | |||
| 2110 | Ga0373925_0151201 | |||
| 2111 | Ga0373925_0519741 | |||
| 2112 | Ga0395899_0351295 | |||
| 2113 | Ga0395900_0010102 | |||
| 2114 | Ga0395898_0036867 | |||
| 2115 | Ga0395898_0166395 | |||
| 2116 | Ga0395898_0767607 | |||
| 2117 | Ga0395905_0062121 | |||
| 2118 | Ga0395905_0514328 | |||
| 2119 | Ga0395905_0584010 | |||
| 2120 | Ga0436364_1091707 | |||
| 2121 | Ga0436364_1175882 | |||
| 2122 | Ga0395901_0141469 | |||
| 2123 | Ga0436365_0263128 | |||
| 2124 | Ga0436365_0503144 | |||
| 2125 | Ga0436365_0661367 | |||
| 2126 | Ga0436365_1219104 | |||
| 2127 | Ga0436365_1404308 | |||
| 2128 | Ga0436361_1064220 | |||
| 2129 | Ga0436363_0386314 | |||
| 2130 | Ga0439465_0012701 | |||
| 2131 | Ga0439465_0040339 | |||
| 2132 | Ga0451787_365869 | |||
| 2133 | Ga0451789_0396661 | |||
| 2134 | Ga0451791_0032085 | |||
| 2135 | Ga0451791_0876452 | |||
| 2136 | Ga0451791_1651265 | |||
| 2137 | Ga0451793_0433591 | |||
| 2138 | Ga0451795_0426728 | |||
| 2139 | Ga0451798_0375827 | |||
| 2140 | Ga0451800_0008514 | |||
| 2141 | Ga0451800_0883643 | |||
| 2142 | Ga0451802_0590931 | |||
| 2143 | Ga0451807_0508539 | |||
| 2144 | Ga0451833_0686837 | |||
| 2145 | Ga0451837_0379450 | |||
| 2146 | Ga0451839_1532871 | |||
| 2147 | Ga0451841_0698586 | |||
| 2148 | Ga0451845_0402220 | |||
| 2149 | Ga0451843_0508687 | |||
| 2150 | Ga0451843_1443504 | |||
| 2151 | Ga0439432_206656 | |||
| 2152 | Ga0439463_120326 | |||
| 2153 | Ga0466969_0057080 | |||
| 2154 | Ga0466966_0001463 | |||
| 2155 | Ga0466961_0000601 | |||
| 2156 | Ga0466963_0098934 | |||
| 2157 | Ga0466963_0376908 | |||
| 2158 | Ga0466963_0523746 | |||
| 2159 | Ga0466971_0023831 | |||
| 2160 | Ga0466968_0156452 | |||
| 2161 | Ga0466970_0121464 | |||
| 2162 | Ga0466959_0020323 | |||
| 2163 | Ga0466959_0122799 | |||
| 2164 | Ga0466958_0068149 | |||
| 2165 | Ga0466967_0118926 | |||
| 2166 | Ga0466967_1835599 | |||
| 2167 | Ga0466967_2346469 | |||
| 2168 | Ga0495617_085265 | |||
| 2169 | Ga0495617_096767 | |||
| 2170 | Ga0495617_102924 | |||
| 2171 | Ga0495592_0042253 | |||
| 2172 | Ga0495592_0099161 | |||
| 2173 | Ga0495603_0000029 | |||
| 2174 | Ga0495603_0004729 | |||
| 2175 | Ga0495603_0014019 | |||
| 2176 | Ga0495603_0226579 | |||
| 2177 | Ga0495603_0380401 | |||
| 2178 | Ga0495590_0079468 | |||
| 2179 | Ga0495590_0171735 | |||
| 2180 | Ga0495590_0336208 | |||
| 2181 | Ga0495629_0000029 | |||
| 2182 | Ga0495629_0103196 | |||
| 2183 | Ga0495638_0039729 | |||
| 2184 | Ga0495638_0304432 | |||
| 2185 | Ga0495641_0004254 | |||
| 2186 | Ga0495651_0018866 | |||
| 2187 | Ga0495651_0561326 | |||
| 2188 | Ga0495653_0053410 | |||
| 2189 | Ga0495653_0261307 | |||
| 2190 | Ga0495650_0150432 | |||
| 2191 | Ga0495580_0000321 | |||
| 2192 | Ga0495580_0143203 | |||
| 2193 | Ga0495582_0000024 | |||
| 2194 | Ga0495582_0047239 | |||
