F493406

General Info

Members Datasets Scaffolds Average Seq Length
1370 515 2740 134

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10173236|Ga0207697_101732362
Length 162
Sequence MFSSRDAFENDFCPVRDELLGEMYRANANGLPLLVESVSSEVRAMLALFCYRRSHLHALAIAIAASCTERELIQLGGRVGSTLYALSREPSARLNAGGNGMWPTPSVRRSAMDQAATTPFCQRTATVKPSCGPSRAVVRMTISPGRSDTTSASLAVAPWLPV

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
122 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
123 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
210 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
221 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
276 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
277 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
278 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
279 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
280 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
281 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
282 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
283 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
286 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
287 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
290 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
293 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
323 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
324 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
325 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
346 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
352 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
353 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
354 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
355 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
356 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
360 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
377 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
378 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
379 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
383 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
384 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
385 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
386 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
387 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
388 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
389 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
390 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
428 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
429 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
430 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
446 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
452 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
453 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
454 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
457 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
458 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
459 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
460 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
461 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
464 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
465 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
466 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
467 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
468 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
469 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
470 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
471 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
472 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
473 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
474 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
475 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
476 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
482 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
483 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
484 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
485 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
486 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
487 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
488 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
489 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
490 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
491 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
492 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
493 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
494 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
495 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
496 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
499 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
500 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
501 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
502 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
503 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
504 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
507 2791355199
508 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
509 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
510 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
511 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
512 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
513 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
514 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
515 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.07
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.4
Nodule 0.73
Rhizoplane 6.79
Rhizosphere 70.8
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10173236 3300025315 Bacteria 944
2 JGI24740J21852_10002607 3300001979 Bacteria 8132
3 JGI24737J22298_10001898 3300001990 Bacteria 7467
4 JGI25153J46596_10009239 3300003215 Bacteria 4612
5 JGI25153J46596_10049944 3300003215 Bacteria 1210
6 JGI25404J52841_10027072 3300003659 Bacteria 1234
7 Ga0055526_1025121 3300003771 Bacteria 1921
8 Ga0055531_10009160 3300003794 Bacteria 5102
9 JGI25405J52794_10157879 3300003911 Bacteria 518
10 Ga0065707_10558919 3300005295 Bacteria 716
11 Ga0070658_10100992 3300005327 Bacteria 2385
12 Ga0070676_10238053 3300005328 Bacteria 1209
13 Ga0070676_10452910 3300005328 Bacteria 903
14 Ga0070683_100011764 3300005329 Bacteria 7577
15 Ga0070683_100042556 3300005329 Bacteria 4182
16 Ga0070683_100293769 3300005329 Bacteria 1546
17 Ga0070683_100546919 3300005329 Bacteria 1107
18 Ga0070690_100085765 3300005330 Bacteria 2066
19 Ga0070670_100196564 3300005331 Bacteria 1752
20 Ga0068869_100131879 3300005334 Bacteria 1921
21 Ga0070666_10473873 3300005335 Bacteria 906
22 Ga0070666_11236078 3300005335 Bacteria 557
23 Ga0070680_100017794 3300005336 Bacteria 5606
24 Ga0070680_100086383 3300005336 Bacteria 2593
25 Ga0070680_100442713 3300005336 Bacteria 1109
26 Ga0070680_101376302 3300005336 Bacteria 611
27 Ga0070682_100023695 3300005337 Bacteria 3646
28 Ga0070682_100286173 3300005337 Bacteria 1203
29 Ga0070682_100381939 3300005337 Bacteria 1060
30 Ga0070682_100592564 3300005337 Bacteria 874
31 Ga0068868_100095954 3300005338 Bacteria 2394
32 Ga0068868_100213716 3300005338 Bacteria 1613
33 Ga0068868_100786078 3300005338 Bacteria 858
34 Ga0068868_101023399 3300005338 Bacteria 757
35 Ga0070660_100003692 3300005339 Bacteria 10562
36 Ga0070660_100284016 3300005339 Bacteria 1354
37 Ga0070660_100402327 3300005339 Bacteria 1132
38 Ga0070660_100896244 3300005339 Bacteria 748
39 Ga0070660_101032243 3300005339 Bacteria 695
40 Ga0070691_10025378 3300005341 Bacteria 2759
41 Ga0070691_10135098 3300005341 Bacteria 1253
42 Ga0070661_100073128 3300005344 Bacteria 2524
43 Ga0070661_100214975 3300005344 Bacteria 1473
44 Ga0070692_10896759 3300005345 Bacteria 613
45 Ga0070668_100041713 3300005347 Bacteria 3516
46 Ga0070668_100395873 3300005347 Bacteria 1178
47 Ga0070668_100445383 3300005347 Bacteria 1112
48 Ga0070668_100550143 3300005347 Bacteria 1004
49 Ga0070668_100589350 3300005347 Bacteria 971
50 Ga0070668_101053579 3300005347 Bacteria 732
51 Ga0070669_101218043 3300005353 Bacteria 650
52 Ga0070669_101237207 3300005353 Bacteria 645
53 Ga0070669_101569545 3300005353 Bacteria 573
54 Ga0070675_100848577 3300005354 Bacteria 836
55 Ga0070675_100966353 3300005354 Bacteria 782
56 Ga0070671_100140650 3300005355 Bacteria 2037
57 Ga0070671_100335302 3300005355 Bacteria 1289
58 Ga0070671_100544137 3300005355 Bacteria 1001
59 Ga0070674_100309728 3300005356 Bacteria 1262
60 Ga0070674_100831361 3300005356 Bacteria 800
61 Ga0070674_101054772 3300005356 Bacteria 716
62 Ga0070673_100187022 3300005364 Bacteria 1776
63 Ga0070673_100305549 3300005364 Bacteria 1402
64 Ga0070673_100865785 3300005364 Bacteria 837
65 Ga0070673_100886820 3300005364 Bacteria 827
66 Ga0070673_101339807 3300005364 Bacteria 673
67 Ga0070688_101021535 3300005365 Bacteria 658
68 Ga0070659_100114311 3300005366 Bacteria 2180
69 Ga0070659_100408717 3300005366 Bacteria 1147
70 Ga0070659_102109478 3300005366 Bacteria 507
71 Ga0070667_100387923 3300005367 Bacteria 1270
72 Ga0070667_100832480 3300005367 Bacteria 858
73 Ga0070667_101235666 3300005367 Bacteria 699
74 Ga0070667_101456985 3300005367 Bacteria 643
75 Ga0070703_10057966 3300005406 Bacteria 1259
76 Ga0070709_10003406 3300005434 Bacteria 8539
77 Ga0070714_100004471 3300005435 Bacteria 10536
78 Ga0070714_100010483 3300005435 Bacteria 7324
79 Ga0070713_100010463 3300005436 Bacteria 6700
80 Ga0070713_100024195 3300005436 Bacteria 4727
81 Ga0070713_100054553 3300005436 Bacteria 3316
82 Ga0070713_100181775 3300005436 Bacteria 1890
83 Ga0070713_100743935 3300005436 Bacteria 938
84 Ga0070713_101238075 3300005436 Bacteria 723
85 Ga0070710_10370455 3300005437 Bacteria 953
86 Ga0070701_10069119 3300005438 Bacteria 1883
87 Ga0070711_100002277 3300005439 Bacteria 10885
88 Ga0070700_100179938 3300005441 Bacteria 1471
89 Ga0070700_100321171 3300005441 Bacteria 1137
90 Ga0070700_101371046 3300005441 Bacteria 597
91 Ga0070663_100004275 3300005455 Bacteria 8359
92 Ga0070663_100096128 3300005455 Bacteria 2203
93 Ga0070663_100152961 3300005455 Bacteria 1770
94 Ga0070663_100174511 3300005455 Bacteria 1663
95 Ga0070663_100906726 3300005455 Bacteria 762
96 Ga0070678_100018412 3300005456 Bacteria 4525
97 Ga0070678_100051193 3300005456 Bacteria 2992
98 Ga0070678_100069727 3300005456 Bacteria 2626
99 Ga0070678_100147771 3300005456 Bacteria 1889
100 Ga0070662_100103279 3300005457 Bacteria 2161
101 Ga0070662_100348139 3300005457 Bacteria 1213
102 Ga0070662_100634142 3300005457 Bacteria 901
103 Ga0070681_10006411 3300005458 Bacteria 11447
104 Ga0070681_10007888 3300005458 Bacteria 10418
105 Ga0070681_10049606 3300005458 Bacteria 4191
106 Ga0070681_10087304 3300005458 Bacteria 3072
107 Ga0070681_10224288 3300005458 Bacteria 1794
108 Ga0070681_10641873 3300005458 Bacteria 976
109 Ga0070681_11718644 3300005458 Bacteria 554
110 Ga0068867_100233957 3300005459 Bacteria 1487
111 Ga0068867_100379654 3300005459 Bacteria 1187
112 Ga0068867_100804010 3300005459 Bacteria 839
113 Ga0070706_100281577 3300005467 Bacteria 1552
114 Ga0070706_100891922 3300005467 Bacteria 822
115 Ga0070698_100231594 3300005471 Bacteria 1780
116 Ga0070679_100039460 3300005530 Bacteria 4692
117 Ga0070679_100195311 3300005530 Bacteria 1991
118 Ga0070679_100285758 3300005530 Bacteria 1601
119 Ga0070679_101179880 3300005530 Bacteria 711
120 Ga0070684_100001671 3300005535 Bacteria 16123
121 Ga0070684_100003951 3300005535 Bacteria 11230
122 Ga0070684_101263467 3300005535 Bacteria 695
123 Ga0070697_100040193 3300005536 Bacteria 3783
124 Ga0068853_100009612 3300005539 Bacteria 7791
125 Ga0068853_100025909 3300005539 Bacteria 4922
126 Ga0068853_100124111 3300005539 Bacteria 2306
127 Ga0068853_100139885 3300005539 Bacteria 2173
128 Ga0068853_100440700 3300005539 Bacteria 1224
129 Ga0068853_100523859 3300005539 Bacteria 1121
130 Ga0068853_100688251 3300005539 Bacteria 975
131 Ga0070672_100074181 3300005543 Bacteria 2713
132 Ga0070672_100148648 3300005543 Bacteria 1937
133 Ga0070686_100578983 3300005544 Bacteria 882
134 Ga0070695_101371784 3300005545 Bacteria 586
135 Ga0070696_100794389 3300005546 Bacteria 778
136 Ga0070693_100147363 3300005547 Bacteria 1487
137 Ga0070665_100006775 3300005548 Bacteria 11646
138 Ga0070665_100012547 3300005548 Bacteria 8534
139 Ga0070665_100156769 3300005548 Bacteria 2278
140 Ga0070665_100167886 3300005548 Bacteria 2196
141 Ga0070665_100252716 3300005548 Bacteria 1763
142 Ga0070665_100538598 3300005548 Bacteria 1179
143 Ga0070665_100653078 3300005548 Bacteria 1065
144 Ga0070665_101202722 3300005548 Bacteria 769
145 Ga0070704_100466046 3300005549 Bacteria 1091
146 Ga0070704_101826829 3300005549 Bacteria 563
147 Ga0068855_100027307 3300005563 Bacteria 6830
148 Ga0068855_100067619 3300005563 Bacteria 4161
149 Ga0068855_100076573 3300005563 Bacteria 3882
150 Ga0068855_100090289 3300005563 Bacteria 3536
151 Ga0068855_100177986 3300005563 Bacteria 2405
152 Ga0068855_100186937 3300005563 Bacteria 2339
153 Ga0068855_100212522 3300005563 Bacteria 2173
154 Ga0070664_100049486 3300005564 Bacteria 3555
155 Ga0070664_100159004 3300005564 Bacteria 1998
156 Ga0070664_101585966 3300005564 Bacteria 620
157 Ga0068857_100007471 3300005577 Bacteria 9410
158 Ga0068857_100013087 3300005577 Bacteria 7230
159 Ga0068857_100038262 3300005577 Bacteria 4248
160 Ga0068857_100244908 3300005577 Bacteria 1642
161 Ga0068857_100435988 3300005577 Bacteria 1223
162 Ga0068854_100024624 3300005578 Bacteria 4124
163 Ga0068854_100601709 3300005578 Bacteria 939
164 Ga0068854_100921927 3300005578 Bacteria 769
165 Ga0068856_100566037 3300005614 Bacteria 1158
166 Ga0068856_100913878 3300005614 Bacteria 896
167 Ga0068856_101603708 3300005614 Bacteria 664
168 Ga0068856_101692440 3300005614 Bacteria 645
169 Ga0070702_100056835 3300005615 Bacteria 2262
170 Ga0068852_100023307 3300005616 Bacteria 4981
171 Ga0068852_100067778 3300005616 Bacteria 3121
172 Ga0068852_100088449 3300005616 Bacteria 2767
173 Ga0068852_100294178 3300005616 Bacteria 1570
174 Ga0068852_102375087 3300005616 Bacteria 551
175 Ga0068859_100036471 3300005617 Bacteria 4936
176 Ga0068859_100128727 3300005617 Bacteria 2602
177 Ga0068864_100186634 3300005618 Bacteria 1898
178 Ga0068864_100795912 3300005618 Bacteria 929
179 Ga0068866_10030173 3300005718 Bacteria 2600
180 Ga0068866_10291203 3300005718 Bacteria 1016
181 Ga0068861_100093110 3300005719 Bacteria 2382
182 Ga0068861_100310549 3300005719 Bacteria 1369
183 Ga0068861_100319113 3300005719 Bacteria 1352
184 Ga0068861_101215064 3300005719 Bacteria 729
185 Ga0068851_10009555 3300005834 Bacteria 4514
186 Ga0068851_10477632 3300005834 Bacteria 745
187 Ga0068870_10035691 3300005840 Bacteria 2553
188 Ga0068870_10508534 3300005840 Bacteria 804
189 Ga0068863_101521688 3300005841 Bacteria 678
190 Ga0068863_101770099 3300005841 Bacteria 628
191 Ga0068858_100066851 3300005842 Bacteria 3329
192 Ga0068858_100364369 3300005842 Bacteria 1385
193 Ga0068860_100071594 3300005843 Bacteria 3294
194 Ga0068860_100226177 3300005843 Bacteria 1817
195 Ga0068860_100280008 3300005843 Bacteria 1629
196 Ga0068860_100370438 3300005843 Bacteria 1412
197 Ga0068862_100084042 3300005844 Bacteria 2765
198 Ga0068862_100105209 3300005844 Bacteria 2473
199 Ga0068862_100223020 3300005844 Bacteria 1707
200 Ga0068862_100575299 3300005844 Bacteria 1078
201 Ga0068862_100841792 3300005844 Bacteria 898
202 Ga0068862_101133275 3300005844 Bacteria 778
203 Ga0081455_10005341 3300005937 Bacteria 14109
204 Ga0081455_10006340 3300005937 Bacteria 12701
205 Ga0081455_10059374 3300005937 Bacteria 3230
206 Ga0081538_10048792 3300005981 Bacteria 2577
207 Ga0081540_1012552 3300005983 Bacteria 5567
208 Ga0081540_1028527 3300005983 Bacteria 3132
209 Ga0081540_1040553 3300005983 Bacteria 2426
210 Ga0081539_10002599 3300005985 Bacteria 24763
211 Ga0070717_10001116 3300006028 Bacteria 18122
212 Ga0070717_10112278 3300006028 Bacteria 2326
213 Ga0070717_10234107 3300006028 Bacteria 1618
214 Ga0075365_10005412 3300006038 Bacteria 6880
215 Ga0075365_10007226 3300006038 Bacteria 6204
216 Ga0075365_10010923 3300006038 Bacteria 5317
217 Ga0075365_10053667 3300006038 Bacteria 2670
218 Ga0075365_10104277 3300006038 Bacteria 1944
219 Ga0075365_10217461 3300006038 Bacteria 1340
220 Ga0075368_10024079 3300006042 Bacteria 2329
221 Ga0075368_10050344 3300006042 Bacteria 1654
222 Ga0075363_100053455 3300006048 Bacteria 2158
223 Ga0075363_100095281 3300006048 Bacteria 1642
224 Ga0075363_100214719 3300006048 Bacteria 1101
225 Ga0075364_10056964 3300006051 Bacteria 2559
226 Ga0075364_10103254 3300006051 Bacteria 1898
227 Ga0075364_10209244 3300006051 Bacteria 1323
228 Ga0075364_10714455 3300006051 Bacteria 684
229 Ga0075364_10726323 3300006051 Bacteria 678
230 Ga0075432_10013645 3300006058 Bacteria 2761
231 Ga0070716_100254125 3300006173 Bacteria 1199
232 Ga0070712_100219332 3300006175 Bacteria 1505
233 Ga0070712_101382812 3300006175 Bacteria 614
234 Ga0075362_10015472 3300006177 Bacteria 3103
235 Ga0075362_10065296 3300006177 Bacteria 1652
236 Ga0075362_10291249 3300006177 Bacteria 809
237 Ga0075362_10366428 3300006177 Bacteria 723
238 Ga0075362_10469750 3300006177 Bacteria 641
239 Ga0075367_10039353 3300006178 Bacteria 2756
240 Ga0075367_10089603 3300006178 Bacteria 1870
241 Ga0075367_10120989 3300006178 Bacteria 1613
242 Ga0075367_10135636 3300006178 Bacteria 1522
243 Ga0075367_10144501 3300006178 Bacteria 1474
244 Ga0075367_10316984 3300006178 Bacteria 982
245 Ga0075367_10702205 3300006178 Bacteria 643
246 Ga0075367_10758596 3300006178 Bacteria 617
247 Ga0075369_10009026 3300006186 Bacteria 3859
248 Ga0075369_10020531 3300006186 Bacteria 2705
249 Ga0075369_10038747 3300006186 Bacteria 2034
250 Ga0075369_10228126 3300006186 Bacteria 863
251 Ga0075366_10131148 3300006195 Bacteria 1513
252 Ga0075366_10316323 3300006195 Bacteria 956
253 Ga0075366_10667824 3300006195 Bacteria 645
254 Ga0097621_100061585 3300006237 Bacteria 3078
255 Ga0097621_100384130 3300006237 Bacteria 1255
256 Ga0097621_100508629 3300006237 Bacteria 1092
257 Ga0097621_100912547 3300006237 Bacteria 819
258 Ga0097621_101004074 3300006237 Bacteria 781
259 Ga0075370_10013335 3300006353 Bacteria 4365
260 Ga0075370_10337151 3300006353 Bacteria 899
261 Ga0068871_100553775 3300006358 Bacteria 1042
262 Ga0075428_100226864 3300006844 Bacteria 2016
263 Ga0075434_100009502 3300006871 Bacteria 9071
264 Ga0068865_100126938 3300006881 Bacteria 1905
265 Ga0068865_100156609 3300006881 Bacteria 1733
266 Ga0068865_100177836 3300006881 Bacteria 1636
267 Ga0075436_100568533 3300006914 Bacteria 833
268 Ga0097620_100036468 3300006931 Bacteria 4936
269 Ga0097620_100128729 3300006931 Bacteria 2602
270 Ga0099823_1036587 3300006944 Bacteria 3760
271 Ga0075435_100200434 3300007076 Bacteria 1691
272 Ga0099794_10002476 3300007265 Bacteria 6813
273 Ga0099794_10085426 3300007265 Bacteria 1561
274 Ga0099794_10098702 3300007265 Bacteria 1456
275 Ga0099795_10001129 3300007788 Bacteria 5569
276 Ga0099795_10013742 3300007788 Bacteria 2493
277 Ga0099795_10019144 3300007788 Bacteria 2210
278 Ga0099795_10128202 3300007788 Bacteria 1021
279 Ga0099795_10228721 3300007788 Bacteria 794
280 Ga0105251_10433864 3300009011 Bacteria 607
281 Ga0105250_10026826 3300009092 Bacteria 2321
282 Ga0105240_10001631 3300009093 Bacteria 38066
283 Ga0105240_10002788 3300009093 Bacteria 27630
284 Ga0105240_10008633 3300009093 Bacteria 14558
285 Ga0105240_10019828 3300009093 Bacteria 8981
286 Ga0105240_10033307 3300009093 Bacteria 6659
287 Ga0105240_10071475 3300009093 Bacteria 4291
288 Ga0105240_10134875 3300009093 Bacteria 2957
289 Ga0105240_10168470 3300009093 Bacteria 2596
290 Ga0105240_10466580 3300009093 Bacteria 1410
291 Ga0105240_11323547 3300009093 Bacteria 759
292 Ga0105240_12010928 3300009093 Bacteria 600
293 Ga0111539_10014399 3300009094 Bacteria 9872
294 Ga0111539_11170263 3300009094 Bacteria 893
295 Ga0105245_10077857 3300009098 Bacteria 3024
296 Ga0105245_10730984 3300009098 Bacteria 1025
297 Ga0105245_12081666 3300009098 Bacteria 621
298 Ga0105247_10126721 3300009101 Bacteria 1660
299 Ga0105247_10129484 3300009101 Bacteria 1643
300 Ga0105247_10358656 3300009101 Bacteria 1027
301 Ga0105247_10574376 3300009101 Bacteria 832
302 Ga0114129_10168882 3300009147 Bacteria 2984
303 Ga0105243_10101927 3300009148 Bacteria 2384
304 Ga0105243_10447974 3300009148 Bacteria 1210
305 Ga0105243_10729377 3300009148 Bacteria 969
306 Ga0105243_10943835 3300009148 Bacteria 861
307 Ga0105241_10016343 3300009174 Bacteria 5442
308 Ga0105241_10496041 3300009174 Bacteria 1088
309 Ga0105241_10865338 3300009174 Bacteria 837
310 Ga0105241_11440924 3300009174 Bacteria 661
311 Ga0105241_12111740 3300009174 Bacteria 557
312 Ga0105242_10181907 3300009176 Bacteria 1855
313 Ga0105242_11039166 3300009176 Bacteria 829
314 Ga0105242_11688964 3300009176 Bacteria 669
315 Ga0105248_10042051 3300009177 Bacteria 5125
316 Ga0105248_10361346 3300009177 Bacteria 1634
317 Ga0105237_10021125 3300009545 Bacteria 6697
318 Ga0105237_10027168 3300009545 Bacteria 5845
319 Ga0105237_10030221 3300009545 Bacteria 5505
320 Ga0105237_10054084 3300009545 Bacteria 4023
321 Ga0105237_10179886 3300009545 Bacteria 2115
322 Ga0105237_10608729 3300009545 Bacteria 1099
323 Ga0105237_10733765 3300009545 Bacteria 994
324 Ga0105237_11433480 3300009545 Bacteria 697
325 Ga0105238_10002394 3300009551 Bacteria 18807
326 Ga0105238_10004666 3300009551 Bacteria 13561
327 Ga0105238_10006268 3300009551 Bacteria 11820
328 Ga0105238_10007999 3300009551 Bacteria 10578
329 Ga0105238_10332213 3300009551 Bacteria 1507
330 Ga0105238_11218272 3300009551 Bacteria 777
331 Ga0105238_11556123 3300009551 Bacteria 691
332 Ga0105249_11475125 3300009553 Bacteria 752
333 Ga0099796_10039140 3300010159 Bacteria 1594
334 Ga0099796_10094634 3300010159 Bacteria 1115
335 Ga0099796_10544448 3300010159 Bacteria 522
336 Ga0105239_10016677 3300010375 Bacteria 8120
337 Ga0105239_10017503 3300010375 Bacteria 7926
338 Ga0105239_10070257 3300010375 Bacteria 3846
339 Ga0105239_10070346 3300010375 Bacteria 3844
340 Ga0105239_10347613 3300010375 Bacteria 1674
341 Ga0105239_10547906 3300010375 Bacteria 1317
342 Ga0105239_10683011 3300010375 Bacteria 1173
343 Ga0105239_11317365 3300010375 Bacteria 833
344 Ga0105239_11510866 3300010375 Bacteria 776
345 Ga0105239_11758788 3300010375 Bacteria 718
346 Ga0105239_11764825 3300010375 Bacteria 717
347 Ga0105239_12878546 3300010375 Bacteria 561
348 Ga0105246_10023159 3300011119 Bacteria 4016
349 Ga0105246_10026492 3300011119 Bacteria 3789
350 Ga0105246_10096483 3300011119 Bacteria 2143
351 Ga0105246_11132365 3300011119 Bacteria 716
352 Ga0157344_1013290 3300012476 Bacteria 629
353 Ga0157318_1014053 3300012482 Bacteria 639
354 Ga0157316_1036984 3300012510 Bacteria 620
355 Ga0157371_10115181 3300013102 Bacteria 1909
356 Ga0157371_10716645 3300013102 Bacteria 750
357 Ga0157371_10830230 3300013102 Bacteria 698
358 Ga0157370_10013445 3300013104 Bacteria 8431
359 Ga0157370_10531279 3300013104 Bacteria 1079
360 Ga0157370_10901388 3300013104 Bacteria 802
361 Ga0157369_10018692 3300013105 Bacteria 7770
362 Ga0157369_10021614 3300013105 Bacteria 7195
363 Ga0157369_10036307 3300013105 Bacteria 5400
364 Ga0157374_10027912 3300013296 Bacteria 5095
365 Ga0157374_10168655 3300013296 Bacteria 2135
366 Ga0157374_11414775 3300013296 Bacteria 718
367 Ga0157378_10066352 3300013297 Bacteria 3232
368 Ga0157378_10073227 3300013297 Bacteria 3079
369 Ga0157378_10227175 3300013297 Bacteria 1777
370 Ga0157378_10626899 3300013297 Bacteria 1089
371 Ga0157378_11357676 3300013297 Bacteria 753
372 Ga0163162_10015498 3300013306 Bacteria 7450
373 Ga0163162_10057235 3300013306 Bacteria 3926
374 Ga0163162_10192145 3300013306 Bacteria 2169
375 Ga0163162_11394313 3300013306 Bacteria 797
376 Ga0163162_11568492 3300013306 Bacteria 751
377 Ga0157372_10067956 3300013307 Bacteria 4006
378 Ga0157372_10079148 3300013307 Bacteria 3716
379 Ga0157372_10574589 3300013307 Bacteria 1314
380 Ga0157372_10766687 3300013307 Bacteria 1121
381 Ga0157372_12499678 3300013307 Bacteria 593
382 Ga0157375_10044510 3300013308 Bacteria 4314
383 Ga0157375_10293845 3300013308 Bacteria 1788
384 Ga0157375_13078166 3300013308 Bacteria 556
385 Ga0157375_13182192 3300013308 Bacteria 548
386 Ga0163163_10074865 3300014325 Bacteria 3379
387 Ga0163163_10084542 3300014325 Bacteria 3179
388 Ga0163163_10714343 3300014325 Bacteria 1066
389 Ga0163163_13261324 3300014325 Bacteria 506
390 Ga0157380_10223349 3300014326 Bacteria 1687
391 Ga0157380_10612798 3300014326 Bacteria 1079
392 Ga0157380_11580869 3300014326 Bacteria 711
393 Ga0157380_12176979 3300014326 Bacteria 618
394 Ga0157377_10081359 3300014745 Bacteria 1894
395 Ga0157377_10123387 3300014745 Bacteria 1573
396 Ga0157377_10410368 3300014745 Bacteria 925
397 Ga0157379_10033261 3300014968 Bacteria 4598
398 Ga0157379_10112561 3300014968 Bacteria 2446
399 Ga0157379_10159391 3300014968 Bacteria 2036
400 Ga0157379_10170930 3300014968 Bacteria 1962
401 Ga0157379_10262352 3300014968 Bacteria 1570
402 Ga0157379_10565469 3300014968 Bacteria 1059
403 Ga0157379_10840125 3300014968 Bacteria 868
404 Ga0157379_10852726 3300014968 Bacteria 862
405 Ga0157376_10226942 3300014969 Bacteria 1733
406 Ga0157376_10572644 3300014969 Bacteria 1120
407 Ga0157376_10660465 3300014969 Bacteria 1047
408 Ga0163161_10913218 3300017792 Bacteria 745
409 Ga0209564_1003160 3300025295 Bacteria 11595
410 Ga0209564_1006871 3300025295 Bacteria 6001
411 Ga0209564_1017804 3300025295 Bacteria 2743
412 Ga0209758_1000015 3300025297 Bacteria 851943
413 Ga0209758_1004632 3300025297 Bacteria 11268
414 Ga0209758_1006280 3300025297 Bacteria 8638
415 Ga0209758_1009996 3300025297 Bacteria 5766
416 Ga0209758_1010086 3300025297 Bacteria 5722
417 Ga0209758_1022902 3300025297 Bacteria 2844
418 Ga0209758_1120724 3300025297 Bacteria 708
419 Ga0209256_1002592 3300025299 Bacteria 14393
420 Ga0209256_1068457 3300025299 Bacteria 805
421 Ga0207426_1000217 3300025302 Bacteria 136180
422 Ga0207426_1016643 3300025302 Bacteria 2633
423 Ga0207426_1108679 3300025302 Bacteria 703
424 Ga0209051_1106550 3300025303 Bacteria 741
425 Ga0209257_1002989 3300025304 Bacteria 15349
426 Ga0209257_1026125 3300025304 Bacteria 1977