| 2195 | Ga0495582_0175141 | |||
| 2196 | Ga0495582_0752118 | |||
| 2197 | Ga0495605_0077229 | |||
| 2198 | Ga0495605_0121756 | |||
| 2199 | Ga0495605_0305044 | |||
| 2200 | Ga0495639_0000006 | |||
| 2201 | Ga0495639_0026865 | |||
| 2202 | Ga0495639_0077820 | |||
| 2203 | Ga0495662_0000068 | |||
| 2204 | Ga0495664_0002214 | |||
| 2205 | Ga0495664_0007034 | |||
| 2206 | Ga0495664_0088422 | |||
| 2207 | Ga0495664_0439276 | |||
| 2208 | Ga0495584_0087591 | |||
| 2209 | Ga0495584_0088953 | |||
| 2210 | Ga0495584_0105262 | |||
| 2211 | Ga0495584_0268437 | |||
| 2212 | Ga0495585_0032631 | |||
| 2213 | Ga0495585_0302416 | |||
| 2214 | Ga0495585_0368772 | |||
| 2215 | Ga0495585_0479109 | |||
| 2216 | Ga0495594_0000170 | |||
| 2217 | Ga0495594_0044046 | |||
| 2218 | Ga0495594_0101779 | |||
| 2219 | Ga0495596_0022507 | |||
| 2220 | Ga0495596_0081177 | |||
| 2221 | Ga0495596_0156540 | |||
| 2222 | Ga0495607_0077506 | |||
| 2223 | Ga0495607_0190722 | |||
| 2224 | Ga0495607_0444124 | |||
| 2225 | Ga0495583_0076812 | |||
| 2226 | Ga0495583_0078672 | |||
| 2227 | Ga0495583_0294955 | |||
| 2228 | Ga0495583_0323665 | |||
| 2229 | Ga0495606_0167138 | |||
| 2230 | Ga0495606_0291845 | |||
| 2231 | Ga0495608_0009012 | |||
| 2232 | Ga0495610_0041986 | |||
| 2233 | Ga0495616_0016693 | |||
| 2234 | Ga0495616_0059685 | |||
| 2235 | Ga0495616_0202204 | |||
| 2236 | Ga0495618_0074655 | |||
| 2237 | Ga0495628_0014226 | |||
| 2238 | Ga0495628_0110070 | |||
| 2239 | Ga0495628_0592241 | |||
| 2240 | Ga0495628_0896722 | |||
| 2241 | Ga0495630_0018888 | |||
| 2242 | Ga0495630_0121912 | |||
| 2243 | Ga0495631_0037304 | |||
| 2244 | Ga0495631_0084995 | |||
| 2245 | Ga0495631_0129524 | |||
| 2246 | Ga0495631_0482174 | |||
| 2247 | Ga0495632_0100744 | |||
| 2248 | Ga0495632_0101919 | |||
| 2249 | Ga0495632_0121414 | |||
| 2250 | Ga0495632_0220394 | |||
| 2251 | Ga0495632_0223282 | |||
| 2252 | Ga0495637_0087746 | |||
| 2253 | Ga0495643_0028111 | |||
| 2254 | Ga0495644_0014483 | |||
| 2255 | Ga0495644_0038719 | |||
| 2256 | Ga0495644_0130675 | |||
| 2257 | Ga0495644_0205417 | |||
| 2258 | Ga0495644_0207300 | |||
| 2259 | Ga0495644_0357583 | |||
| 2260 | Ga0495648_0002829 | |||
| 2261 | Ga0495648_0053168 | |||
| 2262 | Ga0495648_0162762 | |||
| 2263 | Ga0495648_0203480 | |||
| 2264 | Ga0495663_0044876 | |||
| 2265 | Ga0495663_0047293 | |||
| 2266 | Ga0495663_0282599 | |||
| 2267 | Ga0495663_0340047 | |||
| 2268 | Ga0495666_0003580 | |||
| 2269 | Ga0495666_0197727 | |||
| 2270 | Ga0495666_0201346 | |||
| 2271 | Ga0495652_0005882 | |||
| 2272 | Ga0495652_0026908 | |||
| 2273 | Ga0495652_0075663 | |||
| 2274 | Ga0495652_0633398 | |||
| 2275 | Ga0495654_0012651 | |||
| 2276 | Ga0495665_0000158 | |||
| 2277 | Ga0495665_0261792 | |||
| 2278 | Ga0495640_0015043 | |||
| 2279 | Ga0495640_0050077 | |||
| 2280 | Ga0495587_0008157 | |||
| 2281 | Ga0495587_0501719 | |||
| 2282 | Ga0495598_0009804 | |||
| 2283 | Ga0495598_0271994 | |||
| 2284 | Ga0495598_0429742 | |||
| 2285 | Ga0495609_0092162 | |||
| 2286 | Ga0495609_0189116 | |||
| 2287 | Ga0495609_0267383 | |||
| 2288 | Ga0495621_0066195 | |||
| 2289 | Ga0495621_0096300 | |||
| 2290 | Ga0495621_0179078 | |||
| 2291 | Ga0495597_0061578 | |||
| 2292 | Ga0495597_0216030 | |||
| 2293 | Ga0495645_0069536 | |||
| 2294 | Ga0495622_0020064 | |||
| 2295 | Ga0495622_0025852 | |||
| 2296 | Ga0495622_0050649 | |||
| 2297 | Ga0495633_0042911 | |||
| 2298 | Ga0495633_0074140 | |||
| 2299 | Ga0495633_0185950 | |||
| 2300 | Ga0495667_0003075 | |||
| 2301 | Ga0495667_0152817 | |||
| 2302 | Ga0495656_0023160 | |||
| 2303 | Ga0495656_0064017 | |||
| 2304 | Ga0495656_0182476 | |||
| 2305 | Ga0495656_0394344 | |||
| 2306 | Ga0495668_0071825 | |||
| 2307 | Ga0495668_0178765 | |||
| 2308 | Ga0495668_0253358 | |||
| 2309 | Ga0495668_0296394 | |||
| 2310 | Ga0495634_0000354 | |||
| 2311 | Ga0495634_0080981 | |||
| 2312 | Ga0495611_0083924 | |||
| 2313 | Ga0495611_0287871 | |||
| 2314 | Ga0495611_0370073 | |||
| 2315 | Ga0495611_0436429 | |||
| 2316 | Ga0495625_0028158 | |||
| 2317 | Ga0495625_0283130 | |||
| 2318 | Ga0495625_0667081 | |||
| 2319 | Ga0495635_0000179 | |||
| 2320 | Ga0495635_0018638 | |||
| 2321 | Ga0495635_0628540 | |||
| 2322 | Ga0495659_0010833 | |||
| 2323 | Ga0495659_0050594 | |||
| 2324 | Ga0495661_0012280 | |||
| 2325 | Ga0495661_0414396 | |||
| 2326 | Ga0495661_0432746 | |||
| 2327 | Ga0495588_0001137 | |||
| 2328 | Ga0495588_0007919 | |||
| 2329 | Ga0495588_0226428 | |||
| 2330 | Ga0495588_0475777 | |||
| 2331 | Ga0495657_0005133 | |||
| 2332 | Ga0495657_0114242 | |||
| 2333 | Ga0495657_0493092 | |||
| 2334 | Ga0495599_0491312 | |||
| 2335 | Ga0495623_0010483 | |||
| 2336 | Ga0495623_0104152 | |||
| 2337 | Ga0495646_0003762 | |||
| 2338 | Ga0495646_0012426 | |||
| 2339 | Ga0495647_0000068 | |||
| 2340 | Ga0495647_0016668 | |||
| 2341 | Ga0495658_0000428 | |||
| 2342 | Ga0495658_0820438 | |||
| 2343 | Ga0495669_0031545 | |||
| 2344 | Ga0495669_0069036 | |||
| 2345 | Ga0495669_0164215 | |||
| 2346 | Ga0495669_0203999 | |||
| 2347 | Ga0495669_0319307 | |||
| 2348 | Ga0495613_0081938 | |||
| 2349 | Ga0495613_0085821 | |||
| 2350 | Ga0495624_0010213 | |||
| 2351 | Ga0495624_0212538 | |||
| 2352 | Ga0495670_0012601 | |||
| 2353 | Ga0495670_0013643 | |||
| 2354 | Ga0495670_0118671 | |||
| 2355 | Ga0495670_0448278 | |||
| 2356 | Ga0495670_0483425 | |||
| 2357 | Ga0495671_0016996 | |||
| 2358 | Ga0495671_0081145 | |||
| 2359 | Ga0495671_0225249 | |||
| 2360 | Ga0495649_0219568 | |||
| 2361 | Ga0495589_0034599 | |||
| 2362 | Ga0495589_0099590 | |||
| 2363 | Ga0495589_0124773 | |||
| 2364 | Ga0495600_0006367 | |||
| 2365 | Ga0495600_0196740 | |||