427 Ga0207697_10541765 3300025315 Bacteria 512
428 Ga0207656_10041260 3300025321 Bacteria 1960
429 Ga0207656_10320129 3300025321 Bacteria 770
430 Ga0207653_10037971 3300025885 Bacteria 1572
431 Ga0207682_10081724 3300025893 Bacteria 1386
432 Ga0207642_10213379 3300025899 Bacteria 1074
433 Ga0207710_10038269 3300025900 Bacteria 2121
434 Ga0207710_10171436 3300025900 Bacteria 1061
435 Ga0207710_10205014 3300025900 Bacteria 975
436 Ga0207688_10010434 3300025901 Bacteria 5056
437 Ga0207680_10573502 3300025903 Bacteria 806
438 Ga0207680_11055744 3300025903 Bacteria 581
439 Ga0207647_10000121 3300025904 Bacteria 61311
440 Ga0207685_10155918 3300025905 Bacteria 1038
441 Ga0207685_10498364 3300025905 Bacteria 640
442 Ga0207699_10174206 3300025906 Bacteria 1442
443 Ga0207645_10079836 3300025907 Bacteria 2097
444 Ga0207645_10138925 3300025907 Bacteria 1583
445 Ga0207645_10415417 3300025907 Bacteria 906
446 Ga0207643_10044900 3300025908 Bacteria 2495
447 Ga0207643_10720775 3300025908 Bacteria 645
448 Ga0207705_10081118 3300025909 Bacteria 2364
449 Ga0207684_10331385 3300025910 Bacteria 1311
450 Ga0207684_10573677 3300025910 Bacteria 964
451 Ga0207654_10000156 3300025911 Bacteria 43523
452 Ga0207654_10080959 3300025911 Bacteria 1954
453 Ga0207654_10115182 3300025911 Bacteria 1679
454 Ga0207707_10000143 3300025912 Bacteria 74226
455 Ga0207707_10008151 3300025912 Bacteria 9091
456 Ga0207707_10014431 3300025912 Bacteria 6882
457 Ga0207707_10105877 3300025912 Bacteria 2458
458 Ga0207707_11045354 3300025912 Bacteria 668
459 Ga0207695_10001028 3300025913 Bacteria 49101
460 Ga0207695_10019143 3300025913 Bacteria 7889
461 Ga0207695_10073340 3300025913 Bacteria 3488
462 Ga0207695_10103371 3300025913 Bacteria 2840
463 Ga0207695_10115462 3300025913 Bacteria 2659
464 Ga0207695_10135842 3300025913 Bacteria 2412
465 Ga0207695_10255073 3300025913 Bacteria 1653
466 Ga0207671_10030586 3300025914 Bacteria 4014
467 Ga0207671_10068414 3300025914 Bacteria 2646
468 Ga0207671_10110923 3300025914 Bacteria 2087
469 Ga0207671_10761091 3300025914 Bacteria 769
470 Ga0207671_11351004 3300025914 Bacteria 554
471 Ga0207693_10397185 3300025915 Bacteria 1078
472 Ga0207663_10019239 3300025916 Bacteria 3842
473 Ga0207663_11369437 3300025916 Bacteria 570
474 Ga0207660_10007904 3300025917 Bacteria 6882
475 Ga0207660_10075631 3300025917 Bacteria 2460
476 Ga0207662_10040742 3300025918 Bacteria 2731
477 Ga0207657_10005482 3300025919 Bacteria 13248
478 Ga0207657_10081530 3300025919 Bacteria 2717
479 Ga0207657_10215621 3300025919 Bacteria 1539
480 Ga0207649_10179476 3300025920 Bacteria 1481
481 Ga0207652_10024703 3300025921 Bacteria 4987
482 Ga0207652_10065253 3300025921 Bacteria 3152
483 Ga0207652_10074664 3300025921 Bacteria 2953
484 Ga0207652_10836310 3300025921 Bacteria 816
485 Ga0207681_10806366 3300025923 Bacteria 784
486 Ga0207681_10870153 3300025923 Bacteria 754
487 Ga0207681_11078012 3300025923 Bacteria 674
488 Ga0207694_10000186 3300025924 Bacteria 63372
489 Ga0207694_10027217 3300025924 Bacteria 4353
490 Ga0207694_10029840 3300025924 Bacteria 4163
491 Ga0207694_10127692 3300025924 Bacteria 2036
492 Ga0207694_10158093 3300025924 Bacteria 1829
493 Ga0207694_10212070 3300025924 Bacteria 1578
494 Ga0207650_10392024 3300025925 Bacteria 1148
495 Ga0207650_10748330 3300025925 Bacteria 827
496 Ga0207687_10165880 3300025927 Bacteria 1699
497 Ga0207687_10329460 3300025927 Bacteria 1238
498 Ga0207687_11316005 3300025927 Bacteria 621
499 Ga0207687_11419795 3300025927 Bacteria 596
500 Ga0207700_10024697 3300025928 Bacteria 4163
501 Ga0207700_10034094 3300025928 Bacteria 3650
502 Ga0207700_10415105 3300025928 Bacteria 1181
503 Ga0207664_10016865 3300025929 Bacteria 5340
504 Ga0207664_10065077 3300025929 Bacteria 2918
505 Ga0207644_10473343 3300025931 Bacteria 1031
506 Ga0207690_10186554 3300025932 Bacteria 1565
507 Ga0207690_10424932 3300025932 Bacteria 1064
508 Ga0207690_10986678 3300025932 Bacteria 700
509 Ga0207706_10118230 3300025933 Bacteria 2331
510 Ga0207706_10121877 3300025933 Bacteria 2293
511 Ga0207706_10128089 3300025933 Bacteria 2232
512 Ga0207706_10379788 3300025933 Bacteria 1226
513 Ga0207686_10363744 3300025934 Bacteria 1093
514 Ga0207709_10010853 3300025935 Bacteria 5018
515 Ga0207709_10555064 3300025935 Bacteria 904
516 Ga0207709_10598354 3300025935 Bacteria 873
517 Ga0207709_10724192 3300025935 Bacteria 798
518 Ga0207670_10273332 3300025936 Bacteria 1314
519 Ga0207669_10130937 3300025937 Bacteria 1723
520 Ga0207669_10862701 3300025937 Bacteria 754
521 Ga0207669_11597502 3300025937 Bacteria 557
522 Ga0207704_10145727 3300025938 Bacteria 1663
523 Ga0207704_10405640 3300025938 Bacteria 1077
524 Ga0207704_11088168 3300025938 Bacteria 679
525 Ga0207704_11185159 3300025938 Bacteria 651
526 Ga0207691_10062150 3300025940 Bacteria 3390
527 Ga0207691_10173916 3300025940 Bacteria 1884
528 Ga0207691_10518455 3300025940 Bacteria 1012
529 Ga0207711_10030129 3300025941 Bacteria 4577
530 Ga0207711_10257545 3300025941 Bacteria 1603
531 Ga0207711_10261215 3300025941 Bacteria 1592
532 Ga0207689_10107240 3300025942 Bacteria 2296
533 Ga0207689_10381278 3300025942 Bacteria 1174
534 Ga0207689_10659464 3300025942 Bacteria 882
535 Ga0207689_10778994 3300025942 Bacteria 807
536 Ga0207689_11215612 3300025942 Bacteria 634
537 Ga0207661_10009377 3300025944 Bacteria 7018
538 Ga0207661_10028137 3300025944 Bacteria 4301
539 Ga0207661_10295156 3300025944 Bacteria 1452
540 Ga0207661_10395929 3300025944 Bacteria 1252
541 Ga0207679_10606129 3300025945 Bacteria 987
542 Ga0207679_11191872 3300025945 Bacteria 699
543 Ga0207667_10020014 3300025949 Bacteria 7455
544 Ga0207667_10020505 3300025949 Bacteria 7348
545 Ga0207667_10023400 3300025949 Bacteria 6803
546 Ga0207667_10025056 3300025949 Bacteria 6539
547 Ga0207667_10057622 3300025949 Bacteria 4077
548 Ga0207667_10998509 3300025949 Bacteria 824
549 Ga0207651_10358880 3300025960 Bacteria 1229
550 Ga0207651_11448683 3300025960 Bacteria 618
551 Ga0207712_10470997 3300025961 Bacteria 1069
552 Ga0207712_10704372 3300025961 Bacteria 882
553 Ga0207668_10163868 3300025972 Bacteria 1735
554 Ga0207668_10389326 3300025972 Bacteria 1175
555 Ga0207668_10783421 3300025972 Bacteria 843
556 Ga0207640_10301766 3300025981 Bacteria 1267
557 Ga0207640_10540751 3300025981 Bacteria 977
558 Ga0207658_10650420 3300025986 Bacteria 950
559 Ga0207658_10900729 3300025986 Bacteria 805
560 Ga0207658_11045407 3300025986 Bacteria 745
561 Ga0207677_10275907 3300026023 Bacteria 1378
562 Ga0207677_10440319 3300026023 Bacteria 1114
563 Ga0207677_10494314 3300026023 Bacteria 1056
564 Ga0207703_10121025 3300026035 Bacteria 2247
565 Ga0207703_10205049 3300026035 Bacteria 1754
566 Ga0207703_10387995 3300026035 Bacteria 1293
567 Ga0207703_10758340 3300026035 Bacteria 925
568 Ga0207703_11040507 3300026035 Bacteria 786
569 Ga0207639_10015471 3300026041 Bacteria 5384
570 Ga0207639_10043716 3300026041 Bacteria 3365
571 Ga0207639_10066380 3300026041 Bacteria 2804
572 Ga0207639_10077369 3300026041 Bacteria 2623
573 Ga0207639_10098345 3300026041 Bacteria 2358
574 Ga0207639_10279479 3300026041 Bacteria 1468
575 Ga0207639_10491193 3300026041 Bacteria 1120
576 Ga0207678_10007639 3300026067 Bacteria 9552
577 Ga0207678_10025016 3300026067 Bacteria 5213
578 Ga0207678_10055862 3300026067 Bacteria 3400
579 Ga0207678_10087755 3300026067 Bacteria 2658
580 Ga0207678_10236829 3300026067 Bacteria 1563
581 Ga0207678_10828132 3300026067 Bacteria 817
582 Ga0207678_11099351 3300026067 Bacteria 704
583 Ga0207678_11103988 3300026067 Bacteria 702
584 Ga0207708_10306848 3300026075 Bacteria 1292
585 Ga0207708_10307142 3300026075 Bacteria 1291
586 Ga0207702_10000064 3300026078 Bacteria 120869
587 Ga0207702_10039481 3300026078 Bacteria 3955
588 Ga0207702_10528544 3300026078 Bacteria 1152
589 Ga0207702_10853984 3300026078 Bacteria 901
590 Ga0207702_11159115 3300026078 Bacteria 767
591 Ga0207702_11382797 3300026078 Bacteria 698
592 Ga0207641_11171949 3300026088 Bacteria 768
593 Ga0207648_10220133 3300026089 Bacteria 1687
594 Ga0207648_10305019 3300026089 Bacteria 1429
595 Ga0207676_10032201 3300026095 Bacteria 3949
596 Ga0207674_10000946 3300026116 Bacteria 37958
597 Ga0207674_10001023 3300026116 Bacteria 36523
598 Ga0207674_10018135 3300026116 Bacteria 7658
599 Ga0207674_10242682 3300026116 Bacteria 1749
600 Ga0207674_10361018 3300026116 Bacteria 1404
601 Ga0207674_10389418 3300026116 Bacteria 1347
602 Ga0207674_11407648 3300026116 Bacteria 667
603 Ga0207675_100022393 3300026118 Bacteria 5885
604 Ga0207675_100148351 3300026118 Bacteria 2231
605 Ga0207675_100335926 3300026118 Bacteria 1478
606 Ga0207675_100370820 3300026118 Bacteria 1406
607 Ga0207675_100549391 3300026118 Bacteria 1154
608 Ga0207675_100560234 3300026118 Bacteria 1143
609 Ga0207683_10007406 3300026121 Bacteria 9411
610 Ga0207683_10011518 3300026121 Bacteria 7550
611 Ga0207683_10051080 3300026121 Bacteria 3622
612 Ga0207683_10146225 3300026121 Bacteria 2131
613 Ga0207683_10192417 3300026121 Bacteria 1852
614 Ga0207683_10541005 3300026121 Bacteria 1077
615 Ga0207683_10674818 3300026121 Bacteria 958
616 Ga0207698_10012190 3300026142 Bacteria 5613
617 Ga0207698_10033871 3300026142 Bacteria 3716
618 Ga0207698_10058830 3300026142 Bacteria 2981
619 Ga0207698_10063110 3300026142 Bacteria 2897
620 Ga0207698_10871055 3300026142 Bacteria 907
621 Ga0207698_11677531 3300026142 Bacteria 651
622 Ga0209389_1000012 3300027296 Bacteria 213243
623 Ga0209489_100019 3300027361 Bacteria 213243
624 Ga0209700_100018 3300027363 Bacteria 238200
625 Ga0209179_1049452 3300027512 Bacteria 899
626 Ga0209588_1044647 3300027671 Bacteria 1433
627 Ga0209813_10049621 3300027866 Bacteria 1307
628 Ga0209813_10151785 3300027866 Bacteria 830
629 Ga0207428_10037444 3300027907 Bacteria 3946
630 Ga0207428_10921502 3300027907 Bacteria 617
631 Ga0268266_10003191 3300028379 Bacteria 16594
632 Ga0268266_10015771 3300028379 Bacteria 6469
633 Ga0268266_10041730 3300028379 Bacteria 3916
634 Ga0268266_10092497 3300028379 Bacteria 2653
635 Ga0268266_10123778 3300028379 Bacteria 2304
636 Ga0268266_10370392 3300028379 Bacteria 1349
637 Ga0268266_11128779 3300028379 Bacteria 758
638 Ga0268265_10067630 3300028380 Bacteria 2766
639 Ga0268265_10187365 3300028380 Bacteria 1783
640 Ga0268265_10941183 3300028380 Bacteria 850
641 Ga0268265_11170689 3300028380 Bacteria 765
642 Ga0268264_10050385 3300028381 Bacteria 3467
643 Ga0268264_10373920 3300028381 Bacteria 1363
644 Ga0268264_10669848 3300028381 Bacteria 1028
645 Ga0307517_10000476 3300028786 Bacteria 68696
646 Ga0307517_10266205 3300028786 Bacteria 990
647 Ga0307517_10442286 3300028786 Bacteria 676
648 Ga0307515_10183742 3300028794 Bacteria 2029
649 Ga0307515_10228322 3300028794 Bacteria 1661
650 Ga0307515_10362971 3300028794 Bacteria 1088
651 Ga0265338_10754481 3300028800 Bacteria 669
652 Ga0307512_10425969 3300030522 Bacteria 546
653 Ga0265762_1099244 3300030760 Bacteria 644
654 Ga0265330_10010731 3300031235 Bacteria 4310
655 Ga0265330_10021675 3300031235 Bacteria 2929
656 Ga0265330_10030642 3300031235 Bacteria 2414
657 Ga0265328_10106210 3300031239 Bacteria 1042
658 Ga0265328_10211959 3300031239 Bacteria 737
659 Ga0265328_10298473 3300031239 Bacteria 622
660 Ga0265325_10024575 3300031241 Bacteria 3277
661 Ga0265340_10016299 3300031247 Bacteria 3849
662 Ga0265340_10120117 3300031247 Bacteria 1210
663 Ga0265340_10234888 3300031247 Bacteria 819
664 Ga0265339_10132922 3300031249 Bacteria 1271
665 Ga0265339_10323372 3300031249 Bacteria 731
666 Ga0265331_10129396 3300031250 Bacteria 1152
667 Ga0265316_10045394 3300031344 Bacteria 3489
668 Ga0265316_10411955 3300031344 Bacteria 972
669 Ga0307513_10182196 3300031456 Bacteria 1962
670 Ga0307513_10196500 3300031456 Bacteria 1863
671 Ga0307513_10519532 3300031456 Bacteria 906
672 Ga0307509_10359830 3300031507 Bacteria 1175
673 Ga0307509_10440274 3300031507 Bacteria 999
674 Ga0307408_100686835 3300031548 Bacteria 919
675 Ga0307408_100808437 3300031548 Bacteria 851
676 Ga0307508_10062120 3300031616 Bacteria 3298
677 Ga0307508_10121402 3300031616 Bacteria 2216
678 Ga0307508_10151308 3300031616 Bacteria 1925
679 Ga0265314_10054500 3300031711 Bacteria 2768
680 Ga0265342_10202160 3300031712 Bacteria 1079
681 Ga0265342_10259627 3300031712 Bacteria 925
682 Ga0307516_10032872 3300031730 Bacteria 5224
683 Ga0307516_10110382 3300031730 Bacteria 2554
684 Ga0307516_10417850 3300031730 Bacteria 999
685 Ga0307516_11022517 3300031730 Bacteria 500
686 Ga0307405_10353501 3300031731 Bacteria 1134
687 Ga0307405_10582605 3300031731 Bacteria 910
688 Ga0307405_11335153 3300031731 Bacteria 625
689 Ga0307413_10016476 3300031824 Bacteria 3819
690 Ga0307406_10094965 3300031901 Bacteria 2017
691 Ga0307406_10436721 3300031901 Bacteria 1047
692 Ga0307406_10791064 3300031901 Bacteria 800
693 Ga0307412_10167113 3300031911 Bacteria 1641
694 Ga0307412_10727941 3300031911 Bacteria 854
695 Ga0307412_11424133 3300031911 Bacteria 628
696 Ga0307409_100294876 3300031995 Bacteria 1505
697 Ga0307409_100961845 3300031995 Bacteria 870
698 Ga0307416_100143847 3300032002 Bacteria 2173
699 Ga0307416_102451615 3300032002 Bacteria 621
700 Ga0307416_103787280 3300032002 Bacteria 506
701 Ga0307414_12165731 3300032004 Bacteria 519