| 2366 | Ga0495600_0224586 | |||
| 2367 | Ga0495600_0593136 | |||
| 2368 | Ga0495660_0228689 | |||
| 2369 | Ga0495581_0000004 | |||
| 2370 | Ga0495581_0069806 | |||
| 2371 | Ga0495581_0070868 | |||
| 2372 | Ga0495581_0089589 | |||
| 2373 | Ga0495604_0000678 | |||
| 2374 | Ga0495604_0105632 | |||
| 2375 | Ga0495604_0268544 | |||
| 2376 | Ga0495604_0776898 | |||
| 2377 | Ga0495636_0017078 | |||
| 2378 | Ga0495636_0026314 | |||
| 2379 | Ga0495636_0047744 | |||
| 2380 | Ga0495674_0000415 | |||
| 2381 | Ga0495674_0224876 | |||
| 2382 | Ga0495674_1123313 | |||
| 2383 | Ga0495672_0034348 | |||
| 2384 | Ga0495672_0117952 | |||
| 2385 | Ga0495672_0211851 | |||
| 2386 | Ga0495676_0005774 | |||
| 2387 | Ga0495676_0060457 | |||
| 2388 | Ga0495680_0001164 | |||
| 2389 | Ga0495683_0137317 | |||
| 2390 | Ga0495683_0166240 | |||
| 2391 | Ga0495683_0166478 | |||
| 2392 | Ga0495675_0004534 | |||
| 2393 | Ga0495677_0017888 | |||
| 2394 | Ga0495677_0158040 | |||
| 2395 | Ga0495677_0257091 | |||
| 2396 | Ga0495677_0438709 | |||
| 2397 | Ga0495679_160938 | |||
| 2398 | Ga0495685_036930 | |||
| 2399 | Ga0495673_0006914 | |||
| 2400 | Ga0495673_0066465 | |||
| 2401 | Ga0495673_0184675 | |||
| 2402 | Ga0495673_0231489 | |||
| 2403 | Ga0495673_0275076 | |||
| 2404 | Ga0495673_0308127 | |||
| 2405 | Ga0495681_0055455 | |||
| 2406 | Ga0495681_0200822 | |||
| 2407 | Ga0495681_0360372 | |||
| 2408 | Ga0495684_0043390 | |||
| 2409 | Ga0495684_0263849 | |||
| 2410 | Ga0495686_0013762 | |||
| 2411 | Ga0495686_0078436 | |||
| 2412 | Ga0495686_0242890 | |||
| 2413 | Ga0495686_0316354 | |||
| 2414 | Ga0495686_0396861 | |||
| 2415 | Ga0495686_0504141 | |||
| 2416 | Ga0495686_0516035 | |||
| 2417 | Ga0495593_0000198 | |||
| 2418 | Ga0495593_0213287 | |||
| 2419 | Ga0495593_0226993 | |||
| 2420 | Ga0495593_0629572 | |||
| 2421 | Ga0495602_0007817 | |||
| 2422 | Ga0495602_0305780 | |||
| 2423 | Ga0495602_1174300 | |||
| 2424 | Ga0495614_0012824 | |||
| 2425 | Ga0495615_0078522 | |||
| 2426 | Ga0495615_0256624 | |||
| 2427 | Ga0495626_0108189 | |||
| 2428 | Ga0496100_0008266 | |||
| 2429 | Ga0496100_0011406 | |||
| 2430 | Ga0496100_0307974 | |||
| 2431 | Ga0496100_0432918 | |||
| 2432 | Ga0496100_1533122 | |||
| 2433 | Ga0496101_0058043 | |||
| 2434 | Ga0496101_0060305 | |||
| 2435 | Ga0496101_0201442 | |||
| 2436 | Ga0496101_0368079 | |||
| 2437 | Ga0496101_0618585 | |||
| 2438 | Ga0496101_0811034 | |||
| 2439 | Ga0496102_0010634 | |||
| 2440 | Ga0496102_0214683 | |||
| 2441 | Ga0496102_0243148 | |||
| 2442 | Ga0496102_0259254 | |||
| 2443 | Ga0496102_1022682 | |||
| 2444 | Ga0496102_1959057 | |||
| 2445 | Ga0496103_0276532 | |||
| 2446 | Ga0496103_0301911 | |||
| 2447 | Ga0496103_0338283 | |||
| 2448 | Ga0496103_0404656 | |||
| 2449 | Ga0496103_0661048 | |||
| 2450 | Ga0496104_0018816 | |||
| 2451 | Ga0496104_0033807 | |||
| 2452 | Ga0496104_0188870 | |||
| 2453 | Ga0496104_0958240 | |||
| 2454 | Ga0496105_0181358 | |||
| 2455 | Ga0496105_0307805 | |||
| 2456 | Ga0496105_0599646 | |||
| 2457 | Ga0496105_0637564 | |||
| 2458 | Ga0496105_0999045 | |||
| 2459 | Ga0496106_0003717 | |||
| 2460 | Ga0496106_0013044 | |||
| 2461 | Ga0496106_0101798 | |||
| 2462 | Ga0496106_0286486 | |||
| 2463 | Ga0496106_0389258 | |||
| 2464 | Ga0496107_0009967 | |||
| 2465 | Ga0496107_0010093 | |||
| 2466 | Ga0496107_0131585 | |||
| 2467 | Ga0496107_0296591 | |||
| 2468 | Ga0496107_0406720 | |||
| 2469 | Ga0496107_1313151 | |||
| 2470 | Ga0496108_0007465 | |||
| 2471 | Ga0496108_0122614 | |||
| 2472 | Ga0496108_0208670 | |||
| 2473 | Ga0496108_0306232 | |||
| 2474 | Ga0496108_0700872 | |||
| 2475 | Ga0496108_1307959 | |||
| 2476 | Ga0496109_0000609 | |||
| 2477 | Ga0496109_0150173 | |||
| 2478 | Ga0496109_0600938 | |||
| 2479 | Ga0496110_0008924 | |||
| 2480 | Ga0496110_0041617 | |||
| 2481 | Ga0496110_0113009 | |||
| 2482 | Ga0496110_0150169 | |||
| 2483 | Ga0496110_0455806 | |||
| 2484 | Ga0496110_0524587 | |||
| 2485 | Ga0496111_0041340 | |||
| 2486 | Ga0496111_0098512 | |||
| 2487 | Ga0496111_0377147 | |||
| 2488 | Ga0496111_0502582 | |||
| 2489 | Ga0496112_0002437 | |||
| 2490 | Ga0496112_0143201 | |||
| 2491 | Ga0496112_0319757 | |||
| 2492 | Ga0496112_0584269 | |||
| 2493 | Ga0496112_0585128 | |||
| 2494 | Ga0496113_0023429 | |||
| 2495 | Ga0496113_0914721 | |||
| 2496 | Ga0496114_0117270 | |||
| 2497 | Ga0496114_0178181 | |||
| 2498 | Ga0496114_0409840 | |||
| 2499 | Ga0496114_0604832 | |||
| 2500 | Ga0496114_0764487 | |||
| 2501 | Ga0496114_0921501 | |||
| 2502 | Ga0496115_0017598 | |||
| 2503 | Ga0496115_0020165 | |||
| 2504 | Ga0496115_0025658 | |||
| 2505 | Ga0496115_0119489 | |||
| 2506 | Ga0496115_0170297 | |||
| 2507 | Ga0496115_0723448 | |||
| 2508 | Ga0496115_1279621 | |||
| 2509 | Ga0496116_0000965 | |||
| 2510 | Ga0496116_0047134 | |||
| 2511 | Ga0496117_0034522 | |||
| 2512 | Ga0496117_0137648 | |||
| 2513 | Ga0496117_0173672 | |||
| 2514 | Ga0496118_0019475 | |||
| 2515 | Ga0496118_0039154 | |||
| 2516 | Ga0496118_0271839 | |||
| 2517 | Ga0496118_0304640 | |||
| 2518 | Ga0496118_0329083 | |||
| 2519 | Ga0496118_0527570 | |||
| 2520 | Ga0496119_0024118 | |||
| 2521 | Ga0496119_0137067 | |||
| 2522 | Ga0496119_0191145 | |||
| 2523 | Ga0496119_0337684 | |||
| 2524 | Ga0496119_0550366 | |||
| 2525 | Ga0496120_0136221 | |||
| 2526 | Ga0496121_0002689 | |||
| 2527 | Ga0496121_0011130 | |||
| 2528 | Ga0496121_0027684 | |||
| 2529 | Ga0496121_0097490 | |||
| 2530 | Ga0496121_0248032 | |||
| 2531 | Ga0496121_0253675 | |||
| 2532 | Ga0496121_0257737 | |||
| 2533 | Ga0496121_0317418 | |||
| 2534 | Ga0496121_0355480 | |||
| 2535 | Ga0496121_0529001 | |||