702 Ga0307411_10929053 3300032005 Bacteria 775
703 Ga0307411_11230677 3300032005 Bacteria 680
704 Ga0307411_11357309 3300032005 Bacteria 649
705 Ga0307411_11450151 3300032005 Bacteria 629
706 Ga0307415_100049710 3300032126 Bacteria 2837
707 Ga0307415_100267581 3300032126 Bacteria 1398
708 Ga0307415_101115163 3300032126 Bacteria 739
709 Ga0307510_10015750 3300033180 Bacteria 8940
710 Ga0307510_10123576 3300033180 Bacteria 2284
711 Ga0373959_0085786 3300034820 Bacteria 731
712 Ga0373928_0239134 3300035084 Bacteria 537
713 Ga0373929_0161657 3300035085 Bacteria 607
714 Ga0373923_0024804 3300035111 Bacteria 2370
715 Ga0373936_0014097 3300035113 Bacteria 3054
716 Ga0373936_0308333 3300035113 Bacteria 715
717 Ga0373953_0413420 3300035117 Bacteria 594
718 Ga0373954_0162963 3300035118 Bacteria 1091
719 Ga0373956_0155943 3300035119 Bacteria 1075
720 Ga0373960_0140404 3300035121 Bacteria 818
721 Ga0373943_0644322 3300035170 Bacteria 626
722 Ga0373946_0011656 3300035171 Bacteria 3286
723 Ga0373955_0069830 3300035172 Bacteria 1961
724 Ga0373955_0979538 3300035172 Bacteria 521
725 Ga0373961_0159112 3300035241 Bacteria 774
726 Ga0373931_0188163 3300035691 Bacteria 1227
727 Ga0373931_0420866 3300035691 Bacteria 849
728 Ga0373935_0001812 3300035692 Bacteria 11998
729 Ga0373927_0000137 3300035695 Bacteria 56546
730 Ga0373927_0091424 3300035695 Bacteria 1976
731 Ga0373927_0146354 3300035695 Bacteria 1547
732 Ga0373933_0000108 3300035724 Bacteria 53024
733 Ga0373933_0639436 3300035724 Bacteria 699
734 Ga0373947_0003829 3300035725 Bacteria 8862
735 Ga0373947_0680834 3300035725 Bacteria 701
736 Ga0373937_0089555 3300036401 Bacteria 2849
737 Ga0373937_0883068 3300036401 Bacteria 843
738 Ga0373937_1096704 3300036401 Bacteria 745
739 Ga0373925_0008084 3300037068 Bacteria 7662
740 Ga0373925_0151201 3300037068 Bacteria 1823
741 Ga0373925_0519741 3300037068 Bacteria 978
742 Ga0395899_0351295 3300037312 Bacteria 986
743 Ga0395900_0010102 3300037418 Bacteria 9655
744 Ga0395898_0036867 3300037466 Bacteria 4853
745 Ga0395898_0166395 3300037466 Bacteria 2109
746 Ga0395898_0767607 3300037466 Bacteria 905
747 Ga0395905_0062121 3300037471 Bacteria 3494
748 Ga0395905_0514328 3300037471 Bacteria 1098
749 Ga0395905_0584010 3300037471 Bacteria 1019
750 Ga0436364_1091707 3300037853 Bacteria 1462
751 Ga0436364_1175882 3300037853 Bacteria 2048
752 Ga0395901_0141469 3300038443 Bacteria 2529
753 Ga0436365_0263128 3300039437 Bacteria 2284
754 Ga0436365_0503144 3300039437 Bacteria 3811
755 Ga0436365_0661367 3300039437 Bacteria 677
756 Ga0436365_1219104 3300039437 Bacteria 1360
757 Ga0436365_1404308 3300039437 Bacteria 819
758 Ga0436361_1064220 3300039447 Bacteria 750
759 Ga0436363_0386314 3300039450 Bacteria 720
760 Ga0439465_0012701 3300041413 Bacteria 2634
761 Ga0439465_0040339 3300041413 Bacteria 1509
762 Ga0451787_365869 3300041441 Bacteria 807
763 Ga0451789_0396661 3300041443 Bacteria 1434
764 Ga0451791_0032085 3300041451 Bacteria 509
765 Ga0451791_0876452 3300041451 Bacteria 606
766 Ga0451791_1651265 3300041451 Bacteria 811
767 Ga0451793_0433591 3300041452 Bacteria 569
768 Ga0451795_0426728 3300041456 Bacteria 677
769 Ga0451798_0375827 3300041458 Bacteria 694
770 Ga0451800_0008514 3300041459 Bacteria 532
771 Ga0451800_0883643 3300041459 Bacteria 1209
772 Ga0451802_0590931 3300041460 Bacteria 690
773 Ga0451807_0508539 3300041486 Bacteria 1492
774 Ga0451833_0686837 3300041491 Bacteria 679
775 Ga0451837_0379450 3300041494 Bacteria 682
776 Ga0451839_1532871 3300041496 Bacteria 671
777 Ga0451841_0698586 3300041498 Bacteria 738
778 Ga0451845_0402220 3300041501 Bacteria 1159
779 Ga0451843_0508687 3300041509 Bacteria 782
780 Ga0451843_1443504 3300041509 Bacteria 621
781 Ga0439432_206656 3300042006 Bacteria 568
782 Ga0439463_120326 3300042016 Bacteria 679
783 Ga0466969_0057080 3300044656 Bacteria 1904
784 Ga0466966_0001463 3300044684 Bacteria 15199
785 Ga0466961_0000601 3300044693 Bacteria 22652
786 Ga0466963_0098934 3300044694 Bacteria 1994
787 Ga0466963_0376908 3300044694 Bacteria 1000
788 Ga0466963_0523746 3300044694 Bacteria 837
789 Ga0466971_0023831 3300044719 Bacteria 2728
790 Ga0466968_0156452 3300044735 Bacteria 1050
791 Ga0466970_0121464 3300044765 Bacteria 1431
792 Ga0466959_0020323 3300045049 Bacteria 4891
793 Ga0466959_0122799 3300045049 Bacteria 1844
794 Ga0466958_0068149 3300045836 Bacteria 2175
795 Ga0466967_0118926 3300045976 Bacteria 2438
796 Ga0466967_1835599 3300045976 Bacteria 603
797 Ga0466967_2346469 3300045976 Bacteria 529
798 Ga0495617_085265 3300046452 Bacteria 1033
799 Ga0495617_096767 3300046452 Bacteria 961
800 Ga0495617_102924 3300046452 Bacteria 927
801 Ga0495592_0042253 3300046454 Bacteria 3414
802 Ga0495592_0099161 3300046454 Bacteria 2078
803 Ga0495603_0000029 3300046455 Bacteria 60872
804 Ga0495603_0004729 3300046455 Bacteria 8133
805 Ga0495603_0014019 3300046455 Bacteria 4847
806 Ga0495603_0226579 3300046455 Bacteria 1078
807 Ga0495603_0380401 3300046455 Bacteria 809
808 Ga0495590_0079468 3300046457 Bacteria 1155
809 Ga0495590_0171735 3300046457 Bacteria 790
810 Ga0495590_0336208 3300046457 Bacteria 572
811 Ga0495629_0000029 3300046459 Bacteria 127000
812 Ga0495629_0103196 3300046459 Bacteria 1989
813 Ga0495638_0039729 3300046460 Bacteria 2985
814 Ga0495638_0304432 3300046460 Bacteria 857
815 Ga0495641_0004254 3300046461 Bacteria 10233
816 Ga0495651_0018866 3300046462 Bacteria 5343
817 Ga0495651_0561326 3300046462 Bacteria 724
818 Ga0495653_0053410 3300046463 Bacteria 3092
819 Ga0495653_0261307 3300046463 Bacteria 1144
820 Ga0495650_0150432 3300046471 Bacteria 836
821 Ga0495580_0000321 3300046472 Bacteria 39093
822 Ga0495580_0143203 3300046472 Bacteria 1657
823 Ga0495582_0000024 3300046473 Bacteria 82444
824 Ga0495582_0047239 3300046473 Bacteria 2371
825 Ga0495582_0175141 3300046473 Bacteria 1222
826 Ga0495582_0752118 3300046473 Bacteria 564
827 Ga0495605_0077229 3300046474 Bacteria 1562
828 Ga0495605_0121756 3300046474 Bacteria 1182
829 Ga0495605_0305044 3300046474 Bacteria 673
830 Ga0495639_0000006 3300046475 Bacteria 100361
831 Ga0495639_0026865 3300046475 Bacteria 2546
832 Ga0495639_0077820 3300046475 Bacteria 1540
833 Ga0495662_0000068 3300046476 Bacteria 36559
834 Ga0495664_0002214 3300046477 Bacteria 10401
835 Ga0495664_0007034 3300046477 Bacteria 6232
836 Ga0495664_0088422 3300046477 Bacteria 1862
837 Ga0495664_0439276 3300046477 Bacteria 782
838 Ga0495584_0087591 3300046491 Bacteria 1569
839 Ga0495584_0088953 3300046491 Bacteria 1557
840 Ga0495584_0105262 3300046491 Bacteria 1426
841 Ga0495584_0268437 3300046491 Bacteria 867
842 Ga0495585_0032631 3300046492 Bacteria 2949
843 Ga0495585_0302416 3300046492 Bacteria 786
844 Ga0495585_0368772 3300046492 Bacteria 695
845 Ga0495585_0479109 3300046492 Bacteria 593
846 Ga0495594_0000170 3300046499 Bacteria 31295
847 Ga0495594_0044046 3300046499 Bacteria 2447
848 Ga0495594_0101779 3300046499 Bacteria 1616
849 Ga0495596_0022507 3300046500 Bacteria 2565
850 Ga0495596_0081177 3300046500 Bacteria 1259
851 Ga0495596_0156540 3300046500 Bacteria 885
852 Ga0495607_0077506 3300046501 Bacteria 1836
853 Ga0495607_0190722 3300046501 Bacteria 1021
854 Ga0495607_0444124 3300046501 Bacteria 583
855 Ga0495583_0076812 3300046506 Bacteria 1458
856 Ga0495583_0078672 3300046506 Bacteria 1436
857 Ga0495583_0294955 3300046506 Bacteria 645
858 Ga0495583_0323665 3300046506 Bacteria 610
859 Ga0495606_0167138 3300046507 Bacteria 1279
860 Ga0495606_0291845 3300046507 Bacteria 887
861 Ga0495608_0009012 3300046511 Bacteria 6978
862 Ga0495610_0041986 3300046512 Bacteria 2291
863 Ga0495616_0016693 3300046513 Bacteria 4057
864 Ga0495616_0059685 3300046513 Bacteria 1875
865 Ga0495616_0202204 3300046513 Bacteria 873
866 Ga0495618_0074655 3300046514 Bacteria 2159
867 Ga0495628_0014226 3300046516 Bacteria 6678
868 Ga0495628_0110070 3300046516 Bacteria 2119
869 Ga0495628_0592241 3300046516 Bacteria 793
870 Ga0495628_0896722 3300046516 Bacteria 615
871 Ga0495630_0018888 3300046517 Bacteria 5067
872 Ga0495630_0121912 3300046517 Bacteria 1978
873 Ga0495631_0037304 3300046518 Bacteria 2166
874 Ga0495631_0084995 3300046518 Bacteria 1363
875 Ga0495631_0129524 3300046518 Bacteria 1084
876 Ga0495631_0482174 3300046518 Bacteria 528
877 Ga0495632_0100744 3300046519 Bacteria 1362
878 Ga0495632_0101919 3300046519 Bacteria 1352
879 Ga0495632_0121414 3300046519 Bacteria 1221
880 Ga0495632_0220394 3300046519 Bacteria 858
881 Ga0495632_0223282 3300046519 Bacteria 851
882 Ga0495637_0087746 3300046520 Bacteria 1231
883 Ga0495643_0028111 3300046522 Bacteria 3156
884 Ga0495644_0014483 3300046523 Bacteria 3021
885 Ga0495644_0038719 3300046523 Bacteria 1798
886 Ga0495644_0130675 3300046523 Bacteria 957
887 Ga0495644_0205417 3300046523 Bacteria 760
888 Ga0495644_0207300 3300046523 Bacteria 756
889 Ga0495644_0357583 3300046523 Bacteria 575
890 Ga0495648_0002829 3300046524 Bacteria 15615
891 Ga0495648_0053168 3300046524 Bacteria 2455
892 Ga0495648_0162762 3300046524 Bacteria 1152
893 Ga0495648_0203480 3300046524 Bacteria 989
894 Ga0495663_0044876 3300046525 Bacteria 1354
895 Ga0495663_0047293 3300046525 Bacteria 1324
896 Ga0495663_0282599 3300046525 Bacteria 595
897 Ga0495663_0340047 3300046525 Bacteria 545
898 Ga0495666_0003580 3300046526 Bacteria 7855
899 Ga0495666_0197727 3300046526 Bacteria 925
900 Ga0495666_0201346 3300046526 Bacteria 915
901 Ga0495652_0005882 3300046529 Bacteria 11474
902 Ga0495652_0026908 3300046529 Bacteria 5073
903 Ga0495652_0075663 3300046529 Bacteria 2795
904 Ga0495652_0633398 3300046529 Bacteria 726
905 Ga0495654_0012651 3300046530 Bacteria 4529
906 Ga0495665_0000158 3300046531 Bacteria 33789
907 Ga0495665_0261792 3300046531 Bacteria 889
908 Ga0495640_0015043 3300046533 Bacteria 5830
909 Ga0495640_0050077 3300046533 Bacteria 2879
910 Ga0495587_0008157 3300046536 Bacteria 6752
911 Ga0495587_0501719 3300046536 Bacteria 671
912 Ga0495598_0009804 3300046537 Bacteria 2276
913 Ga0495598_0271994 3300046537 Bacteria 633
914 Ga0495598_0429742 3300046537 Bacteria 520
915 Ga0495609_0092162 3300046538 Bacteria 1318
916 Ga0495609_0189116 3300046538 Bacteria 864
917 Ga0495609_0267383 3300046538 Bacteria 701
918 Ga0495621_0066195 3300046539 Bacteria 1321
919 Ga0495621_0096300 3300046539 Bacteria 1121
920 Ga0495621_0179078 3300046539 Bacteria 845
921 Ga0495597_0061578 3300046542 Bacteria 1634
922 Ga0495597_0216030 3300046542 Bacteria 763
923 Ga0495645_0069536 3300046543 Bacteria 2542
924 Ga0495622_0020064 3300046557 Bacteria 3112
925 Ga0495622_0025852 3300046557 Bacteria 2743
926 Ga0495622_0050649 3300046557 Bacteria 1926
927 Ga0495633_0042911 3300046558 Bacteria 2146
928 Ga0495633_0074140 3300046558 Bacteria 1586
929 Ga0495633_0185950 3300046558 Bacteria 956
930 Ga0495667_0003075 3300046559 Bacteria 11195
931 Ga0495667_0152817 3300046559 Bacteria 1486
932 Ga0495656_0023160 3300046615 Bacteria 2441
933 Ga0495656_0064017 3300046615 Bacteria 1613
934 Ga0495656_0182476 3300046615 Bacteria 1032
935 Ga0495656_0394344 3300046615 Bacteria 723
936 Ga0495668_0071825 3300046616 Bacteria 1902
937 Ga0495668_0178765 3300046616 Bacteria 1162
938 Ga0495668_0253358 3300046616 Bacteria 963
939 Ga0495668_0296394 3300046616 Bacteria 886
940 Ga0495634_0000354 3300046642 Bacteria 44714
941 Ga0495634_0080981 3300046642 Bacteria 2124
942 Ga0495611_0083924 3300046648 Bacteria 1468
943 Ga0495611_0287871 3300046648 Bacteria 758
944 Ga0495611_0370073 3300046648 Bacteria 657
945 Ga0495611_0436429 3300046648 Bacteria 597
946 Ga0495625_0028158 3300046660 Bacteria 4217
947 Ga0495625_0283130 3300046660 Bacteria 1066
948 Ga0495625_0667081 3300046660 Bacteria 617
949 Ga0495635_0000179 3300046663 Bacteria 40014
950 Ga0495635_0018638 3300046663 Bacteria 4842
951 Ga0495635_0628540 3300046663 Bacteria 700
952 Ga0495659_0010833 3300046664 Bacteria 2935
953 Ga0495659_0050594 3300046664 Bacteria 1511
954 Ga0495661_0012280 3300046665 Bacteria 5785
955 Ga0495661_0414396 3300046665 Bacteria 653
956 Ga0495661_0432746 3300046665 Bacteria 635
957 Ga0495588_0001137 3300046674 Bacteria 11460
958 Ga0495588_0007919 3300046674 Bacteria 4856
959 Ga0495588_0226428 3300046674 Bacteria 987
960 Ga0495588_0475777 3300046674 Bacteria 655
961 Ga0495657_0005133 3300046675 Bacteria 10381
962 Ga0495657_0114242 3300046675 Bacteria 1707
963 Ga0495657_0493092 3300046675 Bacteria 715
964 Ga0495599_0491312 3300046678 Bacteria 723
965 Ga0495623_0010483 3300046679 Bacteria 5998
966 Ga0495623_0104152 3300046679 Bacteria 1726
967 Ga0495646_0003762 3300046680 Bacteria 9487
968 Ga0495646_0012426 3300046680 Bacteria 5414
969 Ga0495647_0000068 3300046681 Bacteria 25521
970 Ga0495647_0016668 3300046681 Bacteria 2590
971 Ga0495658_0000428 3300046683 Bacteria 23516
972 Ga0495658_0820438 3300046683 Bacteria 595
973 Ga0495669_0031545 3300046684 Bacteria 2327
974 Ga0495669_0069036 3300046684 Bacteria 1608
975 Ga0495669_0164215 3300046684 Bacteria 1055
976 Ga0495669_0203999 3300046684 Bacteria 945
977 Ga0495669_0319307 3300046684 Bacteria 749
978 Ga0495613_0081938 3300046689 Bacteria 2344
979 Ga0495613_0085821 3300046689 Bacteria 2283
980 Ga0495624_0010213 3300046690 Bacteria 6471
981 Ga0495624_0212538 3300046690 Bacteria 1173
982 Ga0495670_0012601 3300046691 Bacteria 4158