| 2536 | Ga0496122_0024545 | |||
| 2537 | Ga0496122_0238997 | |||
| 2538 | Ga0496123_0065829 | |||
| 2539 | Ga0496124_0067565 | |||
| 2540 | Ga0496124_0348594 | |||
| 2541 | Ga0496125_0001441 | |||
| 2542 | Ga0496125_0001512 | |||
| 2543 | Ga0496125_0001630 | |||
| 2544 | Ga0496125_0056184 | |||
| 2545 | Ga0496125_0231720 | |||
| 2546 | Ga0496125_0332777 | |||
| 2547 | Ga0496126_0003472 | |||
| 2548 | Ga0496126_0022661 | |||
| 2549 | Ga0496126_0033555 | |||
| 2550 | Ga0496126_0038950 | |||
| 2551 | Ga0496126_0104438 | |||
| 2552 | Ga0496126_0130051 | |||
| 2553 | Ga0496126_0301495 | |||
| 2554 | Ga0496126_0861504 | |||
| 2555 | Ga0495682_0038299 | |||
| 2556 | Ga0495682_0045592 | |||
| 2557 | Ga0495682_0075744 | |||
| 2558 | Ga0501067_0013941 | |||
| 2559 | Ga0501071_0969290 | |||
| 2560 | Ga0501075_0732020 | |||
| 2561 | nmdc:mga03683_109449_c1 | |||
| 2562 | nmdc:mga03683_243412_c1 | |||
| 2563 | nmdc:mga03683_24826_c1 | |||
| 2564 | nmdc:mga03683_284465_c1 | |||
| 2565 | nmdc:mga03683_565971_c1 | |||
| 2566 | nmdc:mga03683_647769_c1 | |||
| 2567 | nmdc:mga03683_99813_c1 | |||
| 2568 | nmdc:mga03n38_39464_c1 | |||
| 2569 | nmdc:mga03n38_579434_c1 | |||
| 2570 | nmdc:mga03n38_585439_c1 | |||
| 2571 | nmdc:mga03n38_867908_c1 | |||
| 2572 | nmdc:mga00v17_22955_c1 | |||
| 2573 | nmdc:mga00v17_28827_c1 | |||
| 2574 | nmdc:mga00v17_738101_c1 | |||
| 2575 | nmdc:mga0yw44_153761_c1 | |||
| 2576 | nmdc:mga0yw44_206802_c1 | |||
| 2577 | nmdc:mga0yw44_434883_c1 | |||
| 2578 | nmdc:mga0yw44_53733_c1 | |||
| 2579 | nmdc:mga0yw44_63216_c1 | |||
| 2580 | nmdc:mga0yw44_66164_c1 | |||
| 2581 | nmdc:mga0yw44_7729_c1 | |||
| 2582 | nmdc:mga0k408_21232_c2 | |||
| 2583 | nmdc:mga0k408_280282_c1 | |||
| 2584 | nmdc:mga0k408_47855_c1 | |||
| 2585 | nmdc:mga0k408_940307_c1 | |||
| 2586 | nmdc:mga06z11_190076_c1 | |||
| 2587 | nmdc:mga06z11_248921_c1 | |||
| 2588 | nmdc:mga06z11_627_c1 | |||
| 2589 | nmdc:mga06z11_666253_c1 | |||
| 2590 | nmdc:mga04h51_17084_c1 | |||
| 2591 | nmdc:mga04h51_176428_c1 | |||
| 2592 | nmdc:mga04h51_51394_c1 | |||
| 2593 | nmdc:mga07m45_2231_c1 | |||
| 2594 | nmdc:mga07m45_244503_c1 | |||
| 2595 | nmdc:mga05p37_90704_c1 | |||
| 2596 | nmdc:mga0qj67_974176_c1 | |||
| 2597 | nmdc:mga08y16_105097_c1 | |||
| 2598 | nmdc:mga08y16_399061_c1 | |||
| 2599 | nmdc:mga0n895_5885_c1 | |||
| 2600 | nmdc:mga0rr50_187200_c1 | |||
| 2601 | nmdc:mga0rr50_893185_c1 | |||
| 2602 | nmdc:mga08x19_769318_c1 | |||
| 2603 | nmdc:mga0sz30_170911_c1 | |||
| 2604 | nmdc:mga0sz30_227467_c1 | |||
| 2605 | nmdc:mga0sz30_26226_c1 | |||
| 2606 | nmdc:mga0sz30_46987_c1 | |||
| 2607 | Ga0495601_0169578 | |||
| 2608 | Ga0495601_0175010 | |||
| 2609 | Ga0495601_0334365 | |||
| 2610 | Ga0495601_0826512 | |||
| 2611 | Ga0500610_0088878 | |||
| 2612 | Ga0500610_0451002 | |||
| 2613 | Ga0495655_0093586 | |||