983 Ga0495670_0013643 3300046691 Bacteria 3995
984 Ga0495670_0118671 3300046691 Bacteria 1373
985 Ga0495670_0448278 3300046691 Bacteria 699
986 Ga0495670_0483425 3300046691 Bacteria 672
987 Ga0495671_0016996 3300046692 Bacteria 3875
988 Ga0495671_0081145 3300046692 Bacteria 1589
989 Ga0495671_0225249 3300046692 Bacteria 907
990 Ga0495649_0219568 3300046694 Bacteria 983
991 Ga0495589_0034599 3300046794 Bacteria 2535
992 Ga0495589_0099590 3300046794 Bacteria 1407
993 Ga0495589_0124773 3300046794 Bacteria 1238
994 Ga0495600_0006367 3300046809 Bacteria 7183
995 Ga0495600_0196740 3300046809 Bacteria 1295
996 Ga0495600_0224586 3300046809 Bacteria 1201
997 Ga0495600_0593136 3300046809 Bacteria 674
998 Ga0495660_0228689 3300046810 Bacteria 873
999 Ga0495581_0000004 3300047315 Bacteria 84424
1000 Ga0495581_0069806 3300047315 Bacteria 2032
1001 Ga0495581_0070868 3300047315 Bacteria 2017
1002 Ga0495581_0089589 3300047315 Bacteria 1784
1003 Ga0495604_0000678 3300047317 Bacteria 28877
1004 Ga0495604_0105632 3300047317 Bacteria 2061
1005 Ga0495604_0268544 3300047317 Bacteria 1157
1006 Ga0495604_0776898 3300047317 Bacteria 604
1007 Ga0495636_0017078 3300047318 Bacteria 2904
1008 Ga0495636_0026314 3300047318 Bacteria 2366
1009 Ga0495636_0047744 3300047318 Bacteria 1788
1010 Ga0495674_0000415 3300047319 Bacteria 38235
1011 Ga0495674_0224876 3300047319 Bacteria 1550
1012 Ga0495674_1123313 3300047319 Bacteria 597
1013 Ga0495672_0034348 3300047320 Bacteria 3134
1014 Ga0495672_0117952 3300047320 Bacteria 1415
1015 Ga0495672_0211851 3300047320 Bacteria 962
1016 Ga0495676_0005774 3300047321 Bacteria 11351
1017 Ga0495676_0060457 3300047321 Bacteria 2969
1018 Ga0495680_0001164 3300047322 Bacteria 28965
1019 Ga0495683_0137317 3300047323 Bacteria 1148
1020 Ga0495683_0166240 3300047323 Bacteria 1017
1021 Ga0495683_0166478 3300047323 Bacteria 1016
1022 Ga0495675_0004534 3300047444 Bacteria 8423
1023 Ga0495677_0017888 3300047445 Bacteria 2569
1024 Ga0495677_0158040 3300047445 Bacteria 874
1025 Ga0495677_0257091 3300047445 Bacteria 683
1026 Ga0495677_0438709 3300047445 Bacteria 517
1027 Ga0495679_160938 3300047446 Bacteria 600
1028 Ga0495685_036930 3300047447 Bacteria 1677
1029 Ga0495673_0006914 3300047469 Bacteria 6607
1030 Ga0495673_0066465 3300047469 Bacteria 1529
1031 Ga0495673_0184675 3300047469 Bacteria 788
1032 Ga0495673_0231489 3300047469 Bacteria 680
1033 Ga0495673_0275076 3300047469 Bacteria 609
1034 Ga0495673_0308127 3300047469 Bacteria 566
1035 Ga0495681_0055455 3300047470 Bacteria 1848
1036 Ga0495681_0200822 3300047470 Bacteria 809
1037 Ga0495681_0360372 3300047470 Bacteria 551
1038 Ga0495684_0043390 3300047471 Bacteria 3443
1039 Ga0495684_0263849 3300047471 Bacteria 1248
1040 Ga0495686_0013762 3300047472 Bacteria 5605
1041 Ga0495686_0078436 3300047472 Bacteria 2021
1042 Ga0495686_0242890 3300047472 Bacteria 1015
1043 Ga0495686_0316354 3300047472 Bacteria 857
1044 Ga0495686_0396861 3300047472 Bacteria 741
1045 Ga0495686_0504141 3300047472 Bacteria 637
1046 Ga0495686_0516035 3300047472 Bacteria 628
1047 Ga0495593_0000198 3300047673 Bacteria 31587
1048 Ga0495593_0213287 3300047673 Bacteria 969
1049 Ga0495593_0226993 3300047673 Bacteria 937
1050 Ga0495593_0629572 3300047673 Bacteria 538
1051 Ga0495602_0007817 3300048088 Bacteria 11179
1052 Ga0495602_0305780 3300048088 Bacteria 1162
1053 Ga0495602_1174300 3300048088 Bacteria 501
1054 Ga0495614_0012824 3300048089 Bacteria 3678
1055 Ga0495615_0078522 3300048090 Bacteria 901
1056 Ga0495615_0256624 3300048090 Bacteria 555
1057 Ga0495626_0108189 3300048091 Bacteria 1206
1058 Ga0496100_0008266 3300048903 Bacteria 5798
1059 Ga0496100_0011406 3300048903 Bacteria 5059
1060 Ga0496100_0307974 3300048903 Bacteria 1187
1061 Ga0496100_0432918 3300048903 Bacteria 1006
1062 Ga0496100_1533122 3300048903 Bacteria 526
1063 Ga0496101_0058043 3300048904 Bacteria 2801
1064 Ga0496101_0060305 3300048904 Bacteria 2752
1065 Ga0496101_0201442 3300048904 Bacteria 1539
1066 Ga0496101_0368079 3300048904 Bacteria 1130
1067 Ga0496101_0618585 3300048904 Bacteria 856
1068 Ga0496101_0811034 3300048904 Bacteria 738
1069 Ga0496102_0010634 3300048905 Bacteria 7927
1070 Ga0496102_0214683 3300048905 Bacteria 1813
1071 Ga0496102_0243148 3300048905 Bacteria 1697
1072 Ga0496102_0259254 3300048905 Bacteria 1639
1073 Ga0496102_1022682 3300048905 Bacteria 747
1074 Ga0496102_1959057 3300048905 Bacteria 502
1075 Ga0496103_0276532 3300048906 Bacteria 1080
1076 Ga0496103_0301911 3300048906 Bacteria 1030
1077 Ga0496103_0338283 3300048906 Bacteria 968
1078 Ga0496103_0404656 3300048906 Bacteria 877
1079 Ga0496103_0661048 3300048906 Bacteria 663
1080 Ga0496104_0018816 3300048907 Bacteria 6309
1081 Ga0496104_0033807 3300048907 Bacteria 4765
1082 Ga0496104_0188870 3300048907 Bacteria 1971
1083 Ga0496104_0958240 3300048907 Bacteria 760
1084 Ga0496105_0181358 3300048908 Bacteria 1724
1085 Ga0496105_0307805 3300048908 Bacteria 1272
1086 Ga0496105_0599646 3300048908 Bacteria 855
1087 Ga0496105_0637564 3300048908 Bacteria 823
1088 Ga0496105_0999045 3300048908 Bacteria 626
1089 Ga0496106_0003717 3300048909 Bacteria 11385
1090 Ga0496106_0013044 3300048909 Bacteria 6132
1091 Ga0496106_0101798 3300048909 Bacteria 2228
1092 Ga0496106_0286486 3300048909 Bacteria 1320
1093 Ga0496106_0389258 3300048909 Bacteria 1120
1094 Ga0496107_0009967 3300048910 Bacteria 6593
1095 Ga0496107_0010093 3300048910 Bacteria 6550
1096 Ga0496107_0131585 3300048910 Bacteria 1847
1097 Ga0496107_0296591 3300048910 Bacteria 1203
1098 Ga0496107_0406720 3300048910 Bacteria 1012
1099 Ga0496107_1313151 3300048910 Bacteria 517
1100 Ga0496108_0007465 3300048911 Bacteria 8863
1101 Ga0496108_0122614 3300048911 Bacteria 2230
1102 Ga0496108_0208670 3300048911 Bacteria 1695
1103 Ga0496108_0306232 3300048911 Bacteria 1384
1104 Ga0496108_0700872 3300048911 Bacteria 878
1105 Ga0496108_1307959 3300048911 Bacteria 609
1106 Ga0496109_0000609 3300048912 Bacteria 29900
1107 Ga0496109_0150173 3300048912 Bacteria 2181
1108 Ga0496109_0600938 3300048912 Bacteria 1036
1109 Ga0496110_0008924 3300048913 Bacteria 8082
1110 Ga0496110_0041617 3300048913 Bacteria 4010
1111 Ga0496110_0113009 3300048913 Bacteria 2442
1112 Ga0496110_0150169 3300048913 Bacteria 2109
1113 Ga0496110_0455806 3300048913 Bacteria 1165
1114 Ga0496110_0524587 3300048913 Bacteria 1077
1115 Ga0496111_0041340 3300048914 Bacteria 3308
1116 Ga0496111_0098512 3300048914 Bacteria 2147
1117 Ga0496111_0377147 3300048914 Bacteria 1049
1118 Ga0496111_0502582 3300048914 Bacteria 892
1119 Ga0496112_0002437 3300048915 Bacteria 14996
1120 Ga0496112_0143201 3300048915 Bacteria 2359
1121 Ga0496112_0319757 3300048915 Bacteria 1496
1122 Ga0496112_0584269 3300048915 Bacteria 1049
1123 Ga0496112_0585128 3300048915 Bacteria 1049
1124 Ga0496113_0023429 3300048916 Bacteria 4377
1125 Ga0496113_0914721 3300048916 Bacteria 693
1126 Ga0496114_0117270 3300048917 Bacteria 2287
1127 Ga0496114_0178181 3300048917 Bacteria 1855
1128 Ga0496114_0409840 3300048917 Bacteria 1200
1129 Ga0496114_0604832 3300048917 Bacteria 967
1130 Ga0496114_0764487 3300048917 Bacteria 844
1131 Ga0496114_0921501 3300048917 Bacteria 755
1132 Ga0496115_0017598 3300048918 Bacteria 5469
1133 Ga0496115_0020165 3300048918 Bacteria 5139
1134 Ga0496115_0025658 3300048918 Bacteria 4591
1135 Ga0496115_0119489 3300048918 Bacteria 2168
1136 Ga0496115_0170297 3300048918 Bacteria 1801
1137 Ga0496115_0723448 3300048918 Bacteria 781
1138 Ga0496115_1279621 3300048918 Bacteria 547
1139 Ga0496116_0000965 3300048919 Bacteria 35491
1140 Ga0496116_0047134 3300048919 Bacteria 2903
1141 Ga0496117_0034522 3300048920 Bacteria 3809
1142 Ga0496117_0137648 3300048920 Bacteria 1468
1143 Ga0496117_0173672 3300048920 Bacteria 1248
1144 Ga0496118_0019475 3300048921 Bacteria 6064
1145 Ga0496118_0039154 3300048921 Bacteria 3787
1146 Ga0496118_0271839 3300048921 Bacteria 949
1147 Ga0496118_0304640 3300048921 Bacteria 873
1148 Ga0496118_0329083 3300048921 Bacteria 825
1149 Ga0496118_0527570 3300048921 Bacteria 581
1150 Ga0496119_0024118 3300048922 Bacteria 4289
1151 Ga0496119_0137067 3300048922 Bacteria 1326
1152 Ga0496119_0191145 3300048922 Bacteria 1066
1153 Ga0496119_0337684 3300048922 Bacteria 733
1154 Ga0496119_0550366 3300048922 Bacteria 531
1155 Ga0496120_0136221 3300048923 Bacteria 1251
1156 Ga0496121_0002689 3300048924 Bacteria 26584
1157 Ga0496121_0011130 3300048924 Bacteria 10036
1158 Ga0496121_0027684 3300048924 Bacteria 5298
1159 Ga0496121_0097490 3300048924 Bacteria 2278
1160 Ga0496121_0248032 3300048924 Bacteria 1236
1161 Ga0496121_0253675 3300048924 Bacteria 1218
1162 Ga0496121_0257737 3300048924 Bacteria 1206
1163 Ga0496121_0317418 3300048924 Bacteria 1050
1164 Ga0496121_0355480 3300048924 Bacteria 974
1165 Ga0496121_0529001 3300048924 Bacteria 742
1166 Ga0496122_0024545 3300048925 Bacteria 5272
1167 Ga0496122_0238997 3300048925 Bacteria 1026
1168 Ga0496123_0065829 3300048926 Bacteria 2299
1169 Ga0496124_0067565 3300048927 Bacteria 2974
1170 Ga0496124_0348594 3300048927 Bacteria 1048
1171 Ga0496125_0001441 3300048928 Bacteria 34581
1172 Ga0496125_0001512 3300048928 Bacteria 33307
1173 Ga0496125_0001630 3300048928 Bacteria 31638
1174 Ga0496125_0056184 3300048928 Bacteria 3199
1175 Ga0496125_0231720 3300048928 Bacteria 1180
1176 Ga0496125_0332777 3300048928 Bacteria 915
1177 Ga0496126_0003472 3300048929 Bacteria 19892
1178 Ga0496126_0022661 3300048929 Bacteria 6104
1179 Ga0496126_0033555 3300048929 Bacteria 4827
1180 Ga0496126_0038950 3300048929 Bacteria 4417
1181 Ga0496126_0104438 3300048929 Bacteria 2475
1182 Ga0496126_0130051 3300048929 Bacteria 2176
1183 Ga0496126_0301495 3300048929 Bacteria 1322
1184 Ga0496126_0861504 3300048929 Bacteria 690
1185 Ga0495682_0038299 3300049460 Bacteria 1762
1186 Ga0495682_0045592 3300049460 Bacteria 1601
1187 Ga0495682_0075744 3300049460 Bacteria 1210
1188 Ga0501067_0013941 3300049583 Bacteria 4452
1189 Ga0501071_0969290 3300049587 Bacteria 657
1190 Ga0501075_0732020 3300049591 Bacteria 753
1191 nmdc:mga03683_109449_c1 3300050489 Bacteria 1220
1192 nmdc:mga03683_243412_c1 3300050489 Bacteria 834
1193 nmdc:mga03683_24826_c1 3300050489 Bacteria 2348
1194 nmdc:mga03683_284465_c1 3300050489 Bacteria 773
1195 nmdc:mga03683_565971_c1 3300050489 Bacteria 554
1196 nmdc:mga03683_647769_c1 3300050489 Bacteria 520
1197 nmdc:mga03683_99813_c1 3300050489 Bacteria 1275
1198 nmdc:mga03n38_39464_c1 3300050490 Bacteria 2048
1199 nmdc:mga03n38_579434_c1 3300050490 Bacteria 637
1200 nmdc:mga03n38_585439_c1 3300050490 Bacteria 634
1201 nmdc:mga03n38_867908_c1 3300050490 Bacteria 529
1202 nmdc:mga00v17_22955_c1 3300050491 Bacteria 3606
1203 nmdc:mga00v17_28827_c1 3300050491 Bacteria 3254
1204 nmdc:mga00v17_738101_c1 3300050491 Bacteria 630
1205 nmdc:mga0yw44_153761_c1 3300050492 Bacteria 1502
1206 nmdc:mga0yw44_206802_c1 3300050492 Bacteria 1298
1207 nmdc:mga0yw44_434883_c1 3300050492 Bacteria 520
1208 nmdc:mga0yw44_53733_c1 3300050492 Bacteria 2447
1209 nmdc:mga0yw44_63216_c1 3300050492 Bacteria 2276
1210 nmdc:mga0yw44_66164_c1 3300050492 Bacteria 2230
1211 nmdc:mga0yw44_7729_c1 3300050492 Bacteria 5309
1212 nmdc:mga0k408_21232_c2 3300050493 Bacteria 1620
1213 nmdc:mga0k408_280282_c1 3300050493 Bacteria 995
1214 nmdc:mga0k408_47855_c1 3300050493 Bacteria 2472
1215 nmdc:mga0k408_940307_c1 3300050493 Bacteria 501
1216 nmdc:mga06z11_190076_c1 3300050494 Bacteria 1188
1217 nmdc:mga06z11_248921_c1 3300050494 Bacteria 1046
1218 nmdc:mga06z11_627_c1 3300050494 Bacteria 12858
1219 nmdc:mga06z11_666253_c1 3300050494 Bacteria 634
1220 nmdc:mga04h51_17084_c1 3300050495 Bacteria 2116
1221 nmdc:mga04h51_176428_c1 3300050495 Bacteria 830
1222 nmdc:mga04h51_51394_c1 3300050495 Bacteria 1385
1223 nmdc:mga07m45_2231_c1 3300050496 Bacteria 9053
1224 nmdc:mga07m45_244503_c1 3300050496 Bacteria 1044
1225 nmdc:mga05p37_90704_c1 3300050507 Bacteria 3766
1226 nmdc:mga0qj67_974176_c1 3300050509 Bacteria 666
1227 nmdc:mga08y16_105097_c1 3300050511 Bacteria 2940
1228 nmdc:mga08y16_399061_c1 3300050511 Bacteria 1408
1229 nmdc:mga0n895_5885_c1 3300050512 Bacteria 10304
1230 nmdc:mga0rr50_187200_c1 3300050513 Bacteria 1695
1231 nmdc:mga0rr50_893185_c1 3300050513 Bacteria 758
1232 nmdc:mga08x19_769318_c1 3300050514 Unclassified 684
1233 nmdc:mga0sz30_170911_c1 3300050516 Bacteria 964
1234 nmdc:mga0sz30_227467_c1 3300050516 Bacteria 830
1235 nmdc:mga0sz30_26226_c1 3300050516 Bacteria 2388
1236 nmdc:mga0sz30_46987_c1 3300050516 Bacteria 1824
1237 Ga0495601_0169578 3300053077 Bacteria 1427
1238 Ga0495601_0175010 3300053077 Bacteria 1403
1239 Ga0495601_0334365 3300053077 Bacteria 986
1240 Ga0495601_0826512 3300053077 Bacteria 587
1241 Ga0500610_0088878 3300053079 Bacteria 1606
1242 Ga0500610_0451002 3300053079 Bacteria 504
1243 Ga0495655_0093586 3300053083 Bacteria 879
1244 Ga0495655_0130451 3300053083 Bacteria 774
1245 Ga0495595_0037722 3300053084 Bacteria 2199
1246 Ga0495595_0038930 3300053084 Bacteria 2168
1247 Ga0495595_0729867 3300053084 Bacteria 508
1248 Ga0495619_0024156 3300053085 Bacteria 3898
1249 Ga0495619_0174194 3300053085 Bacteria 1488
1250 Ga0500578_0076702 3300053086 Bacteria 2128
1251 Ga0500578_0443889 3300053086 Bacteria 740
1252 Ga0500643_000048 3300053087 Bacteria 147879
1253 Ga0500643_154038 3300053087 Bacteria 617
1254 Ga0500644_0004674 3300053088 Bacteria 3435
1255 Ga0500646_0022886 3300053090 Bacteria 1673
1256 Ga0500646_0215919 3300053090 Bacteria 663
1257 Ga0500647_0248655 3300053091 Bacteria 783
1258 Ga0500583_0010766 3300053092 Bacteria 3412
1259 Ga0500583_0060762 3300053092 Bacteria 1783
1260 Ga0500651_0002004 3300053093 Bacteria 10570
1261 Ga0500651_0015050 3300053093 Bacteria 4743
1262 Ga0500651_0070845 3300053093 Bacteria 2170
1263 Ga0500651_0202834 3300053093 Bacteria 1170
1264 Ga0500651_0501790 3300053093 Bacteria 669
1265 Ga0500566_0002605 3300053094 Bacteria 10733
1266 Ga0500566_0006460 3300053094 Bacteria 6955
1267 Ga0500566_0061049 3300053094 Bacteria 2134
1268 Ga0500566_0365180 3300053094 Bacteria 657
1269 Ga0500566_0380453 3300053094 Bacteria 638
1270 Ga0500641_0008827 3300053096 Bacteria 3608
1271 Ga0500641_0155793 3300053096 Bacteria 985
1272 Ga0500641_0325848 3300053096 Bacteria 624
1273 Ga0500641_0328934 3300053096 Bacteria 620
1274 Ga0500648_152082 3300053097 Bacteria 1229
1275 Ga0500554_061582 3300053102 Bacteria 1205
1276 Ga0500555_144278 3300053103 Bacteria 585
1277 Ga0500557_000088 3300053105 Bacteria 31829
1278 Ga0500562_020061 3300053108 Bacteria 1734
1279 Ga0500569_002366 3300053109 Bacteria 3699
1280 Ga0500569_085580 3300053109 Bacteria 1014
1281 Ga0500571_314731 3300053110 Bacteria 513
1282 Ga0500582_036894 3300053114 Bacteria 1536
1283 Ga0500592_001298 3300053116 Bacteria 4052
1284 Ga0500593_230583 3300053117 Bacteria 643
1285 Ga0500594_0002506 3300053118 Bacteria 3995
1286 Ga0500594_0012929 3300053118 Bacteria 1976
1287 Ga0500595_000333 3300053119 Bacteria 30925
1288 Ga0500595_000497 3300053119 Bacteria 23997
1289 Ga0500595_002282 3300053119 Bacteria 9644
1290 Ga0500595_004153 3300053119 Bacteria 6566
1291 Ga0500595_013163 3300053119 Bacteria 3173
1292 Ga0500595_020920 3300053119 Bacteria 2344
1293 Ga0500597_191896 3300053120 Bacteria 862
1294 Ga0500597_293894 3300053120 Bacteria 651
1295 Ga0500607_019806 3300053121 Bacteria 3804
1296 Ga0500607_066218 3300053121 Bacteria 1875
1297 Ga0500608_334710 3300053122 Bacteria 544
1298 Ga0500618_006607 3300053125 Bacteria 3387
1299 Ga0500642_0000015 3300053130 Bacteria 181424
1300 Ga0500642_0000143 3300053130 Bacteria 31709
1301 Ga0500642_0001744 3300053130 Bacteria 6273
1302 Ga0500642_0347039 3300053130 Bacteria 659
1303 Ga0500652_003561 3300053131 Bacteria 4724
1304 Ga0500655_029403 3300053133 Bacteria 1054
1305 Ga0500658_0031805 3300053134 Bacteria 2066
1306 Ga0500658_0169324 3300053134 Bacteria 991
1307 Ga0500559_0001714 3300053136 Bacteria 12043
1308 Ga0500559_0005658 3300053136 Bacteria 5719
1309 Ga0500564_121438 3300053138 Bacteria 1137
1310 Ga0500564_330418 3300053138 Bacteria 574
1311 Ga0500568_0010874 3300053139 Bacteria 4244
1312 Ga0500568_0070271 3300053139 Bacteria 1341
1313 Ga0500568_0285877 3300053139 Bacteria 599
1314 Ga0500573_0561340 3300053140 Bacteria 503
1315 Ga0500577_0000798 3300053142 Bacteria 8118
1316 Ga0500577_0245612 3300053142 Bacteria 777
1317 Ga0500579_276854 3300053143 Bacteria 517
1318 Ga0500586_000330 3300053145 Bacteria 9419
1319 Ga0500588_0174675 3300053146 Bacteria 787
1320 Ga0500589_042224 3300053147 Bacteria 2126
1321 Ga0500589_099011 3300053147 Bacteria 1269
1322 Ga0500590_080953 3300053148 Bacteria 1595
1323 Ga0500590_162550 3300053148 Bacteria 992
1324 Ga0500603_009249 3300053150 Bacteria 2201
1325 Ga0500604_0101708 3300053151 Bacteria 948
1326 Ga0500604_0115254 3300053151 Bacteria 895
1327 Ga0500604_0197041 3300053151 Bacteria 692
1328 Ga0500619_006592 3300053154 Bacteria 2685
1329 Ga0500619_307813 3300053154 Bacteria 510
1330 Ga0500620_262817 3300053155 Bacteria 571
1331 Ga0500622_0083261 3300053156 Bacteria 1598
1332 Ga0500627_0030354 3300053158 Bacteria 2262
1333 Ga0500627_0034673 3300053158 Bacteria 2141
1334 Ga0500627_0043782 3300053158 Bacteria 1931
1335 Ga0500633_0036925 3300053160 Bacteria 1618
1336 Ga0500634_0128681 3300053161 Bacteria 1219
1337 Ga0500634_0204866 3300053161 Bacteria 862
1338 Ga0500634_0348609 3300053161 Bacteria 566
1339 Ga0500638_016198 3300053162 Bacteria 3434
1340 Ga0500638_041168 3300053162 Bacteria 2244
1341 Ga0500638_127956 3300053162 Bacteria 1155
1342 Ga0500638_200225 3300053162 Bacteria 845
1343 Ga0500636_0000148 3300053177 Bacteria 36338
1344 Ga0500636_0015308 3300053177 Bacteria 4519
1345 Ga0500636_0044508 3300053177 Bacteria 2618
1346 Ga0500636_0053183 3300053177 Bacteria 2377
1347 Ga0500636_0227488 3300053177 Bacteria 967
1348 Ga0500637_0000060 3300053178 Bacteria 38881
1349 Ga0500649_164480 3300053722 Bacteria 775
1350 Ga0500611_212108 3300053727 Bacteria 551
1351 Ga0500625_025808 3300053729 Bacteria 2781
1352 Ga0500645_006475 3300053730 Bacteria 4171
1353 Ga0500645_020541 3300053730 Bacteria 2047
1354 Ga0500645_039938 3300053730 Bacteria 1389
1355 Ga0500645_089926 3300053730 Bacteria 871
1356 Ga0500656_005792 3300053732 Bacteria 1233
1357 Ga0500661_001013 3300055283 Bacteria 5278
1358 Ga0500661_007645 3300055283 Bacteria 1995
1359 Ga0466962_0032344 3300061719 Bacteria 2504
1360 Ga0466962_0445135 3300061719 Bacteria 652
1361 2723842243 2721755755 Bacteria 8322773
1362 2793077986
1363 2874610167 2874604998 Bacteria 7834745
1364 2876815724 2876808645 Bacteria 8824342
1365 2879117043 2879110137 Bacteria 8907982
1366 2922366757 2922361189 Bacteria 7436256
1367 2922389340 2922386360 Bacteria 7017218
1368 8006927334 8006926726 Bacteria 6749210
1369 8006966355 8006964411 Bacteria 8966052
1370 8006993181 8006984368 Bacteria 9651211
1371 Ga0207697_10173236
1372 JGI24740J21852_10002607
1373 JGI24737J22298_10001898
1374 JGI25153J46596_10009239
1375 JGI25153J46596_10049944
1376 JGI25404J52841_10027072
1377 Ga0055526_1025121
1378 Ga0055531_10009160
1379 JGI25405J52794_10157879
1380 Ga0065707_10558919
1381 Ga0070658_10100992
1382 Ga0070676_10238053
1383 Ga0070676_10452910
1384 Ga0070683_100011764
1385 Ga0070683_100042556
1386 Ga0070683_100293769
1387 Ga0070683_100546919
1388 Ga0070690_100085765
1389 Ga0070670_100196564
1390 Ga0068869_100131879
1391 Ga0070666_10473873
1392 Ga0070666_11236078
1393 Ga0070680_100017794
1394 Ga0070680_100086383
1395 Ga0070680_100442713
1396 Ga0070680_101376302
1397 Ga0070682_100023695
1398 Ga0070682_100286173
1399 Ga0070682_100381939
1400 Ga0070682_100592564
1401 Ga0068868_100095954
1402 Ga0068868_100213716
1403 Ga0068868_100786078
1404 Ga0068868_101023399
1405 Ga0070660_100003692
1406 Ga0070660_100284016
1407 Ga0070660_100402327
1408 Ga0070660_100896244
1409 Ga0070660_101032243
1410 Ga0070691_10025378
1411 Ga0070691_10135098
1412 Ga0070661_100073128
1413 Ga0070661_100214975
1414 Ga0070692_10896759
1415 Ga0070668_100041713
1416 Ga0070668_100395873
1417 Ga0070668_100445383
1418 Ga0070668_100550143
1419 Ga0070668_100589350
1420 Ga0070668_101053579
1421 Ga0070669_101218043
1422 Ga0070669_101237207
1423 Ga0070669_101569545
1424 Ga0070675_100848577
1425 Ga0070675_100966353
1426 Ga0070671_100140650
1427 Ga0070671_100335302
1428 Ga0070671_100544137
1429 Ga0070674_100309728
1430 Ga0070674_100831361
1431 Ga0070674_101054772
1432 Ga0070673_100187022
1433 Ga0070673_100305549
1434 Ga0070673_100865785
1435 Ga0070673_100886820
1436 Ga0070673_101339807
1437 Ga0070688_101021535
1438 Ga0070659_100114311
1439 Ga0070659_100408717
1440 Ga0070659_102109478
1441 Ga0070667_100387923
1442 Ga0070667_100832480
1443 Ga0070667_101235666
1444 Ga0070667_101456985
1445 Ga0070703_10057966
1446 Ga0070709_10003406
1447 Ga0070714_100004471
1448 Ga0070714_100010483
1449 Ga0070713_100010463
1450 Ga0070713_100024195
1451 Ga0070713_100054553
1452 Ga0070713_100181775
1453 Ga0070713_100743935
1454 Ga0070713_101238075
1455 Ga0070710_10370455
1456 Ga0070701_10069119
1457 Ga0070711_100002277
1458 Ga0070700_100179938
1459 Ga0070700_100321171
1460 Ga0070700_101371046
1461 Ga0070663_100004275
1462 Ga0070663_100096128
1463 Ga0070663_100152961
1464 Ga0070663_100174511
1465 Ga0070663_100906726
1466 Ga0070678_100018412
1467 Ga0070678_100051193
1468 Ga0070678_100069727
1469 Ga0070678_100147771
1470 Ga0070662_100103279
1471 Ga0070662_100348139
1472 Ga0070662_100634142
1473 Ga0070681_10006411
1474 Ga0070681_10007888
1475 Ga0070681_10049606
1476 Ga0070681_10087304
1477 Ga0070681_10224288
1478 Ga0070681_10641873
1479 Ga0070681_11718644
1480 Ga0068867_100233957
1481 Ga0068867_100379654
1482 Ga0068867_100804010
1483 Ga0070706_100281577
1484 Ga0070706_100891922
1485 Ga0070698_100231594
1486 Ga0070679_100039460
1487 Ga0070679_100195311
1488 Ga0070679_100285758
1489 Ga0070679_101179880
1490 Ga0070684_100001671
1491 Ga0070684_100003951
1492 Ga0070684_101263467
1493 Ga0070697_100040193
1494 Ga0068853_100009612
1495 Ga0068853_100025909
1496 Ga0068853_100124111
1497 Ga0068853_100139885
1498 Ga0068853_100440700
1499 Ga0068853_100523859
1500 Ga0068853_100688251
1501 Ga0070672_100074181
1502 Ga0070672_100148648
1503 Ga0070686_100578983
1504 Ga0070695_101371784
1505 Ga0070696_100794389
1506 Ga0070693_100147363
1507 Ga0070665_100006775
1508 Ga0070665_100012547
1509 Ga0070665_100156769
1510 Ga0070665_100167886
1511 Ga0070665_100252716
1512 Ga0070665_100538598
1513 Ga0070665_100653078
1514 Ga0070665_101202722
1515 Ga0070704_100466046
1516 Ga0070704_101826829
1517 Ga0068855_100027307
1518 Ga0068855_100067619
1519 Ga0068855_100076573
1520 Ga0068855_100090289
1521 Ga0068855_100177986
1522 Ga0068855_100186937
1523 Ga0068855_100212522
1524 Ga0070664_100049486
1525 Ga0070664_100159004
1526 Ga0070664_101585966
1527 Ga0068857_100007471
1528 Ga0068857_100013087
1529 Ga0068857_100038262
1530 Ga0068857_100244908
1531 Ga0068857_100435988
1532 Ga0068854_100024624
1533 Ga0068854_100601709
1534 Ga0068854_100921927
1535 Ga0068856_100566037
1536 Ga0068856_100913878
1537 Ga0068856_101603708
1538 Ga0068856_101692440
1539 Ga0070702_100056835
1540 Ga0068852_100023307
1541 Ga0068852_100067778
1542 Ga0068852_100088449
1543 Ga0068852_100294178
1544 Ga0068852_102375087
1545 Ga0068859_100036471
1546 Ga0068859_100128727
1547 Ga0068864_100186634
1548 Ga0068864_100795912
1549 Ga0068866_10030173
1550 Ga0068866_10291203
1551 Ga0068861_100093110
1552 Ga0068861_100310549
1553 Ga0068861_100319113
1554 Ga0068861_101215064
1555 Ga0068851_10009555
1556 Ga0068851_10477632
1557 Ga0068870_10035691
1558 Ga0068870_10508534
1559 Ga0068863_101521688
1560 Ga0068863_101770099
1561 Ga0068858_100066851
1562 Ga0068858_100364369
1563 Ga0068860_100071594
1564 Ga0068860_100226177
1565 Ga0068860_100280008
1566 Ga0068860_100370438
1567 Ga0068862_100084042
1568 Ga0068862_100105209
1569 Ga0068862_100223020
1570 Ga0068862_100575299
1571 Ga0068862_100841792
1572 Ga0068862_101133275
1573 Ga0081455_10005341
1574 Ga0081455_10006340
1575 Ga0081455_10059374
1576 Ga0081538_10048792
1577 Ga0081540_1012552
1578 Ga0081540_1028527
1579 Ga0081540_1040553
1580 Ga0081539_10002599
1581 Ga0070717_10001116
1582 Ga0070717_10112278
1583 Ga0070717_10234107
1584 Ga0075365_10005412
1585 Ga0075365_10007226
1586 Ga0075365_10010923
1587 Ga0075365_10053667
1588 Ga0075365_10104277
1589 Ga0075365_10217461
1590 Ga0075368_10024079
1591 Ga0075368_10050344
1592 Ga0075363_100053455
1593 Ga0075363_100095281
1594 Ga0075363_100214719
1595 Ga0075364_10056964
1596 Ga0075364_10103254
1597 Ga0075364_10209244
1598 Ga0075364_10714455
1599 Ga0075364_10726323
1600 Ga0075432_10013645
1601 Ga0070716_100254125
1602 Ga0070712_100219332
1603 Ga0070712_101382812
1604 Ga0075362_10015472
1605 Ga0075362_10065296
1606 Ga0075362_10291249
1607 Ga0075362_10366428
1608 Ga0075362_10469750
1609 Ga0075367_10039353
1610 Ga0075367_10089603
1611 Ga0075367_10120989
1612 Ga0075367_10135636
1613 Ga0075367_10144501
1614 Ga0075367_10316984
1615 Ga0075367_10702205
1616 Ga0075367_10758596
1617 Ga0075369_10009026
1618 Ga0075369_10020531
1619 Ga0075369_10038747
1620 Ga0075369_10228126
1621 Ga0075366_10131148
1622 Ga0075366_10316323
1623 Ga0075366_10667824
1624 Ga0097621_100061585
1625 Ga0097621_100384130
1626 Ga0097621_100508629
1627 Ga0097621_100912547
1628 Ga0097621_101004074
1629 Ga0075370_10013335
1630 Ga0075370_10337151
1631 Ga0068871_100553775
1632 Ga0075428_100226864
1633 Ga0075434_100009502
1634 Ga0068865_100126938
1635 Ga0068865_100156609
1636 Ga0068865_100177836
1637 Ga0075436_100568533
1638 Ga0097620_100036468
1639 Ga0097620_100128729
1640 Ga0099823_1036587
1641 Ga0075435_100200434
1642 Ga0099794_10002476
1643 Ga0099794_10085426
1644 Ga0099794_10098702
1645 Ga0099795_10001129
1646 Ga0099795_10013742
1647 Ga0099795_10019144
1648 Ga0099795_10128202
1649 Ga0099795_10228721
1650 Ga0105251_10433864
1651 Ga0105250_10026826
1652 Ga0105240_10001631
1653 Ga0105240_10002788
1654 Ga0105240_10008633
1655 Ga0105240_10019828
1656 Ga0105240_10033307
1657 Ga0105240_10071475
1658 Ga0105240_10134875
1659 Ga0105240_10168470
1660 Ga0105240_10466580
1661 Ga0105240_11323547
1662 Ga0105240_12010928
1663 Ga0111539_10014399
1664 Ga0111539_11170263
1665 Ga0105245_10077857
1666 Ga0105245_10730984
1667 Ga0105245_12081666
1668 Ga0105247_10126721
1669 Ga0105247_10129484
1670 Ga0105247_10358656
1671 Ga0105247_10574376
1672 Ga0114129_10168882
1673 Ga0105243_10101927
1674 Ga0105243_10447974
1675 Ga0105243_10729377
1676 Ga0105243_10943835
1677 Ga0105241_10016343
1678 Ga0105241_10496041
1679 Ga0105241_10865338
1680 Ga0105241_11440924