| 2614 | Ga0495655_0130451 | |||
| 2615 | Ga0495595_0037722 | |||
| 2616 | Ga0495595_0038930 | |||
| 2617 | Ga0495595_0729867 | |||
| 2618 | Ga0495619_0024156 | |||
| 2619 | Ga0495619_0174194 | |||
| 2620 | Ga0500578_0076702 | |||
| 2621 | Ga0500578_0443889 | |||
| 2622 | Ga0500643_000048 | |||
| 2623 | Ga0500643_154038 | |||
| 2624 | Ga0500644_0004674 | |||
| 2625 | Ga0500646_0022886 | |||
| 2626 | Ga0500646_0215919 | |||
| 2627 | Ga0500647_0248655 | |||
| 2628 | Ga0500583_0010766 | |||
| 2629 | Ga0500583_0060762 | |||
| 2630 | Ga0500651_0002004 | |||
| 2631 | Ga0500651_0015050 | |||
| 2632 | Ga0500651_0070845 | |||
| 2633 | Ga0500651_0202834 | |||
| 2634 | Ga0500651_0501790 | |||
| 2635 | Ga0500566_0002605 | |||
| 2636 | Ga0500566_0006460 | |||
| 2637 | Ga0500566_0061049 | |||
| 2638 | Ga0500566_0365180 | |||
| 2639 | Ga0500566_0380453 | |||
| 2640 | Ga0500641_0008827 | |||
| 2641 | Ga0500641_0155793 | |||
| 2642 | Ga0500641_0325848 | |||
| 2643 | Ga0500641_0328934 | |||
| 2644 | Ga0500648_152082 | |||
| 2645 | Ga0500554_061582 | |||
| 2646 | Ga0500555_144278 | |||
| 2647 | Ga0500557_000088 | |||
| 2648 | Ga0500562_020061 | |||
| 2649 | Ga0500569_002366 | |||
| 2650 | Ga0500569_085580 | |||
| 2651 | Ga0500571_314731 | |||
| 2652 | Ga0500582_036894 | |||
| 2653 | Ga0500592_001298 | |||
| 2654 | Ga0500593_230583 | |||
| 2655 | Ga0500594_0002506 | |||
| 2656 | Ga0500594_0012929 | |||
| 2657 | Ga0500595_000333 | |||
| 2658 | Ga0500595_000497 | |||
| 2659 | Ga0500595_002282 | |||
| 2660 | Ga0500595_004153 | |||
| 2661 | Ga0500595_013163 | |||
| 2662 | Ga0500595_020920 | |||
| 2663 | Ga0500597_191896 | |||
| 2664 | Ga0500597_293894 | |||
| 2665 | Ga0500607_019806 | |||
| 2666 | Ga0500607_066218 | |||
| 2667 | Ga0500608_334710 | |||
| 2668 | Ga0500618_006607 | |||
| 2669 | Ga0500642_0000015 | |||
| 2670 | Ga0500642_0000143 | |||
| 2671 | Ga0500642_0001744 | |||
| 2672 | Ga0500642_0347039 | |||
| 2673 | Ga0500652_003561 | |||
| 2674 | Ga0500655_029403 | |||
| 2675 | Ga0500658_0031805 | |||
| 2676 | Ga0500658_0169324 | |||
| 2677 | Ga0500559_0001714 | |||
| 2678 | Ga0500559_0005658 | |||
| 2679 | Ga0500564_121438 | |||
| 2680 | Ga0500564_330418 | |||
| 2681 | Ga0500568_0010874 | |||
| 2682 | Ga0500568_0070271 | |||
| 2683 | Ga0500568_0285877 | |||
| 2684 | Ga0500573_0561340 | |||
| 2685 | Ga0500577_0000798 | |||
| 2686 | Ga0500577_0245612 | |||
| 2687 | Ga0500579_276854 | |||
| 2688 | Ga0500586_000330 | |||
| 2689 | Ga0500588_0174675 | |||
| 2690 | Ga0500589_042224 | |||
| 2691 | Ga0500589_099011 | |||
| 2692 | Ga0500590_080953 | |||
| 2693 | Ga0500590_162550 | |||
| 2694 | Ga0500603_009249 | |||
| 2695 | Ga0500604_0101708 | |||
| 2696 | Ga0500604_0115254 | |||
| 2697 | Ga0500604_0197041 | |||
| 2698 | Ga0500619_006592 | |||
| 2699 | Ga0500619_307813 | |||
| 2700 | Ga0500620_262817 | |||
| 2701 | Ga0500622_0083261 | |||
| 2702 | Ga0500627_0030354 | |||
| 2703 | Ga0500627_0034673 | |||
| 2704 | Ga0500627_0043782 | |||
| 2705 | Ga0500633_0036925 | |||
| 2706 | Ga0500634_0128681 | |||
| 2707 | Ga0500634_0204866 | |||
| 2708 | Ga0500634_0348609 | |||
| 2709 | Ga0500638_016198 | |||
| 2710 | Ga0500638_041168 | |||
| 2711 | Ga0500638_127956 | |||
| 2712 | Ga0500638_200225 | |||
| 2713 | Ga0500636_0000148 | |||
| 2714 | Ga0500636_0015308 | |||
| 2715 | Ga0500636_0044508 | |||
| 2716 | Ga0500636_0053183 | |||
| 2717 | Ga0500636_0227488 | |||
| 2718 | Ga0500637_0000060 | |||
| 2719 | Ga0500649_164480 | |||
| 2720 | Ga0500611_212108 | |||
| 2721 | Ga0500625_025808 | |||
| 2722 | Ga0500645_006475 | |||
| 2723 | Ga0500645_020541 | |||
| 2724 | Ga0500645_039938 | |||
| 2725 | Ga0500645_089926 | |||
| 2726 | Ga0500656_005792 | |||
| 2727 | Ga0500661_001013 | |||
| 2728 | Ga0500661_007645 | |||
| 2729 | Ga0466962_0032344 | |||
| 2730 | Ga0466962_0445135 | |||
| 2731 | 2723842243 | |||
| 2732 | 2793077986 | |||
| 2733 | 2874610167 | |||
| 2734 | 2876815724 | |||
| 2735 | 2879117043 | |||
| 2736 | 2922366757 | |||
| 2737 | 2922389340 | |||
| 2738 | 8006927334 | |||
| 2739 | 8006966355 | |||
| 2740 | 8006993181 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gpv-assembly1.cif.gz_A-2 | cytoplasmic domain structure of the mgte mg2+ channel from clostridiales bacterium | 0.4106 | 3 | 75 |
| 8eox-assembly1.cif.gz_B | precisely patterned nanofibers made from extendable protein multiplexes | 0.405 | 4 | 75 |
| 2uy1-assembly1.cif.gz_A | crystal structure of cstf-77 | 0.404 | 2 | 85 |
| 3ash-assembly2.cif.gz_B | mama d159k mutant 1 | 0.396 | 17 | 87 |
| 8eox-assembly1.cif.gz_A | precisely patterned nanofibers made from extendable protein multiplexes | 0.3783 | 4 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yvzB01 | Mainly Alpha;Alpha Horseshoe;MgtE N-terminal fold;MgtE N-terminal domain-like | 0.4978 | 3 | 75 | 1.25.60.10 |
| af_A0A0R0IBP5_539_661_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.48 | 18 | 87 | 1.25.40.10 |
| af_I1KI77_60_217_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.48 | 3 | 87 | 1.25.40.10 |
| 2zy9B01 | Mainly Alpha;Alpha Horseshoe;MgtE N-terminal fold;MgtE N-terminal domain-like | 0.4759 | 1 | 89 | 1.25.60.10 |
| af_A0A1D6HSV6_399_529_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.4657 | 8 | 87 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A345ZT00-F1-model_v4 | Uncharacterized protein | 0.9265 | 13 | 90 |
|
| AF-A0A1M7AQL1-F1-model_v4 | Uncharacterized protein | 0.9085 | 10 | 87 |
|
| AF-A0A7W6H8H5-F1-model_v4 | Uncharacterized protein | 0.9051 | 13 | 88 |
|
| AF-A0A2M8VF14-F1-model_v4 | deleted | 0.8908 | 13 | 90 |
|
| AF-A0A3B0TMT5-F1-model_v4 | Uncharacterized protein | 0.8805 | 10 | 88 |
|