1681 Ga0105241_12111740
1682 Ga0105242_10181907
1683 Ga0105242_11039166
1684 Ga0105242_11688964
1685 Ga0105248_10042051
1686 Ga0105248_10361346
1687 Ga0105237_10021125
1688 Ga0105237_10027168
1689 Ga0105237_10030221
1690 Ga0105237_10054084
1691 Ga0105237_10179886
1692 Ga0105237_10608729
1693 Ga0105237_10733765
1694 Ga0105237_11433480
1695 Ga0105238_10002394
1696 Ga0105238_10004666
1697 Ga0105238_10006268
1698 Ga0105238_10007999
1699 Ga0105238_10332213
1700 Ga0105238_11218272
1701 Ga0105238_11556123
1702 Ga0105249_11475125
1703 Ga0099796_10039140
1704 Ga0099796_10094634
1705 Ga0099796_10544448
1706 Ga0105239_10016677
1707 Ga0105239_10017503
1708 Ga0105239_10070257
1709 Ga0105239_10070346
1710 Ga0105239_10347613
1711 Ga0105239_10547906
1712 Ga0105239_10683011
1713 Ga0105239_11317365
1714 Ga0105239_11510866
1715 Ga0105239_11758788
1716 Ga0105239_11764825
1717 Ga0105239_12878546
1718 Ga0105246_10023159
1719 Ga0105246_10026492
1720 Ga0105246_10096483
1721 Ga0105246_11132365
1722 Ga0157344_1013290
1723 Ga0157318_1014053
1724 Ga0157316_1036984
1725 Ga0157371_10115181
1726 Ga0157371_10716645
1727 Ga0157371_10830230
1728 Ga0157370_10013445
1729 Ga0157370_10531279
1730 Ga0157370_10901388
1731 Ga0157369_10018692
1732 Ga0157369_10021614
1733 Ga0157369_10036307
1734 Ga0157374_10027912
1735 Ga0157374_10168655
1736 Ga0157374_11414775
1737 Ga0157378_10066352
1738 Ga0157378_10073227
1739 Ga0157378_10227175
1740 Ga0157378_10626899
1741 Ga0157378_11357676
1742 Ga0163162_10015498
1743 Ga0163162_10057235
1744 Ga0163162_10192145
1745 Ga0163162_11394313
1746 Ga0163162_11568492
1747 Ga0157372_10067956
1748 Ga0157372_10079148
1749 Ga0157372_10574589
1750 Ga0157372_10766687
1751 Ga0157372_12499678
1752 Ga0157375_10044510
1753 Ga0157375_10293845
1754 Ga0157375_13078166
1755 Ga0157375_13182192
1756 Ga0163163_10074865
1757 Ga0163163_10084542
1758 Ga0163163_10714343
1759 Ga0163163_13261324
1760 Ga0157380_10223349
1761 Ga0157380_10612798
1762 Ga0157380_11580869
1763 Ga0157380_12176979
1764 Ga0157377_10081359
1765 Ga0157377_10123387
1766 Ga0157377_10410368
1767 Ga0157379_10033261
1768 Ga0157379_10112561
1769 Ga0157379_10159391
1770 Ga0157379_10170930
1771 Ga0157379_10262352
1772 Ga0157379_10565469
1773 Ga0157379_10840125
1774 Ga0157379_10852726
1775 Ga0157376_10226942
1776 Ga0157376_10572644
1777 Ga0157376_10660465
1778 Ga0163161_10913218
1779 Ga0209564_1003160
1780 Ga0209564_1006871
1781 Ga0209564_1017804
1782 Ga0209758_1000015
1783 Ga0209758_1004632
1784 Ga0209758_1006280
1785 Ga0209758_1009996
1786 Ga0209758_1010086
1787 Ga0209758_1022902
1788 Ga0209758_1120724
1789 Ga0209256_1002592
1790 Ga0209256_1068457
1791 Ga0207426_1000217
1792 Ga0207426_1016643
1793 Ga0207426_1108679
1794 Ga0209051_1106550
1795 Ga0209257_1002989
1796 Ga0209257_1026125
1797 Ga0207697_10541765
1798 Ga0207656_10041260
1799 Ga0207656_10320129
1800 Ga0207653_10037971
1801 Ga0207682_10081724
1802 Ga0207642_10213379
1803 Ga0207710_10038269
1804 Ga0207710_10171436
1805 Ga0207710_10205014
1806 Ga0207688_10010434
1807 Ga0207680_10573502
1808 Ga0207680_11055744
1809 Ga0207647_10000121
1810 Ga0207685_10155918
1811 Ga0207685_10498364
1812 Ga0207699_10174206
1813 Ga0207645_10079836
1814 Ga0207645_10138925
1815 Ga0207645_10415417
1816 Ga0207643_10044900
1817 Ga0207643_10720775
1818 Ga0207705_10081118
1819 Ga0207684_10331385
1820 Ga0207684_10573677
1821 Ga0207654_10000156
1822 Ga0207654_10080959
1823 Ga0207654_10115182
1824 Ga0207707_10000143
1825 Ga0207707_10008151
1826 Ga0207707_10014431
1827 Ga0207707_10105877
1828 Ga0207707_11045354
1829 Ga0207695_10001028
1830 Ga0207695_10019143
1831 Ga0207695_10073340
1832 Ga0207695_10103371
1833 Ga0207695_10115462
1834 Ga0207695_10135842
1835 Ga0207695_10255073
1836 Ga0207671_10030586
1837 Ga0207671_10068414
1838 Ga0207671_10110923
1839 Ga0207671_10761091
1840 Ga0207671_11351004
1841 Ga0207693_10397185
1842 Ga0207663_10019239
1843 Ga0207663_11369437
1844 Ga0207660_10007904
1845 Ga0207660_10075631
1846 Ga0207662_10040742
1847 Ga0207657_10005482
1848 Ga0207657_10081530
1849 Ga0207657_10215621
1850 Ga0207649_10179476
1851 Ga0207652_10024703
1852 Ga0207652_10065253
1853 Ga0207652_10074664
1854 Ga0207652_10836310
1855 Ga0207681_10806366
1856 Ga0207681_10870153
1857 Ga0207681_11078012
1858 Ga0207694_10000186
1859 Ga0207694_10027217
1860 Ga0207694_10029840
1861 Ga0207694_10127692
1862 Ga0207694_10158093
1863 Ga0207694_10212070
1864 Ga0207650_10392024
1865 Ga0207650_10748330
1866 Ga0207687_10165880
1867 Ga0207687_10329460
1868 Ga0207687_11316005
1869 Ga0207687_11419795
1870 Ga0207700_10024697
1871 Ga0207700_10034094
1872 Ga0207700_10415105
1873 Ga0207664_10016865
1874 Ga0207664_10065077
1875 Ga0207644_10473343
1876 Ga0207690_10186554
1877 Ga0207690_10424932
1878 Ga0207690_10986678
1879 Ga0207706_10118230
1880 Ga0207706_10121877
1881 Ga0207706_10128089
1882 Ga0207706_10379788
1883 Ga0207686_10363744
1884 Ga0207709_10010853
1885 Ga0207709_10555064
1886 Ga0207709_10598354
1887 Ga0207709_10724192
1888 Ga0207670_10273332
1889 Ga0207669_10130937
1890 Ga0207669_10862701
1891 Ga0207669_11597502
1892 Ga0207704_10145727
1893 Ga0207704_10405640
1894 Ga0207704_11088168
1895 Ga0207704_11185159
1896 Ga0207691_10062150
1897 Ga0207691_10173916
1898 Ga0207691_10518455
1899 Ga0207711_10030129
1900 Ga0207711_10257545
1901 Ga0207711_10261215
1902 Ga0207689_10107240
1903 Ga0207689_10381278
1904 Ga0207689_10659464
1905 Ga0207689_10778994
1906 Ga0207689_11215612
1907 Ga0207661_10009377
1908 Ga0207661_10028137
1909 Ga0207661_10295156
1910 Ga0207661_10395929
1911 Ga0207679_10606129
1912 Ga0207679_11191872
1913 Ga0207667_10020014
1914 Ga0207667_10020505
1915 Ga0207667_10023400
1916 Ga0207667_10025056
1917 Ga0207667_10057622
1918 Ga0207667_10998509
1919 Ga0207651_10358880
1920 Ga0207651_11448683
1921 Ga0207712_10470997
1922 Ga0207712_10704372
1923 Ga0207668_10163868
1924 Ga0207668_10389326
1925 Ga0207668_10783421
1926 Ga0207640_10301766
1927 Ga0207640_10540751
1928 Ga0207658_10650420
1929 Ga0207658_10900729
1930 Ga0207658_11045407
1931 Ga0207677_10275907
1932 Ga0207677_10440319
1933 Ga0207677_10494314
1934 Ga0207703_10121025
1935 Ga0207703_10205049
1936 Ga0207703_10387995
1937 Ga0207703_10758340
1938 Ga0207703_11040507
1939 Ga0207639_10015471
1940 Ga0207639_10043716
1941 Ga0207639_10066380
1942 Ga0207639_10077369
1943 Ga0207639_10098345
1944 Ga0207639_10279479
1945 Ga0207639_10491193
1946 Ga0207678_10007639
1947 Ga0207678_10025016
1948 Ga0207678_10055862
1949 Ga0207678_10087755
1950 Ga0207678_10236829
1951 Ga0207678_10828132
1952 Ga0207678_11099351
1953 Ga0207678_11103988
1954 Ga0207708_10306848
1955 Ga0207708_10307142
1956 Ga0207702_10000064
1957 Ga0207702_10039481
1958 Ga0207702_10528544
1959 Ga0207702_10853984
1960 Ga0207702_11159115
1961 Ga0207702_11382797
1962 Ga0207641_11171949
1963 Ga0207648_10220133
1964 Ga0207648_10305019
1965 Ga0207676_10032201
1966 Ga0207674_10000946
1967 Ga0207674_10001023
1968 Ga0207674_10018135
1969 Ga0207674_10242682
1970 Ga0207674_10361018
1971 Ga0207674_10389418
1972 Ga0207674_11407648
1973 Ga0207675_100022393
1974 Ga0207675_100148351
1975 Ga0207675_100335926
1976 Ga0207675_100370820
1977 Ga0207675_100549391
1978 Ga0207675_100560234
1979 Ga0207683_10007406
1980 Ga0207683_10011518
1981 Ga0207683_10051080
1982 Ga0207683_10146225
1983 Ga0207683_10192417
1984 Ga0207683_10541005
1985 Ga0207683_10674818
1986 Ga0207698_10012190
1987 Ga0207698_10033871
1988 Ga0207698_10058830
1989 Ga0207698_10063110
1990 Ga0207698_10871055
1991 Ga0207698_11677531
1992 Ga0209389_1000012
1993 Ga0209489_100019
1994 Ga0209700_100018
1995 Ga0209179_1049452
1996 Ga0209588_1044647
1997 Ga0209813_10049621
1998 Ga0209813_10151785
1999 Ga0207428_10037444
2000 Ga0207428_10921502
2001 Ga0268266_10003191
2002 Ga0268266_10015771
2003 Ga0268266_10041730
2004 Ga0268266_10092497
2005 Ga0268266_10123778
2006 Ga0268266_10370392
2007 Ga0268266_11128779
2008 Ga0268265_10067630
2009 Ga0268265_10187365
2010 Ga0268265_10941183
2011 Ga0268265_11170689
2012 Ga0268264_10050385
2013 Ga0268264_10373920
2014 Ga0268264_10669848
2015 Ga0307517_10000476
2016 Ga0307517_10266205
2017 Ga0307517_10442286
2018 Ga0307515_10183742
2019 Ga0307515_10228322
2020 Ga0307515_10362971
2021 Ga0265338_10754481
2022 Ga0307512_10425969
2023 Ga0265762_1099244
2024 Ga0265330_10010731
2025 Ga0265330_10021675
2026 Ga0265330_10030642
2027 Ga0265328_10106210
2028 Ga0265328_10211959
2029 Ga0265328_10298473
2030 Ga0265325_10024575
2031 Ga0265340_10016299
2032 Ga0265340_10120117
2033 Ga0265340_10234888
2034 Ga0265339_10132922
2035 Ga0265339_10323372
2036 Ga0265331_10129396
2037 Ga0265316_10045394
2038 Ga0265316_10411955
2039 Ga0307513_10182196
2040 Ga0307513_10196500
2041 Ga0307513_10519532
2042 Ga0307509_10359830
2043 Ga0307509_10440274
2044 Ga0307408_100686835
2045 Ga0307408_100808437
2046 Ga0307508_10062120
2047 Ga0307508_10121402
2048 Ga0307508_10151308
2049 Ga0265314_10054500
2050 Ga0265342_10202160
2051 Ga0265342_10259627
2052 Ga0307516_10032872
2053 Ga0307516_10110382
2054 Ga0307516_10417850
2055 Ga0307516_11022517
2056 Ga0307405_10353501
2057 Ga0307405_10582605
2058 Ga0307405_11335153
2059 Ga0307413_10016476
2060 Ga0307406_10094965
2061 Ga0307406_10436721
2062 Ga0307406_10791064
2063 Ga0307412_10167113
2064 Ga0307412_10727941
2065 Ga0307412_11424133
2066 Ga0307409_100294876
2067 Ga0307409_100961845
2068 Ga0307416_100143847
2069 Ga0307416_102451615
2070 Ga0307416_103787280
2071 Ga0307414_12165731
2072 Ga0307411_10929053
2073 Ga0307411_11230677
2074 Ga0307411_11357309
2075 Ga0307411_11450151
2076 Ga0307415_100049710
2077 Ga0307415_100267581
2078 Ga0307415_101115163
2079 Ga0307510_10015750
2080 Ga0307510_10123576
2081 Ga0373959_0085786
2082 Ga0373928_0239134
2083 Ga0373929_0161657
2084 Ga0373923_0024804
2085 Ga0373936_0014097
2086 Ga0373936_0308333
2087 Ga0373953_0413420
2088 Ga0373954_0162963
2089 Ga0373956_0155943
2090 Ga0373960_0140404
2091 Ga0373943_0644322
2092 Ga0373946_0011656
2093 Ga0373955_0069830
2094 Ga0373955_0979538
2095 Ga0373961_0159112
2096 Ga0373931_0188163
2097 Ga0373931_0420866
2098 Ga0373935_0001812
2099 Ga0373927_0000137
2100 Ga0373927_0091424
2101 Ga0373927_0146354
2102 Ga0373933_0000108
2103 Ga0373933_0639436
2104 Ga0373947_0003829
2105 Ga0373947_0680834
2106 Ga0373937_0089555
2107 Ga0373937_0883068
2108 Ga0373937_1096704
2109 Ga0373925_0008084
2110 Ga0373925_0151201
2111 Ga0373925_0519741
2112 Ga0395899_0351295
2113 Ga0395900_0010102
2114 Ga0395898_0036867
2115 Ga0395898_0166395
2116 Ga0395898_0767607
2117 Ga0395905_0062121
2118 Ga0395905_0514328
2119 Ga0395905_0584010
2120 Ga0436364_1091707
2121 Ga0436364_1175882
2122 Ga0395901_0141469
2123 Ga0436365_0263128
2124 Ga0436365_0503144
2125 Ga0436365_0661367
2126 Ga0436365_1219104
2127 Ga0436365_1404308
2128 Ga0436361_1064220
2129 Ga0436363_0386314
2130 Ga0439465_0012701
2131 Ga0439465_0040339
2132 Ga0451787_365869
2133 Ga0451789_0396661
2134 Ga0451791_0032085
2135 Ga0451791_0876452
2136 Ga0451791_1651265
2137 Ga0451793_0433591
2138 Ga0451795_0426728
2139 Ga0451798_0375827
2140 Ga0451800_0008514
2141 Ga0451800_0883643
2142 Ga0451802_0590931
2143 Ga0451807_0508539
2144 Ga0451833_0686837
2145 Ga0451837_0379450
2146 Ga0451839_1532871
2147 Ga0451841_0698586
2148 Ga0451845_0402220
2149 Ga0451843_0508687
2150 Ga0451843_1443504
2151 Ga0439432_206656
2152 Ga0439463_120326
2153 Ga0466969_0057080
2154 Ga0466966_0001463
2155 Ga0466961_0000601
2156 Ga0466963_0098934
2157 Ga0466963_0376908
2158 Ga0466963_0523746
2159 Ga0466971_0023831
2160 Ga0466968_0156452
2161 Ga0466970_0121464
2162 Ga0466959_0020323
2163 Ga0466959_0122799
2164 Ga0466958_0068149
2165 Ga0466967_0118926
2166 Ga0466967_1835599
2167 Ga0466967_2346469
2168 Ga0495617_085265
2169 Ga0495617_096767
2170 Ga0495617_102924
2171 Ga0495592_0042253
2172 Ga0495592_0099161
2173 Ga0495603_0000029
2174 Ga0495603_0004729
2175 Ga0495603_0014019
2176 Ga0495603_0226579
2177 Ga0495603_0380401
2178 Ga0495590_0079468
2179 Ga0495590_0171735
2180 Ga0495590_0336208
2181 Ga0495629_0000029
2182 Ga0495629_0103196
2183 Ga0495638_0039729
2184 Ga0495638_0304432
2185 Ga0495641_0004254
2186 Ga0495651_0018866
2187 Ga0495651_0561326
2188 Ga0495653_0053410
2189 Ga0495653_0261307
2190 Ga0495650_0150432
2191 Ga0495580_0000321
2192 Ga0495580_0143203
2193 Ga0495582_0000024
2194 Ga0495582_0047239
2195 Ga0495582_0175141
2196 Ga0495582_0752118
2197 Ga0495605_0077229
2198 Ga0495605_0121756
2199 Ga0495605_0305044
2200 Ga0495639_0000006
2201 Ga0495639_0026865
2202 Ga0495639_0077820
2203 Ga0495662_0000068
2204 Ga0495664_0002214
2205 Ga0495664_0007034
2206 Ga0495664_0088422
2207 Ga0495664_0439276
2208 Ga0495584_0087591
2209 Ga0495584_0088953
2210 Ga0495584_0105262
2211 Ga0495584_0268437
2212 Ga0495585_0032631
2213 Ga0495585_0302416
2214 Ga0495585_0368772
2215 Ga0495585_0479109
2216 Ga0495594_0000170
2217 Ga0495594_0044046
2218 Ga0495594_0101779
2219 Ga0495596_0022507
2220 Ga0495596_0081177
2221 Ga0495596_0156540
2222 Ga0495607_0077506
2223 Ga0495607_0190722
2224 Ga0495607_0444124
2225 Ga0495583_0076812
2226 Ga0495583_0078672
2227 Ga0495583_0294955
2228 Ga0495583_0323665
2229 Ga0495606_0167138
2230 Ga0495606_0291845
2231 Ga0495608_0009012
2232 Ga0495610_0041986
2233 Ga0495616_0016693
2234 Ga0495616_0059685
2235 Ga0495616_0202204
2236 Ga0495618_0074655
2237 Ga0495628_0014226
2238 Ga0495628_0110070
2239 Ga0495628_0592241
2240 Ga0495628_0896722
2241 Ga0495630_0018888
2242 Ga0495630_0121912
2243 Ga0495631_0037304
2244 Ga0495631_0084995
2245 Ga0495631_0129524
2246 Ga0495631_0482174
2247 Ga0495632_0100744
2248 Ga0495632_0101919
2249 Ga0495632_0121414
2250 Ga0495632_0220394
2251 Ga0495632_0223282
2252 Ga0495637_0087746
2253 Ga0495643_0028111
2254 Ga0495644_0014483
2255 Ga0495644_0038719
2256 Ga0495644_0130675
2257 Ga0495644_0205417
2258 Ga0495644_0207300
2259 Ga0495644_0357583
2260 Ga0495648_0002829
2261 Ga0495648_0053168
2262 Ga0495648_0162762
2263 Ga0495648_0203480
2264 Ga0495663_0044876
2265 Ga0495663_0047293
2266 Ga0495663_0282599
2267 Ga0495663_0340047
2268 Ga0495666_0003580
2269 Ga0495666_0197727
2270 Ga0495666_0201346
2271 Ga0495652_0005882
2272 Ga0495652_0026908
2273 Ga0495652_0075663
2274 Ga0495652_0633398
2275 Ga0495654_0012651
2276 Ga0495665_0000158
2277 Ga0495665_0261792
2278 Ga0495640_0015043
2279 Ga0495640_0050077
2280 Ga0495587_0008157
2281 Ga0495587_0501719
2282 Ga0495598_0009804
2283 Ga0495598_0271994
2284 Ga0495598_0429742
2285 Ga0495609_0092162
2286 Ga0495609_0189116
2287 Ga0495609_0267383
2288 Ga0495621_0066195
2289 Ga0495621_0096300
2290 Ga0495621_0179078
2291 Ga0495597_0061578
2292 Ga0495597_0216030
2293 Ga0495645_0069536
2294 Ga0495622_0020064
2295 Ga0495622_0025852
2296 Ga0495622_0050649
2297 Ga0495633_0042911
2298 Ga0495633_0074140
2299 Ga0495633_0185950
2300 Ga0495667_0003075
2301 Ga0495667_0152817
2302 Ga0495656_0023160
2303 Ga0495656_0064017
2304 Ga0495656_0182476
2305 Ga0495656_0394344
2306 Ga0495668_0071825
2307 Ga0495668_0178765
2308 Ga0495668_0253358
2309 Ga0495668_0296394
2310 Ga0495634_0000354
2311 Ga0495634_0080981
2312 Ga0495611_0083924
2313 Ga0495611_0287871
2314 Ga0495611_0370073
2315 Ga0495611_0436429
2316 Ga0495625_0028158
2317 Ga0495625_0283130
2318 Ga0495625_0667081
2319 Ga0495635_0000179
2320 Ga0495635_0018638
2321 Ga0495635_0628540
2322 Ga0495659_0010833
2323 Ga0495659_0050594
2324 Ga0495661_0012280
2325 Ga0495661_0414396
2326 Ga0495661_0432746
2327 Ga0495588_0001137
2328 Ga0495588_0007919
2329 Ga0495588_0226428
2330 Ga0495588_0475777
2331 Ga0495657_0005133
2332 Ga0495657_0114242
2333 Ga0495657_0493092
2334 Ga0495599_0491312
2335 Ga0495623_0010483
2336 Ga0495623_0104152
2337 Ga0495646_0003762
2338 Ga0495646_0012426
2339 Ga0495647_0000068
2340 Ga0495647_0016668
2341 Ga0495658_0000428
2342 Ga0495658_0820438
2343 Ga0495669_0031545
2344 Ga0495669_0069036
2345 Ga0495669_0164215
2346 Ga0495669_0203999
2347 Ga0495669_0319307
2348 Ga0495613_0081938
2349 Ga0495613_0085821
2350 Ga0495624_0010213
2351 Ga0495624_0212538
2352 Ga0495670_0012601
2353 Ga0495670_0013643
2354 Ga0495670_0118671
2355 Ga0495670_0448278
2356 Ga0495670_0483425
2357 Ga0495671_0016996
2358 Ga0495671_0081145
2359 Ga0495671_0225249
2360 Ga0495649_0219568
2361 Ga0495589_0034599
2362 Ga0495589_0099590
2363 Ga0495589_0124773
2364 Ga0495600_0006367
2365 Ga0495600_0196740
2366 Ga0495600_0224586
2367 Ga0495600_0593136
2368 Ga0495660_0228689
2369 Ga0495581_0000004
2370 Ga0495581_0069806
2371 Ga0495581_0070868
2372 Ga0495581_0089589
2373 Ga0495604_0000678
2374 Ga0495604_0105632
2375 Ga0495604_0268544
2376 Ga0495604_0776898
2377 Ga0495636_0017078
2378 Ga0495636_0026314
2379 Ga0495636_0047744
2380 Ga0495674_0000415
2381 Ga0495674_0224876
2382 Ga0495674_1123313
2383 Ga0495672_0034348
2384 Ga0495672_0117952
2385 Ga0495672_0211851
2386 Ga0495676_0005774
2387 Ga0495676_0060457
2388 Ga0495680_0001164
2389 Ga0495683_0137317
2390 Ga0495683_0166240
2391 Ga0495683_0166478
2392 Ga0495675_0004534
2393 Ga0495677_0017888
2394 Ga0495677_0158040
2395 Ga0495677_0257091
2396 Ga0495677_0438709
2397 Ga0495679_160938
2398 Ga0495685_036930
2399 Ga0495673_0006914
2400 Ga0495673_0066465
2401 Ga0495673_0184675
2402 Ga0495673_0231489
2403 Ga0495673_0275076
2404 Ga0495673_0308127
2405 Ga0495681_0055455
2406 Ga0495681_0200822
2407 Ga0495681_0360372
2408 Ga0495684_0043390
2409 Ga0495684_0263849
2410 Ga0495686_0013762
2411 Ga0495686_0078436
2412 Ga0495686_0242890
2413 Ga0495686_0316354
2414 Ga0495686_0396861
2415 Ga0495686_0504141
2416 Ga0495686_0516035
2417 Ga0495593_0000198
2418 Ga0495593_0213287
2419 Ga0495593_0226993
2420 Ga0495593_0629572
2421 Ga0495602_0007817
2422 Ga0495602_0305780
2423 Ga0495602_1174300
2424 Ga0495614_0012824
2425 Ga0495615_0078522
2426 Ga0495615_0256624
2427 Ga0495626_0108189
2428 Ga0496100_0008266
2429 Ga0496100_0011406
2430 Ga0496100_0307974
2431 Ga0496100_0432918
2432 Ga0496100_1533122
2433 Ga0496101_0058043
2434 Ga0496101_0060305
2435 Ga0496101_0201442
2436 Ga0496101_0368079
2437 Ga0496101_0618585
2438 Ga0496101_0811034
2439 Ga0496102_0010634
2440 Ga0496102_0214683
2441 Ga0496102_0243148
2442 Ga0496102_0259254
2443 Ga0496102_1022682
2444 Ga0496102_1959057
2445 Ga0496103_0276532
2446 Ga0496103_0301911
2447 Ga0496103_0338283
2448 Ga0496103_0404656
2449 Ga0496103_0661048
2450 Ga0496104_0018816
2451 Ga0496104_0033807
2452 Ga0496104_0188870
2453 Ga0496104_0958240
2454 Ga0496105_0181358
2455 Ga0496105_0307805
2456 Ga0496105_0599646
2457 Ga0496105_0637564
2458 Ga0496105_0999045
2459 Ga0496106_0003717
2460 Ga0496106_0013044
2461 Ga0496106_0101798
2462 Ga0496106_0286486
2463 Ga0496106_0389258
2464 Ga0496107_0009967
2465 Ga0496107_0010093
2466 Ga0496107_0131585
2467 Ga0496107_0296591
2468 Ga0496107_0406720
2469 Ga0496107_1313151
2470 Ga0496108_0007465
2471 Ga0496108_0122614
2472 Ga0496108_0208670
2473 Ga0496108_0306232
2474 Ga0496108_0700872
2475 Ga0496108_1307959
2476 Ga0496109_0000609
2477 Ga0496109_0150173
2478 Ga0496109_0600938
2479 Ga0496110_0008924
2480 Ga0496110_0041617
2481 Ga0496110_0113009
2482 Ga0496110_0150169
2483 Ga0496110_0455806
2484 Ga0496110_0524587
2485 Ga0496111_0041340
2486 Ga0496111_0098512
2487 Ga0496111_0377147
2488 Ga0496111_0502582
2489 Ga0496112_0002437
2490 Ga0496112_0143201
2491 Ga0496112_0319757
2492 Ga0496112_0584269
2493 Ga0496112_0585128
2494 Ga0496113_0023429
2495 Ga0496113_0914721
2496 Ga0496114_0117270
2497 Ga0496114_0178181
2498 Ga0496114_0409840
2499 Ga0496114_0604832
2500 Ga0496114_0764487
2501 Ga0496114_0921501
2502 Ga0496115_0017598
2503 Ga0496115_0020165
2504 Ga0496115_0025658
2505 Ga0496115_0119489
2506 Ga0496115_0170297
2507 Ga0496115_0723448
2508 Ga0496115_1279621
2509 Ga0496116_0000965
2510 Ga0496116_0047134
2511 Ga0496117_0034522
2512 Ga0496117_0137648
2513 Ga0496117_0173672
2514 Ga0496118_0019475
2515 Ga0496118_0039154
2516 Ga0496118_0271839
2517 Ga0496118_0304640
2518 Ga0496118_0329083
2519 Ga0496118_0527570
2520 Ga0496119_0024118
2521 Ga0496119_0137067
2522 Ga0496119_0191145
2523 Ga0496119_0337684
2524 Ga0496119_0550366
2525 Ga0496120_0136221
2526 Ga0496121_0002689
2527 Ga0496121_0011130
2528 Ga0496121_0027684
2529 Ga0496121_0097490
2530 Ga0496121_0248032
2531 Ga0496121_0253675
2532 Ga0496121_0257737
2533 Ga0496121_0317418
2534 Ga0496121_0355480
2535 Ga0496121_0529001
2536 Ga0496122_0024545
2537 Ga0496122_0238997
2538 Ga0496123_0065829
2539 Ga0496124_0067565
2540 Ga0496124_0348594
2541 Ga0496125_0001441
2542 Ga0496125_0001512
2543 Ga0496125_0001630
2544 Ga0496125_0056184
2545 Ga0496125_0231720
2546 Ga0496125_0332777
2547 Ga0496126_0003472
2548 Ga0496126_0022661
2549 Ga0496126_0033555
2550 Ga0496126_0038950
2551 Ga0496126_0104438
2552 Ga0496126_0130051
2553 Ga0496126_0301495
2554 Ga0496126_0861504
2555 Ga0495682_0038299
2556 Ga0495682_0045592
2557 Ga0495682_0075744
2558 Ga0501067_0013941
2559 Ga0501071_0969290
2560 Ga0501075_0732020
2561 nmdc:mga03683_109449_c1
2562 nmdc:mga03683_243412_c1
2563 nmdc:mga03683_24826_c1
2564 nmdc:mga03683_284465_c1
2565 nmdc:mga03683_565971_c1
2566 nmdc:mga03683_647769_c1
2567 nmdc:mga03683_99813_c1
2568 nmdc:mga03n38_39464_c1
2569 nmdc:mga03n38_579434_c1
2570 nmdc:mga03n38_585439_c1
2571 nmdc:mga03n38_867908_c1
2572 nmdc:mga00v17_22955_c1
2573 nmdc:mga00v17_28827_c1
2574 nmdc:mga00v17_738101_c1
2575 nmdc:mga0yw44_153761_c1
2576 nmdc:mga0yw44_206802_c1
2577 nmdc:mga0yw44_434883_c1
2578 nmdc:mga0yw44_53733_c1
2579 nmdc:mga0yw44_63216_c1
2580 nmdc:mga0yw44_66164_c1
2581 nmdc:mga0yw44_7729_c1
2582 nmdc:mga0k408_21232_c2
2583 nmdc:mga0k408_280282_c1
2584 nmdc:mga0k408_47855_c1
2585 nmdc:mga0k408_940307_c1
2586 nmdc:mga06z11_190076_c1
2587 nmdc:mga06z11_248921_c1
2588 nmdc:mga06z11_627_c1
2589 nmdc:mga06z11_666253_c1
2590 nmdc:mga04h51_17084_c1
2591 nmdc:mga04h51_176428_c1
2592 nmdc:mga04h51_51394_c1
2593 nmdc:mga07m45_2231_c1
2594 nmdc:mga07m45_244503_c1
2595 nmdc:mga05p37_90704_c1
2596 nmdc:mga0qj67_974176_c1
2597 nmdc:mga08y16_105097_c1
2598 nmdc:mga08y16_399061_c1
2599 nmdc:mga0n895_5885_c1
2600 nmdc:mga0rr50_187200_c1
2601 nmdc:mga0rr50_893185_c1
2602 nmdc:mga08x19_769318_c1
2603 nmdc:mga0sz30_170911_c1
2604 nmdc:mga0sz30_227467_c1
2605 nmdc:mga0sz30_26226_c1
2606 nmdc:mga0sz30_46987_c1
2607 Ga0495601_0169578
2608 Ga0495601_0175010
2609 Ga0495601_0334365
2610 Ga0495601_0826512
2611 Ga0500610_0088878
2612 Ga0500610_0451002
2613 Ga0495655_0093586
2614 Ga0495655_0130451
2615 Ga0495595_0037722
2616 Ga0495595_0038930
2617 Ga0495595_0729867
2618 Ga0495619_0024156
2619 Ga0495619_0174194
2620 Ga0500578_0076702
2621 Ga0500578_0443889
2622 Ga0500643_000048
2623 Ga0500643_154038
2624 Ga0500644_0004674
2625 Ga0500646_0022886
2626 Ga0500646_0215919
2627 Ga0500647_0248655
2628 Ga0500583_0010766
2629 Ga0500583_0060762
2630 Ga0500651_0002004
2631 Ga0500651_0015050
2632 Ga0500651_0070845
2633 Ga0500651_0202834
2634 Ga0500651_0501790
2635 Ga0500566_0002605
2636 Ga0500566_0006460
2637 Ga0500566_0061049
2638 Ga0500566_0365180
2639 Ga0500566_0380453
2640 Ga0500641_0008827
2641 Ga0500641_0155793
2642 Ga0500641_0325848
2643 Ga0500641_0328934
2644 Ga0500648_152082
2645 Ga0500554_061582
2646 Ga0500555_144278
2647 Ga0500557_000088
2648 Ga0500562_020061
2649 Ga0500569_002366
2650 Ga0500569_085580
2651 Ga0500571_314731
2652 Ga0500582_036894
2653 Ga0500592_001298
2654 Ga0500593_230583
2655 Ga0500594_0002506
2656 Ga0500594_0012929
2657 Ga0500595_000333
2658 Ga0500595_000497
2659 Ga0500595_002282
2660 Ga0500595_004153
2661 Ga0500595_013163
2662 Ga0500595_020920
2663 Ga0500597_191896
2664 Ga0500597_293894
2665 Ga0500607_019806
2666 Ga0500607_066218
2667 Ga0500608_334710
2668 Ga0500618_006607
2669 Ga0500642_0000015
2670 Ga0500642_0000143
2671 Ga0500642_0001744
2672 Ga0500642_0347039
2673 Ga0500652_003561
2674 Ga0500655_029403
2675 Ga0500658_0031805
2676 Ga0500658_0169324
2677 Ga0500559_0001714
2678 Ga0500559_0005658
2679 Ga0500564_121438
2680 Ga0500564_330418
2681 Ga0500568_0010874
2682 Ga0500568_0070271
2683 Ga0500568_0285877
2684 Ga0500573_0561340
2685 Ga0500577_0000798
2686 Ga0500577_0245612
2687 Ga0500579_276854
2688 Ga0500586_000330
2689 Ga0500588_0174675
2690 Ga0500589_042224
2691 Ga0500589_099011
2692 Ga0500590_080953
2693 Ga0500590_162550
2694 Ga0500603_009249
2695 Ga0500604_0101708
2696 Ga0500604_0115254
2697 Ga0500604_0197041
2698 Ga0500619_006592
2699 Ga0500619_307813
2700 Ga0500620_262817
2701 Ga0500622_0083261
2702 Ga0500627_0030354
2703 Ga0500627_0034673
2704 Ga0500627_0043782
2705 Ga0500633_0036925
2706 Ga0500634_0128681
2707 Ga0500634_0204866
2708 Ga0500634_0348609
2709 Ga0500638_016198
2710 Ga0500638_041168
2711 Ga0500638_127956
2712 Ga0500638_200225
2713 Ga0500636_0000148
2714 Ga0500636_0015308
2715 Ga0500636_0044508
2716 Ga0500636_0053183
2717 Ga0500636_0227488
2718 Ga0500637_0000060
2719 Ga0500649_164480
2720 Ga0500611_212108
2721 Ga0500625_025808
2722 Ga0500645_006475
2723 Ga0500645_020541
2724 Ga0500645_039938
2725 Ga0500645_089926
2726 Ga0500656_005792
2727 Ga0500661_001013
2728 Ga0500661_007645
2729 Ga0466962_0032344
2730 Ga0466962_0445135
2731 2723842243
2732 2793077986
2733 2874610167
2734 2876815724
2735 2879117043
2736 2922366757
2737 2922389340
2738 8006927334
2739 8006966355
2740 8006993181

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gpv-assembly1.cif.gz_A-2 cytoplasmic domain structure of the mgte mg2+ channel from clostridiales bacterium 0.4106 3 75
8eox-assembly1.cif.gz_B precisely patterned nanofibers made from extendable protein multiplexes 0.405 4 75
2uy1-assembly1.cif.gz_A crystal structure of cstf-77 0.404 2 85
3ash-assembly2.cif.gz_B mama d159k mutant 1 0.396 17 87
8eox-assembly1.cif.gz_A precisely patterned nanofibers made from extendable protein multiplexes 0.3783 4 87
ID Description Score Start End Superfamily
2yvzB01 Mainly Alpha;Alpha Horseshoe;MgtE N-terminal fold;MgtE N-terminal domain-like 0.4978 3 75 1.25.60.10
af_A0A0R0IBP5_539_661_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.48 18 87 1.25.40.10
af_I1KI77_60_217_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.48 3 87 1.25.40.10
2zy9B01 Mainly Alpha;Alpha Horseshoe;MgtE N-terminal fold;MgtE N-terminal domain-like 0.4759 1 89 1.25.60.10
af_A0A1D6HSV6_399_529_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4657 8 87 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A345ZT00-F1-model_v4 Uncharacterized protein 0.9265 13 90
AF-A0A1M7AQL1-F1-model_v4 Uncharacterized protein 0.9085 10 87
AF-A0A7W6H8H5-F1-model_v4 Uncharacterized protein 0.9051 13 88
AF-A0A2M8VF14-F1-model_v4 deleted 0.8908 13 90
AF-A0A3B0TMT5-F1-model_v4 Uncharacterized protein 0.8805 10 88

Map